WO2010071772A2 - Synthesis of 3b-amino-5-cholestene and related 3b-halides involving i-steroid and retro-i-steroid rearrangements - Google Patents
Synthesis of 3b-amino-5-cholestene and related 3b-halides involving i-steroid and retro-i-steroid rearrangements Download PDFInfo
- Publication number
- WO2010071772A2 WO2010071772A2 PCT/US2009/067897 US2009067897W WO2010071772A2 WO 2010071772 A2 WO2010071772 A2 WO 2010071772A2 US 2009067897 W US2009067897 W US 2009067897W WO 2010071772 A2 WO2010071772 A2 WO 2010071772A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- receptor
- synthetic
- cells
- receptors
- cholestene
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 CCCC(C)(C(C)(C)C=C)N(*N*)*(C)C*(*)*C1CCCC1 Chemical compound CCCC(C)(C(C)(C)C=C)N(*N*)*(C)C*(*)*C1CCCC1 0.000 description 4
- JRPWOWVEZWMWCI-UDNWOFFPSA-N CC(C)CC(CCC1C)[C@@H]1N Chemical compound CC(C)CC(CCC1C)[C@@H]1N JRPWOWVEZWMWCI-UDNWOFFPSA-N 0.000 description 1
- QNIVIMYXGGFTAK-QMMMGPOBSA-N CC(C)CCC[C@H](C)N Chemical compound CC(C)CCC[C@H](C)N QNIVIMYXGGFTAK-QMMMGPOBSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07J—STEROIDS
- C07J41/00—Normal steroids containing one or more nitrogen atoms not belonging to a hetero ring
- C07J41/0005—Normal steroids containing one or more nitrogen atoms not belonging to a hetero ring the nitrogen atom being directly linked to the cyclopenta(a)hydro phenanthrene skeleton
- C07J41/0011—Unsubstituted amino radicals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07J—STEROIDS
- C07J41/00—Normal steroids containing one or more nitrogen atoms not belonging to a hetero ring
- C07J41/0005—Normal steroids containing one or more nitrogen atoms not belonging to a hetero ring the nitrogen atom being directly linked to the cyclopenta(a)hydro phenanthrene skeleton
- C07J41/0027—Azides
Definitions
- the present invention relates to new synthetic receptors and the use of the synthetic receptors for delivering a protein, peptide, drug, prodrug, nucleic acid, or a small molecule into a target cell via receptor-mediated endocytosis.
- the synthetic receptors comprise a membrane-binding element that is a cholesterol derivative and novel methods for stereoselective preparation of 3 ⁇ -amino-cholestene and related 3 ⁇ - halides are also disclosed for use according to the invention.
- Receptor-mediated endocytosis involves the movement of ligands bound to membrane receptors into the interior of an area bounded by the membrane through invagination of the membrane. The process is initiated or activated by the binding of a receptor- specific ligand to the receptor.
- the internal pH of these endosomes decrease by the action of proton pumps, changing the conformation of the receptor and/or ligand.
- the result is the release of the ligand and the formation of separate receptor-containing vesicles and ligand-containing ones.
- the receptor-bearing vesicles are delivered to the cell membrane where they are released and "recycled" for additional use.
- the resulting vesicles, along with the internalized ligand are delivered to and fused with lysosomes where the eventual breakdown likely takes place.
- Another destination of some ligands internalized by RME including certain drugs, viral proteins, and protein toxins is escape from endosomes and entry into the cellular cytoplasm or nucleus.
- Receptor-mediated endocytotic activity has been utilized for delivering exogenous molecules such as proteins and nucleic acids to cells.
- exogenous molecules such as proteins and nucleic acids
- a specified ligand is chemically conjugated by covalent, ionic or hydrogen bonding to an exogenous molecule of interest (i.e. the exogenous compound), where the modified ligand is still able to bind to its cognate receptor.
- this method limits delivery of the exogenous molecule to cells that display a particular receptor.
- agents including pharmaceuticals, small molecules, peptides and oligonucleotides
- Cholesterol mimics have been utilized to facilitate delivery of siRNA, enhance DNA transfection, probe cellular membrane subdomains, and have been proposed for tumor targeting applications. See e.g., Wolfram, C. et al, Nat. Biotechnol. 2007, 25, 1149- 1157; Pitard, B. et al, Proc. Natl. Acad. ScL U.S.A. 1999, 96, 2621-2626; Sato, S. et al, J. Biol. Chem. 2004, 479, 23790-23796; Firestone, R.A., Bioconjug. Chem. 1994, 5, 105-113.
- synthetic receptors are provided in which the receptor includes the following regions: at least one binding, chelating, or mimicking motif linked to a membrane-binding element that anchors the receptor to a plasma membrane of a cell.
- the binding, chelating, or mimicking motif and membrane-binding element are linked to the other via a linker region.
- the membrane-binding element includes at least of one the following: cholesterol, dihydrocholesterol, ergosterol, brassicasterol, derivatives of cholesterol, dihydrocholesterol, ergosterol, brassicasterol, and related compounds thereof.
- the membrane-binding element includes at least one of the following: cholesterylamine, dihydrocholesterylamine, ergosterylamine, brassicasterylamine, derivatives of cholesterylamine, dihydrocholesterylamine, ergosterylamine, brassicasterylamine, and related compounds thereof.
- synthetic receptors include synthetic protein- binding receptors, synthetic metal-chelating receptors, synthetic immunoglobulin Fc- binding receptors, synthetic cytokine or growth factor-binding receptors, synthetic drug- binding receptors, synthetic lipid mimicking receptors, and synthetic transmembrane receptors.
- Another embodiment includes the loading of low-density lipoprotein (LDL) with synthetic receptors for the delivery of proteins, carbohydrates, nucleic acids, lipids, or drugs, to cells, tissues, or tumors.
- LDL low-density lipoprotein
- a protein into a cell that includes contacting the cell with a synthetic cell receptor so that the synthetic receptor inserts into the cell plasma membrane on the cell's surface.
- the synthetic receptor has a protein- binding motif and a membrane-binding element that anchors the synthetic receptor into the cell plasma membrane.
- the inserted synthetic receptor binds a protein via its protein- binding motif, thereby triggering receptor-mediated endocytosis of the protein-bound synthetic receptor and delivery of the protein into the cell.
- the present invention provides pharmaceutical compositions comprising a synthetic receptor and a pharmaceutically acceptable carrier.
- the present invention further includes methods of using the synthetic receptors for various applications.
- the synthetic receptors may be used as cellular probes.
- the present invention provides a method of treating a disease, disorder, or condition comprising delivering a therapeutically effective amount of a protein, peptide, drug, prodrug, or small molecule into a target cell using a synthetic cell receptor.
- the synthetic receptors may be used in enzyme replacement therapy or to treat viral, yeast, or bacterial infections, cancer, inflammation, or autoimmune diseases.
- the invention includes methods of modulating the immune response of a subject by removing a protein of interest from circulation in a subject, in particular extracellular ligands.
- a method for inducing apoptosis by contacting a synthetic lipid-mimicking receptor with a cell is provided.
- methods of using synthetic metal chelating receptors as a contrast agent in a patient in need of an MRI by delivering a synthetic metal chelating receptor into a cell population either in vivo, ex vivo or in vitro. Methods of this invention are useful for in vitro and in vivo applications.
- the present invention provides methods for synthesizing preferred membrane-binding elements, preferably cholesterylamine derivatives, including 3 ⁇ -amino-5-cholestene (3 ⁇ -cholesterylamine) and related 3 ⁇ -halides.
- preferred membrane-binding elements preferably cholesterylamine derivatives, including 3 ⁇ -amino-5-cholestene (3 ⁇ -cholesterylamine) and related 3 ⁇ -halides.
- the synthesis methods convert inexpensive cholesterol to 3 ⁇ -amino-5- cholestene and related 3 ⁇ -halides through a mechanism involving i-steroid and retro-j- steroid rearrangements.
- Fig. 1 Structures of the small natural receptor ganglioside GMl, novel synthetic receptors, and related control compounds.
- Fig. 2 The synthetic receptor targeting approach for enhancing cellular uptake of impermeable ligands. Synthetic mimics of cell surface receptors are added to living mammalian cells. These cells internalize cognate ligands such as macromolecular antibodies (IgG) bound to bacterial protein A (PrA) by synthetic receptor-mediated endocytosis.
- IgG macromolecular antibodies
- PrA bacterial protein A
- Fig. 3 The construction of synthetic receptors by modifying a previously reported synthesis of 3beta-cholesterylamine.
- the reagents and the conditions that correspond with the figure are as follows: (a) Oxalyl chloride, DMSO, CH 2 Cl 2 , TEA, -78 0 C. (b) L- Selectride, THF, -78 0 C. (c) PPh 3 , HN 3 , DEAD, benzene, (d) LiAlH 4 , Et 2 O, 0 0 C. (e) 2- Nitrobenzensulfonyl chloride, DIEA, THF. (f) Boc-3-chloropropylamine, K 2 CO 3 , DMA, 120 0 C.
- Fig. 4 Determination of the apparent affinities of DNP (27, Panel A) and NBD (28, Panel B) derivatives for rabbit polyclonal anti-DNP IgG (Sigma) by fluorescence polarization.
- the fluorescein moiety of 27 is shown in the dianionic form that predominates at pH 7.4. l Fixed concentrations of 27 (20 nM) and 28 (100 nM) in PBS (pH 7.4, 100 ⁇ L) were employed.
- the data shown in Panel B was corrected to compensate for partial binding-induced quenching of the NBD fluorophore. 2 ' 3 These experiments were run in triplicate, and errors reflect 95% confidence intervals.
- Fig. 5 Analysis of uptake of red fluorescent anti-DNP / PrA-AF633 by cells treated with the green fluorescent receptors 6-9.
- Jurkat lymphocytes were treated with receptors 6-9 (10 ⁇ M) for 1 h followed by addition of anti-DNP / PrA-AF633 for 4 h.
- Cells were washed with media containing 6-(2,4-dinitrophenyl) aminohexanoic acid (100 ⁇ M) to remove any non-internalized protein prior to analysis by flow cytometry.
- Panel A Median green (NBD) and red (AF633) cellular fluorescence resulting from treatment with 6-9 and anti-DNP / PrA-AF633.
- Panels B-E the distribution of green and red cellular fluorescence after treatment with anti-DNP / PrA-AF633 alone or receptor 6 (10 ⁇ M) and anti-DNP / PrA-AF633. UV absorbance measurements were employed to equalize receptor concentrations prior to addition to cells. Total cellular fluorescence from the NBD groups of receptors 6-9 was within two-fold.
- Fig. 6 Confocal laser scanning and DIC microscopy of living Jurkat lymphocytes treated with green fluorescent receptor 9 (10 ⁇ M) and red fluorescent BODIPY TR ceramide (5 ⁇ M) as a probe of the golgi apparatus and nuclear membrane. Yellow pixels indicate colocalization of green and red fluorophores. These experiments revealed that the ineffective receptor 9 (the iV-acyl analogue) exhibits a unique intracellular localization compared with receptors 6-8.
- Fig. 7. Confocal laser scanning and DIC microscopy of living Jurkat lymphocytes transfected with the green fluorescent late endosome / lysosome marker EGFP-lgpl20 4 and subjected to ligand uptake mediated by receptor 2. Transfected cells were treated with receptor 2 (10 ⁇ M) for 1 h followed by addition of red fluorescent anti-DNP / PrA-AF594 for 4 h. Yellow pixels indicate colocalization of green and red fhiorophores.
- Fig. 8 Synthetic receptor-mediated uptake of protein ligands in Jurkat lymphocytes. Cells were pretreated with receptors for one hour at 37 0 C prior to addition of an anti-DNP IgG/PrA complex.
- Panel A Confocal laser scanning and differential interference contract (DIC) microscopy of cells treated with green fluorescent receptor 6 (10 ⁇ M) followed by the addition of red anti-DNP/PrA-AF594 (for 4 hours). Yellow pixels indicate the localization of green and red fluorophores.
- Panel B Dose-dependent magnitude of uptake of anti-DNP/PrA-AF488 quantified by flow cytometry after 4 hours.
- Fig. 9 Subcellular localization of synthetic receptors in living Jurkat lymphocytes.
- Panel A DIC (left images) and epifluorescence micrographs (right images) of cells treated for 1 hour with green fluorescent receptors 6-9 (10 ⁇ M).
- Panel B Quantification of cell surface fluorescence by sodium dithionite quenching of exposed fluorophores. Cells treated as shown in Panel A were washed with sodium dithionite (5 mM) for 10 seconds at 22 0 C and residual fluorescence quantified by flow cytometry.
- Panel C Quantification of the cellular half- life of receptor 2.
- Fig. 11 Quantification of efflux kinetics of receptor 10 from endosomes to the plasma membrane of Jurkat lymphocytes by back exchange.
- Cells treated with 10 (1 ⁇ M, 1 hour) were cooled to 4 0 C and cell surface fluorophores removed (>90%) by repeated washing with ice-cold back exchange media containing BSA (1%) and methyl- ⁇ - cyclodextrin (2 mM).
- Cells were resuspended in back exchange media at 37 0 C to resume recycling, cellular fluorescence was quantified by flow cytometry, and loss of fluorescence was evaluated with a one-site exponential decay model.
- Fig. 12 Association of receptor-ligand complexes with putative lipid raft functions of plasma membranes of Jurkat lymphocytes.
- Panel A Cells were treated with AF488- labeled protein ligand for 30 minutes at 4 0 C.
- Panel B Cells were treated with receptors 2- 5 (1 ⁇ M) for 1 hour at 37 0 C followed by anti-DNP-AF488 for 30 minutes at 4 0 C. Cells fractionated by ultracentrifugation for 20 hours at 4 0 C in a 2% to 40% sucrose step gradient containing 0.2% Triton-X.
- CT-B Cholera toxin B subunit.
- Fig. 13 A simple model of synthetic receptor-mediated endocytosis. Synthetic receptors embedded in cellular plasma membranes rapidly cycle between the cell surface and intracellular endosomes. Binding of the ligand (IgG) results in association with lipid rafts and uptake of the complex by endocytosis. Dissociation in endosomes frees the receptor to return to the cell surface. The protein ligand is sorted to late endosomes and lysosomes.
- Fig. 14 Structures of the antibiotic vancomycin (1) and a green fluorescent derivative oregon green vancomycin (2).
- Fig. 15 Structures of a vancomycin-binding synthetic receptor bearing a D-Phe-D- Ala motif (3), a related L-Phe-L-Ala analogue that does not bind vancomycin (4), and an amide analogue that binds vancomycin but exhibits a lower affinity for the cellular plasma membrane (5).
- Fig. 16 The synthetic receptor targeting strategy for endocytic delivery of vancomycin (1).
- Fig. 17 Confocal laser scanning and differential interference contrast (DIC) microscopy of living J-774 macrophages alone (Panel A) and infected with L. monocytogenes (Panel B). Prior to microscopy, receptor 2 (10 ⁇ M) was added to cells for 1 h, cells were washed to remove excess receptor, and fluorescent vancomycin (3, 3 ⁇ M) was added for 4 h. Scale bar: 10 ⁇ m.
- Fig. 18 Flow cytometric analysis of cellular uptake of fluorescent vancomycin 2 promoted by synthetic receptor 3 and control compounds.
- Preload conditions Receptor 3 or analogues (4, 5) were added to cells for 1 h to load the plasma membrane, cells were washed, and 2 (3 ⁇ M) was added for 4 h.
- Premix conditions Receptor 3 or analogues (4, 5) were preequilibrated with 2 (3 ⁇ M) at 23 0 C for 1 h followed by addition of this mixture to cells for 4 h.
- Fig. 19 Effects of premixed receptor 3 and vancomycin (1) on HeLa cells infected with L. monocytogenes. Infected cells were treated with 1 and 3 for 6 h at the concentrations indicated, then washed with media lacking antibiotics.
- Panel A Viability of L. monocytogenes cultured from infected HeLa cells. BHI media was added, and bacterial growth was quantified by absorbance measurements after an additional 18 h.
- Panel B DMEM media was added and viability of infected HeLa cells after an additional 30 h in culture quantified by flow cytometry.
- Fig. 20 Synthetic receptor targeting of fluorescent vancomycin 2 to specific tissues in vivo. Mice were injected i.p. with compounds, tissues were isolated after 8 h, and cellular fluorescence was analyzed by flow cytometry. In the spleen, liver, heart, kidney, and pancreas, two different populations of cells were analyzed.
- Fig. 21 SDS PAGE analysis of oligohistidine-tagged AcGFP proteins.
- Lane 1 Protein molecular weight marker.
- Lane 2 Crude lysate from cells expressing AcGFP(His) 10 .
- Lane 3 Purified AcGFP(His) 10 .
- Lane 4 Crude lysate from cells expressing AcGFP(His) 6 .
- Lane 5 Purified AcGFP(His) 6 .
- Fig. 22 Delivery of oligohistidine-tagged AcGFP to endosomes and lysosomes.
- Jurkat lymphocytes were treated with synthetic receptor 1 (10 ⁇ M) at 37 0 C for 1 h, the cells were washed with media, and Ni(OAc) 2 (100 ⁇ M), green fluorescent AcGFP(HiS) 1 O (3.2 ⁇ M), and red fluorescent Dil-loaded LDL (50 ⁇ g / mL ( ⁇ 0.1 ⁇ M)) were added at 37 0 C for an additional 4 h.
- Fig. 23 Inhibition of protein uptake at 4 0 C.
- Jurkat lymphocytes were treated with synthetic receptor 1 (10 ⁇ M) at 37 0 C for 1 h, washed to remove unincorporated receptors, the cells were cooled to 4 0 C, and AcGFP(His) 10 (3.2 ⁇ M) and Ni(OAc) 2 (100 ⁇ M) were added at 4 0 C for 4 h.
- Fig. 24 Confocal laser scanning (left) and differential interference contrast (right) micrographs of living Jurkat lymphocytes.
- Cellular plasma membranes were preloaded with receptor 1 (10 ⁇ M) for 1 h at 37 0 C, cells were washed with fresh media, and media containing AcGFP-HiS 10 (3.2 ⁇ M) and Ni(OAc) 2 (100 ⁇ M) was added for an additional 4 h at 37 0 C.
- Cells shown in Panel A were imaged immediately after this treatment.
- Cells shown in Panel B were washed with NTA (400 ⁇ M) prior to microscopy to remove non- internalized protein from the cell surface.
- Scale bar 10 ⁇ m.
- Fig. 25 Analysis of cellular uptake of His-tagged AcGFP proteins by flow cytometry. Each bar represents the average fluorescence of 10,000 cells. Unless otherwise noted, cellular plasma membranes of Jurkat lymphocytes were preloaded with receptor 1 (10 ⁇ M) for 1 h at 37 0 C, cells were washed with fresh media, and His-tagged AcGFP (3.2 ⁇ M) / metal diacetate solution (100 ⁇ M) was added for 4 h at 37 0 C. Prior to analysis, cells were washed with NTA (400 ⁇ M, 30 min) in PBS (pH 7.4) to remove bound surface protein. Panel A: Dose dependence of receptor-mediated uptake.
- Premix conditions a solution containing receptor 1, Ni(OAc) 2 , and AcGFP(His) 10 was added to cells for 4 h.
- Panel B Dependence on [Ni(OAc) 2 ].
- Panel C Omission control experiments.
- Panel D Uptake of (His) 6 and (HiS) 1O fusion proteins promoted by different metal diacetates.
- Fig. 26 Uptake of fluorescent human IgG by FcR + and FcR " human cells. Micrographs shown on the top. Confocal laser scanning and DIC images of human THP-I monocytes (left image) and human Jurkat lymphocytes (middle and right images) treated with green fluorescent human IgG.
- sFcR synthetic Fc receptor. Histogram shown on the bottom: Flow cytometric quantitation of cellular uptake of fluorescent human IgG by THP-I monocytes and Jurkat lymphocytes. sFcR: synthetic Fc receptor. PrA: Protein A, a competitor that binds to the Fc region of the IgG. Fig. 27. Uptake of synthetic receptors by certain mammalian cells requires low- density lipoprotein (LDL).
- LDL low- density lipoprotein
- Fig. 28 Examination of the conversion of mesylate (2) to 3 ⁇ -azido-5-cholestene (3) using 1 H NMR (400 MHz).
- Fig. 28A shows 1 H NMR spectra of mesylate (2) before (bottom spectrum) and at selected time points after the addition of TMSN 3 (1 equiv) and BF 3 -OEt 2 (2 equiv) to mesylate (2) (0.5 mmol) in CDCl 3 (0.5 mL).
- the arrows point to signals identified as the C6 proton of 6 ⁇ -azido-3 ⁇ , 5-cyclo-5 ⁇ -cholestane (12).
- Fig. 28B shows the observed chemical shifts of mesulate (2), 6 ⁇ -azido-3 ⁇ ,5-cyclo-5 ⁇ -cholestane (12), and 3 ⁇ -azido-5-cholestene (3).
- the present invention relates to new synthetic receptors. More particularly, the invention relates to methods for synthesizing preferred cholesterylamine-derived membrane-binding elements, preferably 3 ⁇ -amino-5-cholestene (3 ⁇ -cholesterylamine) and related 3 ⁇ -halides through a mechanism involving i-steroid and retro-j-steroid rearrangements.
- preferred cholesterylamine-derived membrane-binding elements preferably 3 ⁇ -amino-5-cholestene (3 ⁇ -cholesterylamine) and related 3 ⁇ -halides through a mechanism involving i-steroid and retro-j-steroid rearrangements.
- Sun, Q. et ah Practical Synthesis of 3beta-Amino-5-Cholestene and Related 3beta-Halides Involving i-Steroid and Retro-i-Steroid Rearrangements, Org. Lett. 2009, 11, 567-570.
- the present invention relates to the use of the synthetic receptors for delivering a polymer, protein, peptide, drug, prodrug, nucleic acid, or small molecule into a target cell via receptor-mediated endocytosis.
- one aspect of the present invention is to deliver a desired protein, peptide, prodrug, or small molecule from the outside of a cell to the inside of a cell.
- the present inventors contemplate the use of synthetic receptors to treat a variety of diseases, conditions, and disorders, including those for which the conventional therapeutic alternatives are not very effective or are non- existent.
- the present inventors are the first to recognize that synthetic receptors comprising membrane-binding elements of cholesterol, dihydrocholesterol, ergosterol, brassicasterol, derivatives of cholesterol, dihydrocholesterol, ergosterol, brassicasterol, and related compounds thereof linked to a protein binding group provide a novel mechanism for receptor mediated endocytosis of the synthetic receptor bound to at least one specific protein and delivery of the protein to the endosome/lysosome.
- the synthetic receptors' membrane-binding elements insert into the cell's plasma membranes, project a protein-binding motif from the cell surface so that the protein-binding motif binds a cognate protein.
- the synthetic receptor undergoes receptor-mediated endocytosis allowing the cell to internalize the conjugate of protein bound to the synthetic receptor.
- the synthetic receptors allow for cycling between plasma membranes and intracellular endosomes.
- the synthetic receptor according to the invention may, in addition, be linked or conjugated to other molecules, including but not limited to for example, a labeling molecule which makes it possible, for example, to visualize the distribution or localization of the synthetic receptor after administration in vitro or in vivo.
- a labeling molecule which makes it possible, for example, to visualize the distribution or localization of the synthetic receptor after administration in vitro or in vivo.
- the protein that binds to the protein-binding motif may be labeled to visualize the distribution or localization of the protein-bound synthetic receptor after administration in vitro or in vivo.
- LDL low-density lipoprotein
- / or other lipoproteins prior to their uptake by cells.
- LDL low-density lipoprotein
- Certain mammalian cells take up LDL loaded with synthetic receptors via natural LDL receptors expressed on the cell surface. This delivery mechanism enables targeting of these compounds to specific cells or tissues in vivo. Because tumors often over express natural LDL receptors, the synthetic receptors described here enable tumor or tissue targeting in vivo. Cell lines that lack LDL receptors or that possess other cholesterol uptake mechanisms can take up synthetic receptors through other mechanisms of action.
- a synthetic receptor comprises a membrane- binding element and a target-binding motif.
- a synthetic receptor comprises a membrane-binding element, a linker region, and a target-binding motif.
- the term "membrane-binding element” includes molecules that can be inserted into a lipid membrane through a hydrophobic anchor and allows the molecule to reside on the cell surface or reside on the cell surface and cycle between endosomes and cell surface.
- the membrane-binding element comprises proteins, peptides, peptidomimetics, phospholipids, sphingolipids, steroids, cholesterol, dihydrocholesterol, ergosterol, brassicasterol, derivatives of proteins, peptides, peptidomimetics, phospholipids, sphingolipids, steroids, cholesterol, dihydrocholesterol, ergosterol, brassicasterol, and related compounds thereof.
- the membrane-binding element comprises cholesterylamine, dihydrocholesterylamine, ergosterylamine, brassicasterylamine, derivatives of cholesterylamine, dihydrocholesterylamine, or ergosterylamine, brassicasterylamine, and related compounds thereof.
- the membrane-binding element comprises 3- cholesterylamine, 3-dihydrocholesterylamine, 3-ergosterylamine, derivatives of 3- cholesterylamine, 3-dihydrocholesterylamine, 3-ergosterylamine, or 3-brassicasterylamine, and related compounds thereof.
- the term “derivative” refers to a chemical substance related structurally to another, i.e., an "original" substance, which can be referred to as a "parent” compound.
- the term “derivative” as used herein with reference to proteins, peptides, peptidomimetics, phospholipids, sphingolipids, steroids, cholesterol, dihydrocholesterol, ergosterol, brassicasterol, derivatives of cholesterol, dihydrocholesterol, ergosterol, brassicasterol, of the membrane-binding element of the present invention refers to a molecule that contains at least the portion of the proteins, peptides, peptidomimetics, phospholipids, sphingolipids, cholesterol, dihydrocholesterol, ergosterol, brassicasterol, derivatives of cholesterol, dihydrocholesterol, ergosterol, brassicasterol, and related compounds thereof that allows the molecule to insert into a cell plasma membrane.
- derivatives of cholesterol include cholesteryl esters and cholesteryl carbamates.
- derivative as used herein with reference to 3- cholesterylamine, 3-dihydrocholesterylamine, or 3-ergosterylamine of the membrane- binding element of the present invention refers to a molecule that contains at least the portion of the 3-cholesterylamine, 3-dihydrocholesterylamine, 3-ergosterylamine, or 3- brassicasterylamine, that allows the molecule to insert into a cell plasma membrane.
- derivatives of the membrane- binding element of the present invention refers to a molecule that contains at least the portion of the 3 ⁇ -cholesterylamine, 3 ⁇ -dihydrocholesterylamine, 3 ⁇ -ergosterylamine or 3 ⁇ - brassicasterylamine that allows the molecule to insert into a cell plasma membrane.
- derivatives of 3 ⁇ -cholesterylamine include, without limitation, N-alkyl, N- aryl, and N-acyl 3 ⁇ -cholesterylamines.
- the term "related compound” refers to a chemical molecule that associates with the cellular plasma membrane, is hydrophobic and has a positive charge, for example, a positive charge from an amine group, or has a polar functional group that allows the molecule to reside on the cell surface and yet cycle between the endosome and cell surface without becoming trapped intracellularly.
- Examples include without limitation a protonated cholesterylamine or a cholesteryl ester, cholesteryl amide, cholesteryl ether, or cholesteryl carbamate linked to another polar or non-polar headgroup.
- the membrane-binding element as described above can be used with any of the synthetic receptors of the present invention regardless of the various binding, chelating or mimicking motifs and/or use of a linker region.
- the present inventors also contemplate that a membrane-binding element with an affinity for membranes can be created by enhancing the hydrophobicity of the membrane- binding element domain (e.g., increasing the amount of hydrophobic residues or functional groups, replacing non-hydrophobic residues with hydrophobic residues, and swapping in a hydrophobic domain that consists of entirely hydrophobic residues).
- the synthetic receptor comprises a linker region that links the target-binding motif of the synthetic receptor to the membrane-binding element of the synthetic receptor.
- the linker region is structurally variable and can have one or multiple functions depending on the intended use of the receptor.
- the linker region (shown as position X 1 in the embodiments above) may include but is not limited to zero, one, or more atoms selected from the group of atoms, C, N, S, and O and/or other chain-extending atoms, zero, one, or more alkane, alkene, alkyne, aryl, ketone, amine, amide, ester, ether, urea, carbamate, heterocyclic, and related functional groups, either linear or cyclic, zero, one, or more alpha, beta, gamma, and delta amino acids as well as aminohexanoic acid and related structures.
- amino acid subunits may also include side-chains such as those found in natural L- and nonnatural D-configuration alpha amino acids or other amino acids.
- the linker may serve as a spacing group between the membrane-binding element and the protein-binding motif so as to minimize the possibility that the membrane-binding element will interfere with the interaction or binding of the binding motif with the target molecule, e.g., a peptide, protein, carbohydrate small molecule, drug, prodrug or nucleic acid that is to be internalized.
- the target molecule may be noncovalently bound or covalently linked to the target-binding motif.
- the linker may also facilitate association with LDL, with the cell surface, and rapid cycling between the cell surface and endosomes, as demonstrated by the present inventors in Example 11 and as discussed below.
- the linker region may contribute to receptor localization and ligand uptake efficiency. See Examples 8 and 9.
- the linker as described above can be used with any of the synthetic receptors of the present invention regardless of the differing membrane-binding elements or the various target-binding, chelating or mimicking motifs.
- the linker comprises zero, one or more atoms that may be selected from the group of atoms, C, N, S, and O and/or other chain- extending atoms repeated 0 to 100 or more times as indicated by the symbol x ⁇ . ⁇ .
- the linker region comprises one or more groups selected from the following: alkane, alkene, alkyne, aryl, ketone, amine, amide, ester, ether, urea, carbamate, heterocyclic, and related functional groups in position X 1 . These functional groups can be linear or cyclic.
- the linker may comprise 0 to 100 or more subunits such as alpha, beta, gamma, and delta amino acids as well as aminohexanoic acid and related structures with 0 to 100 or more atoms between the amine and carboxylic acid.
- These amino acid subunits may also include side-chains such as those found in natural L- and nonnatural D- configuration alpha amino acids or other amino acids.
- the linker comprises one or more alpha amino acids, beta amino acids, gamma amino acids, delta amino acids, 6 aminohexanoic acid or related compounds to facilitate association with the cell surface and rapid cycling between the cell surface and endosomes.
- the linker region is located between the last amine of the cholesterylamine and the first amino acid of the protein-binding or other binding element.
- the linker region has at least three carbon atoms between the cholesterylamine and the first polar functional group (such as an amide).
- the present inventors have found that modifying the linker region of the synthetic receptor effects the receptor localization and ligand uptake efficiency.
- the present inventors have found that insertion of amide derivatives of 3 ⁇ -cholesterylamine in the linker region of the receptor elicits certain effects in trafficking and expression of the receptor on the cell surface.
- the present inventors have found that N-acyl derivatives of 3 ⁇ -cholesterylamine in the linker region results in decreased expression of the receptor on the cell surface, especially when compared with the N-alkyl receptors containing ⁇ -alanine subunits in the linker.
- the linker plays a role in maintaining or increasing a synthetic receptor population on the cell surface by keeping the synthetic receptors cycling from the cell surface to the endosome back to the cell surface.
- the linker region of the synthetic receptor comprises ⁇ -alanine subunits.
- the linker comprises an N-acyl derivative of 3 ⁇ -cholesterylamine.
- the linker comprises an N-aryl derivative of 3 ⁇ -cholesterylamine.
- the linker comprises an N-alkyl derivative of 3 ⁇ -cholesterylamine.
- the synthetic receptor comprises a target- binding motif.
- target-binding motif refers to a region in the receptor that recognizes and binds non-covalently or is covalently linked to a protein, a polypeptide, a peptide, an antibody, an immunoglobulin, a ligand, a cytokine, a growth factor, a nucleic acid, a lipid, membrane, a carbohydrate, a drug, a prodrug, a small molecule or a fragment thereof.
- the synthetic receptor comprises a protein-binding motif.
- protein-binding motif refers to a region in the receptor that recognizes and binds non-covalently or is covalently linked to specific amino acid residues in the context of variable surrounding peptide or protein sequences.
- protein includes polypeptides, peptides, antibodies, and other protein ligands, including, for example, cytokines, growth factors, immunoglobulins, cell surface receptors, antigens, or drugs or medicine, for example, peptide drugs, glycopeptide antibiotics such as vancomycin and teicoplanin.
- the protein-binding motif comprises a protein, peptide, nucleic acid, or synthetic polymer that disrupts membranes of intracellular endosomes.
- the protein includes but is not limited to a viral or bacterial fusogenic protein such as hemagglutinin or listeriolysin O or a fragment thereof.
- the peptide includes but is not limited to the peptide termed GALA or endoporter. See Summerton JE. Endo-porter: a novel reagent for safe, effective delivery of substances into cells. Ann N Y Acad Sci.
- the synthetic polymer includes but is not limited to poly (alkylacrylic acids) such as poly (2-propylacrylic acid) and salts thereof.
- the present invention provides a synthetic receptor that is a synthetic immunoglobulin Fc receptor.
- the synthetic immunoglobulin Fc receptor has a Fc binding region and a membrane-binding element.
- the synthetic immunoglobulin Fc receptor has a Fc binding region, a linker region, and a membrane-binding element.
- membrane-binding element has been described above, and examples of the membrane-binding element include but are not limited to N-alkyl, N-aryl, or N-acyl derivatives of 3-cholesterylamine, 3- dihydrocholesterylamine, 3-ergosterylamine, 3-brassicasterylamine and related compounds.
- the Fc binding region includes a protein including but not limited to the IgG- binding proteins: Protein A (from S. aureus), Protein G, Protein L, or Protein Z, a peptide, a cyclic peptide including but not limited to the minimized protein A variant termed Z34C, or a small molecule that binds the Fc fragment of immunoglobulins.
- Protein A from S. aureus
- Protein G from S. aureus
- Protein L Protein L
- Protein Z Protein Z
- a peptide a cyclic peptide including but not limited to the minimized protein A variant termed Z34C
- Z34C minimized protein A variant
- small molecule that binds the Fc fragment of immunoglobulins is shown below:
- the linker comprises atoms that may be selected from the group of atoms, C, N, S, and O and/or other chain-extending atoms repeated 0 to 100 or more times as indicated by the symbol n ⁇ .
- the linker region comprises one or more groups selected from the following: alkane, alkene, alkyne, aryl, ketone, amine, amide, ester, ether, urea, carbamate, heterocyclic, and related functional groups in position X 1 . These functional groups can be linear or cyclic.
- the linker may comprise 0 to 100 or more subunits such as alpha, beta, gamma, and delta amino acids as well as aminohexanoic acid and related structures with 0 to 100 or more atoms between the amine and carboxylic acid.
- These amino acid subunits may also include side-chains such as those found in natural L- and nonnatural D-configuration alpha amino acids or other amino acids.
- These and related synthetic immunoglobulin Fc receptors promote the cellular endocytosis of immunoglobulins by recruiting these proteins to cell surfaces.
- the synthetic immunoglobulin Fc receptor may also be used to control natural receptors on cell surfaces by providing additional stabilization with the cell surface of antibodies that target natural cell surface receptors.
- the synthetic immunoglobulin Fc receptor may also be used to deliver therapeutic antibodies into cells. These antibodies include neutralizing antibodies against intracellular bacteria, viruses, and other pathogens. Other therapeutic antibodies that target antigens involved in cellular proliferation may be delivered to interfere with the proliferation of cancer cells. Synthetic immunoglobulin Fc receptors can also be used to deliver IgG into cells in combination with an endosome disruptive agent such as membrane fusogenic proteins, peptides, or synthetic polymers to enable live cell immunolabeling of antigens such as immunofluorescence experiments or to control intracellular processes by binding of targeted biomolecules. Other Fc-binding motifs such as substituted triazines (See: J. Comb. Chem. 2004, 6, 862-868) are known to those skilled in the art, and these and related Fc-binding compounds linked to membrane- binding elements are claimed in this application.
- the present invention provides a synthetic receptor that is a synthetic receptor for cytokines and growth factors.
- a synthetic receptor for cytokines and growth factors comprises a cytokine or growth factor -binding motif and a membrane-binding element as described above.
- a synthetic receptor for cytokines and growth factors comprises a cytokine or growth factor- binding motif, a linker region as described above, and a membrane-binding element as described above.
- the cytokine or growth factor-binding motif may comprise a small molecule, an oligonucleotide, a carbohydrate, a peptide, or a protein-based binding motif that binds an extracellular cytokine or a growth factor.
- a synthetic receptor for binding cytokines and growth factors is shown below:
- n ⁇ comprises 0 to 100 or more atoms
- X 1 comprises one or more linker atoms or functional groups such as amines, amides, carbamates, ureas, esters, or ethers.
- X 1 comprises 0 to 100 linker subunits such as alpha, beta, gamma, or delta amino acids as well as aminohexanoic acid and related structures with 0 to 100 or more atoms between the amine and the carboxylic acid.
- the present invention provides a synthetic receptor that is a synthetic drug delivery receptor.
- the synthetic drug delivery receptor has a drug-binding motif and a membrane-binding element.
- the synthetic drug delivery receptor has a drug-binding motif, a linker region, and a membrane-binding element.
- a membrane -binding element's structure and function has been described above.
- the drug-binding motif may bind non-covalently to drugs or prodrugs or be covalently linked to drugs or prodrugs.
- the drug-binding motif comprises a protein, a linear or cyclic peptide, a small molecule, a carbohydrate or oligosaccaride, or a nucleic acid or oligonucleotide.
- the drug-binding motif is capable of binding non-covalently to or is covalently linked to a drug, a prodrug, a small molecule, a linear or cyclic peptide, a protein, a carbohydrate or oligosaccaride, or a nucleic acid such as a DNA or RNA oligonucleotide, plasmid DNA, siRNA, or ribozyme.
- Binding of nucleic acids by the synthetic receptor may allow delivery of linear or plasmid DNA into cells for transfection as used in gene therapy, diagnostic, or other applications. Binding of RNA may allow delivery of RNA into cells for antisense or siRNA gene silencing applications.
- the drug- binding motif can include DNA or RNA intercalators such as ethidium bromide and related compounds or major-groove or minor-groove binding agents that bind nucleic acids.
- RNA intercalators such as ethidium bromide and related compounds or major-groove or minor-groove binding agents that bind nucleic acids.
- ni comprises 0 to 100 or more atoms
- X 1 comprises one or more linker atoms such as O, N, C, or S, or functional groups such as amines, amides, carbamates, ureas, esters, or ethers.
- X 1 comprises 0 to 100 linker subunits such as alpha, beta, gamma, or delta amino acids as well as aminohexanoic acid and related structures with 0 to 100 or more atoms between the amine and the carboxylic acid.
- a synthetic drug delivery receptor has one or more drug- binding motif linked to N-alkyl, N-aryl, or N-acyl derivatives of cholesterylamine, dihydrocholesterylamine or ergosterylamine.
- Synthetic drug delivery receptors having more than one drug-binding motif can bind multiple drugs or increase the affinity for a specific drug through multivalent interactions to enhance efficacy.
- one aspect of the synthetic drug delivery receptor includes a vancomycin-binding motif as a drug-binding motif.
- the vancomycin-binding motif is ⁇ -Ahx-D-Phe-D-Ala.
- the vancomycin- binding motif is D-AIa-D-AIa.
- the vancomycin-binding motif includes D-amino acids.
- the protein-binding motif of the receptor comprises 2,4-dinitrophenyl (DNP).
- the protein-binding motif of the receptor comprises 7-nitrobenz-2-oxa-l,3-diazole (NBD) derivatives.
- NBD 7-nitrobenz-2-oxa-l,3-diazole
- the protein-binding motif of the synthetic receptor may selectively bind almost any desired protein or peptide.
- the protein-binding embodiments of the invention include partial or complete amino acid sequences and functional equivalents to such molecules including, but not limited to, polypeptides having conservative and nonconservative amino acid substitutions, mutants and peptidomimetics that resemble these molecules.
- the term "functional equivalents” refers to any modified version of a nucleotide or polypeptide which retains the basic function of its unmodified form. As an example, it is well-known that certain alterations in amino acid or nucleic acid sequences may not affect the polypeptide encoded by that molecule or the function of the polypeptide. It is also possible for deleted versions of a molecule to perform a particular function as well as the original molecule. Even where an alteration does affect whether and to what degree a particular function is performed, such altered molecules are included within the term "functional equivalent” provided that the function of the molecule is not so deleteriously affected as to render the molecule useless for its intended purpose.
- substitutions refers to the substitution of one amino acid for another at a given location in the peptide, where the substitution conserves the character of the amino acid residue.
- substitutions of like amino acid residues can be made on the basis of relative similarity of side-chain substituents, for example, their size, charge, hydrophobicity and hydrophilicity.
- the following eight groups each contain amino acids that are conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, 1984, Proteins).
- the protein-binding motif of the synthetic receptor may be modified to enhance its binding affinity for the cognate protein using standard molecular techniques. See Maniatis and Sambrook et al, In Molecular Cloning: A Laboratory Manual, Cold Spring Harbor, N.Y., 1989. Additionally, methods of preparing the protein-binding embodiments of the invention through chemical synthesis and recombinant techniques are disclosed.
- the synthetic receptors may be used to construct vaccines. Lipids are often linked to peptides or proteins to create vaccines (see J. Immunol. 2002, 169, 4905-4912).
- novel membrane anchors described in this invention By linking the novel membrane anchors described in this invention to peptides, proteins, lipids, carbohydrates, or nucleic acids, new synthetic vaccines can be constructed.
- the novel membrane anchor comprises a derivative of cholesterol, dihydrocholesterol, cholesterylamine, or dihydrocholesterylamine.
- the synthetic receptor of the present invention comprises a synthetic metal chelating receptor.
- the synthetic metal chelating receptor comprises a metal-binding motif and a membrane-binding element as described above.
- the synthetic metal chelating receptor comprises a metal-binding motif, a linker region as described above, and a membrane -binding element as described above.
- the metal binding motif includes metal chelating groups, for example, nitrilotriacetic acid (NTA), ethylenediaminetetraacetic acid (EDTA), 1,4,7,10- tetraazacyclododecane-l,4,7,10-tetraacetic acid (DOTA), 10-(2-hydroxypropyl)-l,4,7,10- tetraazacyclododecane-l,4,7-triacetic acid (HP-DO3A), and (carboxymethyl) imino] bis (ethyleneitrilo) tetra-acetic acid (DTPA) that bind metal including but not limited to gadolinium, aluminum, lead, titanium, vanadium, chromium, manganese, iron, cobalt, nickel, copper, zinc, yttrium, zirconium, niobium, molybdenum, technetium, ruthenium, rhodium, palladium, silver, cadmium, hafnium,
- x ⁇ . ⁇ comprises 0 to 100 or more atoms
- X 1 comprises one or more linker functional groups such as amines, amides, carbamates, ureas, esters, or ethers.
- X 1 comprises 0 to 100 linker subunits such as alpha, beta, gamma, or delta amino acids as well as aminohexanoic acid and related structures with 0 to 100 or more atoms between the amine and the carboxylic acid.
- one aspect of the synthetic metal-chelating receptor includes a NTA-binding motif as a metal-chelating motif.
- synthetic metal chelating receptors may be useful for MRI and other imaging applications.
- synthetic metal chelating receptors may be delivered into a cell population ex vivo/in vitro and injected into a patient or delivered to a cell population in vivo in a patient in need of an MRI.
- the cell population displaying the synthetic metal chelating receptors or the synthetic metal chelating receptors themselves may be administered a site of interest in the patient, for example, by injection.
- the synthetic metal chelating receptors may be bound to metal ions prior to administration to the patient or they may bind metal ions in the patient' s blood stream or any combination thereof, thereby acting as a MRI contrast agent.
- the synthetic metal chelating receptor can be used to reduce the level of iron or other metals in cells in need of such a reduction. In one aspect, the synthetic metal chelating receptor can be used to inhibit tumor cell growth. It is contemplated that the synthetic metal chelating receptor can be used in the treatment and prevention of the following medical conditions including, but are not limited to, cancer, inflammatory and infectious conditions, vasoreactive and vasoocclusive conditions, coronary and peripheral athlerosclerosis, parasitic diseases, neurologic and neuromuscular conditions, and viral conditions including AIDS.
- Additional medical conditions further include vasospasm, Parkinson's disease, Alzeihmer's disease, malaria, tuberculosis, arthritis, allergic and asthmatic conditions, hepatitis, coronary and peripheral vascular ischemia-reperfusion injury of blood vessels.
- the synthetic receptor of the present invention comprises synthetic a lipid-mimicking receptor.
- the synthetic lipid-mimicking receptor comprises a lipid-mimicking motif and a membrane-binding element as described previously.
- the synthetic lipid-mimicking receptor comprises a lipid- mimicking motif, a linker region as described previously, and a membrane -binding element as described previously.
- C-reactive protein is a protein that circulates in the human bloodstream and is a non-specific but sensitive marker of the acute inflammatory response. CRP binds to lipids on the surface of dead or dying cells.
- CRP Normally lipids are packed very tightly on the surface of a cell so that CRP does not have access to bind these extracellular surface lipids. But in dead and dying cells, phosphatidylcholine lipids protrude allowing the CRP to bind to the cell, triggering an immune response. CRP can bind to complement factor CIq and factor H and activate the classic pathway of complement activation. In addition, CRP plays a part in the innate immunity (opsonization) and in the removal of membrane and nuclear material from necrotic cells.
- the present inventors have found that when a synthetic lipid-mimicking receptor comprising phosphatidylcholine linked to a membrane-binding element is contacted with cells, the CRP recognizes the cells as dead or dying cells, binds the lipid-mimicking receptor, triggering an immune response, thereby promoting apoptosis of the cell.
- the lipid-mimicking motif includes lipids that are found on dead and/or dying cells.
- the lipid-mimicking motif includes without limitation phosphatidylcholine, phosphatidylserine, and phosphatidylethanolamine or components thereof such as the headgroups phosphocholine, phosphoserine, and phosphoethanolamine.
- a synthetic lipid-mimicking receptor of the present invention is shown below:
- xs. ⁇ comprises 0 to 100 or more atoms
- X 1 comprises one or more linker atoms or functional groups such as amines, amides, carbamates, ureas, esters, or ethers.
- X 1 comprises 0 to 100 linker subunits such as alpha, beta, gamma, or delta amino acids as well as aminohexanoic acid and related structures with 0 to 100 or more atoms between the amine and the carboxylic acid.
- the synthetic lipid-mimicking receptor can be used to induce apoptosis.
- the synthetic lipid-mimicking receptor that mimics phosphatidylcholine shown above inserted into a cell membrane binds C-reactive protein to induce cellular apoptosis.
- the present invention provides a method for stimulating an immune response against cells.
- stimulating an immune response means increasing the amount of a component of the immune system or the activity by which a component of the immune system is characterized, increasing the amount of a receptor present on the surface of an immune cell, or increasing the number of immune cells present in the mammal.
- the present invention provides a method for inducing apoptosis by contacting the synthetic lipid-mimicking receptor with a cell.
- the cell is a tumor cell.
- the following standard techniques can be used to measure the induction of apoptosis caused in a target cell after it is contacted with a synthetic lipid- mimicking receptor of the present invention.
- apoptosis can be examined or measured in a variety of ways including the detection of morphological indicia of apoptosis (e.g., membrane blebbing, chromatin condensation and fragmentation, and formation of apoptotic bodies), TUNEL (Terminal end-labeling of broken DNA fragments with labeled nucleotides ) staining, measuring of DNA laddering, measuring known caspase substrate degradation (e.g., PARP; Taylor et al, J. Neurochem. 68:1598-605, 1997) and counting dying cells, which have become susceptible to dye uptake.
- morphological indicia of apoptosis e.g., membrane blebbing, chromatin condensation and fragmentation, and formation of apoptotic bodies
- TUNEL Terminal end-labeling of broken DNA fragments with labeled nucleotides staining
- measuring of DNA laddering measuring known caspase substrate degradation (e.g., PARP; Taylor et al, J.
- kits useful for the measurement of apoptosis by various methods.
- the method of contacting the cell with a synthetic lipid-mimicking receptor, the amount of the synthetic lipid-mimicking receptor administered, the appropriate incubation time with the synthetic lipid-mimicking receptor are well known to those of ordinary skill in the art.
- known inhibitors of apoptotic pathways for instance caspase inhibitors, can be used to compare the effectiveness of synthetic lipid-mimicking receptors of this invention.
- Appropriate inhibitors include viral caspase inhibitors like crmA and baculovirus p35, and peptide-type caspase inhibitors including zVAD-fink, YVAD- and DEVD-type inhibitors. See Rubin, British Med. Bulle., 53:617-631, 1997.
- related synthetic receptors incorporating phosphoserine and phosphoethanolamine derivatives can be transported to the inner leaflet of cellular plasma membranes (or displayed on the cell surface, depending on the receptor structure) and by projecting target-binding, chelating, or mimicking groups into the extracellular environment or cellular cytoplasm can be useful for controlling cellular signal transduction, cellular proliferation, and other biological processes.
- the synthetic receptors of the present invention comprise a synthetic transmembrane receptor.
- the synthetic transmembrane receptor comprises at least two binding motifs and at least two membrane-binding elements.
- the synthetic transmembrane receptor comprises a binding motif linked to a first linker region that is in turn linked to a first membrane-binding element.
- the first membrane-binding element is linked to a second linker region linked to a second membrane-binding element which is linked to a third linker region.
- the third linker region is linked to a second binding motif.
- the binding motif comprises a small molecule, an oligonucleotide, a carbohydrate, a peptide, or a protein capable of binding noncovalently or covalently linked to a biomolecule, including a small molecule, an oligonucleotide, a carbohydrate, a peptide, a protein, or a drug.
- the binding motif includes but is not limited to a protein-binding motif, a drug-binding motif, a lipid-binding motif, or a metal-binding motif as described above. Suitable linker regions and membrane-binding elements for use with the synthetic receptors and synthetic transmembrane receptors of the present invention have been described above in detail.
- a synthetic transmembrane receptor of the present invention is shown below:
- n ⁇ and n 2 comprise 0 to 100 or more atoms
- the Linker comprises zero, one, or more linker functional groups such as amines, amides, carbamates, ureas, esters, or ethers. These functional groups can be linear or cyclic.
- the Lipid region is a natural or nonnatural phospholipid, sphingolipid, or sterol or derivative thereof.
- X 1 , X 2 , or X 3 Linker regions comprise 0 to 100 linker subunits such as natural or nonnatural alpha, beta, gamma, or delta amino acids as well as aminohexanoic acid and related structures with 0 to 100 or more atoms between the amine and the carboxylic acid.
- X 1 , X 2 , or X 3 Linker regions may comprise a fully saturated alkane of zero to 100 carbon atoms or an alkane of zero to 100 carbon atoms that includes one or more alkene or alkyne functional groups.
- the linker regions comprise zero, one or more groups selected from the following: alkane, alkene, alkyne, aryl, ketone, amine, amide, ester, ether, urea, carbamate, heterocyclic, and related functional groups in positions X 1 , X 2 , or X 3 .
- X 1 , X 2 , or X 3 linker regions may comprise 0 to 100 or more subunits such as alpha, beta, gamma, and delta amino acids as well as aminohexanoic acid and related structures with 0 to 100 or more atoms between the amine and carboxylic acid. These amino acid subunits may also include side-chains such as those found in natural L- and nonnatural D-configuration alpha amino acids or other amino acids.
- At least one binding motif is located intracellularly.
- the intracellular binding motif may bind or mimic proteins or or other biomolecules or bind or associate with cytoplasmic domains of other proteins, lipids, carbohydrates, or receptors known to activate various messenger systems.
- at least one binding motif is located extracellularly.
- the extracellular binding motif as described previously may bind noncovalently or be covalently linked to proteins, drugs, prodrugs, carbohydrates, nucleic acids, lipids or other biomolecules, including those associated with ligand binding and/or signal transduction.
- the synthetic transmembrane receptor may be part of a protein which is monomeric, homodimeric, heterodimeric, or associated with a larger number of proteins in a non-covalent or disulfide-bonded complex.
- the receptors of the present invention can be useful for modifying or mediating cellular signal transduction, proliferation, apoptosis, endocytosis, cellular transfection, and drug delivery.
- CTLs cytotoxic CD8+ T cells
- CTLs which have synthetic transmembrane receptors inserted to their cell membrane where the synthetic transmembrane receptors contain an extracellular binding domain which recognizes specific antigens can be used to augment proliferation and/or killing of infected cells in a variety of viral, and parasitic diseases, where the infected cells express the antigens from the pathogen.
- the membrane-binding element may be prepared by chemical synthesis. (See E. J. Corey. THE LOGIC OF CHEMICAL SYNTHESIS, Wiley-Interscience, New Ed edition (1995) and K. C. Nicolaou. CLASSICS IN TOTAL SYNTHESIS, Wiley- VCH (1996)) See also Examples section.
- the linker region may be prepared using standard techniques known to those skilled in the art or purchased from commercially available sources. See, for example, Thermo Electron Corporation, world wide web at thermo.com. A wide variety of linkers are known in the art for linking two molecules together, particularly, for linking a moiety such as cholesterylamine or its derivative to a peptide, all of which are included within the scope of the present invention.
- a cholesterylamine membrane-binding element may be synthesized as described above and then a linker added as an intact unit using standard techniques, for example, amide bond formation reactions or the linker may be sequentially added to the membrane-binding element using standard chemical synthesis methods, for example, using protecting groups such as trifluoro acetyl or Fmoc or Boc, and selective deprotection of a protecting group to couple the linker to the membrane-binding element.
- linkers examples include but are not limited to amino acids, such as those described in Boonyarattanakalin, S.; Martin, S. E.; Dykstra, S. A.; Peterson, B. R. /. Am. Chem. Soc. 2004, 126, 16379-16386.
- the determination of an appropriate linker that allows for cycling between the cell surface and the endosomes can be determined using the assays detailed in the present disclosure.
- linkers may influence receptor localization and ligand uptake efficiency which may be determined by performing standard assays including but not limited to fluorescence based assays, microscopy, flow cytometry to measure the amount of the synthetic receptor on the cell surface using an antibody directed against the protein-binding motif or an antibody directed against a protein bound by the synthetic receptor as described in Examples 6 and 22.
- the protein-binding domain may be prepared using standard techniques. Appropriate molecular biological techniques may be found in Maniatis and Sambrook et al, In Molecular Cloning: A Laboratory Manual, Cold Spring Harbor, N. Y., 1989.
- the protein binding domain can be prepared by chemical synthesis methods (such as solid phase peptide synthesis) using techniques known in the art such as those set forth by Merrifield et al., J. Am. Chem. Soc. 85:2149 (1964), Houghten et al., Proc. Natl. Acad. Sci. USA, 82:51:32 (1985), Stewart and Young (Solid phase peptide synthesis, Pierce Chem Co., Rockford, 111. (1984), and Creighton, 1983, Proteins: Structures and Molecular Principles, W. H. Freeman & Co., N. Y. herein incorporated by reference.
- the protein-binding motif can be coupled to the linker using standard techniques, including, for example, standard techniques such as amide bond formation reactions or the linker may be sequentially added to the membrane-binding element using standard chemical synthesis methods, for example, using protecting groups such as trifluoroacetyl or Fmoc or Boc, and selective deprotection of a protecting group, followed by addition of a coupling reagent, to couple the linker to the membrane-binding element.
- standard techniques including, for example, standard techniques such as amide bond formation reactions or the linker may be sequentially added to the membrane-binding element using standard chemical synthesis methods, for example, using protecting groups such as trifluoroacetyl or Fmoc or Boc, and selective deprotection of a protecting group, followed by addition of a coupling reagent, to couple the linker to the membrane-binding element.
- the protein-binding motif can bind known binding proteins, such as vancomycin, or used to identify new binding proteins or partners not yet identified.
- the synthetic receptor is allowed to contact the cell surface of a cell and fluorescence based assays or functional assays are used to detect proteins that bind to the protein-binding motif of the synthetic receptor inserted into the cell's membrane. See Examples 6 and 22. Protein-protein interactions between a protein and the protein binding motif of the synthetic receptor can be determined using two-hybrid systems (Field & Song, Nature 340:245-246 (1989); Chien et al., Proc. Natl. Acad. Sci.
- the receptors of the present invention When the receptors of the present invention are contacted with living mammalian cells, these receptors insert in the cellular plasma membrane, project the protein-binding motifs from the cell surface, bind the proteins and internalize them through endocytosis.
- the various forms of the term "contact”, “contacting”, “contacted”, etc. i.e., contacting a synthetic receptor with a cell
- incubating the synthetic receptor and the cell together in vitro e.g., adding the synthetic receptor to cells in culture
- administering the agent to a subject such that the synthetic receptor and cells of the subject are contacted in vivo. Any suitable method of contacting the synthetic receptor with cells may be used.
- the present invention also provides a method for delivering a protein, peptide, nucleic acid, or small molecule into a cell.
- the term "delivering” includes but is not limited to causing the protein to enter the cell.
- the method comprises contacting the synthetic receptors with the target cells.
- Target cells according to the invention is understood to include, without limitation, bacterial, fungal, plant, insect, avian, reptilian, amphibian, and mammalian cells, including human or animal cells. Any suitable duration of growth of the target cells of contacting of the target cells with a synthetic receptor may be used in the present invention.
- the synthetic cell surface receptors exhibit stability, dynamic cycling between the plasma membrane and intracellular endosomes, targeting of ligands to proposed cholesterol and sphingolipid-enriched lipid raft membrane microdomains, and delivery of protein or drug ligands to late endosomes/lysosomes. Therefore, the synthetic receptors with modified linker regions have potential as cellular probes, as they confer dramatic differences in subcellular localization, and would provide useful as probes for cellular mechanisms that regulate the segregation, localization, and sorting of membrane-associated biomolecules.
- the synthetic receptor conjugated to a label or tag with or without the linker region described previously or constructed as a tagged small molecule, fusion protein, peptide, nucleic acid, or carbohydrate can also be utilized as a tool for visualizing cellular or subcellular localization, such as labeling of the cellular plasma membrane, endosomes, or other subcellular compartments, and protein trafficking or cycling from the cell surface to the endosome.
- the synthetic receptor conjugated to a fluorophore or otherwise tagged or labeled or a synthetic receptor analog can also be used to track or analyze cells in vitro or in vivo.
- synthetic receptors conjugated to a fluorophore such as fluorescein or fluorescein analogues may be added to cells ex vivo and administered to a recipient.
- synthetic receptor conjugated to a fluorophore can be inserted into a cell or cell population and detected using standard techniques known to one skilled in the art, including for example, flow cytometry, fluorescence activated cell sorting, fluorescence microscopy, and other histological methods.
- the synthetic receptors can be labeled with a detectable moiety. Detection of a synthetic receptor of the present invention can be facilitated by coupling (i.e., physically linking) the synthetic receptor to a detectable moiety.
- detectable moieties include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials.
- suitable enzymes include horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase;
- suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin;
- suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin;
- an example of a luminescent material includes luminol;
- examples of bioluminescent materials include luciferase, luciferin, and aequorin, and examples of suitable radioactive material include I 125 , 1 131 , S 35 or H 3 .
- the detectable moiety should be capable of producing, either directly or indirectly, a detectable signal. Any method known in the art for conjugating the synthetic receptor to the detectable moiety may be employed, including those methods described by Hunter et al., Nature, 144:945 (1962); David et al., Biochemistry, 13:1014 (1974); Pain et al., J. Immunol. Meth., 40:219 (1981); and Nygren, J. Histochem. and Cytochem., 30:407 (1982).
- the synthetic receptor comprises a tag polypeptide which provides an epitope to which an anti-tag antibody can selectively bind.
- the epitope tag may be placed at the amino- or carboxyl-terminus of the synthetic receptor.
- epitope-tagged forms of the synthetic receptor can be detected using an antibody against the tag polypeptide.
- provision of the epitope tag enables the synthetic receptor to be readily purified by affinity purification using an anti-tag antibody or another type of affinity matrix that binds to the epitope tag.
- tag polypeptides and their respective antibodies are well known in the art. Examples include poly-histidine (poly-his) or poly-histidine-glycine (poly-his-gly) tags; the flu HA tag polypeptide and its antibody 12CA5 [Field et al., MoI. Cell.
- tag polypeptides include the Flag-peptide [Hopp et al., BioTechnology, 6:1204-1210 (1988)]; the KT3 epitope peptide [Martin et al., Science, 255:192-194 (1992)]; an ⁇ -tubulin epitope peptide [Skinner et al., J. Biol. Chem., 266:15163-15166 (1991)]; and the T7 gene 10 protein peptide tag [Lutz-Freyermuth et al., Proc. Natl. Acad. ScL USA, 87:6393-6397 (1990)].
- synthetic cellular receptors may be used as mechanistic probes.
- the probe is a fluorescent analog of a synthetic receptor.
- These fluorescent analogs may contain diverse fluorophores, including for example, without limitation, NBD, fluorescein and its derivatives, for example, the red- shifted hexachlorofluorescein, texas red, rhodamine, coumarin derivatives, Cy3, AlexaFluor dyes, and fluorescent quantum dots.
- the invention also relates to a method for delivering in vitro, ex vivo or in vivo at least one protein into target cells according to which the cell is brought into contact with a synthetic receptor bound to a protein according to the invention.
- the present invention provides a method of treating a disease, disorder, or condition comprising administering a therapeutically effective amount of a protein into a target cell using a synthetic cell receptor to a subject in need thereof.
- the synthetic receptor for delivering a protein into a cell comprises a protein-binding motif and a membrane-binding element.
- the membrane-binding element may include, for example, cholesterylamine, dihydrocholesterylamine, ergosterylamine, derivatives of cholesterylamine, dihydrocholesterylamine, ergosterylamine and related compounds thereof wherein the element anchors the receptor into a cell plasma membrane.
- terapéuticaally effective amount refers to an amount that is effective in reducing, eliminating, treating, preventing or controlling the symptoms of diseases and conditions.
- controlling is intended to refer to all processes wherein there may be a slowing, interrupting, arresting, or stopping of the progression of the diseases and conditions described herein, but does not necessarily indicate a total elimination of all disease and condition symptoms, and is intended to include prophylactic treatment.
- the method additionally comprises a synthetic receptor as described above and pharmaceutically acceptable carrier.
- Pharmaceutically acceptable carriers are generally added that are compatible with the active ingredients and acceptable for pharmaceutical use. Combinations of carriers may also be used.
- Pharmaceutically acceptable carriers include but are not limited to cyclodextrins, Low-Density Lipoprotein (LDL), and High-Density Lipoprotein (HDL).
- LDL Low-Density Lipoprotein
- HDL High-Density Lipoprotein
- a pharmaceutical composition for treating a disease, disorder, or condition comprises a pharmaceutically acceptable carrier and a synthetic cell receptor for delivering a protein into a cell where the receptor comprises a protein-or target-binding motif and a membrane-binding element.
- the membrane-binding element may include cholesterylamine, dihydrocholesterylamine, ergosterylamine, derivatives of cholesterylamine, dihydrocholesterylamine, ergosterylamine and related compounds thereof to anchor into a cell plasma membrane.
- the synthetic receptor bound to a protein according to the invention can be used to treat a disease, disorder, or condition, or as a prophylactic.
- the subject of the invention may be used in enzyme replacement therapy or to treat a variety of diseases, disorders, or conditions, including without limitation, viral, yeast, and bacterial infections, cancer, inflammation, and autoimmune diseases.
- the synthetic receptors may be used to deliver an enzyme to a cell in need of the enzyme replacement therapy.
- treating refers to: (i) preventing a disease, disorder or condition from occurring in an animal or human that may be predisposed to the disease, disorder and/or condition but has not yet been diagnosed as having it; (ii) inhibiting the disease, disorder or condition, i.e., arresting its development; and/or (iii) relieving the disease, disorder or condition, i.e., causing regression of the disease, disorder and/or condition.
- synthetic receptors may be employed to deliver proteins, peptides, or small molecules that inhibit viruses that replicate in the cytoplasm.
- proteins include, for example, nucleic acid aptamers or antibodies that bind proteins important in viral life cycles.
- viruses that replicate in the cytoplasm belong to the families: Picornaviridae, Caliciviridae, Togaviridae, Flaviviridae, Coronaviridae, Paramyxoviridae, Reoviridae, Bunyaviridae, Arenaviridae, Paramyxoviridae, Rhabdoviridae, Poxviridae, and Hepadnaviridae. This is important since many viruses do not have vaccines to provide immunity. Thus, the present invention offers new prospects for applications as tools for drug delivery.
- the present inventors have found a method for treating microbes that elude antibiotics and related glycopeptide antibiotics administered in a traditional manner.
- Listeria moncytogenes L. monocytogenes
- the present inventors have found that the present invention may be used to deliver vancomycin, a glycopeptide antibiotic, and/or other related glycopeptide antibiotics into the cytoplasm of cells infected with L. moncytogenes.
- the present inventors treated non-infected mammalian cells with a synthetic receptor containing an enhanced vancomycin-binding motif linked to 3 ⁇ -cholesterylamine.
- the synthetic receptor bound the vancomycin derivative, underwent endocytosis, released the vancomycin derivative in the endosome/lysosome where it was degraded, allowing the synthetic receptor to recycle to the cell surface to recommence the delivery process.
- the endosome/lysosome in particular, the protein is released from the synthetic receptor.
- the pathogen secretes membrane- disruptive proteins that disrupt the integrity of the endosome so that the pathogen can escape from the endosome and replicate in the cytoplasm.
- the present invention capitalizes on this event so that when the synthetic receptor bound with vancomycin undergoes endocytosis, the vancomycin is delivered to the endosome, but escapes into the cytoplasm using the same route that the pathogen created. In this way, the antibiotic is able to encounter and bind L. monocytogenes, inhibiting the construction of the bacterial cell walls. Therefore, in another aspect, once the protein-bound synthetic receptor has entered the cell, the protein is released from the synthetic receptor and may enter the cytoplasm. The receptor is then free to recycle to the cell surface for additional rounds of delivery. Therefore, in one aspect of the present invention, the synthetic receptors have bacteriocidal or bacteriostatic effects as shown in viability assays. Examples 15-19.
- these synthetic receptors with modified linker regions have unlimited potential to treat bacteria and viruses.
- the present inventors have identified a composition and method that effectively enhances the delivery of poorly permeable antibiotics, such as vancomycin or teicoplanin, to cells.
- This invention will provide an effective tool for the war on drug-resistant bacteria. Once internalized, the drug can accumulate within the cells where it has a therapeutic effect. Not only does the current invention deliver an antibiotic to the pathogenic replicative source but also does so in an efficient manner using any "custom-designed" binding motif.
- the synthetic receptor contains an enhanced binding motif for vancomycin, resulting in improved affinity for the antibiotic.
- a synthetic receptor having an ergosterol-derived membrane-binding element can be used to treat bacteria or yeast infections in a subject.
- the method comprises contacting a synthetic receptor with yeast or bacterial cells in vitro or in vivo, causing the synthetic receptor to insert into the cells' membranes, so that the yeast or bacterial cells displaying the synthetic receptors in vivo, for example, in a mammal, would be recognized as foreign by the mammal's immune system and destroyed.
- a synthetic receptor having an ergosterol-derived or brassicasterol-derived membrane -binding element can be used as probe in avian, reptilian, amphibian, insect, yeast, bacterial, or plant cells.
- synthetic receptors may be used to modulate therapeutically important extracellular ligands.
- These ligands include but are not limited to cytokines, growth factors, hormones, antibodies, and angiogenic factors. These ligands are secreted by a number of cells and act through cell surface receptors to elicit biochemical responses in their target cells, such as cell differentiation and proliferation.
- the present invention contemplates the removal of extra-cellular ligands from circulation in physiological fluids, including, for example, blood, using synthetic receptors. Receptors displaying the desired ligand-binding motif would bind the cognate ligand, deliver the ligand to the endosome, where it would be released and degraded.
- the receptor would then be recycled back to the surface to bind and remove more ligands from circulation. This has been demonstrated by removal of antibodies from cell culture media using synthetic receptors bearing antibody-binding motifs. Therefore, use of the present invention to remove targeted ligands from circulation would allow for the modulation of the immune response, cellular proliferation such as cancer proliferation, or cellular differentiation.
- modulating of the immune response means increasing or decreasing either the amount of a component of the immune system or the activity by which a component of the immune system is characterized, increasing or decreasing the amount of receptor present on the surface of an immune cell, or increasing or decreasing the number of immune cells present in the mammal. In the context of the use of a method of treatment in vivo according to the present invention, it is, in addition, a treatment designed deplete a patient of a particular protein.
- the synthetic receptors may be used to treat cancer.
- Many tumor cells do not express the necessary cell surface receptor to "take in" anti-cancer drugs or express the cell surface receptor at insufficient levels.
- the drug can still be delivered.
- cancer cells may become resistant to methotrexate by stopping production of the folate receptors.
- synthetic folate receptors can be expressed on the surface of tumor cells.
- the protein-binding motif of the synthetic folate receptor can then bind the anti-cancer drug methotrexate and undergo receptor-mediated endocytosis, thereby inhibiting the enzyme dihydrofolate reductase.
- Calixarenes can be prepared by those skilled in the art to bind the vascular epidermal growth factor (VEGF), platelet-derived growth factor (PDGF), and other proteins. These compounds could be used to remove these and related cancer-promoting growth factors from circulation to stop tumor growth or conversely could be used to activate receptors for these proteins by promoting the association of growth factors with cell surfaces.
- VEGF vascular epidermal growth factor
- PDGF platelet-derived growth factor
- Cyclic peptides can be prepared by those skilled in the art to bind immunoglobulins and other proteins. This would allow for modulation the immune system by promoting the endocytic destruction of antibodies such as antibodies involved in autoimmune diseases such as lupus and pemphigus.
- cysteine-disulfide constrained cyclic peptides containing the sequence DCAWHLGELVWCT exhibit high affinity for the hinge region of human immunoglobulins.
- Other cyclic peptides can be identified by techniques such as phage display that bind to specific proteins.
- the effective dose and method of administration of a particular synthetic receptor thereof can vary based on the individual needs of the patient and the treatment or preventative measure sought.
- Therapeutic efficacy and toxicity of such compounds can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., ED50 (the dose therapeutically effective in 50% of the population).
- the synthetic receptors discussed above can be administered to the mice and the effect on certain tissues or cells can be determined using histology, flow cytometry, ELISA and other assays. The data obtained from these assays is then used in formulating a range of dosage for use with other organisms, including humans. The dosage varies within this range depending upon type of synthetic receptor or binding protein, the dosage form employed, sensitivity of the organism, and the route of administration.
- Normal dosage amounts of various synthetic receptors can vary from approximately 1 to 100,000 micrograms, up to a total dose of about 10 grams, depending upon the route of administration.
- a constant infusion of the synthetic receptors can also be provided so as to maintain a stable concentration in the tissues as measured by blood levels.
- the exact dosage is chosen by the individual physician in view of the patient to be treated. Dosage and administration are adjusted to provide sufficient levels of the active moiety or to maintain the desired effect. Additional factors that can be taken into account include the severity of the disease, age of the organism, and weight or size of the organism; diet, time and frequency of administration, drug combination(s), reaction sensitivities, and tolerance/response to therapy.
- Synthetic receptors may be administered hourly, daily, weekly, monthly or as needed.
- Routes of administration of the synthetic receptors of the invention include, but are not limited to, topical, transdermal, parenteral, gastrointestinal, transbronchial, and transalveolar.
- Transdermal administration is accomplished by application of a cream, rinse, gel, etc. capable of allowing the pharmacologically active compounds to penetrate the skin.
- Parenteral routes of administration include, but are not limited to, electrical or direct injection such as direct injection into a central venous line, intravenous, intramuscular, intraperitoneal, intradermal, or subcutaneous injection.
- Gastrointestinal routes of administration include, but are not limited to, ingestion and rectal.
- Transbronchial and transalveolar routes of administration include, but are not limited to, inhalation, either via the mouth or intranasally.
- Synthetic receptors of this invention that are suitable for transdermal or topical administration include, but are not limited to, pharmaceutically acceptable suspensions, oils, creams, and ointments applied directly to the skin or incorporated into a protective carrier such as a transdermal device ("transdermal patch").
- a transdermal device such as a transdermal device ("transdermal patch").
- suitable creams, ointments, etc. can be found, for instance, in the Physician's Desk Reference.
- suitable transdermal devices are described, for instance, in U.S. Pat. No. 4,818,540 issued Apr. 4, 1989 to Chinen, et al., herein incorporated by reference.
- Synthetic receptors of this invention that are suitable for parenteral administration include, but are not limited to, pharmaceutically acceptable sterile isotonic solutions.
- Such solutions include, but are not limited to, saline and phosphate buffered saline for injection into a central venous line, intravenous, intramuscular, intraperitoneal, intradermal, or subcutaneous injection.
- Synthetic receptors of this invention that are suitable for transbronchial and transalveolar administration include, but not limited to, various types of aerosols for inhalation.
- Devices suitable for transbronchial and transalveolar administration of these are also embodiments.
- Such devices include, but are not limited to, atomizers and vaporizers. Many forms of currently available atomizers and vaporizers can be readily adapted to deliver compositions having the pharmacologically active compounds of the invention.
- Synthetic receptors of this invention that are suitable for gastrointestinal administration include, but not limited to, pharmaceutically acceptable powders, pills or liquids for ingestion and suppositories for rectal administration. Once the synthetic receptors has been obtained, it can be administered to a organism in need to treat or prevent a disease, disorder, or condition.
- the synthetic receptors according to the present invention can be administered orally, by subcutaneous or other injection, intravenously, intracerebrally, intramuscularly, parenternally, transdermally, nasally or rectally.
- the appropriate route of administration and dosage vary according to various parameters, for example the individual or disease to be treated or alternatively the polynucleotide to be transferred.
- the form in which the synthetic receptor is administered depends at least in part on the route by which the synthetic receptor is administered.
- the synthetic receptors described according to the present invention comprise a membrane-binding element linked to a protein-binding or other binding group in order to provide a novel mechanism for receptor-mediated endocytosis of the synthetic receptor and bound ligands.
- the membrane-binding element is preferably cholesterol, dihydrocholesterol, ergosterol, brassicasterol, or derivatives of cholesterol, dihydrocholesterol, ergosterol, brassicasterol, and related compounds thereof.
- the membrane-binding element according to the present invention may preferably be derived from the inexpensive and readily available source of cholesterol.
- cholesterol is derived to form the cholesterol derivatives 3 ⁇ -amino-5-cholestene, and related 3 ⁇ -halides, including 3 ⁇ -chloro-5-cholestene, 3 ⁇ -bromo-5-cholestene and 3 ⁇ -iodo-5-cholestene.
- the present invention relates to the use of regiospecific, stereoselective and stereo specific sequential i-steroid and retro-j-steroid rearrangements for the synthesis of 3 ⁇ -amino-5-cholestene, 3 ⁇ -chloro-5-cholestene, 3 ⁇ -bromo-5-cholestene, and 3 ⁇ -iodo-5- cholestene from cholesterol.
- the w-alkyl derivatives of 3 ⁇ -amino-5-cholestene are preferably selected for the ability to insert into plasma membranes of living mammalian cells and cycle between the cell surface and early/recycling endosomes, mimicking the membrane trafficking of many cell surface receptors, and/or delivering molecules directly to the cytosol and nucleus of cells when linked to endosome disruptive peptides. See Peterson, B., Org. Biomol. Chem. 2005, 3, 3607-3612; Sun et al, J. Am. Chem. Soc. 2008, 130, 10064-10065.
- the methods for synthesizing membrane-binding elements that are 3 ⁇ -amino-5- cholestene, and related 3 ⁇ -halides may comprise synthesizing 3 ⁇ -azido-5-cholestene by Vorbruggen-type coupling of electrophilic cholesterol derivatives.
- the synthesis comprises reacting cholesterol or a cholesterol bearing a leaving group at the 3-position (including for example, cholesterol triflate, cholesterol mesylate, cholesterol tosylate or cholesteryl esters) with a Lewis acid in the presence of an azide.
- a Lewis acid catalyst may further be utilized at a temperature between minus 150 0 C to plus 200 0 C to obtain a reaction mixture containing 3 ⁇ -azido-5-cholestene.
- a preferred Lewis acid catalyst is boron trifluoride.
- Lewis acid may include for example, boron trifluoride, tin tetrachloride, aluminum trichloride, titanium tetrachloride, trimethylsilyl triflate, BBr 3 , SnCl 4 , ZnCl 2 , MgCl 2 , or MgBr 2 Et 2 O or any salt thereof.
- azide refers to any compound or derivative having the N 3 " ; moiety therein, including azide derivatives or salts thereof.
- the azide can be a silyl azide such as trimethylsilyl azide or a metal azide wherein the metal is an alkali metal such as potassium, sodium, lithium, rubidium or cesium.
- the metal can be a transition metal such as, but not limited to, iron, cobalt, nickel, copper or zinc.
- the azide of the present invention can also be an organic azide or ammonium azide.
- the 3 ⁇ -azido-5-cholestene (3) produced from the reaction with the Lewis acid and azide is next reacted with a reducing agent in a solvent to produce the desired 3 ⁇ -amino-5-cholestene or related 3 ⁇ -halide.
- a reducing agent in a solvent to produce the desired 3 ⁇ -amino-5-cholestene or related 3 ⁇ -halide.
- various reducing agents and solvents may be utilized.
- Preferred reducing agents according to the synthesis methods described herein are lithium aluminium hydride or catalytic hydrogenation.
- the solvent used for the synthesis methods is dichloromethane.
- benzene or chloroform may be utilized.
- the solvent utilized does not result in diminishing the yield of the 3 ⁇ -azido-5- cholestene or related 3 ⁇ -halides.
- Solvents having heteroatoms that function as Lewis bases including for example, tetrahydrofuran, acetone, diethyl ether, or DMF, are not preferred solvents according to the invention.
- One skilled in the art may ascertain additional solvents that may be utilized according to the present invention.
- the reaction time for synthesis according to the invention may vary from a few minutes to 18 hours, preferably from 2 hours to 12 hours. The synthesis reactions preferably occur at ambient temperature.
- the methods of synthesis described herein provide high yields of the 3 ⁇ -amino-5- cholestene and related 3 ⁇ -halides for membrane -binding elements for use with the synthetic receptor according to the invention.
- the Lewis acid BF3*OEt 2 provides optimal yields of 3 ⁇ -azido-5-cholestene.
- yields of 3 ⁇ -azido-5-cholestene in excess of 90%, 91%, 92%, 93%, 94%, 95% and 96% may be observed.
- use of varying Lewis acids result in the synthesis of alterative related 3 ⁇ - halides.
- SnCl 4 , TiCl 4 , and AlCl 3 preferrably generate 3 ⁇ -chloro-5- cholestene.
- yields of 3 ⁇ -amino-5-cholestene and the related 3 ⁇ -halides for use as membrane-binding elements according to the invention exceed at least about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95% and 96%.
- i- steroid and retro-j- steroid rearrangements are promoted by a Lewis acid to synthesize the halides.
- the Lewis acid converts the cholesterol derivative to a homoallylic carbocation that rapidly undergoes i-steroid rearrangement and/or retro-j- steroid rearrangement (Fig. 28).
- i-steroid rearrangement and/or retro-j- steroid rearrangement Fig. 28.
- These novel synthesis methods are highly efficient, demonstrating high retention of 3 ⁇ -stereochemistry configurations in high yields as a result of the non-classical carbocation forming a partial bond between C5 and C3 only on the alpha face of the steroid. Accordingly, the synthesis methods may be utilized for large-scale preparation of such halides with 3 ⁇ - stereochemistry, demonstrating significant improvement over the substitution reactions of cholesterol and derivatives which result in poor stereoselectivity, elimination, and rearrangement.
- Embodiments of the present invention are further defined in the following non- limiting Examples. While the present invention is disclosed with reference to embodiments and examples detailed above, it is to be understood that these examples are intended in an illustrative rather than limiting sense, as it is contemplated that modifications will readily occur to those skilled in the art, which modifications will be within the spirit of the invention and the scope of the appended claims. From the above discussion and these Examples, one skilled in the art can ascertain the essential characteristics of this invention, and without departing from the spirit and scope thereof, can make various changes and modifications of the embodiments of the invention to adapt it to various usages and conditions.
- EXAMPLE 1 Design and Synthesis of Receptors for Anti-DNP IgG Ligands.
- the numbered receptors in examples 1-14 refer to those shown in Figures 1-13 and in examples 1-14.
- Synthetic receptors were designed that incorporate 2,4-dinitrophenyl (DNP) and structurally similar green fluorescent 7-nitrobenz-2-oxa-l,3-diazole (NBD) headgroups. These headgroups were linked to N-alkyl and N-acyl derivatives of 3 ⁇ - cholesterylamine via tethers containing 6-aminohexanoic acid and ⁇ -alanine subunits as seen in FIG. 1.
- DNP 2,4-dinitrophenyl
- NBD green fluorescent 7-nitrobenz-2-oxa-l,3-diazole
- EXAMPLE 3 Scheme Showing the Synthesis of 3 ⁇ -Cholesterylamine and Derivatives from Cholesterol.
- Reagents and conditions (a) MsCl, DIEA, CH 2 Cl 2 , 4°C; (b) BF3 etherate, TMSN 3 , CH 2 Cl 2 ; (c) LiAlH 4 , ether, 4°C; (d) 3-bromopropyl phthalimide, K 2 CO 3 , DMF, 55°C; (e) (Boc)2O, DIEA, CH 2 Cl 2 ; (f) NH 2 NH 2 , EtOH, 50 0 C; (g) ethyl 5-bromovalerate, K 2 CO 3, 6O 0 C; (h) (BoC) 2 O, CH 2 Cl 2 ; (i) LiOH, MeOH, THF.
- the present inventors have discovered a novel method for synthesis of 3 ⁇ -azido-5- cholestene by Vorbruggen-type coupling of electrophilic cholesterol derivatives (shown as step b in the above scheme).
- the method for synthesis of 3 ⁇ -azido-5- cholestene by Vorbruggen-type coupling of electrophilic cholesterol derivatives comprises reacting cholesterol or a cholesterol bearing a leaving group at the 3-position, for example, cholesterol triflate, cholesterol mesylate, cholesterol tosylate or cholesteryl esters, with a Lewis acid, for example, boron trifluoride etherate, in the presence of an azide, for example, a silyl azide such as trimethylsilyl azide, at a temperature between minus 150 0 C to plus 200 0 C and a Lewis acid catalyst to obtain a reaction mixture containing 3 ⁇ -azido-5- cholestene.
- a Lewis acid for example, boron trifluoride etherate
- the present inventors have discovered a novel method for synthesis of N-[3- (phthalimido)propyl]-N-cholesterylamine by SN2 reaction of cholesterylamine with an electrophile (shown as step d in the above scheme).
- the method for synthesis of N-[3-(phthalimido)propyl]-N-cholesterylamine by SN2 reaction of cholesterylamine with an electrophile comprises reacting cholesterylamine with 3-bromopropyl phthalimide, K 2 CO 3 , and DMF at a temperature between -78°C and 250 0 C.
- the present inventors have discovered a novel method for synthesis of N-[3- (phthalimido)propyl]-N-(t-butyloxycarbonyl)-3 ⁇ -cholesterylamine by nucleophilic acyl substitution of N-[3-(phthalimido)propyl]-3 ⁇ -cholesterylamine (shown as step e in the above scheme).
- the method for synthesis of N-[3-(phthalimido)propyl]-N-(t- butyloxycarbonyl)-cholesterylamine by nucleophilic acyl substitution of N-[3- (phthalimido)propyl]-N-cholesterylamine comprises reacting N-[3-(phthalimido)propyl]- N-cholesterylamine with (Boc)2O, DIEA, CH 2 Cl 2 .
- the present inventors have discovered a novel method for synthesis of ethyl 5-
- the method for synthesis of ethyl 5- ⁇ (tert-butoxycarbonyl)[(3beta)-cholest-5-en-3-yl] amino ⁇ pentanoate (3) comprises adding to DMF (10 mL) 3 ⁇ -amino-5-cholestene (2, 386 mg, 1.0 mmol), ethyl 5 -bromo valerate (174 microL, 1.1 mmol) and K2CO3 (276 mg, 2.0 mmol), heating the solution to 60 0 C, stirring the solution for 24 hours, cooling the reaction to 23°C, removing the DMF in vacuo to generate a solid residue, adding CH 2 Cl 2 (10 mL) to the resulting solid residue, removing insoluble salts from residue by filtration, and washing the solids with additional CH 2 Cl 2 (5 niL) to generate a
- Lewis acids may be used in these synthesis methods as exemplified in Table 1.
- Additional Lewis acids that may be used according to the invention include, without limitation, boron trifluoride, tin tetrachloride, aluminum trichloride, titanium tetrachloride or trimethylsilyl triflate, BBr 3 , SnCl 4 , ZnCl 2 , MgCl 2 , or MgBr 2 Et 2 O.
- Table 1 Varying Lewis Acids entry substrate Lewis acid reaction yield (%) conditions 1 M 3b% SnCl 4 -20 0 C, 1 h to 54 (3); 36
- Table 2 summarizes the effect of the leaving group on the reactivity of 3 ⁇ - cholesterol derivatives. Reactions were run on a 1 mmol scale in anhydrous CH 2 Cl 2 containing TMSN 3 (1.1 equiv). Recovery of starting material (4) is additionally shown in entry 2. NR indicates no reaction was observed.
- EXAMPLE 4 Construction of Synthetic Receptors.
- Various synthetic receptors were constructed by modifying a 3 ⁇ -cholesterylamine as shown in Example 3 above. Cholesterol may alternatively be modified to become a nosyl-protected 3 ⁇ - cholesterylamine via a Swern oxidation, reduction to epicholesterol, and synthesis of 3beta-azido-5-cholestene via Mitsunobu reaction with hydrazoic acid.
- the compound underwent further modification to become a receptor by reduction, protection as a nosyl sulfonamide, and use of Fukuyama's amine synthesis methodology and/or deprotection and sequential amide bond formation reactions.
- EXAMPLE 5 General. Chemical reagents were obtained from Acros, Aldrich, Alfa Aesar, or TCI America. Solvents were from EM Science. Media and antibiotics were purchased from Gibco BRL. Cholera toxin B subunit-Alexa Fluor 488 (CT-B-AF488), Transferrin-Alexa Fluor-488, Protein A Alexa Fluor 488 (PrA- AF488), Protein A Alexa Fluor 594 (PrA- AF594), Protein A Alexa Fluor 633 (PrA- AF633), and BODIPY TR ceramide were from Molecular Probes. Rabbit polyclonal antidinitrophenyl (anti-DNP) IgG was from Sigma.
- Flash column chromatography employed ICN SiliTech Silica Gel (32-63 ⁇ m).
- Infrared spectra were obtained with a Perkin Elmer 1600 Series FTIR.
- NMR spectra were obtained with Bruker AMX-360, DRX-400, or AMX-2-500 instruments with chemical shifts reported in parts per million (ppm, ⁇ ) referenced to either CDCl 3 ( 1 H 7.27 ppm; 13 C 77.23 ppm), DMSOd 6 ( 1 H 2.50 ppm; 13 C 39.51 ppm), or (CH 3 ) 4 Si.
- High-resolution mass spectra were obtained from the University of Texas at Austin Mass Spectrometry Facility (ESI and CI). Peaks are reported as m/z.
- the organic layer was separated and the aqueous layer was extracted with diethyl ether (60 mL x 2). The organic layers were combined, washed with deionized water (100 mL), dried over anhydrous Na 2 SO 4 and concentrated under reduced pressure to give the crude product as light yellow solid.
- 3 ⁇ -Amino-5-cholestene A solution of 3 ⁇ -azido-5-cholestene (6.18 g, 15.0 mmol) in anhydrous diethyl ether (100 mL) was cooled to 4 0 C by ice-water bath. To this solution, LiAlH 4 (855 mg, 22.5mmol) was added in four equal portions. The reaction was maintained at 4 0 C for 30 min, warmed to 22 0 C and stirred for 2 h. When the starting material disappeared by TLC analysis (hexanes), the reaction was cooled to 4 0 C and carefully quenched by slow drop wise addition of cold deionized water (10 mL).
- N-cholesteryl-2-nitrobenzenesulfonamide (15). To 3 ⁇ -azido-5-cholestene (14, 3.30 g, 8.02 mmol) in dry diethyl ether (150 mL) at 4 0 C was added lithium aluminum hydride
- This aminosteroid was dissolved in dry THF (150 rnL), and diisopropylethylamine (2.61 rnL, 15.03 mmol) was added.
- 2-Nitrobenzenesulfonyl chloride (2.20 g, 9.92 mmol) in dry THF (40 mL) was added by addition funnel over 30 min. After 2 h at 23 0 C, solvents were removed in vacuo, CH 2 Cl 2 was added (75 mL), and this organic solution was washed with aqueous NaHCO 3 (10%, 1 x 100 mL) and saturated aqueous NaCl (2 x 100 mL).
- N-[3-(tert-butoxycarbonylamino)propyl]-N-cholesteryl-2-nitrobenzenesulfonamide (16).
- iV-cholesteryl-2-nitrobenzenesulfonamide (15, 3.50 g, 6.14 mmol)
- potassium carbonate (12.50 g, 90.44 mmol)
- Boc-3-chloropropylamine (2.50 g, 12.91 mmol, prepared as previously reported 5 ) were added to dimethylacetamide (200 mL). This mixture was heated to 12O 0 C for 20 h. The reaction was filtered to remove excess potassium carbonate and the solvent was removed in vacuo.
- N- [3-(te/t-butoxycarbonylamino) propyl]- ⁇ f-cholesteryl-2-nitrobenzenesulfonamide (16, 38 mg, 0.053 mmol) was treated with trifluoroacetic acid in CH 2 Cl 2 (2:25, 10 mL). After 2 h at 23 0 C, TLC analysis (MeOH / CH 2 Cl 2 , 1:50) revealed conversion to the more polar primary amine.
- CI m/z 1093.4837 (MH + , C 60 H 70 F 2 N 4 O 11 S requires 1093.4809).
- N- ⁇ 3-[5-fluoresceinisothiourea]propyl-6-[(2,4- dinitrophenyl)amino]hexanamide (27).
- EXAMPLE 6 Biological Assays.
- Jurkat lymphocytes acute T-cell leukemia, ATCC #TIB-152
- RPMI 1640 media supplemented with Fetal Bovine Serum (FBS, 10%), penicillin (100 units / mL), and streptomycin (100 ⁇ g / mL).
- FBS Fetal Bovine Serum
- penicillin 100 units / mL
- streptomycin 100 ⁇ g / mL
- RPMI media used for cell culture and wash steps contained antibiotics and FBS unless otherwise noted.
- OPTI-MEM media employed for transfection was not supplemented with FBS or antibiotics.
- Epifluorescence micrographs were captured through a Zeiss Fluar (100 X) objective by a Zeiss Axiocam digital camera interfaced to a Zeiss Axiovert SlOOTV microscope. Fluorophores were excited with FITC/Bodipy (Ex. 480/40, Em. 535/50) or Texas Red (Ex. 560/55, Em. 645/75) filter sets (Chroma). Images were processed with Adobe Photoshop 7.0.
- Flow cytometry Analyses were performed with Beckman-Coulter XL-MCL bench-top and EPICS Elite flow cytometers. Forward- scatter (FS) and side-scatter (SSC) dot plots afforded cellular physical properties of size and granularity that allowed gating of live cells. After gating, 10,000 cells were counted.
- FS Forward- scatter
- SSC side-scatter
- AF-488 was excited at 488 nm with a 15 mW air- cooled argon-ion laser, the emission was split with a 550 nm dichroic and filtered through a 510 nm long pass filter and 530/30-nm band pass filter using the XL-MCL cytometer.
- the PMT voltage for this instrument was set to 724 for detection of AF488.
- Calibration with Sphere Rainbow Calibration particles (Spherotech) bearing 330,000 molecules of fluorescein/particle provided a fluorescence of 15.6 at this voltage.
- treated cells Prior to analysis, treated cells were washed with media (0.5 mL), washed again with media containing 6-(2,4- dinitrophenyl)aminohexanoic acid (100 ⁇ M, 3 x 0.5 mL x 20 min, 1% DMSO) to compete away any non-internalized protein, washed again with media (0.5 mL), and resuspended in media (0.6 mL) for analysis by epifluorescence microscopy, confocal microscopy, or flow cytometry.
- Jurkat lymphocytes were subjected to the antibody uptake assay (cells were treated with receptors 2 - 5 at 10 ⁇ M for 1 h followed by addition of a pre-equilibrated complex (preincubated at 23 0 C for 1 h) of anti-DNP-IgG / PrA- AF488 for 15 min to 4 h) and internalized cellular fluorescence was quantified by flow cytometry. Doubling the concentration of pre-equilibrated anti-DNP-IgG / PrA-AF488 did not affect the rate or magnitude of uptake (data not shown), indicating that synthetic receptors were saturated under these conditions.
- the rate constant and the ligand internalization half-life shown on the right of Figure 8C were determined by treatment of Jurkat lymphocytes (in RPMI media, 500 ⁇ L) with receptor 2 (1 ⁇ M) for 1 h at 37 0 C. These cells were washed with ice-cold media (500 ⁇ L) and maintained at 4 0 C. A pre-equilibrated (1 h at 23 0 C) ice-cold solution of RPMI media (100 ⁇ L) containing anti-DNP-IgG (7.2 ⁇ g) and PrA-AF488 (2 ⁇ g) was added. After 1 h at 4 0 C, the cells were washed with ice-cold RPMI media (2 x 500 ⁇ L).
- Intracellular fluorescence was quantified by flow cytometry.
- Jurkat lymphocytes (4 x 10 6 ) were suspended in media (2 mL, 1% DMSO) containing receptor 6 (10 ⁇ M) and incubated for 1 h at 37 0 C. Cells were washed with media (2 x 2 mL), and cooled on ice (2 min) to block plasma membrane recycling. Ice-cold media containing sodium dithionite (30 mM, 1 mL) was added and the cells were maintained at 4 0 C for 5 min to irreversibly quench cell surface fluorophores.
- PrA633 (2 ⁇ g) in phosphate buffered saline (PBS, 8 ⁇ L, pH 7.4) was added to tubes A and C.
- PBS 8 ⁇ L, pH 7.4 was added to tubes B and D as control experiments.
- the four tubes were maintained at 4 0 C for an additional 15 min, washed with ice-cold serum free recycling media (1 mL), resuspended in ice-cold serum free recycling media (1 mL), and the fluorescence of bound anti-DNP/PrA-AF633 was analyzed by flow cytometry.
- the background fluorescence of cells in tubes B and D was subtracted from values obtained from cells in tubes A and C respectively to correct for minor spectral overlap ( ⁇ 10%) of the NBD and AF633 fluorophores.
- Receptor-treated cells were washed with ice-cold serum free recycling media (2 x 0.5 mL), resuspended in ice- cold serum free recycling media (1.5 mL), and analyzed by flow cytometry.
- Cells were isolated by centrifugation, resuspended in ice-cold back-exchange media (serum free recycling media containing 2 mM Me- ⁇ -cyclodextrin and 1% BSA, 1.5 mL), maintained on ice (2 min), and analyzed by flow cytometry (this single wash with back-exchange media resulted in a 44% loss of total cellular fluorescence).
- the cells were maintained on ice, washed again with ice-cold back exchange media (3 x 10 min x 1.5 mL), and analyzed by flow cytometry (this combination of four total wash steps with back-exchange media resulted in a 84% loss of total cellular fluorescence; additional wash steps resulted in >90% removal of receptor from the cell surface).
- Jurkat lymphocytes (3 x 10 6 ) were resuspended in serum free recycling media containing 10 (1 ⁇ M, 1% DMSO, 1.5 niL) and incubated for 10 min at 37 0 C. These cells were washed with serum free recycling media (2 x 1 mL) to remove unincorporated receptor (10). These receptor- treated cells were cooled on ice (5 min) to halt recycling and washed with ice-cold back-exchange media (6 x 1.5 mL x 10 min) to selectively remove 10 from the cell surface without affecting the population of 10 in intracellular endosomes.
- Serum free recycling media This media was prepared as previously described 7 and included NaCl (150 mM), KCl (5 mM), CaCl 2 (1 mM), MgCl 2 (1 mM), glucose (2g / L), and Hepes (20 mM, pH 7.4).
- Cells were maintained at 4 0 C for 30 min and washed with ice-cold media (2 x 0.5 mL). Cells were lysed at 4 0 C in an ultracentrifugation tube (ultra clear 14x89 mm, Beckmann Instruments) by addition of TNEV lysis buffer (2 mL, 0.2% Triton X-100 (v/v), 150 mM NaCl, 5 mM EDTA, 5 mM Na 3 VO 4 , 25 mM Tris-HCl, pH 7.4) followed by vortex mixing for 20 seconds every 20 min for 1 h.
- TNEV lysis buffer 2 mL, 0.2% Triton X-100 (v/v), 150 mM NaCl, 5 mM EDTA, 5 mM Na 3 VO 4 , 25 mM Tris-HCl, pH 7.4
- This lysate was combined with a solution of 80% sucrose in TNEV lysis buffer (2 mL, w/v) to yield 4 mL of a 40% sucrose solution at the bottom of the ultracentrifugation tube.
- This 40% sucrose solution was overlayed with 30% sucrose in TNEV lysis buffer (4 rnL), followed by 5% sucrose in TNEV lysis buffer (2 rnL), and a final solution of 2% sucrose in TNEV lysis buffer (2 rnL) by syringe.
- Masses of ultracentrifugation tubes were balanced to within 1 mg by the addition of 2% sucrose solution in TNEV lysis buffer.
- Tubes were centrifuged at 33,000 rpm (134,409 g) for 20 h at 4 0 C in a Beckman OptimaTM LE-80K preparative ultra centrifuge using a SW41 swinging bucket rotor. Fractions (12 x 1 rnL) were harvested by aspiration with a capillary tube and small pump beginning with the highest density fraction at the bottom of the ultracentrifugation tube. The fluorescence of these fractions were quantified with a Packard Fusion microtiterplate reader fitted with a 480 nm excitation filter and 535 nm emission filter.
- Fluorescence polarization assays ( Figure 9). Fluorescence polarization binding experiments employed a Packard Fusion microtiterplate reader equipped with a 485 nm excitation filter and a 535 nm polarization emission filter. Apparent dissociation constants for binding of NBD and DNP derivatives to rabbit polyclonal anti-DNP IgG were determined by analyzing a fixed concentration of FITC-DNP (27, 20 nM) or 6-(7- nitrobenzofuran-4-ylamino)hexanoic acid (28, 100 nM) in PBS (pH 7.4, 100 ⁇ L).
- Fluorescent probes were equilibrated for 30 min with varying concentrations of rabbit anti- DNP IgG in black 96 well plates (Costar) prior to fluorescence polarization measurements in triplicate. Dissociation constants were calculated by nonlinear regression using a sigmoidal dose-response model with variable slope (GraphPad Prism 3.0 software).
- the 24-well plate was incubated at 37 0 C in a humidified CO 2 incubator for 4 h.
- RPMI media 400 ⁇ L
- FBS FBS
- PHA-L 1 ⁇ g / mL
- PMA 5 ng / mL
- Maximal transfection efficiency 40%) was obtained after incubation for 24 to 36 h (37 0 C, 5% CO 2 ).
- Analysis of receptor cytotoxicity Jurkat lymphocytes were treated with receptor 3 (10 ⁇ M) for 1 h followed by Anti-DNP-IgG / PrA488 for 4 h under the antibody uptake assay conditions. These cells were washed twice with media and incubated for an additional 24 h at 37 0 C.
- the dead-cell stain propidium iodide (10 ⁇ g / mL) was added to cells prior to analysis, and viability was quantified from flow cytometry forward and side- scatter dot plots. Greater than 95% of cells remained viable under these conditions. Additionally, cells were examined after treatment with receptor 2 (10 ⁇ M) for 1 h, removal of unincorporated 2 by resuspension in receptor-free cell culture media, and longer-term growth in culture. After an additional 96 h in culture, >90% of these cells remained viable and were morphologically indistinguishable from untreated cells.
- EXAMPLE 7 Kinetics of Ligand Uptake for Synthetic Receptors. Synthetic receptors were evaluated as mediators of cellular uptake of protein ligands in living Jurkat lymphocytes, a human T cell line. Confocal laser scanning microscopy and flow cytometry were employed to analyze cells treated with compounds 2-9 for 1 hour followed by addition of anti-DNP IgG complexed with fluorescent conjugates of the IgG-binding protein A (PrA) from S. aureus.
- PrA IgG-binding protein A
- the IgG-loaded intracellular compartments were identified as late endosomes and lysosomes by co-localization studies in cells transfected with EGFP- lgp 120, a fluorescent protein marker of these compartments.
- Excess anti-DNP IgG/PrA-AF594 added to cells treated with 6 did not appreciably deplete this receptor from the cell surface despite extensive uptake of this protein complex.
- EXAMPLE 8 Efficiency of Uptake Mediated by the DNF '-based receptors 2-5.
- the magnitude and kinetics of delivery of a green fluorescent anti-DNP/PrA-AF488 complex was quantified by flow cytometry as shown in FIG. 8., panels B and C.
- EXAMPLE 9 Effect of Linker Structure on Subcellular Localization of Synthetic Receptors.
- Cells were treated with structurally similar green fluorescent receptors (6-9).
- Epifluorescence microscopy and fluorescence quenching assays were employed to investigate the differences in cellular fluorescence and subcellular localization.
- Panel A the overall fluorescence resulting from treatment with 10 ⁇ M of these compounds was within 2-fold.
- the subcellular localization of these compounds differed dramatically.
- Receptor 6 bearing two ⁇ -alanine linker subunits was observed predominantly on the cell surface.
- the single ⁇ -alanine containing receptor 7 exhibited lower cell surface localization, and the absence of B-alanine in the linker of 8 rendered this compound primarily intracellular.
- the amide analog 9 was essentially completely associated with internal membranes which explain the inability of this analog to mediate significant cellular uptake of the anti-IgG ligand.
- This amide analog nearly completely localized with a red fluorescent probe of the cellular golgi apparatus and nuclear membrane, indicating a unique intracellular destination of this receptor.
- the fraction of receptors 6-9 at the cell surface was quantified by irreversible quenching of exposed NBD fluorophores on the cell surface. This was accomplished by brief treatment of cells with relatively cell-impermeable reducing agent (sodium hypodisulfite, NaO 2 S-SO 2 Na), which rapidly reduces the nitro functionality of extracellular NBD headgroups to the amine, enabling quantification of differences in cell surface and intracellular fluorescence.
- cell-impermeable reducing agent sodium hypodisulfite, NaO 2 S-SO 2 Na
- Quantitative dithionite quenching assays demonstrated dramatic differences in receptor subcellular localization that paralleled the magnitude and kinetics of IgG uptake observed with receptors 2-5, as shown in FIG. 10, Panel B. Thus, differences in trafficking to intracellular membranes control the efficiency of these synthetic receptors.
- EXAMPLE 10 Temporal Stability of Receptor 2. To evaluate the temporal stability of receptor 2 on the cell surface, the half- life of this compound on Jurkat lymphocytes was quantified by addition of a soluble antibody. Cells were treated with this receptor for 1 hour (10 ⁇ M), unincorporated receptor was removed by washing cells with fresh media, and the abundance of 2 as a function of time was detected with a green fluorescent anti-DNP/PrA-AF488 complex. As shown in FIG. 10., Panel C, curve fitting of the flow cytometry data revealed a cell surface half-life of 20 hours. This value is similar to the 24 hour half- life of natural folate receptor that is anchored to the cell surface by covalently attached GPI lipids.
- EXAMPLE 11 Cycling of Receptor 6 Between the Cell Surface and Intracellular Endosomes in Jurkat Lymphocytes.
- a fluorescent-quenching assay with sodium dithionite was employed. As shown in FIG 11, Jurkat cells were treated with receptor 6 (10 ⁇ M) and cooled to 4 0 C to stop plasma membrane recycling. Fluorescence at the cell surface was quenched by treatment with ice-cold sodium dithionite, and cells were washed with cold media to remove this reducing agent (FIG. 11, Panel A).
- This cell culture was split into two equal portions; one portion was maintained at 4 0 C, shown in FIG 11, Panel B, for 30 minutes, and the other portion was allowed to return to 37 0 C for 30 minutes to reactivate plasma membrane recycling as shown in FIG.l 1, Panel C.
- Significant return of green fluorescence back to the plasma membrane was observed only in the panel warmed to 37 0 C. Compare Panels B and C in FIG 11. NBD headgroups that have returned to the cell's surface were detected with an NBD-binding red fluorescent anti-DNP/PrA-AF633 complex.
- EXAMPLE 12 Quantifying the rate of plasma membrane recycling of receptor 10.
- oregon green-derived receptor 10 was employed. Unlike the more strongly cell-associated DNP and NBD-based receptors, the compound 10 binds proteins in cell culture media and can be rapidly and efficiently depleted from cell surfaces by washing cells with "back exchange" media containing bovine serum albumin (BSA, 1%) and methyl-beta-cyclodextrin (Me-beta-CD, 2 mM). This concentration of Me-beta-CD is known to affect neither endocytosis nor plasma membrane recycling.
- BSA bovine serum albumin
- Me-beta-CD methyl-beta-CD
- the oregon green-fluorophore of 10 was also chosen for these studies because unlike structurally similar carboxydfluorescein the fluorescence of oregon green is not appreciably quenched in acidic environment of endosomal compartments.
- Cells treated with 10 (1 ⁇ M) exhibited bright green fluorescence both at the cell surface and in intracellular (endosomal) compartments; patterns of cellular fluorescence were similar to treatment with the structurally related receptor 7 (data not shown).
- Cells were treated with 10 and cooled to 4 0 C to stop dynamic plasma recycling. These cells were washed four times with ice-cold back exchange media to extensively deplete 10 from the cell surface without affecting the population of this compound in intracellular endosomes.
- EXAMPLE 13 Synthetic receptor/ligand complexes co-fractionate with lipid raft components of cellular plasma membranes. Another hallmark of many natural cell surface receptors is the proposed association of these biomolecules with cholesterol and sphingolipid-enriched lipid raft subdomains of cellular plasma membranes. These subdomains are generally biochemically characterized as low density fractions of the plasma membrane insoluble in buffers containing non-ionic detergents such as Triton-X at 4 0 C.
- Ganglioside GMl (1) is prototypical example of a small lipid raft- associated cell surface receptor, and complexes of this glycolipid with a fluorescent cholera toxin protein are often used as a marker for lipid rafts.
- macromolecules receptors including B-cell receptors, T cell receptors, and growth factor receptors are thought to associate with these membrane subdomains.
- binding of ligands to receptors initiates formation of lipid rafts. This ligand-mediated concentration of specific membrane lipids has been proposed to recruit intracellular raft-associated kinases to activate cellular signaling pathways.
- EXAMPLE 14 References for examples 1-13. (1) Sjoback, R.; Nygren, J.; Kubista, M. Spectrochimica Acta Part a-Molecular and Biomolecular Spectroscopy 1995, 57, L7-L21.
- EXAMPLE 15 Design and synthesis of receptors for vancomycin and related glycopeptide antibiotic ligands.
- the numbered receptors in examples 15-21 refer to those shown in Figures 14-19 and in Examples 15-21.
- vancomycin (1) into endosomes of cells infected with pathogenic bacteria might enable access of this cell-impermeable antibiotic to the cytoplasm.
- vancomycin (2) and an artificial cell surface receptor (3) comprising the vancomycin-binding motif D-Phe-D-Ala linked to 3 ⁇ - cholesterylamine.
- the D-Phe-D-Ala dipeptide was chosen because of its improved affinity for vancomycin (K d ⁇ 7 ⁇ M) compared with the natural D-AIa-D-AIa substrate. 6 This binding group was coupled to 3 ⁇ -cholesterylamine to add a membrane anchor previously shown by our laboratory to access a membrane trafficking pathway involving rapid cycling between the plasma membrane and endosomes of mammalian cells. 7 Control compounds that do not bind vancomycin (L- Ala- L- Ala analogue 4) or that exhibit lower affinity for the cellular plasma membrane (amide analogue 5) were also synthesized for comparison.
- EXAMPLE 16 Confocal laser scanning and differential interference contrast (DIC) microscopy of living J -774 murine macrophages. Confocal laser scanning microscopy was used to examine the delivery of fluorescent vancomycin derivative 2 into J774 mouse macrophage cells. As shown in Figure 17, cells treated with both receptor 3 and ligand 2 exhibited substantial uptake of this fluorescent probe. In healthy (non- infected) cells, this intracellular fluorescence was localized to endosomes and lysosomes as evidenced by colocalization with a red fluorescent marker of these compartments (supporting information). However, when these cells were also infected by L. monocytogenes, the fluorescent vancomycin (2) was distributed throughout the cytoplasm and nucleus.
- DIC differential interference contrast
- EXAMPLE 17 Dose-dependent effectiveness of delivery of receptor 2 into mouse J-774 cells and human HeLa cells.
- the dose-dependent effectiveness of delivery of 2 into mouse J-774 cells and human HeLa cells mediated by receptor 2 was examined quantitatively by flow cytometry.
- preequilibration of the receptor (3) with the ligand (2) prior to addition to cells was ca. 2-fold more effective for delivery compared with preloading of cellular plasma membranes with the receptor (3) followed by addition of the ligand (2).
- both of these conditions engendered substantial receptor- mediated enhancements of ligand uptake.
- EXAMPLE 18 Delivery of vancomycin via synthetic receptor 3 into HeLa cells infected by L. monocytogenes to determine effects on antibiotic activity against this pathogen.
- the synthetic receptor 3 was employed to deliver vancomycin (1) into HeLa cells infected by L. monocytogenes to investigate effects on antibiotic activity against this pathogen.
- treatment of HeLa cells with this receptor (10 ⁇ M) enabled vancomycin (50 ⁇ M) to eliminate this intracellular parasite and rescue HeLa cells from the lethal effects of this pathogen.
- EXAMPLE 19 Delivery of fluorescent Vancomycin derivative 2 by synthetic receptor 3 in vivo to mice.
- the delivery of fluorescent Vancomycin derivative 2 by synthetic receptor 3 was investigated in vivo ( Figure 20).
- Figure 20 synthetic receptor-mediated targeting of the fluorescent vancomycin (2) to specific tissues was observed, indicating that N-alkyl-3b-cholesterylamine derivatives such as 3 provide novel tools for drug delivery in vivo.
- a synthetic cell surface receptor can enhance the in vitro effectiveness of a clinically used drug against an intracellular pathogen.
- This receptor also enables targeting of the drug to specific tissues in vivo. This approach provides a novel tool to combat microorganisms that invade mammalian cells.
- EXAMPLE 20 General information for histidine/metal chelators. Chemical reagents were obtained from Acros, Aldrich, Alfa Aesar, or TCI America. Solvents were from EM Science. Media and antibiotics were purchased from Mediatech. Dil-loaded human low-density lipoprotein was from Invitrogen. Commercial grade reagents were used without further purification unless otherwise noted. Anhydrous solvents were obtained after passage through a drying column of a solvent purification system from GlassContour (Laguna Beach, CA). All reactions were performed under an atmosphere of dry argon or nitrogen. Reactions were monitored by analytical thin-layer chromatography on plates coated with 0.25 mm silica gel 60 F 254 (EM Science).
- Agilent 1100 preparative pump / gradient extension instrument equipped with a Hamilton PRP-I (polystyrene-divinylbenzene) reverse phase column (7 ⁇ m particle size, 21.5 mm x 25 cm).
- Melting points were measured with a Thomas Hoover capillary melting point apparatus and are uncorrected. Infrared spectra were obtained with a Perkin Elmer 1600 Series FTIR.
- NMR spectra were obtained with Bruker CDPX-300, DPX-300, AMX-360, or DRX-400 instruments with chemical shifts reported in parts per million (ppm, ⁇ ) referenced to either CDCl 3 ( 1 H 7.27 ppm; 13 C 77.23 ppm), DMSOd 6 ( 1 H 2.50 ppm; 13 C 39.51 ppm), or (CH 3 ) 4 Si.
- High-resolution mass spectra were obtained from the University of Texas at Austin and Penn State University Mass Spectrometry Facilities (ESI and CI). Peaks are reported as m/z.
- N-Fmoc- ⁇ -alanine- ⁇ -alanine ethyl ester (5). ./V-Fmoc- ⁇ -alanine (311 mg, 1.0 mmol) in anhydrous CH 2 Cl 2 (20 niL) under N 2 was cooled to O 0 C. HOBt (168 mg, 1.1 mmol) and EDC (230 mg, 1.2 mmol) were added and the solution was stirred for 30 min at O 0 C. ⁇ - Alanine ethyl ester hydrochloride (169 mg, 1.1 mmol) in anhydrous CH 2 Cl 2 (10 mL) and DIEA (180 ⁇ L, 1.1 mmol) were added.
- the reaction was warmed to 23 0 C and stirred for 16 h.
- the reaction solution was diluted with CH 2 Cl 2 (30 mL) and washed with aqueous HCl (5%, 30 mL), followed by aqueous NaOH (0.1 M, 30 mL), and deionized H 2 O (30 mL).
- the organic layer was dried over anhydrous Na 2 SO 4 and concentrated in vacuo.
- Aqueous LiOH (10 mL, 0.5 M) was added dropwise to a solution of 3 (315 mg, 0.51 mmol) in a mixture of MeOH (15 mL) and THF (10 mL). The solution was stirred for 4 h at 23 0 C and the organic solvents were removed in vacuo. The remaining aqueous solution was acidified with aqueous HCl (10%) and the resulting carboxylic acid precipitated as a white solid. This solid was collected by vacuum filtration, washed with cold water, and dried in vacuo. The dried solid was dissolved in anhydrous CH 2 Cl 2 (20 ml) under dry N 2 and cooled to O 0 C.
- This amine was prepared from N a ,N a -Bis[(tert- butoxycarbonyl)methyl]-./V- ⁇ -benzyloxycarbonyl-L-lysine tert-butyl ester (the Cbz precursor) as previously reported, 2 but the Cbz precursor (3.4 g) in EtOH (50 mL) was deprotected by catalytic hydrogenation (Pd(C), 10%) using 300 psi H 2 for 12 h to afford 2.51 g of amine (97%). The reaction was warmed to 23 0 C and stirred for 16 h.
- numbered receptors in examples 22-24 refer to those shown in Figures 20-25 and in Examples 22-24.
- Jurkat lymphocytes human acute T-cell leukemia, ATCC #TIB- 152 were maintained in Roswell Park Memorial Institute (RPMI) 1640 media supplemented with Fetal Bovine Serum (FBS, 10%), penicillin (100 units / mL), and streptomycin (100 ⁇ g / mL).
- RPMI media used for cell culture and wash steps contained antibiotics and FBS unless otherwise noted.
- Microscopy A Zeiss LSM 5 Pascal confocal laser- scanning microscope fitted with a Plan Apochromat objective (63 X) was employed. Alexa Fluor 488 was excited with a 488 nm Argon ion laser and emitted photons were collected through 505 nm LP filter.
- the dead-cell stain propidium iodide (10 ⁇ g / mL) was added to cells prior to analysis, and viability was quantified by flow cytometry forward and side- scatter dot plots. No significant effects on viability or cellular morphology were observed under these conditions.
- the gene encoding AcGFP was amplified by PCR using primers 5'-EcoRI-XhoI-AcGFP (5 ' - AGTCGAATTCGGTCTCGAGATGGTGAGCAAGGGC-S ' ), 3 ' -SalINoStop- AcGFP (5'-GACTGTCGACCTTGTACAGCTCATC-S'), and pAcGFPl(BD biosciences) as the template to append flanking EcoRI and Sail restriction sites.
- This PCR product was digested with EcoRI and Sail and inserted into EcoRI / X/zoI-digested vectors pSA4 and pSLH2, derivatives of vector pLM 3 that add decahistidine (pSA4) or hexahistidine (pSLH2) peptides, followed by a stop codon, to the C-terminus of the gene.
- the resulting AcGFP(His) 10 and AcGFP(HiS) 6 genes were digested with EcoRI I Sail and ligated to the EcoRI I S ⁇ /I-digested vector pSMl, a derivative of pLM 3 modified by S.
- HA hemagglutinin
- the cultures were shaken at 3O 0 C for 5 h and cells harvested by centrifugation (4400 rpm, 10 min). The cell pellets were resuspended in Bacterial Protein Extraction Reagent (BPER, Pierce, 3 mL). The cells were shaken at 3O 0 C for 30 min, centrifuged (10,000 rpm, 5 min) and the supernatant was applied to packed Talon resin (7.5 mL, Clontech / BD biosciences) prewashed with phosphate buffered saline (DPBS, pH 8).
- BPER Bacterial Protein Extraction Reagent
- the resin was washed with cold DPBS (5 x 5 mL), and the protein was eluted from the resin by washing with DPBS containing imidazole (300 mM, 2 x 2 mL).
- the eluate was concentrated by centrifugation against a protein-impermeable membrane (Millipore centricon concentrator, 10K) and washed at 4 0 C with cold DPBS (5 x 1.5 mL) to remove the imidazole.
- proteins were analyzed by SDS PAGE on a 15% polyacrylamide gel (Cambrex) and detected by staining with coomassie dye.
- the concentration of the protein was quantified using the Coomassie Plus protein assay reagent (Pierce).
- the purified proteins were stored at final concentrations of: 1.19 mg / mL (AcGFP(His)io, 1000 ⁇ L) and 1.09 mg / mL, (AcGFP(His) 6 , 750 ⁇ L). Amino acid sequences of AcGFP proteins expressed in E. coli.
- these proteins also include an N- terminal hemagglutinin (HA) epitope tag (sequence: YPYDVPDYA).
- HA hemagglutinin
- AcGFP(HJs) n MRGSGTELQLMASYPYDVPDYASPEFGLEMVSKGAELFTGIVPILIELNGDVNGHK FSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSYGVQCFSRYPDHMKQH DFFKSAMPEGYIQERTIFFEDDGNYKSRAEVKFEGDTLVNRIELTGTDFKEDGNILG NKMEYNYNAHNVYIMTDKAKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGP VLLPDNHYLSTQSALSKDPNEKRDHMIYFGFVTAAAITHGMDELYKVEGTHHHH
- EXAMPLE 23 Oligohistidine peptides are often fused to proteins to provide affinity tags that facilitate protein purification.
- an artificial cell surface receptor (1) comprising the plasma membrane anchor iV-alkyl-3 ⁇ -cholesterylamine linked to the metal chelator nitrilotriacetic acid (NTA).
- NTA metal chelator nitrilotriacetic acid
- iV-Alkyl-3 ⁇ -cholesterylamine derivatives can function as prosthetic molecules active on the surface of living mammalian cells because this steroid can insert into cellular plasma membranes, project linked headgroups from the cell surface, and rapidly cycle between the plasma membrane and intracellular endosomes, similar to many naturally- occuring cell surface receptors.
- NTA motif binds tightly to nickel, cobalt, copper, and zinc dications, and immobilized metal chelate chromatography (IMAC) with NTA- linked supports is widely used to purify proteins fused to His-tags. Other lipids linked to NTA headgroups have also been reported. 9 ' 10
- Receptor 1 was synthesized from 3 ⁇ -cholesterylamine (2) 8 as shown in Scheme 1. Alkylation of 2 with ethyl 5-bromovalerate, followed by Boc protection of the secondary amine to afford 3, was found to provide an improved route to protected iV-alkyl derivatives of the membrane anchor. Addition of a linker shown to increase the population of these compounds on the cell surface, 8 acylation with a protected NTA derivative, and final deprotection afforded 1 in 47% overall yield. As representative His-tagged proteins, we overexpressed the monomeric green fluorescent protein AcGFP fused to C-terminal (His) 6 and (HiS) 1O peptides and purified these proteins by IMAC.
- the (His) 10 peptide binds Ni-NTA complexes ⁇ 6-fold more tightly than (His) 6 .
- human Jurkat T-lymphocytes were treated with 1 (10 ⁇ M) for one hour to load this compound into the outer leaflet of the cellular plasma membrane. These cells were washed and subsequently treated with a solution of AcGFP(His) 10 (3.2 ⁇ M) and Ni(OAc) 2 (100 ⁇ M) for an additional four hours. As shown in Figure 24 (panel A), examination of these cells by confocal laser scanning microscopy revealed fluorescent protein both on cell surface and in defined intracellular compartments.
- cellular viability was examined by flow cytometry.
- Jurkat lymphocytes were treated with receptor 1 (10 ⁇ M, 1 h), followed by AcGFP(His)i 0 (3.2 ⁇ M), and Ni(OAc) 2 (100 ⁇ M, 4 h) to enhance protein uptake by 600-fold.
- Cells were washed with disodium NTA to remove cell surface protein and were cultured for an additional 48 h.
- EXAMPLE 24 References for examples 16-23. (1) Boonyarattanakalin, S.; Martin, S. E.; Dykstra, S. A.; Peterson, B. R. /. Am. Chem.
- EXAMPLE 25 A Synthetic Scheme Describing the Synthesis of the Lipid- mimicking synthetic receptors, e.g. CRP receptors (lipid mimics that promote cellular apoptosis in the presence of C-reactive protein)
- CRP receptors lipid mimics that promote cellular apoptosis in the presence of C-reactive protein
- EXAMPLE 28 Synthesis of 3 ⁇ -amino-5-cholestene and Derivatives from cholesterol (yields represented on a 1 mmol scale).
- the method for synthesis of 3 ⁇ -amino-5-cholestene (7) by i-steroid and retro-j-steroid rearrangements comprises reacting cholesterol (1) or a cholesterol bearing a leaving group at the 3- position, for example, cholesterol mesylate (2), cholesterol triflate, cholesterol tosylate or cholesterol esters, with a Lewis acid, for example, boron trifluoride etherate, in the presence of an azide, for example, a silyl azide such as trimethlysilyl azide, at a temperature between minus 150 0 C to plus 200 0 C and a Lewis acid, such as boron trifluoride etherate, in a solvent such as dichloromethane, to obtain a reaction mixture comprising 3 ⁇ -azi
- 3 ⁇ -azido-5-cholestene (3) is then reacted with a reducing agent such as lithium aluminium hydride in a solvent such as diethyl ether to produce 3 ⁇ -amino-5-cholestene (7).
- a reducing agent such as lithium aluminium hydride
- a solvent such as diethyl ether
- the reduction of 3 ⁇ -azido-5-cholestene (3) by catalytic hydrogenation may be performed in tetrahydrofuran over 10% palladium on carbon or another suitable catalyst.
- the novel method for synthesis of 3 ⁇ -chloro-5-cholestene (4) by i-steroid and retro- i- steroid rearrangements was further examined.
- the method for synthesis of 3 ⁇ -chloro-5-cholestene (4) comprises reacting cholesterol (1) or a cholesterol-bearing a leaving group at the 3-position, for example, cholesterol mesylate (2), cholesterol triflate, cholesterol tosylate or cholesterol esters, with titanium (IV) chloride, trimethylsilyl chloride, and dichloromethane, achieving a 95% yield.
- the synthesis methods for 3 ⁇ - bromo-5-cholestene (5) by i-steroid and retro-j-steroid rearrangements may comprise reacting cholesterol (1) or a cholesterol bearing a leaving group at the 3-position, for example, cholesterol mesylate (2), cholesterol triflate, cholesterol tosylate or cholesterol esters, with boron trifluoride-diethyl ether complex, trimethylsilyl bromide, and dichloromethane, achieving a 92% yield.
- novel method for synthesis of 3 ⁇ - iodo-5-cholestene (6) by i-steroid and retro-j-steroid rearrangements may comprise reacting cholesterol (1) or a cholesterol bearing a leaving group at the 3-position, for example, cholesterol mesylate (2), cholesterol triflate, cholesterol tosylate or cholesterol esters, with boron trifluoride-diethyl ether complex, trimethylsilyl iodide, and dichloromethane, achieving an 82% yield.
- EXAMPLE 29 Additional Synthetic procedures and compound characterization data. Chemical reagents were obtained from Acros, Aldrich or Alfa Aesar. Solvents were from EM Science. Commercial reagents were used without further purification unless otherwise noted.
- EI spectra were obtained on a ZAB HS mass spectrometer (VG Anlytical Ltd, Manchester, UK) or an Agilent 6890N GC interfaced with quadrupole mass analyzer (Quattro Micro GC, Waters corp., Milford, MA); ESI spectra were obtained on a LCT Premier time of flight mass spectrometer (Waters Corp., Milford, MA). Peaks are reported as m/z.
- Compound 7 could alternatively be prepared by hydrogenation of 3 as follows: To a solution of 3 ⁇ -azido-5a-cholestene (3, 10.5 g, 25.5 mmol) in anhydrous THF (120 mL) in a round bottom flask (250 mL) was added Pd (10%) on activated carbon (2.65 g, 2.5 mmol). The suspension was stirred under one atmosphere of hydrogen for 24 h at ambient temperature (22 0 C).
- EXAMPLE 30 References for Example 29. (1) Poza, J. et al, Bioorg. Med. Chem. 2007, 15, 4722-4720.
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Steroid Compounds (AREA)
Abstract
The present invention relates to methods for synthesizing preferred membrane-binding elements, preferably cholesterylamine derivatives, including 3-amino-5-cholestene (3-cholesterylamine) and related 3-halides through i-steroid and retro-i-steroid rearrangements.
Description
TITLE: SYNTHESIS OF 3B-AMINO-5-CHOLESTENE AND RELATED 3B-
HALIDES INVOLVING I STEROID AND RETRO-I-STEROID REARRANGEMENTS
CROSS-REFERENCE TO RELATED APPLICATIONS
This application claims benefit of U.S. Provisional Application 61/122,458, filed
December 15, 2008, the contents of which are incorporated into this application by reference in their entirety.
GRANT REFERENCE
Work for this invention was funded in part by a grant from the United States
Government, NIH Grant No. CA83831. The Government may have certain rights in this invention.
FIELD OF THE INVENTION
The present invention relates to new synthetic receptors and the use of the synthetic receptors for delivering a protein, peptide, drug, prodrug, nucleic acid, or a small molecule into a target cell via receptor-mediated endocytosis. According to the invention, the synthetic receptors comprise a membrane-binding element that is a cholesterol derivative and novel methods for stereoselective preparation of 3β-amino-cholestene and related 3β- halides are also disclosed for use according to the invention.
BACKGROUND OF THE INVENTION It is often difficult to deliver compounds, such as proteins, peptides, nucleic acids, and other drugs and diagnostic compounds intracellularly because cell membranes often resist the passage of these compounds. Various methods have been developed to administer agents intracellularly.
One method for transmembrane delivery of exogenous molecules having a wide applicability is based on the mechanism of receptor-mediated endocytotic activity. Unlike many other methods, receptor-mediated endocytotic activity can be used successfully both in vivo and in vitro. Receptor-mediated endocytosis involves the movement of ligands bound to membrane receptors into the interior of an area bounded by the membrane through invagination of the membrane. The process is initiated or activated by the binding
of a receptor- specific ligand to the receptor. Many receptor-mediated endocytotic systems have been characterized, including those recognizing galactose, mannose, mannose 6- phosphate, transferrin, asialoglycoprotein, transcobalamin (Vitamin B12), alpha-2- macroglobulins, insulin, and other peptide growth factors such as epidermal growth factor (EGF).
Investigators in the field agree that the assimilation of physiologically significant molecules such as nutrients, hormones, enzymes, virions, toxins, and various types of proteins begins with the initial binding of the macromolecule or ligand to specific receptors which are mobile and randomly distributed on the cell membrane surface. These ligand- receptor complexes rapidly accumulate in specialized regions of the membrane termed coated pits. From this stage, the receptor-mediated endocytosis (RME) proceeds to the formation of smooth- walled vesicles which allow entry of the concentrated ligand-receptor complexes into the cell. These vesicles, often referred to as "endosomes" or "receptosomes," may fuse together or combine with larger vesicles. Subsequently, the internal pH of these endosomes decrease by the action of proton pumps, changing the conformation of the receptor and/or ligand. The result is the release of the ligand and the formation of separate receptor-containing vesicles and ligand-containing ones. In some cases, the receptor-bearing vesicles are delivered to the cell membrane where they are released and "recycled" for additional use. In others, the resulting vesicles, along with the internalized ligand, are delivered to and fused with lysosomes where the eventual breakdown likely takes place. Another destination of some ligands internalized by RME including certain drugs, viral proteins, and protein toxins is escape from endosomes and entry into the cellular cytoplasm or nucleus.
Receptor-mediated endocytotic activity has been utilized for delivering exogenous molecules such as proteins and nucleic acids to cells. Generally, a specified ligand is chemically conjugated by covalent, ionic or hydrogen bonding to an exogenous molecule of interest (i.e. the exogenous compound), where the modified ligand is still able to bind to its cognate receptor. Disadvantageously, this method limits delivery of the exogenous molecule to cells that display a particular receptor. Thus, there exists a need for a delivery system which can be utilized for the delivery of agents, including pharmaceuticals, small molecules, peptides and oligonucleotides, to any cell or tissue.
Cholesterol mimics have been utilized to facilitate delivery of siRNA, enhance
DNA transfection, probe cellular membrane subdomains, and have been proposed for tumor targeting applications. See e.g., Wolfram, C. et al, Nat. Biotechnol. 2007, 25, 1149- 1157; Pitard, B. et al, Proc. Natl. Acad. ScL U.S.A. 1999, 96, 2621-2626; Sato, S. et al, J. Biol. Chem. 2004, 479, 23790-23796; Firestone, R.A., Bioconjug. Chem. 1994, 5, 105-113. Further, derivatives of 3β-amino-5-cholestene have been used to construct photoaffinity probes and related amino steroids. See Spencer, T. et al, J. Lipid Res. 2004, 45, 1510- 1518; Salmi, C. et al, Lett. Drug Design Discov. 2008, 5, 169-172. The cationic cholesterol mimic 3β-amino-5-cholestene (3β-cholesterylamine) has a demonstrated high affinity for phospholipid membranes. Kan, C. et al, Biochemistry 1992, 31, 1866-1874. However, the prior art fails in its synthesis of cholesterol mimics having poor stereoselectivity and being susceptible to elimination and rearrangement. Windaus et al. first reported that reacting cholesteryl chloride with ammonia, or reduction of cholestenone oxime, provides 3-substituted cholesterylamines in modest yields. Berichte Der Deutschen Chemischen Gesellschaft, 1911, 44, 3051-3058. Subsequently, stereoselective synthesis of 3β-azido-5-cholestene has involved conversion of cholesterol to epicholesterol followed by a Mitsunobu reation with hydrazoic acid or treatment of 6β-methoxy-3α,5-cyclo-5α- cholestane and related compounds with hydrazoic acid. See e.g., Kan et al, Biochemistry 1992, 31, 1866-1874; Spencer et al, J. Lipid Res. 2004, 45, 1510-1518. Such methods still result in products having poor stereoselectivity and are susceptible to elimination and rearrangement due to the participation of the homoallylic double bond at the C5 position of the steroid. The limitations of the products effectively limit the synthesis to small-scale preparation of 3β-azido-5-cholestene.
Thus, there further exists a need for synthesis of suitable membrane-binding agents having a high affinity for phospholipid membranes suitable for the delivery of pharmaceuticals, small molecules, peptides and oligonucleotides to a cell or tissue.
There still further exists a need for synthesis methods to stereo selectively convert cholesterol to 3β-azido-5-cholestene and 3β-amino-5-cholestene and related 3β-halides.
BRIEF SUMMARY OF THE INVENTION Various synthetic receptors and their uses are described. In one aspect of the present invention, synthetic receptors are provided in which the receptor includes the following regions: at least one binding, chelating, or mimicking motif linked to a
membrane-binding element that anchors the receptor to a plasma membrane of a cell. In another embodiment, the binding, chelating, or mimicking motif and membrane-binding element are linked to the other via a linker region. In one aspect, the membrane-binding element includes at least of one the following: cholesterol, dihydrocholesterol, ergosterol, brassicasterol, derivatives of cholesterol, dihydrocholesterol, ergosterol, brassicasterol, and related compounds thereof. In a preferred embodiment, the membrane-binding element includes at least one of the following: cholesterylamine, dihydrocholesterylamine, ergosterylamine, brassicasterylamine, derivatives of cholesterylamine, dihydrocholesterylamine, ergosterylamine, brassicasterylamine, and related compounds thereof.
Additional embodiments of the synthetic receptors include synthetic protein- binding receptors, synthetic metal-chelating receptors, synthetic immunoglobulin Fc- binding receptors, synthetic cytokine or growth factor-binding receptors, synthetic drug- binding receptors, synthetic lipid mimicking receptors, and synthetic transmembrane receptors.
Another embodiment includes the loading of low-density lipoprotein (LDL) with synthetic receptors for the delivery of proteins, carbohydrates, nucleic acids, lipids, or drugs, to cells, tissues, or tumors.
Provided herein are methods for delivering a protein into a cell that includes contacting the cell with a synthetic cell receptor so that the synthetic receptor inserts into the cell plasma membrane on the cell's surface. The synthetic receptor has a protein- binding motif and a membrane-binding element that anchors the synthetic receptor into the cell plasma membrane. The inserted synthetic receptor binds a protein via its protein- binding motif, thereby triggering receptor-mediated endocytosis of the protein-bound synthetic receptor and delivery of the protein into the cell.
In another embodiment, the present invention provides pharmaceutical compositions comprising a synthetic receptor and a pharmaceutically acceptable carrier. The present invention further includes methods of using the synthetic receptors for various applications. In one embodiment, the synthetic receptors may be used as cellular probes. In another embodiment, the present invention provides a method of treating a disease, disorder, or condition comprising delivering a therapeutically effective amount of a protein, peptide, drug, prodrug, or small molecule into a target cell using a synthetic cell
receptor. In one aspect, the synthetic receptors may be used in enzyme replacement therapy or to treat viral, yeast, or bacterial infections, cancer, inflammation, or autoimmune diseases.
In addition, the invention includes methods of modulating the immune response of a subject by removing a protein of interest from circulation in a subject, in particular extracellular ligands. In another embodiment, a method for inducing apoptosis by contacting a synthetic lipid-mimicking receptor with a cell is provided. Also, provided herein are methods of using synthetic metal chelating receptors as a contrast agent in a patient in need of an MRI by delivering a synthetic metal chelating receptor into a cell population either in vivo, ex vivo or in vitro. Methods of this invention are useful for in vitro and in vivo applications.
In another embodiment, the present invention provides methods for synthesizing preferred membrane-binding elements, preferably cholesterylamine derivatives, including 3β-amino-5-cholestene (3β-cholesterylamine) and related 3β-halides. In another embodiment, the synthesis methods convert inexpensive cholesterol to 3β-amino-5- cholestene and related 3β-halides through a mechanism involving i-steroid and retro-j- steroid rearrangements.
BRIEF DESCRIPTION OF THE FIGURES The numbered receptors in Figures 1-13, 14-19, and 20-25 correspond with receptors in examples 1-14, 15-21, and 22-24 respectively.
Fig. 1. Structures of the small natural receptor ganglioside GMl, novel synthetic receptors, and related control compounds.
Fig. 2. The synthetic receptor targeting approach for enhancing cellular uptake of impermeable ligands. Synthetic mimics of cell surface receptors are added to living mammalian cells. These cells internalize cognate ligands such as macromolecular antibodies (IgG) bound to bacterial protein A (PrA) by synthetic receptor-mediated endocytosis.
Fig. 3. The construction of synthetic receptors by modifying a previously reported synthesis of 3beta-cholesterylamine. The reagents and the conditions that correspond with the figure are as follows: (a) Oxalyl chloride, DMSO, CH2Cl2, TEA, -78 0C. (b) L- Selectride, THF, -78 0C. (c) PPh3, HN3, DEAD, benzene, (d) LiAlH4, Et2O, 0 0C. (e) 2-
Nitrobenzensulfonyl chloride, DIEA, THF. (f) Boc-3-chloropropylamine, K2CO3, DMA, 120 0C. (g) TFA, CH2Cl2 (2:25), (h) 2,4-Dinitrophenylaminocaproate NHS ester, DIEA, CH2Cl2, (i) PhSH, K2CO3, THF/DMF (1:4), (j) 6-(N-(7-nitrobenz-2-oxa-l,3-diazol-4- yl)amino)hexanoic acid succinimidyl ester, DIEA, CH2Cl2. (k) Boc-β-alanine NHS ester, DIEA, CH2Cl2, (1) 5-carboxyoregongreen NHS ester, DIEA, DMF.
Fig. 4. Determination of the apparent affinities of DNP (27, Panel A) and NBD (28, Panel B) derivatives for rabbit polyclonal anti-DNP IgG (Sigma) by fluorescence polarization. The fluorescein moiety of 27 is shown in the dianionic form that predominates at pH 7.4. l Fixed concentrations of 27 (20 nM) and 28 (100 nM) in PBS (pH 7.4, 100 μL) were employed. The data shown in Panel B was corrected to compensate for partial binding-induced quenching of the NBD fluorophore.2'3 These experiments were run in triplicate, and errors reflect 95% confidence intervals.
Fig. 5. Analysis of uptake of red fluorescent anti-DNP / PrA-AF633 by cells treated with the green fluorescent receptors 6-9. Jurkat lymphocytes were treated with receptors 6-9 (10 μM) for 1 h followed by addition of anti-DNP / PrA-AF633 for 4 h. Cells were washed with media containing 6-(2,4-dinitrophenyl) aminohexanoic acid (100 μM) to remove any non-internalized protein prior to analysis by flow cytometry. Panel A: Median green (NBD) and red (AF633) cellular fluorescence resulting from treatment with 6-9 and anti-DNP / PrA-AF633. Panels B-E: the distribution of green and red cellular fluorescence after treatment with anti-DNP / PrA-AF633 alone or receptor 6 (10 μM) and anti-DNP / PrA-AF633. UV absorbance measurements were employed to equalize receptor concentrations prior to addition to cells. Total cellular fluorescence from the NBD groups of receptors 6-9 was within two-fold.
Fig. 6. Confocal laser scanning and DIC microscopy of living Jurkat lymphocytes treated with green fluorescent receptor 9 (10 μM) and red fluorescent BODIPY TR ceramide (5 μM) as a probe of the golgi apparatus and nuclear membrane. Yellow pixels indicate colocalization of green and red fluorophores. These experiments revealed that the ineffective receptor 9 (the iV-acyl analogue) exhibits a unique intracellular localization compared with receptors 6-8. Fig. 7. Confocal laser scanning and DIC microscopy of living Jurkat lymphocytes transfected with the green fluorescent late endosome / lysosome marker EGFP-lgpl204 and subjected to ligand uptake mediated by receptor 2. Transfected cells were treated with
receptor 2 (10 μM) for 1 h followed by addition of red fluorescent anti-DNP / PrA-AF594 for 4 h. Yellow pixels indicate colocalization of green and red fhiorophores.
Fig. 8. Synthetic receptor-mediated uptake of protein ligands in Jurkat lymphocytes. Cells were pretreated with receptors for one hour at 37 0C prior to addition of an anti-DNP IgG/PrA complex. Panel A. Confocal laser scanning and differential interference contract (DIC) microscopy of cells treated with green fluorescent receptor 6 (10 μM) followed by the addition of red anti-DNP/PrA-AF594 (for 4 hours). Yellow pixels indicate the localization of green and red fluorophores. Panel B: Dose-dependent magnitude of uptake of anti-DNP/PrA-AF488 quantified by flow cytometry after 4 hours. Right: Competitive inhibition of this uptake (mediated by receptor 2, 1 μM) by addition of 6-(2, 4-dinitrophenyl) aminohexanoic acid (DNP-CO2H). Panel C: Kinetics of uptake of anti-DNP / PrA-AF488 quantified by flow cytometry. Left: Relative differences in receptor uptake rates quantified by accumulation of cellular fluorescence. Right: Determination of the rate and half- life of ligand internalization mediated by receptor 2 at 1 μM.
Fig. 9. Subcellular localization of synthetic receptors in living Jurkat lymphocytes. Panel A: DIC (left images) and epifluorescence micrographs (right images) of cells treated for 1 hour with green fluorescent receptors 6-9 (10 μM). Panel B: Quantification of cell surface fluorescence by sodium dithionite quenching of exposed fluorophores. Cells treated as shown in Panel A were washed with sodium dithionite (5 mM) for 10 seconds at 220C and residual fluorescence quantified by flow cytometry. Panel C: Quantification of the cellular half- life of receptor 2. Cells were treated with 2 (10 μM) for 1 hour, resuspended in receptor-free media for the times indicated, and 2 was detected on the cell surface with anti-DNP/PrA-AF488. Fig. 10. Cycling of receptor 6 between cell surface and intracellular endo somes in
Jurkat lymphocytes. Panels A-E: DIC (left) and epifluorescence (right) micrographs of cells captured after treatment with 6 (10 μM, 1 hour) followed by quenching of cell surface fluorophores at 40C with sodium dithionite (30 mM, 5 min). Cells were washed with ice- cold media (time = 0 minutes, Panel A), split up into two portions, and return of green fluorescence to the cell surface was examined as a function of time and temperature
(Panels A-C). Cells were again cooled to 40C prior to detection of NBD headgroups at the cell surface with red fluorescent anti-DNP/PrA-AF633 by epifluorescence microscopy
(Panels D-E, time = 30 minutes) and flow cytometry (Panel F, time = 30 minutes). NBD fluorescence is shown in the panels A-C, PrA-AF633 florescence is shown in panels D-F.
Fig. 11. Quantification of efflux kinetics of receptor 10 from endosomes to the plasma membrane of Jurkat lymphocytes by back exchange. Cells treated with 10 (1 μM, 1 hour) were cooled to 40C and cell surface fluorophores removed (>90%) by repeated washing with ice-cold back exchange media containing BSA (1%) and methyl-β- cyclodextrin (2 mM). Cells were resuspended in back exchange media at 370C to resume recycling, cellular fluorescence was quantified by flow cytometry, and loss of fluorescence was evaluated with a one-site exponential decay model. Fig. 12. Association of receptor-ligand complexes with putative lipid raft functions of plasma membranes of Jurkat lymphocytes. Panel A: Cells were treated with AF488- labeled protein ligand for 30 minutes at 40C. Panel B: Cells were treated with receptors 2- 5 (1 μM) for 1 hour at 370C followed by anti-DNP-AF488 for 30 minutes at 40C. Cells fractionated by ultracentrifugation for 20 hours at 40C in a 2% to 40% sucrose step gradient containing 0.2% Triton-X. CT-B: Cholera toxin B subunit.
Fig. 13. A simple model of synthetic receptor-mediated endocytosis. Synthetic receptors embedded in cellular plasma membranes rapidly cycle between the cell surface and intracellular endosomes. Binding of the ligand (IgG) results in association with lipid rafts and uptake of the complex by endocytosis. Dissociation in endosomes frees the receptor to return to the cell surface. The protein ligand is sorted to late endosomes and lysosomes.
Fig. 14. Structures of the antibiotic vancomycin (1) and a green fluorescent derivative oregon green vancomycin (2).
Fig. 15. Structures of a vancomycin-binding synthetic receptor bearing a D-Phe-D- Ala motif (3), a related L-Phe-L-Ala analogue that does not bind vancomycin (4), and an amide analogue that binds vancomycin but exhibits a lower affinity for the cellular plasma membrane (5).
Fig. 16. The synthetic receptor targeting strategy for endocytic delivery of vancomycin (1). The synthetic receptor targeting approach for enhancing the effectiveness of poorly permeable drugs such as vancomycin against intracellular pathogens such as L. monocytogenes and S. auerus.
Fig. 17. Confocal laser scanning and differential interference contrast (DIC)
microscopy of living J-774 macrophages alone (Panel A) and infected with L. monocytogenes (Panel B). Prior to microscopy, receptor 2 (10 μM) was added to cells for 1 h, cells were washed to remove excess receptor, and fluorescent vancomycin (3, 3 μM) was added for 4 h. Scale bar: 10 μm. Fig. 18. Flow cytometric analysis of cellular uptake of fluorescent vancomycin 2 promoted by synthetic receptor 3 and control compounds. Preload conditions: Receptor 3 or analogues (4, 5) were added to cells for 1 h to load the plasma membrane, cells were washed, and 2 (3 μM) was added for 4 h. Premix conditions: Receptor 3 or analogues (4, 5) were preequilibrated with 2 (3 μM) at 23 0C for 1 h followed by addition of this mixture to cells for 4 h.
Fig. 19. Effects of premixed receptor 3 and vancomycin (1) on HeLa cells infected with L. monocytogenes. Infected cells were treated with 1 and 3 for 6 h at the concentrations indicated, then washed with media lacking antibiotics. Panel A: Viability of L. monocytogenes cultured from infected HeLa cells. BHI media was added, and bacterial growth was quantified by absorbance measurements after an additional 18 h. Panel B: DMEM media was added and viability of infected HeLa cells after an additional 30 h in culture quantified by flow cytometry.
Fig. 20. Synthetic receptor targeting of fluorescent vancomycin 2 to specific tissues in vivo. Mice were injected i.p. with compounds, tissues were isolated after 8 h, and cellular fluorescence was analyzed by flow cytometry. In the spleen, liver, heart, kidney, and pancreas, two different populations of cells were analyzed.
Fig. 21. SDS PAGE analysis of oligohistidine-tagged AcGFP proteins. Lane 1: Protein molecular weight marker. Lane 2: Crude lysate from cells expressing AcGFP(His)10. Lane 3: Purified AcGFP(His)10. Lane 4: Crude lysate from cells expressing AcGFP(His)6. Lane 5: Purified AcGFP(His)6.
Fig. 22. Delivery of oligohistidine-tagged AcGFP to endosomes and lysosomes. Jurkat lymphocytes were treated with synthetic receptor 1 (10 μM) at 370C for 1 h, the cells were washed with media, and Ni(OAc)2 (100 μM), green fluorescent AcGFP(HiS)1O (3.2 μM), and red fluorescent Dil-loaded LDL (50 μg / mL (~ 0.1 μM)) were added at 370C for an additional 4 h. Cells were imaged by confocal laser scanning (left) and DIC microscopy (right). Green fluorescence is shown in the upper left panel. Red fluorescence is shown in the lower left panel. Colocalization of green and red fluorescence is shown in
yellow overlaid on the DIC image in the lower right panel. Scale bar = 10 μm.
Fig. 23. Inhibition of protein uptake at 40C. Jurkat lymphocytes were treated with synthetic receptor 1 (10 μM) at 370C for 1 h, washed to remove unincorporated receptors, the cells were cooled to 40C, and AcGFP(His)10 (3.2 μM) and Ni(OAc)2 (100 μM) were added at 40C for 4 h. Cells were imaged by confocal laser scanning (left) and DIC microscopy (right). Scale bar = 10 μm.
Fig. 24. Confocal laser scanning (left) and differential interference contrast (right) micrographs of living Jurkat lymphocytes. Cellular plasma membranes were preloaded with receptor 1 (10 μM) for 1 h at 37 0C, cells were washed with fresh media, and media containing AcGFP-HiS10 (3.2 μM) and Ni(OAc)2 (100 μM) was added for an additional 4 h at 37 0C. Cells shown in Panel A were imaged immediately after this treatment. Cells shown in Panel B were washed with NTA (400 μM) prior to microscopy to remove non- internalized protein from the cell surface. Scale bar = 10 μm.
Fig. 25. Analysis of cellular uptake of His-tagged AcGFP proteins by flow cytometry. Each bar represents the average fluorescence of 10,000 cells. Unless otherwise noted, cellular plasma membranes of Jurkat lymphocytes were preloaded with receptor 1 (10 μM) for 1 h at 370C, cells were washed with fresh media, and His-tagged AcGFP (3.2 μM) / metal diacetate solution (100 μM) was added for 4 h at 370C. Prior to analysis, cells were washed with NTA (400 μM, 30 min) in PBS (pH 7.4) to remove bound surface protein. Panel A: Dose dependence of receptor-mediated uptake. Premix conditions: a solution containing receptor 1, Ni(OAc)2, and AcGFP(His)10 was added to cells for 4 h. Panel B: Dependence on [Ni(OAc)2]. Panel C: Omission control experiments. Panel D; Uptake of (His)6 and (HiS)1O fusion proteins promoted by different metal diacetates. Fig. 26. Uptake of fluorescent human IgG by FcR+ and FcR" human cells. Micrographs shown on the top. Confocal laser scanning and DIC images of human THP-I monocytes (left image) and human Jurkat lymphocytes (middle and right images) treated with green fluorescent human IgG. The Jurkat lymphocytes on the right were additionally treated with the synthetic Fc receptor (1 micromolar). sFcR: synthetic Fc receptor. Histogram shown on the bottom: Flow cytometric quantitation of cellular uptake of fluorescent human IgG by THP-I monocytes and Jurkat lymphocytes. sFcR: synthetic Fc receptor. PrA: Protein A, a competitor that binds to the Fc region of the IgG.
Fig. 27. Uptake of synthetic receptors by certain mammalian cells requires low- density lipoprotein (LDL). Jurkat lymphocytes in RPMI media (no serum) were treated for 5 min with the fluorescent synthetic receptor shown (10 μM) under conditions listed to the left of the images and imaged by confocal laser scanning (left) and DIC (middle) microscopy. Significant cellular fluorescence resulting from uptake of the synthetic receptor was only observed in the presence of LDL or FBS (containing LDL). These results illustrate the use of LDL as a delivery system for synthetic receptors.
Fig. 28. Examination of the conversion of mesylate (2) to 3β-azido-5-cholestene (3) using 1H NMR (400 MHz). Fig. 28A shows 1H NMR spectra of mesylate (2) before (bottom spectrum) and at selected time points after the addition of TMSN3 (1 equiv) and BF3-OEt2 (2 equiv) to mesylate (2) (0.5 mmol) in CDCl3 (0.5 mL). The arrows point to signals identified as the C6 proton of 6β-azido-3α, 5-cyclo-5α-cholestane (12). Fig. 28B shows the observed chemical shifts of mesulate (2), 6β-azido-3α,5-cyclo-5α-cholestane (12), and 3β-azido-5-cholestene (3).
DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENT
The present invention relates to new synthetic receptors. More particularly, the invention relates to methods for synthesizing preferred cholesterylamine-derived membrane-binding elements, preferably 3β-amino-5-cholestene (3β-cholesterylamine) and related 3β-halides through a mechanism involving i-steroid and retro-j-steroid rearrangements. Sun, Q. et ah, Practical Synthesis of 3beta-Amino-5-Cholestene and Related 3beta-Halides Involving i-Steroid and Retro-i-Steroid Rearrangements, Org. Lett. 2009, 11, 567-570. Additionally, the present invention relates to the use of the synthetic receptors for delivering a polymer, protein, peptide, drug, prodrug, nucleic acid, or small molecule into a target cell via receptor-mediated endocytosis. Thus, one aspect of the present invention is to deliver a desired protein, peptide, prodrug, or small molecule from the outside of a cell to the inside of a cell. The present inventors contemplate the use of synthetic receptors to treat a variety of diseases, conditions, and disorders, including those for which the conventional therapeutic alternatives are not very effective or are non- existent.
The present inventors are the first to recognize that synthetic receptors comprising membrane-binding elements of cholesterol, dihydrocholesterol, ergosterol, brassicasterol,
derivatives of cholesterol, dihydrocholesterol, ergosterol, brassicasterol, and related compounds thereof linked to a protein binding group provide a novel mechanism for receptor mediated endocytosis of the synthetic receptor bound to at least one specific protein and delivery of the protein to the endosome/lysosome. Briefly, when the synthetic receptors are added to living cells, the synthetic receptors' membrane-binding elements insert into the cell's plasma membranes, project a protein-binding motif from the cell surface so that the protein-binding motif binds a cognate protein. The synthetic receptor undergoes receptor-mediated endocytosis allowing the cell to internalize the conjugate of protein bound to the synthetic receptor. In addition, the synthetic receptors allow for cycling between plasma membranes and intracellular endosomes.
The synthetic receptor according to the invention may, in addition, be linked or conjugated to other molecules, including but not limited to for example, a labeling molecule which makes it possible, for example, to visualize the distribution or localization of the synthetic receptor after administration in vitro or in vivo. In another aspect of the invention, the protein that binds to the protein-binding motif may be labeled to visualize the distribution or localization of the protein-bound synthetic receptor after administration in vitro or in vivo.
One unique and novel aspect of the synthetic receptors described here is their ability to bind low-density lipoprotein (LDL) and / or other lipoproteins prior to their uptake by cells. Certain mammalian cells take up LDL loaded with synthetic receptors via natural LDL receptors expressed on the cell surface. This delivery mechanism enables targeting of these compounds to specific cells or tissues in vivo. Because tumors often over express natural LDL receptors, the synthetic receptors described here enable tumor or tissue targeting in vivo. Cell lines that lack LDL receptors or that possess other cholesterol uptake mechanisms can take up synthetic receptors through other mechanisms of action.
I. SYNTHETIC RECEPTORS
A. Synthetic Target-binding Receptors
In one embodiment of the invention, a synthetic receptor comprises a membrane- binding element and a target-binding motif. In another embodiment, a synthetic receptor comprises a membrane-binding element, a linker region, and a target-binding motif. The above and other features and advantages of the present invention will become more
apparent in the following description of the various embodiments in greater detail. One embodiment of a synthetic receptor is shown below:
Another embodiment of a synthetic receptor is shown below:
Another embodiment of a synthetic receptor is shown below:
Membrane-binding element
Another embodiment of a synthetic receptor is shown below:
Membrane-binding element
As used herein, the term "membrane-binding element" includes molecules that can be inserted into a lipid membrane through a hydrophobic anchor and allows the molecule to reside on the cell surface or reside on the cell surface and cycle between endosomes and cell surface. In one aspect of the invention, the membrane-binding element comprises proteins, peptides, peptidomimetics, phospholipids, sphingolipids, steroids, cholesterol, dihydrocholesterol, ergosterol, brassicasterol, derivatives of proteins, peptides, peptidomimetics, phospholipids, sphingolipids, steroids, cholesterol, dihydrocholesterol, ergosterol, brassicasterol, and related compounds thereof. In one aspect of the invention, the membrane-binding element comprises cholesterylamine, dihydrocholesterylamine, ergosterylamine, brassicasterylamine, derivatives of cholesterylamine, dihydrocholesterylamine, or ergosterylamine, brassicasterylamine, and related compounds thereof. In one aspect of the invention, the membrane-binding element comprises 3- cholesterylamine, 3-dihydrocholesterylamine, 3-ergosterylamine, derivatives of 3- cholesterylamine, 3-dihydrocholesterylamine, 3-ergosterylamine, or 3-brassicasterylamine, and related compounds thereof. As used herein, the term "derivative" refers to a chemical substance related structurally to another, i.e., an "original" substance, which can be referred to as a "parent" compound. The term "derivative" as used herein with reference to proteins, peptides, peptidomimetics, phospholipids, sphingolipids, steroids, cholesterol, dihydrocholesterol, ergosterol, brassicasterol, derivatives of cholesterol, dihydrocholesterol, ergosterol, brassicasterol, of the membrane-binding element of the present invention refers to a molecule that contains at least the portion of the proteins, peptides, peptidomimetics, phospholipids, sphingolipids, cholesterol, dihydrocholesterol, ergosterol, brassicasterol, derivatives of cholesterol, dihydrocholesterol, ergosterol, brassicasterol, and related compounds thereof that allows the molecule to insert into a cell plasma membrane. Examples of derivatives of cholesterol include cholesteryl esters and cholesteryl carbamates. The term "derivative" as used herein with reference to 3- cholesterylamine, 3-dihydrocholesterylamine, or 3-ergosterylamine of the membrane-
binding element of the present invention refers to a molecule that contains at least the portion of the 3-cholesterylamine, 3-dihydrocholesterylamine, 3-ergosterylamine, or 3- brassicasterylamine, that allows the molecule to insert into a cell plasma membrane. The term "derivative" as used herein with reference to 3β-cholesterylamine, 3β- dihydrocholesterylamine, 3β-ergosterylamine, or 3β-brassicasterylamine of the membrane- binding element of the present invention refers to a molecule that contains at least the portion of the 3β-cholesterylamine, 3β-dihydrocholesterylamine, 3β-ergosterylamine or 3β- brassicasterylamine that allows the molecule to insert into a cell plasma membrane. Examples of derivatives of 3 β -cholesterylamine include, without limitation, N-alkyl, N- aryl, and N-acyl 3 β -cholesterylamines. As used herein, the term "related compound" refers to a chemical molecule that associates with the cellular plasma membrane, is hydrophobic and has a positive charge, for example, a positive charge from an amine group, or has a polar functional group that allows the molecule to reside on the cell surface and yet cycle between the endosome and cell surface without becoming trapped intracellularly. Examples include without limitation a protonated cholesterylamine or a cholesteryl ester, cholesteryl amide, cholesteryl ether, or cholesteryl carbamate linked to another polar or non-polar headgroup. The membrane-binding element as described above can be used with any of the synthetic receptors of the present invention regardless of the various binding, chelating or mimicking motifs and/or use of a linker region. The present inventors also contemplate that a membrane-binding element with an affinity for membranes can be created by enhancing the hydrophobicity of the membrane- binding element domain (e.g., increasing the amount of hydrophobic residues or functional groups, replacing non-hydrophobic residues with hydrophobic residues, and swapping in a hydrophobic domain that consists of entirely hydrophobic residues). In another aspect of the present invention, as shown above, the synthetic receptor comprises a linker region that links the target-binding motif of the synthetic receptor to the membrane-binding element of the synthetic receptor. The linker region is structurally variable and can have one or multiple functions depending on the intended use of the receptor. For example, the linker region (shown as position X1 in the embodiments above) may include but is not limited to zero, one, or more atoms selected from the group of atoms, C, N, S, and O and/or other chain-extending atoms, zero, one, or more alkane, alkene, alkyne, aryl, ketone, amine, amide, ester, ether, urea, carbamate, heterocyclic, and
related functional groups, either linear or cyclic, zero, one, or more alpha, beta, gamma, and delta amino acids as well as aminohexanoic acid and related structures. These amino acid subunits may also include side-chains such as those found in natural L- and nonnatural D-configuration alpha amino acids or other amino acids. The linker may serve as a spacing group between the membrane-binding element and the protein-binding motif so as to minimize the possibility that the membrane-binding element will interfere with the interaction or binding of the binding motif with the target molecule, e.g., a peptide, protein, carbohydrate small molecule, drug, prodrug or nucleic acid that is to be internalized. The target molecule may be noncovalently bound or covalently linked to the target-binding motif. The linker may also facilitate association with LDL, with the cell surface, and rapid cycling between the cell surface and endosomes, as demonstrated by the present inventors in Example 11 and as discussed below. In addition, the linker region may contribute to receptor localization and ligand uptake efficiency. See Examples 8 and 9. The linker as described above can be used with any of the synthetic receptors of the present invention regardless of the differing membrane-binding elements or the various target-binding, chelating or mimicking motifs.
One embodiment of a synthetic protein-binding receptor is shown below:
Another embodiment of a synthetic protein-binding receptor is shown below:
Another embodiment of a synthetic protein-binding receptor is shown below:
Membrane-binding element
Referring to the embodiment shown above, the linker comprises zero, one or more atoms that may be selected from the group of atoms, C, N, S, and O and/or other chain- extending atoms repeated 0 to 100 or more times as indicated by the symbol x\.\. The linker region comprises one or more groups selected from the following: alkane, alkene, alkyne, aryl, ketone, amine, amide, ester, ether, urea, carbamate, heterocyclic, and related functional groups in position X1. These functional groups can be linear or cyclic. Furthermore, the linker may comprise 0 to 100 or more subunits such as alpha, beta, gamma, and delta amino acids as well as aminohexanoic acid and related structures with 0 to 100 or more atoms between the amine and carboxylic acid. These amino acid subunits may also include side-chains such as those found in natural L- and nonnatural D- configuration alpha amino acids or other amino acids.
In another aspect, the linker comprises one or more alpha amino acids, beta amino acids, gamma amino acids, delta amino acids, 6 aminohexanoic acid or related compounds to facilitate association with the cell surface and rapid cycling between the cell surface and endosomes. In another aspect, the linker region is located between the last amine of the cholesterylamine and the first amino acid of the protein-binding or other binding element. In another aspect, the linker region has at least three carbon atoms between the cholesterylamine and the first polar functional group (such as an amide).
Remarkably, the present inventors have found that modifying the linker region of the synthetic receptor effects the receptor localization and ligand uptake efficiency. The present inventors have found that insertion of amide derivatives of 3β-cholesterylamine in
the linker region of the receptor elicits certain effects in trafficking and expression of the receptor on the cell surface. For example, the present inventors have found that N-acyl derivatives of 3β-cholesterylamine in the linker region results in decreased expression of the receptor on the cell surface, especially when compared with the N-alkyl receptors containing β-alanine subunits in the linker. Fig. 10, Example 9. Thus, the linker plays a role in maintaining or increasing a synthetic receptor population on the cell surface by keeping the synthetic receptors cycling from the cell surface to the endosome back to the cell surface. In one aspect of the present invention, the linker region of the synthetic receptor comprises β-alanine subunits. Moreover, results with human Jurkat cell line indicate that these synthetic receptors mimic natural cell surface receptors, as evidenced by its temporal stability on the cell surface and rapid cycling between the cell surface and endosomes.
Interestingly, some receptors containing amide derivatives of 3β-cholesterylamine (N-acyl derivatives) traffic extensively to the golgi apparatus and nuclear membranes of living cells. Depending on the headgroup linked to lipids such as 3β-cholesterylamine derivatives, other N-acyl derivatives are similar to N-alkyl derivatives in membrane localization and trafficking. In one aspect of the present invention, the linker comprises an N-acyl derivative of 3β-cholesterylamine. In another aspect of the present invention, the linker comprises an N-aryl derivative of 3β-cholesterylamine. In another aspect of the present invention, the linker comprises an N-alkyl derivative of 3β-cholesterylamine.
In one aspect of the present invention, the synthetic receptor comprises a target- binding motif. As used herein, "target-binding motif" refers to a region in the receptor that recognizes and binds non-covalently or is covalently linked to a protein, a polypeptide, a peptide, an antibody, an immunoglobulin, a ligand, a cytokine, a growth factor, a nucleic acid, a lipid, membrane, a carbohydrate, a drug, a prodrug, a small molecule or a fragment thereof.
In another aspect of the present invention, the synthetic receptor comprises a protein-binding motif. As used herein, "protein-binding motif" refers to a region in the receptor that recognizes and binds non-covalently or is covalently linked to specific amino acid residues in the context of variable surrounding peptide or protein sequences. Thus, the term protein includes polypeptides, peptides, antibodies, and other protein ligands, including, for example, cytokines, growth factors, immunoglobulins, cell surface receptors,
antigens, or drugs or medicine, for example, peptide drugs, glycopeptide antibiotics such as vancomycin and teicoplanin.
In another aspect, the protein-binding motif comprises a protein, peptide, nucleic acid, or synthetic polymer that disrupts membranes of intracellular endosomes. In one embodiment, the protein includes but is not limited to a viral or bacterial fusogenic protein such as hemagglutinin or listeriolysin O or a fragment thereof. In another embodiment, the peptide includes but is not limited to the peptide termed GALA or endoporter. See Summerton JE. Endo-porter: a novel reagent for safe, effective delivery of substances into cells. Ann N Y Acad Sci. (2005) 1058: 62-75; Kakudo T, Chaki S, Futaki S, Nakase I, Akaji K, Kawakami T, Maruyama K, Kamiya H, Harashima H, Transferrin-modified Liposomes Equipped with a pH-sensitive Fusogenic Peptide: an Artificial Viral-like Delivery System Biochemistry (2004) 43: 5618-5628.
In another embodiment, the synthetic polymer includes but is not limited to poly (alkylacrylic acids) such as poly (2-propylacrylic acid) and salts thereof. In one embodiment, the present invention provides a synthetic receptor that is a synthetic immunoglobulin Fc receptor. In one aspect, the synthetic immunoglobulin Fc receptor has a Fc binding region and a membrane-binding element. In another aspect, the synthetic immunoglobulin Fc receptor has a Fc binding region, a linker region, and a membrane-binding element. The membrane-binding element's structure and function have been described above, and examples of the membrane-binding element include but are not limited to N-alkyl, N-aryl, or N-acyl derivatives of 3-cholesterylamine, 3- dihydrocholesterylamine, 3-ergosterylamine, 3-brassicasterylamine and related compounds.
The Fc binding region includes a protein including but not limited to the IgG- binding proteins: Protein A (from S. aureus), Protein G, Protein L, or Protein Z, a peptide, a cyclic peptide including but not limited to the minimized protein A variant termed Z34C, or a small molecule that binds the Fc fragment of immunoglobulins. One embodiment of the synthetic immunoglobulin Fc receptor is shown below:
Fc binding motif
In the embodiment shown above, the linker comprises atoms that may be selected from the group of atoms, C, N, S, and O and/or other chain-extending atoms repeated 0 to 100 or more times as indicated by the symbol n\. In another aspect, the linker region comprises one or more groups selected from the following: alkane, alkene, alkyne, aryl, ketone, amine, amide, ester, ether, urea, carbamate, heterocyclic, and related functional groups in position X1. These functional groups can be linear or cyclic. Furthermore, the linker may comprise 0 to 100 or more subunits such as alpha, beta, gamma, and delta amino acids as well as aminohexanoic acid and related structures with 0 to 100 or more atoms between the amine and carboxylic acid. These amino acid subunits may also include side-chains such as those found in natural L- and nonnatural D-configuration alpha amino acids or other amino acids. These and related synthetic immunoglobulin Fc receptors promote the cellular endocytosis of immunoglobulins by recruiting these proteins to cell surfaces. The synthetic immunoglobulin Fc receptor may also be used to control natural receptors on cell surfaces by providing additional stabilization with the cell surface of antibodies that target natural cell surface receptors. The synthetic immunoglobulin Fc receptor may also be used to deliver therapeutic antibodies into cells. These antibodies include neutralizing antibodies against intracellular bacteria, viruses, and other pathogens. Other therapeutic antibodies that target antigens involved in cellular proliferation may be delivered to interfere with the proliferation of cancer cells. Synthetic immunoglobulin Fc receptors can also be used to deliver IgG into cells in combination with an endosome disruptive agent such as membrane fusogenic proteins, peptides, or synthetic polymers to enable live cell immunolabeling of antigens such as immunofluorescence experiments or to
control intracellular processes by binding of targeted biomolecules. Other Fc-binding motifs such as substituted triazines (See: J. Comb. Chem. 2004, 6, 862-868) are known to those skilled in the art, and these and related Fc-binding compounds linked to membrane- binding elements are claimed in this application.
One embodiment of the synthetic immunoglobulin Fc receptor is shown below:
In one embodiment, the present invention provides a synthetic receptor that is a synthetic receptor for cytokines and growth factors. In one embodiment, a synthetic receptor for cytokines and growth factors comprises a cytokine or growth factor -binding motif and a membrane-binding element as described above. In another embodiment, a synthetic receptor for cytokines and growth factors comprises a cytokine or growth factor- binding motif, a linker region as described above, and a membrane-binding element as described above.
The cytokine or growth factor-binding motif may comprise a small molecule, an oligonucleotide, a carbohydrate, a peptide, or a protein-based binding motif that binds an extracellular cytokine or a growth factor. One embodiment of a synthetic receptor for binding cytokines and growth factors is shown below:
Another embodiment of a synthetic receptor for binding cytokines and growth factors is shown below:
Membrane-binding element
Another embodiment of a synthetic receptor for binding cytokines and growth factors is shown below:
Membrane-binding element
In the embodiment shown above, n\ comprises 0 to 100 or more atoms, X1 comprises one or more linker atoms or functional groups such as amines, amides, carbamates, ureas, esters, or ethers. In another aspect, X1 comprises 0 to 100 linker subunits such as alpha, beta, gamma, or delta amino acids as well as aminohexanoic acid and related structures with 0 to 100 or more atoms between the amine and the carboxylic acid.
In one embodiment, the present invention provides a synthetic receptor that is a synthetic drug delivery receptor. In one embodiment, the synthetic drug delivery receptor has a drug-binding motif and a membrane-binding element. In one embodiment, the synthetic drug delivery receptor has a drug-binding motif, a linker region, and a membrane-binding element. A membrane -binding element's structure and function has been described above. The drug-binding motif may bind non-covalently to drugs or prodrugs or be covalently linked to drugs or prodrugs.
In one aspect, the drug-binding motif comprises a protein, a linear or cyclic peptide, a small molecule, a carbohydrate or oligosaccaride, or a nucleic acid or oligonucleotide. In
another aspect, the drug-binding motif is capable of binding non-covalently to or is covalently linked to a drug, a prodrug, a small molecule, a linear or cyclic peptide, a protein, a carbohydrate or oligosaccaride, or a nucleic acid such as a DNA or RNA oligonucleotide, plasmid DNA, siRNA, or ribozyme. Binding of nucleic acids by the synthetic receptor may allow delivery of linear or plasmid DNA into cells for transfection as used in gene therapy, diagnostic, or other applications. Binding of RNA may allow delivery of RNA into cells for antisense or siRNA gene silencing applications. The drug- binding motif can include DNA or RNA intercalators such as ethidium bromide and related compounds or major-groove or minor-groove binding agents that bind nucleic acids. One embodiment of a synthetic drug delivery receptor is shown below:
Another embodiment of a synthetic drug delivery receptor is shown below:
Another embodiment of a synthetic drug delivery receptor is shown below:
Membrane-binding element
In the embodiment shown above, ni comprises 0 to 100 or more atoms, X1 comprises one or more linker atoms such as O, N, C, or S, or functional groups such as amines, amides, carbamates, ureas, esters, or ethers. In another aspect, X1 comprises 0 to 100 linker subunits such as alpha, beta, gamma, or delta amino acids as well as aminohexanoic acid and related structures with 0 to 100 or more atoms between the amine and the carboxylic acid.
In another embodiment, a synthetic drug delivery receptor has one or more drug- binding motif linked to N-alkyl, N-aryl, or N-acyl derivatives of cholesterylamine, dihydrocholesterylamine or ergosterylamine. Synthetic drug delivery receptors having more than one drug-binding motif can bind multiple drugs or increase the affinity for a specific drug through multivalent interactions to enhance efficacy.
One embodiment of a synthetic receptor for intracellular delivery and tissue targeting of the antibiotic vancomycin is shown below:
In the embodiment shown above, one aspect of the synthetic drug delivery receptor includes a vancomycin-binding motif as a drug-binding motif. In one aspect, the vancomycin-binding motif is ε-Ahx-D-Phe-D-Ala. In another aspect, the vancomycin- binding motif is D-AIa-D-AIa. In yet another aspect, the vancomycin-binding motif includes D-amino acids.
In another aspect of the present invention, the protein-binding motif of the receptor comprises 2,4-dinitrophenyl (DNP). In yet another embodiment, the protein-binding motif of the receptor comprises 7-nitrobenz-2-oxa-l,3-diazole (NBD) derivatives. Thus, the protein-binding motif of the synthetic receptor may selectively bind almost any desired protein or peptide.
The protein-binding embodiments of the invention include partial or complete amino acid sequences and functional equivalents to such molecules including, but not limited to, polypeptides having conservative and nonconservative amino acid substitutions, mutants and peptidomimetics that resemble these molecules. As used herein, the term "functional equivalents" refers to any modified version of a nucleotide or polypeptide which retains the basic function of its unmodified form. As an example, it is well-known that certain alterations in amino acid or nucleic acid sequences may not affect the polypeptide encoded by that molecule or the function of the polypeptide. It is also possible for deleted versions of a molecule to perform a particular function as well as the original molecule. Even where an alteration does affect whether and to what degree a particular function is performed, such altered molecules are included within the term "functional equivalent" provided that the function of the molecule is not so deleteriously affected as to render the molecule useless for its intended purpose. As used herein, the term "conserved amino acid substitutions" refers to the substitution of one amino acid for another at a given location in the peptide, where the substitution conserves the character of the amino acid residue. In making such changes, substitutions of like amino acid residues can be made on the basis of relative similarity of side-chain substituents, for example, their size, charge, hydrophobicity and hydrophilicity. The following eight groups each contain amino acids that are conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, 1984, Proteins).
In one embodiment of the present invention, the protein-binding motif of the synthetic receptor may be modified to enhance its binding affinity for the cognate protein using standard molecular techniques. See Maniatis and Sambrook et al, In Molecular Cloning: A Laboratory Manual, Cold Spring Harbor, N.Y., 1989. Additionally, methods of preparing the protein-binding embodiments of the invention through chemical synthesis and recombinant techniques are disclosed. In another aspect of the present invention, the synthetic receptors may be used to construct vaccines. Lipids are often linked to peptides or proteins to create vaccines (see J. Immunol. 2002, 169, 4905-4912). By linking the novel membrane anchors described in
this invention to peptides, proteins, lipids, carbohydrates, or nucleic acids, new synthetic vaccines can be constructed. In a preferred embodiment, the novel membrane anchor comprises a derivative of cholesterol, dihydrocholesterol, cholesterylamine, or dihydrocholesterylamine. B. Synthetic Metal Chelating Receptors
In another embodiment, the synthetic receptor of the present invention comprises a synthetic metal chelating receptor. In one aspect, the synthetic metal chelating receptor comprises a metal-binding motif and a membrane-binding element as described above. In one aspect, the synthetic metal chelating receptor comprises a metal-binding motif, a linker region as described above, and a membrane -binding element as described above.
The metal binding motif includes metal chelating groups, for example, nitrilotriacetic acid (NTA), ethylenediaminetetraacetic acid (EDTA), 1,4,7,10- tetraazacyclododecane-l,4,7,10-tetraacetic acid (DOTA), 10-(2-hydroxypropyl)-l,4,7,10- tetraazacyclododecane-l,4,7-triacetic acid (HP-DO3A), and (carboxymethyl) imino] bis (ethyleneitrilo) tetra-acetic acid (DTPA) that bind metal including but not limited to gadolinium, aluminum, lead, titanium, vanadium, chromium, manganese, iron, cobalt, nickel, copper, zinc, yttrium, zirconium, niobium, molybdenum, technetium, ruthenium, rhodium, palladium, silver, cadmium, hafnium, tantalum, tungsten, rhenium, osmium, iridium, platinum, gold, mercury, rutherfordium, dubnium, beryllium, magnesium, calcium, strontium, barium, radium. One embodiment of a synthetic metal chelating receptor is shown below:
Another embodiment of a synthetic metal chelating receptor is shown below:
Membrane-binding element
Another embodiment of a synthetic metal chelating receptor is shown below:
In the embodiment shown above, x\.\ comprises 0 to 100 or more atoms, X1 comprises one or more linker functional groups such as amines, amides, carbamates, ureas, esters, or ethers. In another aspect, X1 comprises 0 to 100 linker subunits such as alpha, beta, gamma, or delta amino acids as well as aminohexanoic acid and related structures with 0 to 100 or more atoms between the amine and the carboxylic acid.
In the embodiment shown above, one aspect of the synthetic metal-chelating receptor includes a NTA-binding motif as a metal-chelating motif.
The present inventors contemplate that the synthetic metal chelating receptors may be useful for MRI and other imaging applications. In another aspect of the present invention, synthetic metal chelating receptors may be delivered into a cell population ex vivo/in vitro and injected into a patient or delivered to a cell population in vivo in a patient in need of an MRI. The cell population displaying the synthetic metal chelating receptors or the synthetic metal chelating receptors themselves may be administered a site of interest in the patient, for example, by injection. The synthetic metal chelating receptors may be bound to metal ions prior to administration to the patient or they may bind metal ions in the
patient' s blood stream or any combination thereof, thereby acting as a MRI contrast agent. In one aspect, the synthetic metal chelating receptor can be used to reduce the level of iron or other metals in cells in need of such a reduction. In one aspect, the synthetic metal chelating receptor can be used to inhibit tumor cell growth. It is contemplated that the synthetic metal chelating receptor can be used in the treatment and prevention of the following medical conditions including, but are not limited to, cancer, inflammatory and infectious conditions, vasoreactive and vasoocclusive conditions, coronary and peripheral athlerosclerosis, parasitic diseases, neurologic and neuromuscular conditions, and viral conditions including AIDS. Additional medical conditions further include vasospasm, Parkinson's disease, Alzeihmer's disease, malaria, tuberculosis, arthritis, allergic and asthmatic conditions, hepatitis, coronary and peripheral vascular ischemia-reperfusion injury of blood vessels.
C. Synthetic Lipid-mimicking Receptors
In another embodiment, the synthetic receptor of the present invention comprises synthetic a lipid-mimicking receptor. In one aspect, the synthetic lipid-mimicking receptor comprises a lipid-mimicking motif and a membrane-binding element as described previously. In one aspect, the synthetic lipid-mimicking receptor comprises a lipid- mimicking motif, a linker region as described previously, and a membrane -binding element as described previously. C-reactive protein (CRP) is a protein that circulates in the human bloodstream and is a non-specific but sensitive marker of the acute inflammatory response. CRP binds to lipids on the surface of dead or dying cells. Normally lipids are packed very tightly on the surface of a cell so that CRP does not have access to bind these extracellular surface lipids. But in dead and dying cells, phosphatidylcholine lipids protrude allowing the CRP to bind to the cell, triggering an immune response. CRP can bind to complement factor CIq and factor H and activate the classic pathway of complement activation. In addition, CRP plays a part in the innate immunity (opsonization) and in the removal of membrane and nuclear material from necrotic cells.
The present inventors have found that when a synthetic lipid-mimicking receptor comprising phosphatidylcholine linked to a membrane-binding element is contacted with cells, the CRP recognizes the cells as dead or dying cells, binds the lipid-mimicking receptor, triggering an immune response, thereby promoting apoptosis of the cell.
The lipid-mimicking motif includes lipids that are found on dead and/or dying cells. For example, the lipid-mimicking motif includes without limitation phosphatidylcholine, phosphatidylserine, and phosphatidylethanolamine or components thereof such as the headgroups phosphocholine, phosphoserine, and phosphoethanolamine. One embodiment of a synthetic lipid-mimicking receptor of the present invention is shown below:
Another embodiment of a synthetic lipid-mimicking receptor of the present invention is shown below:
Membrane-binding element
Another embodiment of a synthetic lipid-mimicking receptor of the present invention is shown below:
In the embodiment shown above, xs.\ comprises 0 to 100 or more atoms, X1 comprises one or more linker atoms or functional groups such as amines, amides, carbamates, ureas, esters, or ethers. In another aspect, X1 comprises 0 to 100 linker subunits such as alpha, beta, gamma, or delta amino acids as well as aminohexanoic acid
and related structures with 0 to 100 or more atoms between the amine and the carboxylic acid.
One embodiment of a synthetic lipid-mimicking receptor that mimics phosphatidylcholine exposed on the surface of dead or dying cells is shown below:
Phosphocholine Linker region Membrane-binding element
In one aspect, the synthetic lipid-mimicking receptor can be used to induce apoptosis. By mimicking phosphatidylcholine exposed on the surface of dead and dying cells, the synthetic lipid-mimicking receptor that mimics phosphatidylcholine shown above inserted into a cell membrane binds C-reactive protein to induce cellular apoptosis. In one embodiment, the present invention provides a method for stimulating an immune response against cells. As used herein, "stimulating an immune response" means increasing the amount of a component of the immune system or the activity by which a component of the immune system is characterized, increasing the amount of a receptor present on the surface of an immune cell, or increasing the number of immune cells present in the mammal.
In one embodiment, the present invention provides a method for inducing apoptosis by contacting the synthetic lipid-mimicking receptor with a cell. In one aspect, the cell is a tumor cell. By way of example, the following standard techniques can be used to measure the induction of apoptosis caused in a target cell after it is contacted with a synthetic lipid- mimicking receptor of the present invention. For example, apoptosis can be examined or measured in a variety of ways including the detection of morphological indicia of apoptosis (e.g., membrane blebbing, chromatin condensation and fragmentation, and formation of apoptotic bodies), TUNEL (Terminal end-labeling of broken DNA fragments with labeled nucleotides ) staining, measuring of DNA laddering, measuring known caspase substrate degradation (e.g., PARP; Taylor et al, J. Neurochem. 68:1598-605, 1997) and counting dying cells, which have become susceptible to dye uptake. Many companies (e.g., Trevigen, Gaithersburg Md., and R&D Systems, Minneapolis Minn.) also supply commercially available kits useful for the measurement of apoptosis by various methods.
The method of contacting the cell with a synthetic lipid-mimicking receptor, the amount of the synthetic lipid-mimicking receptor administered, the appropriate incubation time with the synthetic lipid-mimicking receptor are well known to those of ordinary skill in the art. In addition, known inhibitors of apoptotic pathways, for instance caspase inhibitors, can be used to compare the effectiveness of synthetic lipid-mimicking receptors of this invention. Appropriate inhibitors include viral caspase inhibitors like crmA and baculovirus p35, and peptide-type caspase inhibitors including zVAD-fink, YVAD- and DEVD-type inhibitors. See Rubin, British Med. Bulle., 53:617-631, 1997.
In another aspect of the present invention, related synthetic receptors incorporating phosphoserine and phosphoethanolamine derivatives can be transported to the inner leaflet of cellular plasma membranes (or displayed on the cell surface, depending on the receptor structure) and by projecting target-binding, chelating, or mimicking groups into the extracellular environment or cellular cytoplasm can be useful for controlling cellular signal transduction, cellular proliferation, and other biological processes. D. Synthetic Transmembrane Receptors
In another embodiment, the synthetic receptors of the present invention comprise a synthetic transmembrane receptor. In one aspect, the synthetic transmembrane receptor comprises at least two binding motifs and at least two membrane-binding elements. In one embodiment, the synthetic transmembrane receptor comprises a binding motif linked to a first linker region that is in turn linked to a first membrane-binding element. The first membrane-binding element is linked to a second linker region linked to a second membrane-binding element which is linked to a third linker region. The third linker region is linked to a second binding motif.
In one aspect of the invention, the binding motif comprises a small molecule, an oligonucleotide, a carbohydrate, a peptide, or a protein capable of binding noncovalently or covalently linked to a biomolecule, including a small molecule, an oligonucleotide, a carbohydrate, a peptide, a protein, or a drug. In another aspect, the binding motif includes but is not limited to a protein-binding motif, a drug-binding motif, a lipid-binding motif, or a metal-binding motif as described above. Suitable linker regions and membrane-binding elements for use with the synthetic receptors and synthetic transmembrane receptors of the present invention have been described above in detail.
One embodiment of a synthetic transmembrane receptor of the present invention is shown below:
Membrane-binding element
Another embodiment of a synthetic transmembrane receptor of the present invention is shown below:
Membrane-binding element
Another embodiment of a synthetic transmembrane receptor of the present invention is shown below:
Membrane-binding element
Another embodiment of a synthetic transmembrane receptor of the present invention is shown below:
Membrane-binding element
In the embodiments shown above, n\ and n2 comprise 0 to 100 or more atoms, the Linker comprises zero, one, or more linker functional groups such as amines, amides,
carbamates, ureas, esters, or ethers. These functional groups can be linear or cyclic. In another aspect, the Lipid region is a natural or nonnatural phospholipid, sphingolipid, or sterol or derivative thereof. In another aspect, X1, X2, or X3 Linker regions comprise 0 to 100 linker subunits such as natural or nonnatural alpha, beta, gamma, or delta amino acids as well as aminohexanoic acid and related structures with 0 to 100 or more atoms between the amine and the carboxylic acid. In another aspect, X1, X2, or X3 Linker regions may comprise a fully saturated alkane of zero to 100 carbon atoms or an alkane of zero to 100 carbon atoms that includes one or more alkene or alkyne functional groups. In another aspect, the linker regions comprise zero, one or more groups selected from the following: alkane, alkene, alkyne, aryl, ketone, amine, amide, ester, ether, urea, carbamate, heterocyclic, and related functional groups in positions X1, X2, or X3. Furthermore, X1, X2, or X3 linker regions may comprise 0 to 100 or more subunits such as alpha, beta, gamma, and delta amino acids as well as aminohexanoic acid and related structures with 0 to 100 or more atoms between the amine and carboxylic acid. These amino acid subunits may also include side-chains such as those found in natural L- and nonnatural D-configuration alpha amino acids or other amino acids.
In one aspect of the synthetic transmembrane receptor, at least one binding motif is located intracellularly. The intracellular binding motif may bind or mimic proteins or or other biomolecules or bind or associate with cytoplasmic domains of other proteins, lipids, carbohydrates, or receptors known to activate various messenger systems. In another aspect of the synthetic transmembrane receptor, at least one binding motif is located extracellularly. The extracellular binding motif as described previously may bind noncovalently or be covalently linked to proteins, drugs, prodrugs, carbohydrates, nucleic acids, lipids or other biomolecules, including those associated with ligand binding and/or signal transduction. The synthetic transmembrane receptor may be part of a protein which is monomeric, homodimeric, heterodimeric, or associated with a larger number of proteins in a non-covalent or disulfide-bonded complex.
These and related synthetic transmembrane receptor span cellular plasma membranes and can bind both extracellular and intracellular biomolecules. The receptors of the present invention can be useful for modifying or mediating cellular signal transduction, proliferation, apoptosis, endocytosis, cellular transfection, and drug delivery. For example, cytotoxic CD8+ T cells (CTLs) which have synthetic transmembrane
receptors inserted to their cell membrane where the synthetic transmembrane receptors contain an extracellular binding domain which recognizes specific antigens can be used to augment proliferation and/or killing of infected cells in a variety of viral, and parasitic diseases, where the infected cells express the antigens from the pathogen.
One embodiment of a synthetic transmembrane receptor that binds extracellular antifluorescein antibodies and intracellular streptavidin protein is shown below:
According to the present invention, an unlimited number of differing synthetic receptors can be generated. One skilled in the art would be familiar with standard methods of making a synthetic receptor. For example, the membrane-binding element may be prepared by chemical synthesis. (See E. J. Corey. THE LOGIC OF CHEMICAL SYNTHESIS, Wiley-Interscience, New Ed edition (1995) and K. C. Nicolaou. CLASSICS IN TOTAL SYNTHESIS, Wiley- VCH (1996)) See also Examples section.
The linker region may be prepared using standard techniques known to those skilled in the art or purchased from commercially available sources. See, for example, Thermo Electron Corporation, world wide web at thermo.com. A wide variety of linkers are known in the art for linking two molecules together, particularly, for linking a moiety such as cholesterylamine or its derivative to a peptide, all of which are included within the scope of the present invention. For example, a cholesterylamine membrane-binding element may be synthesized as described above and then a linker added as an intact unit using standard techniques, for example, amide bond formation reactions or the linker may be sequentially added to the membrane-binding element using standard chemical synthesis methods, for example, using protecting groups such as trifluoro acetyl or Fmoc or Boc, and selective deprotection of a protecting group to couple the linker to the membrane-binding element.
Examples of classes of linkers that may be used include but are not limited to amino acids, such as those described in Boonyarattanakalin, S.; Martin, S. E.; Dykstra, S. A.; Peterson, B. R. /. Am. Chem. Soc. 2004, 126, 16379-16386. The determination of an appropriate linker that allows for cycling between the cell surface and the endosomes can
be determined using the assays detailed in the present disclosure. In addition, the linkers may influence receptor localization and ligand uptake efficiency which may be determined by performing standard assays including but not limited to fluorescence based assays, microscopy, flow cytometry to measure the amount of the synthetic receptor on the cell surface using an antibody directed against the protein-binding motif or an antibody directed against a protein bound by the synthetic receptor as described in Examples 6 and 22.
The protein-binding domain may be prepared using standard techniques. Appropriate molecular biological techniques may be found in Maniatis and Sambrook et al, In Molecular Cloning: A Laboratory Manual, Cold Spring Harbor, N. Y., 1989. The protein binding domain can be prepared by chemical synthesis methods (such as solid phase peptide synthesis) using techniques known in the art such as those set forth by Merrifield et al., J. Am. Chem. Soc. 85:2149 (1964), Houghten et al., Proc. Natl. Acad. Sci. USA, 82:51:32 (1985), Stewart and Young (Solid phase peptide synthesis, Pierce Chem Co., Rockford, 111. (1984), and Creighton, 1983, Proteins: Structures and Molecular Principles, W. H. Freeman & Co., N. Y. herein incorporated by reference.
The protein-binding motif can be coupled to the linker using standard techniques, including, for example, standard techniques such as amide bond formation reactions or the linker may be sequentially added to the membrane-binding element using standard chemical synthesis methods, for example, using protecting groups such as trifluoroacetyl or Fmoc or Boc, and selective deprotection of a protecting group, followed by addition of a coupling reagent, to couple the linker to the membrane-binding element.
The present inventors contemplate that the protein-binding motif can bind known binding proteins, such as vancomycin, or used to identify new binding proteins or partners not yet identified. To determine whether a protein binds the protein binding motif of the synthetic receptor, the synthetic receptor is allowed to contact the cell surface of a cell and fluorescence based assays or functional assays are used to detect proteins that bind to the protein-binding motif of the synthetic receptor inserted into the cell's membrane. See Examples 6 and 22. Protein-protein interactions between a protein and the protein binding motif of the synthetic receptor can be determined using two-hybrid systems (Field & Song, Nature 340:245-246 (1989); Chien et al., Proc. Natl. Acad. Sci. USA 88:9578-9582 (1991); and Young K H, Biol. Reprod. 58:302-311 (1998), GST/HIS pull down assays, mutant operators (Granger et al., WO 98/01879) and the like (See also Mathis G., Clin. Chem.
41:139-147 (1995); Lam K. S. Anticancer Drug Res., 12:145-167 (1997); and Phizicky et al, Microbiol. Rev. 59:94-123 (1995).
Several embodiments of the invention have biotechnological, diagnostic, and therapeutic use. When the receptors of the present invention are contacted with living mammalian cells, these receptors insert in the cellular plasma membrane, project the protein-binding motifs from the cell surface, bind the proteins and internalize them through endocytosis. As used herein, the various forms of the term "contact", "contacting", "contacted", etc. (i.e., contacting a synthetic receptor with a cell) is intended to include incubating the synthetic receptor and the cell together in vitro (e.g., adding the synthetic receptor to cells in culture) and administering the agent to a subject such that the synthetic receptor and cells of the subject are contacted in vivo. Any suitable method of contacting the synthetic receptor with cells may be used.
The present invention also provides a method for delivering a protein, peptide, nucleic acid, or small molecule into a cell. As used herein, the term "delivering" includes but is not limited to causing the protein to enter the cell. In one aspect of the invention, the method comprises contacting the synthetic receptors with the target cells. "Target cells" according to the invention is understood to include, without limitation, bacterial, fungal, plant, insect, avian, reptilian, amphibian, and mammalian cells, including human or animal cells. Any suitable duration of growth of the target cells of contacting of the target cells with a synthetic receptor may be used in the present invention. There are no particular limitations to the different conditions in the culturing of the target cells and the methods that are ordinarily used may be carried out, where bacterial, fungal, plant, insect, avian, reptilian, amphibian, and mammalian cells are cultured in suitable media. General growth conditions for culturing the particular cells may be obtained from texts known in the art such as Bergey's Manual of Systematic Bacteriology, Vol.l, Williams and Wilkins, Baltimore/London (1984), N. R. Krieg, ed.; R. Ian Freshney. Culture of Animal Cells: A Manual of Basic Technique, 4th Edition Wiley- Liss; 4 edition (2000); Victor Vinci. Handbook of Industrial Cell Culture: Mammalian, Microbial, and Plant Cells. Humana Press (2003); The Mycota: A Comprehensive Treatise on Fungi as Experimental Systems for Basic and Applied Research, Volume VIII: Biology of the Fungal Cell. Springer; first edition (2001); Insect Cell Culture Engineering (Biotechnology and Bioprocessing Series).
Marcel Dekker. (1993). The introduction of the protein may be confirmed by any means known to one skilled in the art, including for example, immunofluorescence microscopy, confocal laser scanning microscopy, flow cytometry, and ELISA assays.
Among the effects observed from the present invention is the synthetic cell surface receptors' stability, dynamic cycling between the plasma membrane and intracellular endosomes, targeting of ligands to proposed cholesterol and sphingolipid-enriched lipid raft membrane microdomains, and delivery of protein or drug ligands to late endosomes/lysosomes. Therefore, the synthetic receptors with modified linker regions have potential as cellular probes, as they confer dramatic differences in subcellular localization, and would provide useful as probes for cellular mechanisms that regulate the segregation, localization, and sorting of membrane-associated biomolecules.
Experiments have been performed wherein a fluorescent analog of a synthetic receptor was administered to a cell, a cell population, or animal, the insertion of the receptor was detected by excitation/emission spectra of the fluorophore. Thus, in one embodiment of the present invention, the synthetic receptor conjugated to a label or tag with or without the linker region described previously or constructed as a tagged small molecule, fusion protein, peptide, nucleic acid, or carbohydrate can also be utilized as a tool for visualizing cellular or subcellular localization, such as labeling of the cellular plasma membrane, endosomes, or other subcellular compartments, and protein trafficking or cycling from the cell surface to the endosome. The synthetic receptor conjugated to a fluorophore or otherwise tagged or labeled or a synthetic receptor analog can also be used to track or analyze cells in vitro or in vivo. For example, synthetic receptors conjugated to a fluorophore such as fluorescein or fluorescein analogues may be added to cells ex vivo and administered to a recipient. In such experiments, synthetic receptor conjugated to a fluorophore can be inserted into a cell or cell population and detected using standard techniques known to one skilled in the art, including for example, flow cytometry, fluorescence activated cell sorting, fluorescence microscopy, and other histological methods.
In another aspect, the synthetic receptors can be labeled with a detectable moiety. Detection of a synthetic receptor of the present invention can be facilitated by coupling (i.e., physically linking) the synthetic receptor to a detectable moiety. Examples of detectable moieties include various enzymes, prosthetic groups, fluorescent materials,
luminescent materials, bioluminescent materials, and radioactive materials. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; examples of bioluminescent materials include luciferase, luciferin, and aequorin, and examples of suitable radioactive material include I125, 1131, S35 or H3. The detectable moiety should be capable of producing, either directly or indirectly, a detectable signal. Any method known in the art for conjugating the synthetic receptor to the detectable moiety may be employed, including those methods described by Hunter et al., Nature, 144:945 (1962); David et al., Biochemistry, 13:1014 (1974); Pain et al., J. Immunol. Meth., 40:219 (1981); and Nygren, J. Histochem. and Cytochem., 30:407 (1982). In one embodiment of the invention, the synthetic receptor comprises a tag polypeptide which provides an epitope to which an anti-tag antibody can selectively bind. The epitope tag may be placed at the amino- or carboxyl-terminus of the synthetic receptor. The presence of such epitope-tagged forms of the synthetic receptor can be detected using an antibody against the tag polypeptide. Also, provision of the epitope tag enables the synthetic receptor to be readily purified by affinity purification using an anti-tag antibody or another type of affinity matrix that binds to the epitope tag. Various tag polypeptides and their respective antibodies are well known in the art. Examples include poly-histidine (poly-his) or poly-histidine-glycine (poly-his-gly) tags; the flu HA tag polypeptide and its antibody 12CA5 [Field et al., MoI. Cell. Biol., 8:2159-2165 (1988)]; the c-myc tag and the 8F9, 3C7, 6E10, G4, B7 and 9E10 antibodies thereto [Evan et al., Molecular and Cellular Biology, 5:3610-3616 (1985)]; and the Herpes Simplex virus glycoprotein D (gD) tag and its antibody [Paborsky et al., Protein Engineering, 3(6):547-553 (1990)]. Other tag polypeptides include the Flag-peptide [Hopp et al., BioTechnology, 6:1204-1210 (1988)]; the KT3 epitope peptide [Martin et al., Science, 255:192-194 (1992)]; an α-tubulin epitope peptide [Skinner et al., J. Biol. Chem., 266:15163-15166 (1991)]; and the T7 gene 10 protein peptide tag [Lutz-Freyermuth et al., Proc. Natl. Acad. ScL USA, 87:6393-6397 (1990)].
Thus, another aspect of the present invention, synthetic cellular receptors may be
used as mechanistic probes. In one aspect, the probe is a fluorescent analog of a synthetic receptor. These fluorescent analogs may contain diverse fluorophores, including for example, without limitation, NBD, fluorescein and its derivatives, for example, the red- shifted hexachlorofluorescein, texas red, rhodamine, coumarin derivatives, Cy3, AlexaFluor dyes, and fluorescent quantum dots.
The invention also relates to a method for delivering in vitro, ex vivo or in vivo at least one protein into target cells according to which the cell is brought into contact with a synthetic receptor bound to a protein according to the invention.
In another embodiment, the present invention provides a method of treating a disease, disorder, or condition comprising administering a therapeutically effective amount of a protein into a target cell using a synthetic cell receptor to a subject in need thereof. The synthetic receptor for delivering a protein into a cell comprises a protein-binding motif and a membrane-binding element. The membrane-binding element may include, for example, cholesterylamine, dihydrocholesterylamine, ergosterylamine, derivatives of cholesterylamine, dihydrocholesterylamine, ergosterylamine and related compounds thereof wherein the element anchors the receptor into a cell plasma membrane. As used herein, "therapeutically effective amount" refers to an amount that is effective in reducing, eliminating, treating, preventing or controlling the symptoms of diseases and conditions. The term "controlling" is intended to refer to all processes wherein there may be a slowing, interrupting, arresting, or stopping of the progression of the diseases and conditions described herein, but does not necessarily indicate a total elimination of all disease and condition symptoms, and is intended to include prophylactic treatment. In another embodiment, the method additionally comprises a synthetic receptor as described above and pharmaceutically acceptable carrier. Pharmaceutically acceptable carriers are generally added that are compatible with the active ingredients and acceptable for pharmaceutical use. Combinations of carriers may also be used. Pharmaceutically acceptable carriers include but are not limited to cyclodextrins, Low-Density Lipoprotein (LDL), and High-Density Lipoprotein (HDL). One of ordinary skill in the art would be familiar with pharmaceutically acceptable carriers and it is described, by way of example, in Remington's Pharmaceutical Sciences, 18th Edition, Mack Publishing Company,
Pennsylvania, USA. Except insofar as any conventional media or agent is incompatible with the active ingredient, use thereof in the pharmaceutical compositions of the present
invention is contemplated.
In one aspect, a pharmaceutical composition for treating a disease, disorder, or condition comprises a pharmaceutically acceptable carrier and a synthetic cell receptor for delivering a protein into a cell where the receptor comprises a protein-or target-binding motif and a membrane-binding element. The membrane-binding element may include cholesterylamine, dihydrocholesterylamine, ergosterylamine, derivatives of cholesterylamine, dihydrocholesterylamine, ergosterylamine and related compounds thereof to anchor into a cell plasma membrane. In one aspect of the present invention, the synthetic receptor bound to a protein according to the invention can be used to treat a disease, disorder, or condition, or as a prophylactic. Accordingly, the subject of the invention may be used in enzyme replacement therapy or to treat a variety of diseases, disorders, or conditions, including without limitation, viral, yeast, and bacterial infections, cancer, inflammation, and autoimmune diseases. In one aspect of the invention, the synthetic receptors may be used to deliver an enzyme to a cell in need of the enzyme replacement therapy. As used herein, unless otherwise defined in conjunction with specific diseases or disorders, the term "treating" refers to: (i) preventing a disease, disorder or condition from occurring in an animal or human that may be predisposed to the disease, disorder and/or condition but has not yet been diagnosed as having it; (ii) inhibiting the disease, disorder or condition, i.e., arresting its development; and/or (iii) relieving the disease, disorder or condition, i.e., causing regression of the disease, disorder and/or condition.
In another aspect of the current invention, synthetic receptors may be employed to deliver proteins, peptides, or small molecules that inhibit viruses that replicate in the cytoplasm. These proteins include, for example, nucleic acid aptamers or antibodies that bind proteins important in viral life cycles. Examples of viruses that replicate in the cytoplasm belong to the families: Picornaviridae, Caliciviridae, Togaviridae, Flaviviridae, Coronaviridae, Paramyxoviridae, Reoviridae, Bunyaviridae, Arenaviridae, Paramyxoviridae, Rhabdoviridae, Poxviridae, and Hepadnaviridae. This is important since many viruses do not have vaccines to provide immunity. Thus, the present invention offers new prospects for applications as tools for drug delivery.
Over time, many strains of gram-positive bacteria, such as Staphylococcus aureus, have evolved to become resistant to virtually all antibiotics. Often times, when no other
antibiotic is effective in killing bacterial pathogens, physicians turn to vancomycin, described as the drug of "last resort." A further impediment is that many antibiotics do not effectively permeate the cell's plasma membranes to reach its pathogenic target.
Remarkably, the present inventors have found a method for treating microbes that elude antibiotics and related glycopeptide antibiotics administered in a traditional manner. For example, Listeria moncytogenes (L. monocytogenes), a potentially fatal food-borne pathogen, eludes the antimicrobial activity of glycopeptide antibiotics by replicating in the cytoplasm of the mammalian cells. The present inventors have found that the present invention may be used to deliver vancomycin, a glycopeptide antibiotic, and/or other related glycopeptide antibiotics into the cytoplasm of cells infected with L. moncytogenes. As a control, the present inventors treated non-infected mammalian cells with a synthetic receptor containing an enhanced vancomycin-binding motif linked to 3β-cholesterylamine. The synthetic receptor bound the vancomycin derivative, underwent endocytosis, released the vancomycin derivative in the endosome/lysosome where it was degraded, allowing the synthetic receptor to recycle to the cell surface to recommence the delivery process. Thus, in one aspect of the present invention, once the protein-bound synthetic receptor has entered the cell, the endosome/lysosome in particular, the protein is released from the synthetic receptor.
However, in cells infected with L. moncytogenes, the pathogen secretes membrane- disruptive proteins that disrupt the integrity of the endosome so that the pathogen can escape from the endosome and replicate in the cytoplasm. The present invention capitalizes on this event so that when the synthetic receptor bound with vancomycin undergoes endocytosis, the vancomycin is delivered to the endosome, but escapes into the cytoplasm using the same route that the pathogen created. In this way, the antibiotic is able to encounter and bind L. monocytogenes, inhibiting the construction of the bacterial cell walls. Therefore, in another aspect, once the protein-bound synthetic receptor has entered the cell, the protein is released from the synthetic receptor and may enter the cytoplasm. The receptor is then free to recycle to the cell surface for additional rounds of delivery. Therefore, in one aspect of the present invention, the synthetic receptors have bacteriocidal or bacteriostatic effects as shown in viability assays. Examples 15-19.
Accordingly, these synthetic receptors with modified linker regions have unlimited potential to treat bacteria and viruses. As described, the present inventors have identified a
composition and method that effectively enhances the delivery of poorly permeable antibiotics, such as vancomycin or teicoplanin, to cells. This invention will provide an effective tool for the war on drug-resistant bacteria. Once internalized, the drug can accumulate within the cells where it has a therapeutic effect. Not only does the current invention deliver an antibiotic to the pathogenic replicative source but also does so in an efficient manner using any "custom-designed" binding motif. For example, in one embodiment of the present invention, the synthetic receptor contains an enhanced binding motif for vancomycin, resulting in improved affinity for the antibiotic.
In one aspect of the invention, a synthetic receptor having an ergosterol-derived membrane-binding element can be used to treat bacteria or yeast infections in a subject. In one aspect, the method comprises contacting a synthetic receptor with yeast or bacterial cells in vitro or in vivo, causing the synthetic receptor to insert into the cells' membranes, so that the yeast or bacterial cells displaying the synthetic receptors in vivo, for example, in a mammal, would be recognized as foreign by the mammal's immune system and destroyed. In another aspect, a synthetic receptor having an ergosterol-derived or brassicasterol-derived membrane -binding element can be used as probe in avian, reptilian, amphibian, insect, yeast, bacterial, or plant cells.
In still another aspect of the present invention, synthetic receptors may be used to modulate therapeutically important extracellular ligands. These ligands include but are not limited to cytokines, growth factors, hormones, antibodies, and angiogenic factors. These ligands are secreted by a number of cells and act through cell surface receptors to elicit biochemical responses in their target cells, such as cell differentiation and proliferation. The present invention contemplates the removal of extra-cellular ligands from circulation in physiological fluids, including, for example, blood, using synthetic receptors. Receptors displaying the desired ligand-binding motif would bind the cognate ligand, deliver the ligand to the endosome, where it would be released and degraded. The receptor would then be recycled back to the surface to bind and remove more ligands from circulation. This has been demonstrated by removal of antibodies from cell culture media using synthetic receptors bearing antibody-binding motifs. Therefore, use of the present invention to remove targeted ligands from circulation would allow for the modulation of the immune response, cellular proliferation such as cancer proliferation, or cellular differentiation. As used herein, the various forms of the term "modulating of the immune
response" means increasing or decreasing either the amount of a component of the immune system or the activity by which a component of the immune system is characterized, increasing or decreasing the amount of receptor present on the surface of an immune cell, or increasing or decreasing the number of immune cells present in the mammal. In the context of the use of a method of treatment in vivo according to the present invention, it is, in addition, a treatment designed deplete a patient of a particular protein.
In another aspect of the present invention, the synthetic receptors may be used to treat cancer. Many tumor cells do not express the necessary cell surface receptor to "take in" anti-cancer drugs or express the cell surface receptor at insufficient levels. However, by using the present invention, the drug can still be delivered. For example, cancer cells may become resistant to methotrexate by stopping production of the folate receptors. Thus, according to the present invention synthetic folate receptors can be expressed on the surface of tumor cells. The protein-binding motif of the synthetic folate receptor can then bind the anti-cancer drug methotrexate and undergo receptor-mediated endocytosis, thereby inhibiting the enzyme dihydrofolate reductase.
Another embodiment of the present invention includes receptors containing calixarenes as protein-binding motifs. Calixarenes can be prepared by those skilled in the art to bind the vascular epidermal growth factor (VEGF), platelet-derived growth factor (PDGF), and other proteins. These compounds could be used to remove these and related cancer-promoting growth factors from circulation to stop tumor growth or conversely could be used to activate receptors for these proteins by promoting the association of growth factors with cell surfaces.
Another embodiment of the present invention includes synthetic receptors containing cyclic peptides as protein binding motifs. Cyclic peptides can be prepared by those skilled in the art to bind immunoglobulins and other proteins. This would allow for modulation the immune system by promoting the endocytic destruction of antibodies such as antibodies involved in autoimmune diseases such as lupus and pemphigus. For example, cysteine-disulfide constrained cyclic peptides containing the sequence DCAWHLGELVWCT exhibit high affinity for the hinge region of human immunoglobulins. Other cyclic peptides can be identified by techniques such as phage display that bind to specific proteins.
The effective dose and method of administration of a particular synthetic receptor
thereof can vary based on the individual needs of the patient and the treatment or preventative measure sought. Therapeutic efficacy and toxicity of such compounds can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., ED50 (the dose therapeutically effective in 50% of the population). For example, the synthetic receptors discussed above, can be administered to the mice and the effect on certain tissues or cells can be determined using histology, flow cytometry, ELISA and other assays. The data obtained from these assays is then used in formulating a range of dosage for use with other organisms, including humans. The dosage varies within this range depending upon type of synthetic receptor or binding protein, the dosage form employed, sensitivity of the organism, and the route of administration.
Normal dosage amounts of various synthetic receptors can vary from approximately 1 to 100,000 micrograms, up to a total dose of about 10 grams, depending upon the route of administration. A constant infusion of the synthetic receptors can also be provided so as to maintain a stable concentration in the tissues as measured by blood levels. The exact dosage is chosen by the individual physician in view of the patient to be treated. Dosage and administration are adjusted to provide sufficient levels of the active moiety or to maintain the desired effect. Additional factors that can be taken into account include the severity of the disease, age of the organism, and weight or size of the organism; diet, time and frequency of administration, drug combination(s), reaction sensitivities, and tolerance/response to therapy. Synthetic receptors may be administered hourly, daily, weekly, monthly or as needed. Routes of administration of the synthetic receptors of the invention include, but are not limited to, topical, transdermal, parenteral, gastrointestinal, transbronchial, and transalveolar. Transdermal administration is accomplished by application of a cream, rinse, gel, etc. capable of allowing the pharmacologically active compounds to penetrate the skin. Parenteral routes of administration include, but are not limited to, electrical or direct injection such as direct injection into a central venous line, intravenous, intramuscular, intraperitoneal, intradermal, or subcutaneous injection. Gastrointestinal routes of administration include, but are not limited to, ingestion and rectal. Transbronchial and transalveolar routes of administration include, but are not limited to, inhalation, either via the mouth or intranasally.
Synthetic receptors of this invention that are suitable for transdermal or topical administration include, but are not limited to, pharmaceutically acceptable suspensions,
oils, creams, and ointments applied directly to the skin or incorporated into a protective carrier such as a transdermal device ("transdermal patch"). Examples of suitable creams, ointments, etc. can be found, for instance, in the Physician's Desk Reference. Examples of suitable transdermal devices are described, for instance, in U.S. Pat. No. 4,818,540 issued Apr. 4, 1989 to Chinen, et al., herein incorporated by reference.
Synthetic receptors of this invention that are suitable for parenteral administration include, but are not limited to, pharmaceutically acceptable sterile isotonic solutions. Such solutions include, but are not limited to, saline and phosphate buffered saline for injection into a central venous line, intravenous, intramuscular, intraperitoneal, intradermal, or subcutaneous injection.
Synthetic receptors of this invention that are suitable for transbronchial and transalveolar administration include, but not limited to, various types of aerosols for inhalation. Devices suitable for transbronchial and transalveolar administration of these are also embodiments. Such devices include, but are not limited to, atomizers and vaporizers. Many forms of currently available atomizers and vaporizers can be readily adapted to deliver compositions having the pharmacologically active compounds of the invention.
Synthetic receptors of this invention that are suitable for gastrointestinal administration include, but not limited to, pharmaceutically acceptable powders, pills or liquids for ingestion and suppositories for rectal administration. Once the synthetic receptors has been obtained, it can be administered to a organism in need to treat or prevent a disease, disorder, or condition.
The synthetic receptors according to the present invention can be administered orally, by subcutaneous or other injection, intravenously, intracerebrally, intramuscularly, parenternally, transdermally, nasally or rectally. The appropriate route of administration and dosage vary according to various parameters, for example the individual or disease to be treated or alternatively the polynucleotide to be transferred. The form in which the synthetic receptor is administered depends at least in part on the route by which the synthetic receptor is administered.
II. METHODS OF MAKING SYNTHETIC RECEPTORS COMPRISING MEMBRANE-BINDING ELEMENTS
The synthetic receptors described according to the present invention comprise a membrane-binding element linked to a protein-binding or other binding group in order to provide a novel mechanism for receptor-mediated endocytosis of the synthetic receptor and bound ligands. According to the invention, the membrane-binding element is preferably cholesterol, dihydrocholesterol, ergosterol, brassicasterol, or derivatives of cholesterol, dihydrocholesterol, ergosterol, brassicasterol, and related compounds thereof. The membrane-binding element according to the present invention may preferably be derived from the inexpensive and readily available source of cholesterol. According to the present invention, methods for the synthesis of 3β-amino-5-cholestene, related halides or steroid derivatives are described. According to a preferred embodiment, cholesterol is derived to form the cholesterol derivatives 3β-amino-5-cholestene, and related 3β-halides, including 3β-chloro-5-cholestene, 3β-bromo-5-cholestene and 3β-iodo-5-cholestene. More particularly, the present invention relates to the use of regiospecific, stereoselective and stereo specific sequential i-steroid and retro-j-steroid rearrangements for the synthesis of 3β-amino-5-cholestene, 3β-chloro-5-cholestene, 3β-bromo-5-cholestene, and 3β-iodo-5- cholestene from cholesterol.
According to the invention, the w-alkyl derivatives of 3β-amino-5-cholestene are preferably selected for the ability to insert into plasma membranes of living mammalian cells and cycle between the cell surface and early/recycling endosomes, mimicking the membrane trafficking of many cell surface receptors, and/or delivering molecules directly to the cytosol and nucleus of cells when linked to endosome disruptive peptides. See Peterson, B., Org. Biomol. Chem. 2005, 3, 3607-3612; Sun et al, J. Am. Chem. Soc. 2008, 130, 10064-10065.
The methods for synthesizing membrane-binding elements that are 3β-amino-5- cholestene, and related 3β-halides, may comprise synthesizing 3β-azido-5-cholestene by Vorbruggen-type coupling of electrophilic cholesterol derivatives. According to a preferred embodiment, the synthesis comprises reacting cholesterol or a cholesterol bearing a leaving group at the 3-position (including for example, cholesterol triflate, cholesterol mesylate, cholesterol tosylate or cholesteryl esters) with a Lewis acid in the presence of an azide. Preferrably, a Lewis acid catalyst may further be utilized at a temperature between minus 1500C to plus 2000C to obtain a reaction mixture containing 3β-azido-5-cholestene. According to one embodiment of the invention, a preferred Lewis acid catalyst is boron
trifluoride.
As used herein, the term "Lewis acid" may include for example, boron trifluoride, tin tetrachloride, aluminum trichloride, titanium tetrachloride, trimethylsilyl triflate, BBr3, SnCl4, ZnCl2, MgCl2, or MgBr2 Et2O or any salt thereof. As used herein, the term "azide" refers to any compound or derivative having the N3 "; moiety therein, including azide derivatives or salts thereof. The azide can be a silyl azide such as trimethylsilyl azide or a metal azide wherein the metal is an alkali metal such as potassium, sodium, lithium, rubidium or cesium. The metal can be a transition metal such as, but not limited to, iron, cobalt, nickel, copper or zinc. The azide of the present invention can also be an organic azide or ammonium azide.
According to the invention, the 3β-azido-5-cholestene (3) produced from the reaction with the Lewis acid and azide is next reacted with a reducing agent in a solvent to produce the desired 3β-amino-5-cholestene or related 3β-halide. According to the invention, various reducing agents and solvents may be utilized. Preferred reducing agents according to the synthesis methods described herein are lithium aluminium hydride or catalytic hydrogenation. Preferrably, the solvent used for the synthesis methods is dichloromethane. Alternatively, benzene or chloroform may be utilized. According to an embodiment, the solvent utilized does not result in diminishing the yield of the 3β-azido-5- cholestene or related 3β-halides. Solvents having heteroatoms that function as Lewis bases, including for example, tetrahydrofuran, acetone, diethyl ether, or DMF, are not preferred solvents according to the invention. One skilled in the art may ascertain additional solvents that may be utilized according to the present invention. The reaction time for synthesis according to the invention may vary from a few minutes to 18 hours, preferably from 2 hours to 12 hours. The synthesis reactions preferably occur at ambient temperature.
The methods of synthesis described herein provide high yields of the 3β-amino-5- cholestene and related 3β-halides for membrane -binding elements for use with the synthetic receptor according to the invention. According to a preferred embodiment of the invention, the Lewis acid BF3*OEt2 provides optimal yields of 3β-azido-5-cholestene. For example, according to a preferred embodiment, yields of 3β-azido-5-cholestene in excess of 90%, 91%, 92%, 93%, 94%, 95% and 96% may be observed. According to alternative embodiments, use of varying Lewis acids result in the synthesis of alterative related 3β-
halides. For example, SnCl4, TiCl4, and AlCl3 preferrably generate 3β-chloro-5- cholestene. According to the invention, yields of 3β-amino-5-cholestene and the related 3β-halides for use as membrane-binding elements according to the invention exceed at least about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95% and 96%. According to one embodiment of the present invention, i- steroid and retro-j- steroid rearrangements are promoted by a Lewis acid to synthesize the halides. According to the invention the Lewis acid converts the cholesterol derivative to a homoallylic carbocation that rapidly undergoes i-steroid rearrangement and/or retro-j- steroid rearrangement (Fig. 28). These novel synthesis methods are highly efficient, demonstrating high retention of 3β-stereochemistry configurations in high yields as a result of the non-classical carbocation forming a partial bond between C5 and C3 only on the alpha face of the steroid. Accordingly, the synthesis methods may be utilized for large-scale preparation of such halides with 3 β- stereochemistry, demonstrating significant improvement over the substitution reactions of cholesterol and derivatives which result in poor stereoselectivity, elimination, and rearrangement.
Embodiments of the present invention are further defined in the following non- limiting Examples. While the present invention is disclosed with reference to embodiments and examples detailed above, it is to be understood that these examples are intended in an illustrative rather than limiting sense, as it is contemplated that modifications will readily occur to those skilled in the art, which modifications will be within the spirit of the invention and the scope of the appended claims. From the above discussion and these Examples, one skilled in the art can ascertain the essential characteristics of this invention, and without departing from the spirit and scope thereof, can make various changes and modifications of the embodiments of the invention to adapt it to various usages and conditions.
All publications and patent applications in this specification are indicative of the level of ordinary skill in the art to which this invention pertains. The references cited in this application are incorporated herein in their entirety. All publications and patent applications are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated by reference.
EXAMPLE 1: Design and Synthesis of Receptors for Anti-DNP IgG Ligands.
The numbered receptors in examples 1-14 refer to those shown in Figures 1-13 and in examples 1-14. Synthetic receptors were designed that incorporate 2,4-dinitrophenyl (DNP) and structurally similar green fluorescent 7-nitrobenz-2-oxa-l,3-diazole (NBD) headgroups. These headgroups were linked to N-alkyl and N-acyl derivatives of 3β- cholesterylamine via tethers containing 6-aminohexanoic acid and β-alanine subunits as seen in FIG. 1.
EXAMPLE 2: Fluorescent Polarization Assays to Determine Binding Affinity
Between the Headgroups and Its Ligand. The affinity of DNP and NBD headgroups affinity for rabbit polyclonal anti-DNP IgG were evaluated using fluorescent derivatives.
Both DNP and fluorescent NBD derivatives bound tightly to this IgG with dissociation constants (Kd) values of 23 + 1.5 nM(DNP) and 820 + 144 nM.
EXAMPLE 3: Scheme Showing the Synthesis of 3β-Cholesterylamine and Derivatives from Cholesterol.
W-[3-(Phthalιmιdo)propyl]-W-(t- butyloxycarbonyl)-3β-cholesterylamιne
Reagents and conditions: (a) MsCl, DIEA, CH2Cl2, 4°C; (b) BF3 etherate, TMSN3, CH2Cl2; (c) LiAlH4, ether, 4°C; (d) 3-bromopropyl phthalimide, K2CO3, DMF, 55°C; (e) (Boc)2O, DIEA, CH2Cl2; (f) NH2NH2, EtOH, 500C; (g) ethyl 5-bromovalerate, K2CO3, 6O0C; (h) (BoC)2O, CH2Cl2; (i) LiOH, MeOH, THF.
The schematic of example 3 is illustrated above and conveys to one of ordinary
skill in the art the process. In word terms, it is as follows:
The present inventors have discovered a novel method for synthesis of 3β-azido-5- cholestene by Vorbruggen-type coupling of electrophilic cholesterol derivatives (shown as step b in the above scheme). In one aspect, the method for synthesis of 3β-azido-5- cholestene by Vorbruggen-type coupling of electrophilic cholesterol derivatives comprises reacting cholesterol or a cholesterol bearing a leaving group at the 3-position, for example, cholesterol triflate, cholesterol mesylate, cholesterol tosylate or cholesteryl esters, with a Lewis acid, for example, boron trifluoride etherate, in the presence of an azide, for example, a silyl azide such as trimethylsilyl azide, at a temperature between minus 1500C to plus 2000C and a Lewis acid catalyst to obtain a reaction mixture containing 3β-azido-5- cholestene.
The present inventors have discovered a novel method for synthesis of N-[3- (phthalimido)propyl]-N-cholesterylamine by SN2 reaction of cholesterylamine with an electrophile (shown as step d in the above scheme). In one aspect, the method for synthesis of N-[3-(phthalimido)propyl]-N-cholesterylamine by SN2 reaction of cholesterylamine with an electrophile comprises reacting cholesterylamine with 3-bromopropyl phthalimide, K2CO3, and DMF at a temperature between -78°C and 2500C.
The present inventors have discovered a novel method for synthesis of N-[3- (phthalimido)propyl]-N-(t-butyloxycarbonyl)-3β-cholesterylamine by nucleophilic acyl substitution of N-[3-(phthalimido)propyl]-3β-cholesterylamine (shown as step e in the above scheme). In one aspect, the method for synthesis of N-[3-(phthalimido)propyl]-N-(t- butyloxycarbonyl)-cholesterylamine by nucleophilic acyl substitution of N-[3- (phthalimido)propyl]-N-cholesterylamine comprises reacting N-[3-(phthalimido)propyl]- N-cholesterylamine with (Boc)2O, DIEA, CH2Cl2. The present inventors have discovered a novel method for synthesis of ethyl 5-
{(tert-butoxycarbonyl)[(3beta)-cholest-5-en-3-yl] amino} pentanoate (3). In one aspect, the method for synthesis of ethyl 5-{(tert-butoxycarbonyl)[(3beta)-cholest-5-en-3- yl] amino Jpentanoate comprises adding to DMF (10 mL) 3β-amino-5-cholestene (2, 386 mg, 1.0 mmol), ethyl 5 -bromo valerate (174 microL, 1.1 mmol) and K2CO3 (276 mg, 2.0 mmol), heating the solution to 600C, stirring the solution for 24 hours, cooling the reaction to 23°C, removing the DMF in vacuo to generate a solid residue, adding CH2Cl2 (10 mL) to the resulting solid residue, removing insoluble salts from residue by filtration, and washing
the solids with additional CH2Cl2 (5 niL) to generate a solution containing the crude secondary amine product, added (Boc)2O (327 mg, 1.5 mmol) and DIEA (0.5 rnL, 3.0 mmol) to the solution, stirring the reaction for 3 hours at 23°C, concentrating the reaction in vacuo, using Flash column chromatography (hexanes / ethyl acetate, 10: 1) to obtain 3 (417 mg, 68%) as a white solid. (See Example 17 of the present disclosure).
The present inventors contemplate that other Lewis acids may be used in these synthesis methods as exemplified in Table 1. Additional Lewis acids that may be used according to the invention include, without limitation, boron trifluoride, tin tetrachloride, aluminum trichloride, titanium tetrachloride or trimethylsilyl triflate, BBr3, SnCl4, ZnCl2, MgCl2, or MgBr2 Et2O. Based upon the present disclosure including the schemes and methods provided above, those skilled in the art would understand how to modify any part of these methods of synthesizing these compounds under various conditions and concentrations to achieve the desired result, including the use of or substitution of other solvents, bases, and lewis acids in these reactions.
Table 1: Varying Lewis Acids entry substrate Lewis acid reaction yield (%) conditions 1 M3b% SnCl4 -20 0C, 1 h to 54 (3); 36
MsO' (1 equiv) 22 0C, 2 h (4)
TiCl4 -20 0C, 1 h to 21 (3);
TMSOTf 22 0C, 12 h complex (1 equiv) mixture
BF3OEt2 22 0C, 2 h NR (2 equiv)
BF3OEt2 22 0C, 2 h NR
MsO &' i (2 equiv)
The impact of using different Lewis acids in step b above was tested as shown in Table 1. For purposes of the experiment, reactions were run on a 1 mmole scale in
anhydrous CH2Cl2 containing TMSN3 (1.1 equiv). For entries 1-4, reaction conditions were obtimized to maximize the yield of 3β-azido-5-cholestene (3), with products isolated by column chromatography (hexane eluent). For entries 1-3, the yields of the major byproduct, 3β-chloro-5-cholestene (4), are additionally listed. Recovery of starting material is shown in entry 5. NR means that no reaction was observed.
Among the Lewis acids investigated, the addition of two equivalents of BF3OEt2 at ambient temperature (220C) for 2 hours proved optimal, providing 3β-azido-5-cholestene (3) in 93% yield. In addition to 3β-azido-5-cholestene (3), SnCl4, TiCl4, and AlCl3 generated 3β-chloro-5-cholestene (4) as a major by product. Reaction of fluoride derived from BF3*OEt2 with TMSN3 is presumably involved in the production of the nucleophilic azide, and the high stability of TMSF likely prevents formation of byproducts compared to the chlorinated Lewis acids. In control experiments, studies of the corresponding 3α- mesylate (8) and the dihydro analogue (9) revealed that both the 3β-configuration of 2 and the C5 alkene were required for reaction of 2 with BF3OEt2 / TMSN3. These results are consistent with previous studies of solvolytic rate enhancements of cholesterol derivatives that compared the corresponding unsaturated and saturated substrates and that examined the stereo specificity of related reactions. These results indicate that the homoallylic double bond of 2 is a key participant in the outcome of this reaction. Table 2 entry substrate ^ewis acid reaction yield (%) conditions
1 BF3»OEt2 22 0C, 3 h 92
Ts0XΛJic (5 equiv)
2 SnCl4 -20 0C, 1 h to 50 (3); cCSϊ (1 equiv) 22 0C, 2 h 45 (4)
3 BF3OEt2 22 0C, 2 h trace
CIXXJ4 (2 equiv)
4 BF3OEt2 22 0C, 2 h NR
Ac0XAJii (2 equiv)
5 BF3OEt2 22 0C, 2 h NR uJUU i (2 equiv)
Table 2 summarizes the effect of the leaving group on the reactivity of 3β- cholesterol derivatives. Reactions were run on a 1 mmol scale in anhydrous CH2Cl2
containing TMSN3 (1.1 equiv). Recovery of starting material (4) is additionally shown in entry 2. NR indicates no reaction was observed.
The less reactive tosylate (10) similarly furnished 3β-azido-5-cholestene (3) in excellent yield but required a larger excess of BF3*OEt2 (5 equiv) and a longer reaction time than the mesylate (2); whereas BF3*OEt2 had little effect on conversion of 3β-chloro- 5-cholestene (4). SnCl4 converted 50% of this compound to the azide 3β-azido-5- cholestene (3). Substrates bearing poorer leaving groups, such as 11 and 1 were unreactive.
The nature of the solvent was also found to play a critical rule in this reaction. Benzene could be substituted for dichloromethane (or chloroform) without appreciably diminishing the yield of 3β-azido-5-cholestene (3) from the mesylate (2) (92%) but required additional equivalents of BF3*OEt2 (5 equiv) and a longer reaction time (12 h) for completion of the reaction. No reaction was observed in solvents bearing heteroatoms that function as Lewis bases, including tetrahydrofuran, acetone, diethyl ether, or DMF, further emphasizing the role of the Lewis acid in activating the leaving group. Poor soluability of the mesylate (2) precluded evaluation of reactivity in hexane, acetonitrile, or DMSO. Because the conversion of mesylate (2) to 3β-azido-5-cholestene (3) proceeds rapidly at ambient temperature in the presence of BF3OEt2 and TMSN3, the course of the reaction is readily followed by 1H NMR. As shown in Figure 28A, the acquisition of 1H NMR spectra at different time points allowed clear observation of the disappearance of signals of starting material and the emergence of product. Importantly, these experiments detected the transient appearance of a signal at 3.27 ppm (observed at 2 and 4 minutes) that did not correspond to the starting material (mesylate (2)) or product 3β-azido-5-cholestene (3), but rather could be assigned as the C6 proton of 6β-azido-3α,5-cyclo-5α-cholestane (12), a structure that was further supported by distinctive cyclopropyl signals observed at 0.53 ppm. This data is consistent with generation of i-steroid intermediate 12 derived from attack of azide on C6 of the homoallylic cation as shown in Figure 28B.
The NMR data shown in Figure 28 A, in conjunction with the necessity of both 3β- stereochemistry of the mesylate (2) and the presence of the homoallylic double bond (Table 1) suggests that (2) is initially converted by the Lewis acid to a homoallylic carbocation that rapidly undergoes i-steroid rearrangement and retro-j-steroid rearrangement shown in Figure 28B. This mechanism is consistent with studies of related
solvolysis reactions by Winstein. Winstein demonstrated that attack at the C6 carbon of cholesterol-derived homoallylic carbocations is kinetically favored, and the struction of the homoallylic cation engenders formation of the 6β-product over the 6α-product. Although the attack of nucleophiles at C3 of the homoallylic carbocation is slower than C6, this addition occurs to form the thermodynamic product with exclusively β-stereochemistry. This stereochemical outcome is a result of the non-classical carbocation forming a partial bond between C5 and C3 only on the alpha face of the steroid.
To further support the idea that i- steroid rearrangement product can lead to 3β- azido-5-cholestene (3), we prepared 6β-azido-3α,5-cyclo-5α-cholestane (12) by treatment of mesylate (2) with NaN3 in refluxing methanol, a modification of the method of Freiberg. Importantly, treatment of (12) with BF3OEt2 (2 equiv) and TMSN3 (1 equiv) resulted in clean conversion to 3β-azido-5-cholestene (3) within 2 hours at ambient temperature. In contrast, treatment of 12 with TMSN3 alone or TMSN3 and TBAF to generate the azide ion did not result in conversion to 3β-azido-5-cholestene (3), indicating that the Lewis acid is required to promote the retro-j- steroid rearrangement. Treatment of 12 with excess BF3*OEt2 (2 equiv) resulted in the formation of 3β-azido-5-cholestene (3) within 10 minutes. However, byproducts were associated with treatment of 12 with BF3OEt2 in the absence Of TMSN3. Thus, the addition of two equivalents Of BF3OEt2 and 1.1 equivalent of TMSN3 to mesylate (2) is preferred to both generate the homoallylic cation and convert 12 to 3β-azido-5-cholestene (3) in high yield.
EXAMPLE 4: Construction of Synthetic Receptors. Various synthetic receptors were constructed by modifying a 3β-cholesterylamine as shown in Example 3 above. Cholesterol may alternatively be modified to become a nosyl-protected 3β- cholesterylamine via a Swern oxidation, reduction to epicholesterol, and synthesis of 3beta-azido-5-cholestene via Mitsunobu reaction with hydrazoic acid. The compound underwent further modification to become a receptor by reduction, protection as a nosyl sulfonamide, and use of Fukuyama's amine synthesis methodology and/or deprotection and sequential amide bond formation reactions.
EXAMPLE 5: General. Chemical reagents were obtained from Acros, Aldrich, Alfa Aesar, or TCI America. Solvents were from EM Science. Media and antibiotics were
purchased from Gibco BRL. Cholera toxin B subunit-Alexa Fluor 488 (CT-B-AF488), Transferrin-Alexa Fluor-488, Protein A Alexa Fluor 488 (PrA- AF488), Protein A Alexa Fluor 594 (PrA- AF594), Protein A Alexa Fluor 633 (PrA- AF633), and BODIPY TR ceramide were from Molecular Probes. Rabbit polyclonal antidinitrophenyl (anti-DNP) IgG was from Sigma. Commercial grade reagents were used without further purification unless otherwise noted. Tetrahydrofuran and diethyl ether were distilled from sodium benzophenone ketyl under nitrogen. Dichloromethane was distilled from calcium hydride under nitrogen. iV,./V-Dimethylformamide was from a freshly-opened bottle. All reactions were performed under an atmosphere of dry argon. Reactions were monitored by analytical thin-layer chromatography on plates coated with 0.25 mm silica gel 60 F254 (EM Science). TLC plates were visualized by UV irradiation (254 nm) or stained with a solution of phosphomolybdic acid and sulfuric acid in ethanol (1:1:20). Flash column chromatography employed ICN SiliTech Silica Gel (32-63 μm). Purification by preparative reverse phase HPLC employed an Agilent 1100 preparative pump / gradient extension instrument equipped with a Hamilton PRP-I (polystyrene-divinylbenzene) reverse phase column (7 μm particle size, 21.5 mm x 25 cm). The HPLC flow rate was increased from 10 niL/min (t = 0 min) to 20 niL/min (t = 1 min) and maintained at 20 niL/min for the remainder of the run unless otherwise noted. Melting points were measured with a Thomas Hoover capillary melting point apparatus and are uncorrected. Infrared spectra were obtained with a Perkin Elmer 1600 Series FTIR. NMR spectra were obtained with Bruker AMX-360, DRX-400, or AMX-2-500 instruments with chemical shifts reported in parts per million (ppm, δ) referenced to either CDCl3 (1H 7.27 ppm; 13C 77.23 ppm), DMSOd6 (1H 2.50 ppm; 13C 39.51 ppm), or (CH3 )4Si. High-resolution mass spectra were obtained from the University of Texas at Austin Mass Spectrometry Facility (ESI and CI). Peaks are reported as m/z.
Synthetic procedures and compound characterization data
3β-Cholest-5-en-3-yl methanesulfonate. A solution of cholesterol (19.3 g, 50.0 mmol) in
anhydrous CH2Cl2 (250 rnL) was cooled to 40C by ice- water bath. To this solution, triethylamine (13.9 rnL, 100.0 mmol) was added, followed by the dropwise addition of methanesulfonyl chloride (4.3 mL, 55 mmol) in anhydrous CH2Cl2 (50 mL). The reaction was maintained at 4 0C and stirred for 3 h. When the cholesterol was consumed as analyzed by TLC (hexanes / ethyl acetate, 5:1), the solvent was removed in vacuo. The resulting residue was redissolved in CH2Cl2 (15 mL), the product was precipitated by addition of MeOH (150 mL), and the product collected by vacuum filtration. The solid was washed with MeOH (3OmL) and dried under vacuum to yield the product (23.0 g, 99.0%) as a white solid, mp 119-120 0C; 1H NMR (300 MHz, CDCl3) δ 5.41 (s, IH), 4.56- 4.45 (m, IH), 3.00 (s, 3H), 2.57-2.43 (m, 2H), 2.04-0.81 (m, 38H), 0.67 (s, 3H); 13C NMR (75 MHz, CDCl3) δ 138. 6, 123.7, 81.9, 56.5, 56.0, 49.9, 42.2, 39.6, 39.4, 39.1, 38.7, 36.8, 36.3, 36.1, 35.7, 31.8, 31.7, 28.9, 28.1, 27.9, 24.2, 23.8, 22.8, 22.5, 20.9, 19.1, 18.6, 11.8; IR (film) v max 3029, 2944, 2908, 2861, 1468, 1440, 1415, 1353, 1330, 1173 cm"1; ESI+ m/z ((MNa)+ 487.3237, C28H48O3SNa requires 487.3222).
3β-Azido-5-cholestene. To a solution of 3β-cholest-5-en-3-yl methanesulfonate (9.30 g, 20.0 mmol) in anhydrous CH2Cl2 (100 mL), TMSN3 (2.95 mL, 22.0 mmol) was added, followed by boron trifluoride etherate (5.0 mL, 40.0 mmol). The reaction was stirred at 22 0C for 2 h. When the starting material was no longer visible by TLC analysis (hexanes), the reaction was slowly poured into saturated aqueous NaHCO3 (100 mL) and vigorously stirred for 10 min. The organic layer was separated and the aqueous layer was extracted with diethyl ether (60 mL x 2). The organic layers were combined, washed with deionized water (100 mL), dried over anhydrous Na2SO4 and concentrated under reduced pressure to give the crude product as light yellow solid. Flash column chromatography (hexanes) afforded the product (7.75 g, 94.1%) as white solid, mp 84-860C; l H NMR (300 MHz, CDCl3) δ 5.38 (s, IH), 3.26-3.15 (m, IH), 2.28 (d, J = 7.9 Hz, 2H), 2.05-0.85 (m, 38H), 0.68 (s, 3H); 13 C NMR (75.4 MHz, CDCl3) δ 139.8, 122.5, 61.1, 56.7, 56.1, 50.1, 42.3, 39.7, 39.5, 38.1, 37.6, 36.6, 36.2, 35.8, 31.8,31.7, 28.2, 28.0, 27.9, 24.2, 23.8, 22.8, 22.5,
21.0, 19.2, 18.7, 11.8; IR (film) v max 2934, 2896, 2861, 2097, 1464, 1443, 1377, 1367,1243, 1231 cm"1; APCI m/z 411.3607 (M+, C27H45N3 requires 411.3613).
3β-Amino-5-cholestene. A solution of 3β-azido-5-cholestene (6.18 g, 15.0 mmol) in anhydrous diethyl ether (100 mL) was cooled to 40C by ice-water bath. To this solution, LiAlH4 (855 mg, 22.5mmol) was added in four equal portions. The reaction was maintained at 40C for 30 min, warmed to 220C and stirred for 2 h. When the starting material disappeared by TLC analysis (hexanes), the reaction was cooled to 40C and carefully quenched by slow drop wise addition of cold deionized water (10 mL). The resulting solution was poured into ice water (90 mL), the organic layer was separated, and the aqueous layer was extracted with ethyl acetate (50 mL x X). The organic layers was combined, washed with saturated aqueous sodium chloride (100 mL), dried over anhydrous Na2SO4 and concentrated in vacuo. The resulting residue was redissolved in CHCl3 (30 mL) and insoluble salts were removed by filtration. Concentration of the filtrate afforded the product (5.57 g, 96.3%) as white solid, mp 92-94 0C; 1H NMR (300 MHz, CDCl3) δ 5.27 (s, IH), 2.60-2.52 (m, IH), 2.10-0.81 (m, 40H), 0.64 (s, 3H); 13C NMR (75 MHz, CDCl3) δ 141.7, 120.5, 56.7, 56.1, 51.9, 50.2, 43.3, 42.2, 39.7, 39.4, 38.1, 36.5, 36.1, 35.7, 32.6, 31.8 (x 2), 28.2, 27.9, 24.2, 23.8, 22.7, 22.5, 20.9, 19.4, 18.6, 11.8; IR (film) v 3354, 3260, 3154, 2936, 2896, 2849, 1464, 1437, 1381 cm"1;
N-cholesteryl-2-nitrobenzenesulfonamide (15). To 3β-azido-5-cholestene (14, 3.30 g, 8.02 mmol) in dry diethyl ether (150 mL) at 40C was added lithium aluminum hydride
(4.60 g, 121.18 mmol) in three equal portions. The reaction was maintained at 40C for 30 min, warmed to 230C, and stirred for an additional 1.5 h. The reaction was quenched by addition of diethyl ether (50 mL) followed by careful dropwise addition of deionized H2O
(60 niL). The organic layer was washed with saturated aqueous NaCl (2 x 100 rnL), dried over anhydrous Na2SO4, and concentrated in vacuo to afford 2.90 g (85%) of crude 3β- amino-5-cholestene. This aminosteroid was dissolved in dry THF (150 rnL), and diisopropylethylamine (2.61 rnL, 15.03 mmol) was added. 2-Nitrobenzenesulfonyl chloride (2.20 g, 9.92 mmol) in dry THF (40 mL) was added by addition funnel over 30 min. After 2 h at 230C, solvents were removed in vacuo, CH2Cl2 was added (75 mL), and this organic solution was washed with aqueous NaHCO3 (10%, 1 x 100 mL) and saturated aqueous NaCl (2 x 100 mL). The organic extracts were dried over anhydrous Na2SO4 and concentrated in vacuo to yield a crude yellow solid. Recrystallization (CH2Cl2 / MeOH, 1:5) followed by flash column chromatography (EtOAc / hexanes, 1:5) afforded off-white 15 (3.50 g, 83%), mp 202-2030C; 1H NMR (300 MHz, CDCl3) δ 8.16 - 8.12 (m, IH), 7.86 - 7.82 (m, IH), 7.75 - 7.67 (m, 2H), 5.19 (s, IH), 5.16 (s, IH), 3.28 - 3.18 (m, IH), 2.18 - 0.83 (m, 40H), 0.63 (s, 3H); 13C NMR (75.41 MHz, CDCl3) δ 148.1, 139.9, 135.4, 133.6, 133.1, 131.0, 125.6, 122.7, 56.9, 56.3, 55.2, 50.2, 42.5, 40.3, 39.9, 39.7, 38.0, 36.6, 36.4, 36.0, 32.0, 31.9, 30.2, 28.4, 28.2, 24.4, 24.0, 23.0, 22.8, 21.1, 19.4, 18.9, 12.0; IR (film) Vmax 3331, 2936, 2359, 1541 cm"1; CI m/z 571.3567 (MH+, C33H51N2O4S requires 571.3569).
N-[3-(tert-butoxycarbonylamino)propyl]-N-cholesteryl-2-nitrobenzenesulfonamide (16). iV-cholesteryl-2-nitrobenzenesulfonamide (15, 3.50 g, 6.14 mmol), potassium carbonate (12.50 g, 90.44 mmol) and Boc-3-chloropropylamine (2.50 g, 12.91 mmol, prepared as previously reported5) were added to dimethylacetamide (200 mL). This mixture was heated to 12O0C for 20 h. The reaction was filtered to remove excess potassium carbonate and the solvent was removed in vacuo. To the crude product was added CH2Cl2 (200 mL) and the organic solution was washed with aqueous citric acid (10%, 2 x 50 mL) and deionized water (50 mL). The organic layer was dried over anhydrous Na2SO4 and the solvent was removed in vacuo. Flash column chromatography (EtOAc / hexanes, 1:5 to
3:10) afforded 16 (3.56 g, 78%), mp 158 - 159 0C; 1H NMR (400 MHz, CDCl3) δ 7.94 (m, IH), 7.61 (m, 2H), 7.53 (m, IH), 5.17 (d, J = 4.8 Hz, IH), 4.78 (br s, IH), 3.55 (m, IH), 3.29 (t, J = 7.2 Hz, 2H), 3.12 (m, 2H), 2.36 (t, J = 12.0 Hz, IH), 1.97 - 0.91 (m, 37H), 0.89 (s, 3H), 0.84 (d, J = 6.8 Hz, 3H), 0.80 (d, J= 2.0 Hz, 3H), 0.78 (d, J= 1.6 Hz, 3H), 0.59 (s, 3H); 13C NMR (100.6 MHz, CDCl3) δ 156.5, 148.4, 140.4, 134.5, 133.8, 132.0, 131.1, 124.5, 122.8, 79.6, 59.4, 57.1, 56.5, 50.4, 42.7, 42.1, 40.1, 39.9, 38.6, 38.1, 37.0, 36.6, 36.2, 32.6, 32.2, 32.1, 28.8 (x3), 28.7, 28.6, 28.4, 27.8, 24.6, 24.2, 23.2, 23.0, 21.3, 19.8, 19.1, 12.3; IR (film) vmax 3400, 2800, 1700, 1550, 1320 cm"1; MALDIFTMS (DHB) m/z 728.4669 (MH+, C4IH65N3O6S requires 728.4672).
tert-butyl-3-[(3-{(3β)-cholest-5-en-3-yl[(2-nitrophenyl)sulfonyl]amino}propyl)amino]- 3-oxopropylcarbamate (17). Trifluoro acetic acid in CH2Cl2 (2:25, 20 mL) was added to N-[3-(?er?-butoxycarbonylamino)propyl]-N-cholesteryl-2-nitrobenzenesulfonamide (16, 100 mg, 0.138 mmol). After 1 h at 23 C, TLC analysis (MeOH / CH2Cl2, 1:50) revealed conversion to the more polar primary amine. Aqueous NaOH (1 M, 40 mL) was added, and the mixture was extracted with CH2Cl2 (2 x 10 mL). The organic layers were combined and dried over anhydrous Na2SO4. The solvent was removed in vacuo, and CH2Cl2 (18 mL), Boc-β-alanine Λ^-hydroxysuccinimidyl ester (119 mg, 0.415 mmol), and diisopropylethylamine (50 μL, 0.277 mmol) were added. After 5 h at 230C, CH2Cl2 (10 mL) and aqueous citric acid (10%, 50 mL) were added. This mixture was extracted with CH2Cl2 (2 x 10 mL), the organic extracts were combined, dried over anhydrous Na2SO4, and solvent removed in vacuo. Flash column chromatography (MeOH / CH2Cl2, 3: 100) afforded 17 (103 mg, 93%), mp 154 - 1560C; 1H NMR (400 MHz, CDCl3) δ 8.00 - 7.97 (m, IH), 7.71 - 7.66 (m, 2H), 7.61 - 7.58 (m, IH), 6.29 (br s, IH), 5.28 (br s, IH), 5.22 (d, J = 4.7 Hz, IH), 3.69 - 3.58 (m, IH), 3.42 - 3.39 (m, 6H), 2.45 - 2.40 (m, 3H), 2.00 - 0.97 (m, 29H), 1.42 (s, 9H), 0.94 (s, 3H), 0.90 (d, J = 6.49 Hz, 3H), 0.86 (d, J = 1.81 Hz, 3H), 0.84 (d, J = 1.80 Hz, 3H), 0.65 (s, 3H); 13C NMR (75.4 MHz, CDCl3) δ 172.0, 156.2,
148.2, 140.1, 134.0, 133.7, 131.8, 130.7, 124.2, 122.6, 79.3, 59.3, 56.8, 56.2, 50.1, 42.4, 41.7, 39.8, 39.7, 38.4, 37.8, 36.8, 36.7, 36.4, 36.3 (x2), 35.9, 32.0, 31.9, 31.7, 28.6 (x3), 28.4, 28.2, 27.7, 24.4, 24.0, 23.0, 22.7, 21.1, 19.6, 18.9, 12.0; IR (film) vmax 3413, 3321, 2937, 2868, 1702, 1655, 1546, 1367 cm"1; CI m/z 799.5062 (MH+, C44H71N4O7S requires 799.5043).
te^butyl-3-({3-[(3-{(3β)-cholest-5-en-3-yl[(2- nitrophenyl)sulfonyl]amino}propyl)amino]-3-oxopropyl}amino)-3- oxopropylcarbamate (18). Trifluoroacetic acid in CH2Cl2 (2:25, 10 mL) was added to tert-butyl 3-[(3-{ (3β)-cholest-5-en-3-yl[(2-nitrophenyl)sulfonyl]amino}propyl)amino]-3- oxopropylcarbamate (17) (50 mg, 0.062 mmol). After 1 h at 230C, TLC analysis (MeOH / CH2Cl2, 1:50) revealed conversion to the more polar primary amine. Aqueous NaOH (1 M, 20 mL) was added, the mixture was extracted with CH2Cl2 (2 x 5 mL), the combined organic extracts were dried over anhydrous Na2SO4, and solvent was removed in vacuo. Boc-β-alanine iV-hydroxysuccinimidyl ester (54 mg, 0.189 mmol), CH2Cl2 (9 mL) and diisopropylethylamine (50 μL, 0.277 mmol) were added. After stirring for 5 h at 230C, CH2Cl2 (5 mL) and aqueous citric acid (10%, 25 mL) were added followed by extraction with CH2Cl2 (2 x 5 mL). The organic extracts were dried over anhydrous Na2SO4 and removed in vacuo. Flash column chromatography (MeOH / CH2Cl2, 3:100) afforded 18 (52 mg, 95%), mp 96 - 980C; 1H NMR (400 MHz, CDCl3) δ 8.03 - 7.97 (m, IH), 7.73 - 7.67 (m, 2H), 7.65 - 7.59 (m, IH), 6.66 (br s, IH), 6.58 (br s, IH), 5.30 (br s, IH), 5.21 (d, J = 4.6 Hz, IH), 3.63 - 3.52 (m, 3H), 3.40 - 3.32 (m, 6H), 2.46 - 2.35 (m, 5H), 2.01 - 0.98 (m, 29H), 1.42 (s, 9H), 0.95 (s, 3H), 0.91 (d, J = 6.5 Hz, 3H), 0.87 (d, J = 1.8 Hz, 3H), 0.86 (d, J = 1.8 Hz, 3H), 0.66 (s, 3H); 13C NMR (75.5 MHz, CDCl3) δ 172.2, 171.8, 156.3, 148.1, 140.1, 134.0, 133.8, 131.9, 130.8, 124.3, 122.7, 79.3, 59.3, 56.8, 56.3, 50.1, 42.4, 41.8, 39.8, 39.7, 38.4, 37.8, 37.0, 36.7, 36.4 (x2), 36.3 (x2), 35.9, 35.8, 32.0 (x2), 31.9, 28.6 (x3), 28.4, 28.2, 27.7, 24.4, 24.0, 23.0, 22.7, 21.1, 19.6, 18.9, 12.0; IR (film) vmax
3378, 3284, 2935, 2867, 1688, 1643, 1548, 1366 cm"1; CY mJz 870.5407 (MH+, C47H76N5O8S requires 870.5415).
N-[3-({3-[(3-{(3β)-cholest-5-en-3-yl[(2-nitrophenyl)sulfonyl]amino}propyl)amino]-3- oxopropyl} amino)-3-oxopropyl]-6-[(2,4-dinitrophenyl)amino]hexanamide (21). tert- butyl 3-({3-[(3-{(3β)-cholest-5-en-3-yl[(2-nitrophenyl)sulfonyl]amino}propyl)amino]-3- oxopropyl} amino)-3-oxopropylcarbamate (18, 52 mg, 0.060 mmol) was treated with trifluoroacetic acid in CH2Cl2 (2:25, 10 niL). After 1 h at 230C, TLC analysis (MeOH / CH2Cl2, 1:25) revealed conversion to the more polar primary amine. Aqueous NaOH (1 M, 40 mL) was added, the mixture was extracted with CH2Cl2 (2 x 10 mL), the organic layers were dried over anhydrous Na2SO4, and the solvent was removed in vacuo. The remaining residue was dissolved in CH2Cl2 (10 mL) and 6-(2,4-dinitrophenyl) aminohexanoic acid succinimidyl ester (71 mg, 0.180 mmol) and diisopropylethylamine (50 μL, 0.287 mmol) were added. After 8 h at 230C, ethylenediamine (50 μL) was added with stirring for 30 min to consume the excess active ester. CH2Cl2 (5 mL) and aqueous citric acid (10%, 25 mL) were added followed by extraction with CH2Cl2 (2 x 5 mL). The organic layer was dried over anhydrous Na2SO4 and removed in vacuo. Flash column chromatography (MeOH / CH2Cl2, 1:25) afforded 21 (60 mg, 96%), mp 106 - 1080C; 1H NMR (500 MHz, CDCl3) δ 9.10 (d, J = 2.59 Hz, IH), 8.57 (t, J = 4.98 Hz, IH), 8.25 (dd, J = 2.6 Hz, J= 9.5 Hz, IH), 8.01 - 7.97 (m, IH), 7.74 - 7.68 (m, 2H), 7.64 - 7.59 (m, IH), 6.93 (d, J = 9.6 Hz, IH), 6.70 (t, J = 5.5 Hz, IH), 6.65 (t, J = 5.7 Hz, IH), 6.58 (d, J = 5.1 Hz, IH), 5.19 (d, J = 4.9 Hz, IH), 3.57 - 3.51 (m, 5H), 3.44 - 3.34 (m, 6H), 2.43 (t, J= 5.9 Hz, 2H), 2.38 (t, J = 5.9 Hz, 2H), 2.21 (d, J = 7.4 Hz, 2H), 2.01 - 1.67 (m, 13H), 1.58 - 1.22 (m, 14H), 1.18 - 0.97 (m, 9H), 0.94 (s, 3H), 0.90 (d, J = 6.5 Hz, 3H), 0.87 (d, J = 2.4 Hz, 3H), 0.86 (d, J = 2.2 Hz, 3H), 0.66 (s, 3H); 13C NMR (125.8 MHz, CDCl3) δ 172.9, 172.1 (x2), 148.6, 148.1, 140.0, 136.1, 133.9, 133.8, 131.9, 130.8, 130.5, 130.4, 124.5, 124.3, 122.7, 114.2, 59.3, 56.8, 56.3, 50.2, 43.5, 42.5, 41.8, 39.8, 39.7, 38.4, 37.8, 36.7, 36.4, 36.4, 36.3, 35.9, 35.9, 35.8, 34.1, 32.0, 31.9, 28.6, 28.4, 28.2, 27.7, 26.6, 25.8, 25.2,
25.1, 24.4, 24.0, 23.0, 22.7, 21.1, 19.6, 18.9, 12.0; IR (film) vmax 3378, 3287, 2937, 2867, 1634, 1622, 1548, 1337 cm"1; CY mJz 1049.5764 (MH+, C54H8IN8O11S requires 1049.5745).
N-(3-{[3-({3-[(3β)-cholest-5-en-3-ylamino]propyl}amino)-3-oxopropyl]amino}-3- oxopropyl)-6-[(2,4-dinitrophenyl)amino]hexanamide (2). To a slurry of JV-[3-({ 3-[(3- {(3β)-cholest-5-en-3-yl[(2-nitrophenyl)sulfonyl]amino}propyl)amino]-3- oxopropyl}amino)-3-oxopropyl]-6-[(2,4-dinitrophenyl)amino]hexanamide (21, 60 mg, 0.057 mmol) and K2CO3 (90 mg, 0.651 mmol) in DMF (4 mL) and THF (1 mL) was added thiophenol (80 μL, 0.874 mmol). After 18 h at 230C, solids were removed by filtration and solvent was removed in vacuo. The crude product was purified by flash column chromatography (CH2Cl2 / MeOH / TEA, 93: 4:3) to afford 2 (36 mg, 72%) mp 191 - 1930C; 1H NMR (400 MHz, CDCl3) δ 9.14 (d, J = 2.6 Hz, IH), 8.56 (t, J = 4.9 Hz, IH), 8.27 (dd, J = 2.6 Hz, J = 9.50 Hz, IH), 7.40 (t, J = 5.2 Hz, IH), 6.93 (d, J = 9.6 Hz, IH), 6.69 (t, J = 5.5 Hz, IH), 6.60 (t, J = 5.4 Hz, IH), 5.32 (d, J = 4.4 Hz, IH), 3.54 - 3.50 (m, 4H), 3.42 (dt, J = 6.9 Hz, J = 5.6 Hz, 2H), 3.34 (dt, J = 5.6 Hz, J = 5.60 Hz, 2H), 2.76 (t, J = 5.6 Hz, 2H), 2.39 - 2.34 (m, 5H), 2.21 (t, J = 7.3 Hz, 2H), 2.02 - 1.00 (m, 37 H), 0.98 (s, 3H), 0.91 (d, J = 6.5 Hz, 3H), 0.87 (d, J = 1.6 Hz, 3H), 0.86 (d, J = 1.6 Hz, 3H), 0.67 (s, 3H); 13C NMR (125.8 MHz, CDCl3) δ 172.5, 171.8, 171.3, 148.3, 141.2, 136.0, 130.5, 130.3, 124.3, 121.1, 113.9, 58.3, 56.8, 56.2, 50.3, 45.5, 43.3, 40.1, 39.8, 39.5, 39.3, 38.0, 37.0, 36.2 (x2), 35.8, 35.6 (x2), 35.5, 35.4, 31.9 (x2), 29.7, 29.6, 28.8, 28.4, 28.2, 28.0, 26.4, 25.0, 24.3, 23.8, 22.8, 22.5, 21.0, 19.4, 18.7, 11.8; IR (film) vmax 3295, 2927, 2849, 1633, 1546, 1340 cm"1; CI m/z 864.5959 (MH+, C48H78N7O7 requires 864.5963).
N-{3-[(3-{(3β)-cholest-5-en-3-yl[(2-nitrophenyl)sulfonyl]amino}propyl)amino]-3-
oxopropyl}-6-[(2,4-dinitrophenyl)amino]hexanamide (20). Trifluoroacetic acid in CH2Cl2 (2:25, 7.5 niL) was added to tert-butyl 3-[(3-{(3β)-cholest-5-en-3-yl[(2- nitrophenyl)sulfonyl]amino}propyl)amino]-3-oxopropylcarbamate (17, 100 mg, 0.125 mmol). After 1 h at 230C, TLC analysis (MeOH in CH2Cl2, 1:50) revealed conversion to the more polar primary amine. Aqueous NaOH (1 M, 35 mL) was added, the mixture was extracted with CH2Cl2 (2 x 20 mL), the organic extracts were combined, dried over anhydrous Na2SO4, and solvent was removed in vacuo. The remaining residue was dissolved in CH2Cl2 (17 mL) and 6-(2,4-dinitrophenyl)aminohexanoic acid succinimidyl
ester (54 mg, 0.137 mmol) and diisopropylethylamine (50 μL, 0.277 mmol) were added. After 6 h at 230C, ethylenediamine (100 μL) was added to consume excess active ester, and the mixture was stirred at 230C for 30 min. CH2Cl2 (10 mL) and aqueous citric acid (10%, 45 mL) were added followed by extraction with CH2Cl2 (2 x 10 mL). The organic extracts were combined, dried over anhydrous Na2SO4, and solvent removed in vacuo. Flash column chromatography (MeOH / CH2Cl2, 1:50) afforded 20 (121 mg, 99%), mp 86 - 870C; 1H NMR (360 MHz, CDCl3) δ 9.10 (d, J = 2.7 Hz, IH), 8.55 (t, J = 4. 8 Hz, IH), 8.24 (dd, J = 9.5 Hz, J = 2.64 Hz, IH), 8.00 - 7.97 (m, IH), 7.71 - 7.68 (m, 2H), 7.61 - 7.58 (m, IH), 6.92 (d, J = 9.6 Hz, IH), 6.51 (t, J = 5.7 Hz, IH), 6.36 (t, J = 5.9 Hz, IH), 5.19 (d, J = 4.8 Hz, IH), 3.61 - 3.52 (m, 3H), 3.44 - 3.32 (m, 6H), 2.46 - 2.42 (m, 3H), 2.21 (t, J = 7.3 Hz, 2H), 1.97 - 0.97 (m, 35H), 0.94 (s, 3H), 0.90 (d, J = 6. 5 Hz, 3H), 0.87 (d, J = 1.6 Hz, 3H), 0.85 (d, J = 1.6 Hz, 3H), 0.65 (s, 3H); 13C NMR (125.8 MHz, CDCl3) δ 172.7, 172.0, 148.4, 147.9, 139.8, 135.8, 133.7, 133.6, 131.7, 130.6, 130.3, 130.2, 124.3, 124.1, 122.5, 114.0, 59.1, 56.6, 56.1, 49.9, 43.3, 42.2, 41.5, 39.6, 39.5, 38.2, 37.6, 36.5, 36.2 (x2), 36.1, 35.7, 35.5 (x2), 31.8, 31.7 (x2), 28.4, 28.2, 28.0, 27.5, 26.4, 25.0, 24.2, 23.8, 22.8, 22.5, 20.9, 19.4, 18.7, 11.8; IR (film) vmax 3365, 3305, 2938, 2867, 1648, 1621, 1544, 1336 cm"1; CI m/z 978.5370 (MH+, C5IH76N7O10S requires 978.5374).
N-[3-({3-[(3β)-cholest-5-en-3-ylamino]propyl}amino)-3-oxopropyl]-6-[(2,4- dinitrophenyl)amino] hexanamide (3). To a slurry of iV-{3-[(3-{(3β)-cholest-5-en-3-
yl[(2-nitrophenyl)sulfonyl]amino}propyl)amino]-3-oxopropyl}-6-[(2,4- dinitrophenyl)amino]hexanamide (20, 121 mg, 0.124 mmol) and K2CO3 (137 mg, 0.991 mmol) in iV,./V-dimethylformamide (8 niL) and tetrahydrofuran (4 niL) was added thiophenol (100 μL, 0.971 mmol). After stirring at 230C for 18 h, the mixture was filtered and solvent removed in vacuo. Flash column chromatography (MeOH / triethylamine / CH2Cl2, 3:5:100) afforded 3 (50 mg, 51%) mp 157 - 1580C; 1H NMR (360 MHz, CDCl3) δ 9.12 (d, J = 2.6 Hz, IH), 8.55 (t, J = 5.0 Hz, IH), 8.26 (dd, J = 2.6 Hz, J = 9.5 Hz, IH), 6.91 (d, J = 9.6 Hz, IH), 6.62 (t, J = 5.5 Hz, IH), 5.30 (d, J = 4.7 Hz, IH), 3.51 (dt, J = 5.8 Hz, J = 5.7 Hz, 2H), 3.41 (dt, J= 7.0 Hz, J = 5.5 Hz, 2H), 3.33 (dt, J = 5.9 Hz, J = 5.7 Hz, 2H), 2.74 (t, J= 6.0 Hz, 2H), 2.38 - 2.31 (m, 3H), 2.21 - 2.14 (m, 3H), 2.01 - 1.00 (m, 37H), 0.97 (s, 3H), 0.90 (d, J = 6.5 Hz, 3H), 0.86 (d, J = 1.4 Hz, 3H), 0.84 (d, J = 1.4 Hz, 3H), 0.66 (s, 3H); 13C NMR (125.8 MHz, CDCl3) δ 172.6, 171.8, 148.5, 141.6, 136.2, 130.6, 130.5, 124.6, 121.2, 114.1, 58.4, 57.0, 56.3, 50.5, 45.7, 43.5, 42.5, 40.4, 40.0, 39.7, 39.5, 38.2, 37.2, 36.5, 36.4, 36.0, 35.7, 35.5, 32.1 (x2), 29.9, 29.1, 28.6, 28.4, 28.2, 26.7, 25.2, 24.5, 24.0, 23.0, 22.7, 21.2, 19.6, 18.9, 12.0; IR (film) vmax 3354, 3299, 2933, 2868, 1647, 1620, 1335 cm"1; CI m/z 793.5584 (MH+, C45H73N6O6 requires 793.5592).
N-(3-{(3β)-cholest-5-en-3-yl[(2-nitrophenyl)sulfonyl]amino}propyl)-6-[(2,4- dinitrophenyl)amino]hexanamide (19). Λf-[3-(te/t-butoxycarbonylamino)propyl]-./V- cholesteryl-2-nitrobenzenesulfonamide (16, 234 mg, 0.323 mmol) was treated with trifluoroacetic acid in CH2Cl2 (2:50, 47 mL). After 1 h at 230C, TLC analysis (MeOH / CH2Cl2, 1:50) revealed conversion to the more polar primary amine. Aqueous NaOH (1 M, 40 mL) was added followed by extraction with CH2Cl2 (3 x 25 mL). The organic layers were combined, dried over anhydrous Na2SO4, and the solvent was removed in vacuo. The remaining residue was dissolved in CH2Cl2 (40 mL) and 6-(2,4-dinitrophenyl) aminohexanoic acid succinimidyl ester (130 mg, 0.330 mmol) and diisopropylethylamine
(62 μL, 0.355 mmol) were added. After 6 h at 230C, ethylenediamine (100 μL) was added as an active ester scavenger and allowed to react for 30 min. CH2Cl2 (20 rnL) and aqueous citric acid (10%, 50 rnL) were added followed by extraction with CH2Cl2 (2 x 30 rnL). The organic extracts were combined, dried over anhydrous Na2SO4, and solvent removed in vacuo. Flash column chromatography (MeOH / CH2Cl2, 1:25) afforded 19 (195 mg, 66%), mp 80 - 820C; 1H NMR (400 MHz, CDCl3) δ 9.05 (d, J = 2.7 Hz, IH), 8.58 (t, J = 5.1 Hz, IH), 8.20 (dd, J = 2.6 Hz, J = 9.5 Hz, IH), 7.99 - 7.97 (m, IH), 7.75 - 7.68 (m, 2H), 7.62 - 7.59 (m, IH), 6.95 (d, J = 9.6 Hz, IH), 6.42 (t, J = 5.9 Hz, IH), 5.19 (d, J = 4.6 Hz, IH), 3.62 - 3.56 (m, IH), 3.47 - 3.34 (m, 6H), 2.46 - 2.40 (m, IH), 2.27 (t, J = 7.3 Hz, 2H), 2.00 - 0.97 (m, 35H), 0.94 (s, 3H), 0.90 (d, J = 6.5 Hz, 3H), 0.87 (d, J = 1.8 Hz, 3H), 0.85 (d, J = 1.8 Hz, 3H), 0.65 (s, 3H); 13C NMR (75.5 MHz, CDCl3) δ 173.0, 148.5, 148.0, 140.0, 135.8, 133.8, 133.7, 131.8, 130.6, 130.3, 130.2, 124.2, 124.1, 122.5, 114.2, 59.2,
56.7, 56.2, 50.0, 43.4, 42.3, 41.7, 39.7, 39.5, 38.3, 37.7, 36.6, 36.4, 36.2, 35.8, 34.0, 31.9,
31.8, 31.6, 28.4, 28.2, 28.0, 27.5, 26.5, 25.1, 24.3, 23.9, 22.9, 22.6, 21.0, 19.4, 18.8, 11.9; IR (film) vmax 3365, 2934, 2866, 1621, 1545, 1336 cm"1; CI m/z 907.5003 (MH+, C48H71N6O9S requires 907.5003).
N-{3-[(3β)-cholest-5-en-3-ylamino]propyl}-6-[(2,4-dinitrophenyl)amino]hexanamide
(4). To a slurry of Λ^-(3-{(3β)-cholest-5-en-3-yl[(2-nitrophenyl)sulfonyl]amino}propyl)-6- [(2,4-dinitrophenyl) amino]hexanamide (19, 164 mg, 0.180 mmol) and K2CO3 (270 mg, 1.954 mmol) in iV,./V-dimethylformamide (20 mL) was added thiophenol (80 μL, 0.777 mmol). After stirring at 230C for 18 h, the mixture was filtered and solvent was removed in vacuo. The crude product was purified by flash column chromatography (MeOH / triethylamine / CH2Cl2, 2:5:100) to afford 4 (77 mg, 59%) mp 165 - 1660C; 1H NMR (500 MHz, CDCl3) δ 9.11 (d, J= 2.6 Hz, IH), 8.53 (br s, IH), 8.25 (dd, J = 2.5 Hz, J = 9.5 Hz, IH), 6.99 (t, J = 4.3, IH), 6.90 (d, J = 9.5 Hz, IH), 5.29 (d, J = 4.8 Hz, IH), 3.42 - 3.38 (m, 2H), 3.34 (dt, J = 5.8 Hz, J= 5.9 Hz, 2H), 2.74 (t, J= 6.1 Hz, 2H), 2.39 - 2.34 (m, IH), 2.23 - 2.17 (m, 3H), 2.04 - 1.92 (m, 4H), 1.84 - 0.98 (m, 32H), 0.95 (s, 3H), 0.90 (d,
J = 6.5 Hz, 3H), 0.85 (d, J = 2.1 Hz, 3H), 0.84 (d, J = 2.1 Hz, 3H), 0.65 (s, 3H); 13C NMR (75.5 MHz, CDCl3) δ 172.5, 148.5, 141.5, 136.2, 130.5 (x2), 124.5, 121.2, 114.7, 58.4, 56.9, 56.3, 50.4, 45.5, 43.6, 42.5, 40.3, 39.9, 39.7, 39.3, 38.1, 37.2, 36.6, 36.4, 36.0, 32.1, 32.0, 29.7, 29.2, 28.7, 28.4, 28.2, 26.8, 25.3, 24.4, 24.0, 23.0, 22.7, 21.2, 19.6, 18.9, 12.0; IR (film) vmax 3362, 3295, 2934, 2867, 1622, 1336 cm"1; CI m/z 722.5229 (MH+, C42H68N5O5 requires 722.5220).
N-{3- [(3β)-cholest-5-en-3-ylamino] -3-oxopropyl}-6- [(2,4-dinitrophenyl) amino]hexanamide(5). To 3-(tert-butoxycarbonylamino)-Λf-cholesterylpropionamide (44 mg, 0.079 mmol, prepared as previously reported6) was added trifluoroacetic acid in
CH2Cl2 (1:20, 10 mL). After 2 h at 230C, TLC analysis (MeOH / CH2Cl2, 1:20) revealed conversion to the more polar primary amine. Aqueous NaOH (1 M, 40 mL) was added followed by extraction with CH2Cl2 (2 x 15 mL). The organic extracts were combined, dried over anhydrous Na2SO4, and solvent was removed in vacuo. CH2Cl2 (10 mL) was added followed by 6- (2,4-dinitrophenyl) aminohexanoic acid succinimidyl ester (37 mg, 0.095 mmol) and diisopropylethylamine (80 μL, 0.459 mmol). After 6 h at 230C, CH2Cl2 (10 mL) and aqueous citric acid (10%, 30 mL) were added. This mixture was extracted with CH2Cl2 (2 x 15 mL), the organic layer was dried over anhydrous Na2SO4, and solvent was removed in vacuo. Flash column chromatography (MeOH / CH2Cl2, 1:50) afforded 5 (47 mg, 80%), mp 197 - 1980C; 1H NMR (400 MHz, CDCl3) δ 9.15 (d, J = 2.7 Hz, IH), 8.56 (br s, IH), 8.28 (dd, J = 2.5 Hz, J = 9.6 Hz, IH), 6.92 (d, J = 9.6 Hz, IH), 6.46 (d, J = 5.5 Hz, IH), 5.56 (d, J = 8.0 Hz, IH), 5.36 - 5.35 (m, IH), 3.71 - 3.63 (m, IH), 3.55 - 3.51 (m, 2H), 3.44 - 3.40 (m, 2H), 2.39 (t, J = 5.8 Hz, 2H), 2.30 - 2.26 (m, IH), 2.21 (t, J= 7.3 Hz, 2H), 2.09 - 1.00 (m, 33H), 0.98 (s, 3H), 0.92 (d, J = 6.52 Hz, 3H), 0.88 (d, J = 1.8 Hz, 3H), 0.86 (d, J = 1.8 Hz, 3H), 0.68 (s, 3H); 13C NMR (90.6 MHz, CDCl3) δ 172.8, 171.0, 148.6, 140.3, 136.3, 130.6 (x2), 124.6, 122.4, 114.1, 56.9, 56.4, 50.3, 50.1, 43.5, 42.5, 39.9, 39.7, 39.5, 38.0, 36.8, 36.5, 36.4, 36.0, 35.8, 35.7, 32.1, 29.9, 29.3, 28.6, 28.4, 28.2, 26.7, 25.2, 24.5, 24.0, 23.0, 22.8, 21.2, 19.5, 18.9, 12.1; IR (CDCl3) Vmax 3691, 2937, 2868, 1660, 1622, 1475, 1338 cm"1; CI m/z 736.5013 (MH+, C42H66N5O6 requires 736.5013).
N-[3-({3-[(3-{(3β)-cholest-5-en-3-yl[(2-nitrophenyl)sulfonyl]amino}propyl)amino]-3- oxopropyl}amino)-3-oxopropyl]-6-(7-nitrobenzofurazan-4-ylamino)hexanamide (24). tert-butyl 3-({3-[(3-{(3β)-cholest-5-en-3-yl[(2-nitrophenyl)sulfonyl]amino}propyl)amino]- 3-oxopropyl}amino)-3-oxopropyl carbamate (18, 41 mg, 0.047 mmol) was treated with trifluoroacetic acid in CH2Cl2 (2:25, 10 niL). After 2 h at 230C, TLC analysis (MeOH / CH2Cl2, 1:25) revealed conversion to the more polar primary amine. Aqueous NaOH (1 M, 10 mL) was added, the mixture was extracted with CH2Cl2 (2 x 10 mL), the organic extracts were combined, dried over anhydrous Na2SO4, and solvent was removed in vacuo. CH2Cl2 (10 mL) was added followed by 6-(N-(7-nitrobenz-2-oxa-l,3-diazol-4-yl)amino) hexanoic acid succinimidyl ester (22 mg, 0.057 mmol) and diisopropylethylamine (100 μL, 0.471 mmol). After 8 h at 230C, aqueous citric acid (10%, 20 mL) was added followed by extraction with CH2Cl2 (2 x 10 mL). The organic extracts were dried over anhydrous Na2SO4 and solvent removed in vacuo. Flash column chromatography (MeOH / CH2Cl2, 1:25) afforded 24 (36 mg, 72%), mp 113 - 1140C; 1H NMR (300 MHz, CDCl3) δ 8.45 (d, J = 8.72 Hz, IH), 7.99 (m, IH), 7.71 (m, 2H), 7.61 (m, IH), 7.48 (br s, IH), 6.80 (t, J= 5.6 Hz, IH), 6.71 (t, J = 5.6 Hz, 2H), 6.17 (d, J = 8.8 Hz, IH), 5.18 (d, J = 4.1 Hz, IH), 3.64 - 3.46 (m, 7H), 3.41 - 3.34 (m, 4H), 2.47 - 2.38 (m, 5H), 2.23 (t, J = 6.9 Hz, 2H), 2.16 - 0.97 (m, 35H), 0.93 (s, 3H), 0.90 (d, J = 6.4 Hz, 3H), 0.87 (d, J = 1.2 Hz, 3H), 0.85 (d, J = 1.2 Hz, 3H), 0.65 (s, 3H); 13C NMR (75.4 MHz, CDCl3) δ 173.3, 172.2 (x2), 148.1, 144.7, 144.5, 144.3, 140.0, 137.0, 133.9, 133.8, 132.0, 130.7, 124.3, 123.2, 122.8, 98.8, 59.3, 56.8, 56.3, 50.1, 44.0, 42.5, 41.8, 39.8, 39.7, 38.4, 37.8, 36.7, 36.5, 36.3 (x2), 36.1 (x2), 36.0 (x2), 35.9, 32.0, 31.9, 29.9, 28.4, 28.2, 27.9, 27.7, 26.4, 25.0, 24.4, 24.0, 23.0, 22.8, 21.1, 19.6, 18.9, 12.0; IR (film) vmax 3292, 2936, 2868, 1650, 1585, 1547, 1300 cm"1; CI m/z 1046.5723 (MH+, C54H80N9Oi0S requires 1046.5749).
N-(3-{[3-({3-[(3β)-cholest-5-en-3-ylamino]propyl}amino)-3-oxopropyl]amino}-3- oxopropyl)-6-(7-nitrobenzofurazan-4-ylamino)hexanamide (6). To a slurry of N-[3- ({3-[(3-{(3β)-cholest-5-en-3-yl[(2-nitrophenyl)sulfonyl]amino}propyl)amino]-3- oxopropyl}amino)-3-oxopropyl]-6-(7-nitrobenzofurazan-4-ylamino)hexanamide (24, 29 mg, 0.028 mmol) and K2CO3 (76 mg, 0.552 mmol) in iV,./V-dimethylformamide (6 mL) and tetrahydrofuran (2 mL) was added thiophenol (40 μL, 0.389 mmol). After 18 h at 230C, the suspension was filtered and solvent removed in vacuo. Purification by preparative reverse-phase HPLC (gradient: 59.9% MeCN, 40% H2O, and 0.1% TFA to 99.9% MeCN, 0% H2O, and 0.1% TFA over 14 min; retention time = 10.6 min) afforded 6 (15 mg, 52%) mp 170 -1710C; 1H NMR (500 MHz, CDCl3) δ 9.54 (br s, IH), 8.68 (br s, IH), 8.50 (d, J = 8.4 Hz, IH), 8.07 (t, J = 5.35, IH), 7.92 (t, J = 5.4 Hz, IH), 7.80 (t, J = 5.3 Hz, IH), 6.40 (d, J = 8.9 Hz, IH), 5.36 (m, IH), 3.43 (m, IH), 3.24 - 3.17 (m, 4H), 3.10 (m, 2H), 2.88 (br s, 3H), 2.35 (d, J = 7.2 Hz, 2H), 2.23 (t, J= 6.9 Hz, 2H), 2.18 (t, J= 7.1 Hz, 2H), 2.04 (t, J = 7.2 Hz, 2H), 1.94 - 0.96 (m, 35H), 0.93 (s, 3H), 0.86 (d, J= 6.2 Hz, 3H), 0.84 (d, J= 2.1 Hz, 3H), 0.82 (d, J = 2.1 Hz, 3H), 0.62 (s, 3H); 13C NMR (125.8 MHz, DMSO d6) δ 171.9, 170.8, 170.3, 145.1, 144.4, 144.2, 138.6, 137.9 122.3, 120.5, 99.1, 56.6, 56.1, 55.5, 49.3 (x2), 45.5, 43.3, 41.8 (x2), 41.5, 36.4, 36.2, 35.6 (x2), 35.5 (x2), 35.3 (x2), 35.2, 35.1, 34.3, 31.2, 27.7, 27.4, 27.3, 26.2, 26.0, 24.9, 24.3, 23.8, 23.2, 22.6, 22.4, 20.5, 18.8, 18.5, 11.6; IR (film) vmax 3173, 3075, 2919, 2848, 1634, 1538, 1331 cm"1; CI m/z 861.5965 (MH+, C48H77N8O6 requires 861.5966).
N-{3-[(3-{(3β)-cholest-5-en-3-yl[(2-nitrophenyl)sulfonyl]amino}propyl)amino]-3- oxopropyl}-6-(7-nitrobenzofurazan-4-ylamino)hexanamide (23). Trifluoroacetic acid
in CH2Cl2 (2:25, 7.5 niL) was added to tert-butyl 3-[(3-{(3β)-cholest-5-en-3-yl[(2- nitrophenyl)sulfonyl]amino}propyl)amino]-3-oxopropylcarbamate (17, 51 mg, 0.064 mmol). After 2 h at 23 0C, TLC analysis (MeOH / CH2Cl2, 1:25) revealed conversion to the more polar primary amine. Aqueous NaOH (1 M, 25 mL) was added and the mixture was extracted with CH2Cl2 (2 x 20 mL). The organic extracts were combined, dried over anhydrous Na2SO4, and solvent was removed in vacuo. CH2Cl2 (10 mL) was added followed by 6-(N-(7-nitrobenz-2-oxa-l,3-diazol-4-yl)amino)hexanoic acid succinimidyl ester (30 mg, 0.077 mmol) and diisopropylethylamine (110 μL, 0.631 mmol). After 8 h at 230C, aqueous citric acid (10%, 45 mL) was added followed by extraction with CH2Cl2 (2 x 20 mL). The combined organic extract was dried over anhydrous Na2SO4 and concentrated in vacuo. Flash column chromatography (MeOH / CH2Cl2, 1:50) afforded 23 (58 mg, 92%), mp 86 - 890C; (500 MHz, CDCl3) δ 8.67 (d, J = 8.7 Hz, IH), 7.96 (m, IH), 7.69 (m, 2H), 7.58 (m, IH), 7.28 (br s, IH), 6.66 (br s, IH), 6.61 (br s, IH), 6.16 (d, J = 8.4 Hz, IH), 5.16 (br s, IH), 3.61 - 3.45 (m, 5H), 3.38 - 3.32 (m, 4H), 2.46 (t, J = 5.5 Hz, 2H), 2.39 (t, J = 12.7 Hz, IH), 2.23 (t, J = 7.0 Hz, 2H), 1.98 - 0.96 (m, 35H), 0.91 (s, 3H), 0.89 (d, J = 6.4 Hz, 3H), 0.86 (d, J = 2.1 Hz, 3H), 0.84 (d, J = 2.1 Hz, 3H), 0.64 (s, 3H); 13C NMR (125.8 MHz, CDCl3) δ 173.4, 172.3, 148.1, 144.7, 144.5, 144.2, 140.0, 137.0, 133.9, 133.8, 132.0, 130.7, 124.3, 123.1, 122.7, 98.7, 59.3, 56.8, 56.3, 50.1, 44.4, 42.4, 41.8, 39.8, 39.7, 38.4, 37.8, 36.7, 36.6, 36.3, 36.2, 35.9 (x2), 35.8, 31.9, 29.8, 28.6, 28.3, 28.2, 28.0, 27.6, 26.4, 25.0, 24.4, 24.0, 23.0, 22.7, 21.1, 19.5, 18.9, 12.0; IR (film) vmax 3281, 2937, 2868, 1652, 1587, 1545, 1301 cm"1; CY mJz 975.5377 (MH+, C5IH75N8O9S requires 975.5378).
N-[3-({3-[(3β)-cholest-5-en-3-ylamino]propyl}amino)-3-oxopropyl]-6-(7- nitrobenzofurazan-4-ylamino)hexanamide (7). To a slurry of iV-{3-[(3-{(3β)-cholest-5- en-3-yl[(2-nitrophenyl) sulfonyl]amino}propyl)amino]-3-oxopropyl}-6-(7- nitrobenzofurazan-4-ylamino) hexanamide (23, 58 mg, 0.059 mmol) and K2CO3 (139 mg, 1.008 mmol) in iV,./V-dimethylformamide (8 mL) and tetrahydrofuran (2 mL), was added
thiophenol (61 μL, 0.590 mmol). After 18 h at 230C, the suspension was filtered and solvent removed in vacuo. The crude product was purified by preparative reverse-phase HPLC (gradient: 59.9% MeCN, 40% H2O, and 0.1% TFA to 99.9% MeCN, 0% H2O, and 0.1% TFA over 10 min; retention time = 7.6 min) to afford 7 (15 mg, 32%) mp 101 - 1040C; 1H NMR (500.13 MHz, CDCl3) δ 9.54 (br s, IH), 8.50 (d, J = 8.9 Hz, IH), 8.42 (br s, IH), 8.01 (t, J = 5.7, IH), 7.82 (t, J = 5.7 Hz, IH), 6.39 (d, J = 6.4 Hz, IH), 5.36 (d, J = 4.7 Hz, IH), 3.43 (m, IH), 3.22 (m, IH), 3.11 (m, 2H), 2.93 - 2.84 (m, 3H), 2.39 - 2.28 (m, 2H), 2.22 (t, J = 7.0 Hz, 2H), 2.04 (t, J= 7.4 Hz, 2H), 1.97 - 0.94 (m, 36H), 0.92 (s, 3H), 0.86 (d, J = 6.5 Hz, 3H), 0.84 (d, J = 2.4 Hz, 3H), 0.82 (d, J = 2.4 Hz, 3H), 0.61 (s, 3H); 13C NMR (125 MHz, DMSO d6) δ 171.9, 170.9, 145.1, 144.4, 144.1, 138.5, 137.9 122.4, 120.5, 99.0, 56.6, 56.0, 55.5, 49.3, 43.3, 41.8 (x2), 41.6, 40.5, 36.4, 36.1 (x2), 35.6, 35.5 (x2), 35.3, 35.2, 35.1, 34.3, 31.2, 27.7, 27.4, 27.3, 26.3, 26.0, 24.9, 24.4, 23.8, 23.2, 22.6, 22.4, 20.4, 18.7, 18.5, 11.6; IR (film) vmax 3257, 3093, 2940, 2858, 1636, 1548, 1377 cm"1; CI m/z 790.5605 (MH+, C45H72N7O5 requires 790.5595).
N-(3-{(3β)-cholest-5-en-3-yl[(2-nitrophenyl)sulfonyl]amino}propyl)-6-(7- nitrobenzofurazan-4-ylamino)hexanamide (22). N- [3-(te/t-butoxycarbonylamino) propyl]-Λf-cholesteryl-2-nitrobenzenesulfonamide (16, 38 mg, 0.053 mmol) was treated with trifluoroacetic acid in CH2Cl2 (2:25, 10 mL). After 2 h at 230C, TLC analysis (MeOH / CH2Cl2, 1:50) revealed conversion to the more polar primary amine. Aqueous NaOH (1 M, 20 mL) was added, and the mixture was extracted with CH2Cl2 (3 x 20 mL). The organic extracts were combined, dried over anhydrous Na2SO4, and solvent was removed in vacuo. CH2Cl2 (10 mL) was added followed by 6-(/V-(7-nitrobenz-2-oxa-l,3-diazol-4- yl)amino)hexanoic acid succinimidyl ester (25 mg, 0.063 mmol) and diisopropylethylamine (92 μL, 0.529 mmol). After 8 h at 230C, aqueous citric acid (10%, 50 mL) was added followed by extraction with CH2Cl2 (2 x 20 mL). The organic extracts were combined, dried over anhydrous Na2SO4, and solvent removed in vacuo. Flash column chromatography (MeOH / CH2Cl2, 1:50) afforded 22 (32 mg, 67%), mp 77 - 790C;
1H NMR (500 MHz, CDCl3) δ 8.38 (d, J = 8.7 Hz, IH), 7.96 (m, IH), 7.68 (m, 2H), 7.57 (m, IH), 7.16 (br s, IH), 6.42 (m, IH), 6.15 (d, J = 8.44 Hz, IH), 5.14 (d, J= 3.3 Hz, IH), 3.60 - 3.45 (m, 3H), 3.38 - 3.34 (m, 4H), 2.39 (t, J = 12.4 Hz, 2H), 2.25 (t, J= 7.1 Hz, 2H), 1.97 - 0.93 (m, 34H), 0.90 (s, 3H), 0.87 (d, J = 6.4 Hz, 3H), 0.84 (d, J = 2.2 Hz, 3H), 0.83 (d, J= 2.2 Hz, 3H), 0.62 (s, 3H); 13C NMR (125.8 MHz, CDCl3) δ 173.3, 148.0,
144.6, 144.4, 144.1, 140.0, 137.0, 133.8 (x2), 131.9, 130.6, 124.2, 123.0, 122.5, 99.0, 59.3,
56.7, 56.2, 50.1, 43.9, 42.4, 41.7, 39.7, 39.6, 38.4, 37.7, 36.7, 36.4, 36.3 (x2), 35.8, 31.9,
31.8, 31.6, 28.3, 28.1, 28.0, 27.6, 26.4, 25.0, 24.3, 23.9, 22.9, 22.7, 20.9, 19.4, 18.8, 11.9; IR (film) vmax 3299, 2928, 2851, 1738, 1586, 1545, 1301 cm"1; CI m/z 904.5021 (MH+, C48H70N7O8S requires 904.5007).
N-{3-[(3β)-cholest-5-en-3-ylamino]propyl}-6-(7-nitrobenzofurazan-4-ylamino) hexanamide (8). To a slurry of iV-(3-{(3β)-cholest-5-en-3-yl[(2-nitrophenyl) sulfonyl]amino}propyl)-6-(7-nitrobenzofurazan-4-ylamino)hexanamide (22, 88 mg, 0.097 mmol) and K2CO3 (134 mg, 0.970 mmol) in N,N-dimethylformamide (8 mL) and tetrahydrofuran (2 mL), was added thiophenol (79 μL, 0.767 mmol). After 18 h at 230C, the suspension was filtered and solvent removed in vacuo. Purification by preparative reverse-phase HPLC (gradient: 69.9% MeCN, 30% H2O, and 0.1% TFA to 99.9%MeCN, 0% H2O, and 0.1% TFA over 10 min; retention time = 7.7 min) afforded 8 (20 mg, 29%) mp 78 - 8O0C; 1H NMR (500 MHz, DMSO d6) δ 9.54 (br s, IH), 8.50 (d, J = 8.8 Hz, IH), 8.43 (br s, IH), 7.99 (t, J = 5.8, IH), 6.38 (d, J= 9.0 Hz, IH), 5.34 (br s, IH), 3.43 (m, IH), 3.11 (m, 2H), 2.94 - 2.81 (m, 3H), 2.30 (m, 2H), 2.09 (t, J= 7.3 Hz, 2H), 1.92 - 0.94 (m, 35H), 0.90 (s, 3H), 0.87 (d, J = 6.4 Hz, 3H), 0.84 (d, J = 2.4 Hz, 3H), 0.83 (d, J = 2.4 Hz, 3H), 0.60 (s, 3H); 13C NMR (125.8 MHz, DMSO d6) δ 172.7, 145.1, 144.4, 144.1, 138.5, 137.9 122.4 (x2), 99.0, 56.6, 56.0, 55.5, 49.3, 43.3, 41.8, 41.7, 41.6, 36.4, 36.1, 35.6, 35.4, 35.1 (x2), 34.3, 31.2 (x2), 27.7, 27.4, 26.3, 26.1, 24.9, 24.4, 23.8, 23.7, 23.1, 22.6, 22.4, 20.4, 18.7, 18.5 (x2), 11.6; IR (film) vmax 3269, 2949, 2868, 1649, 1585, 1530, 1300 cm"1; CI m/z 719.5224 (MH+, C42H67N6O4 requires 719.5224).
N-{3-[(3β)-cholest-5-en-3-ylamino]-3-oxopropyl}-6-(7-nitrobenzofurazan-4- ylamino)hexanamide (9). To 3-(tert-butoxycarbonylamino)-N-cholesterylpropionamide (108 mg, 0.194 mmol, prepared as previously reported6) was added trifluoroacetic acid in CH2Cl2, (2:25, 10 niL). After 2 h at 230C, TLC analysis (MeOH / CH2Cl2, 1 :20) revealed conversion to the more polar primary amine. Aqueous NaOH (1 M, 20 mL) was added followed by extraction with CH2Cl2 (2 x 35 mL). The organic extracts were combined, dried over anhydrous Na2SO4, and solvent was removed in vacuo. CH2Cl2 (15 mL), 6-(N- (7-nitrobenz-2-oxa-l,3-diazol-4-yl)amino)hexanoic acid succinimidyl ester (68 mg, 0.174 mmol), and diisopropylethylamine (338 μL, 1.940 mmol) were added. After 6 h at 230C, aqueous citric acid (10%, 30 mL) was added followed by extraction with CH2Cl2 (2 x 35 mL). The organic extracts were combined, dried over anhydrous Na2SO4, and solvent removed in vacuo. Flash column chromatography (MeOH / CH2Cl2, 1.5:100) afforded 9 (103 mg, 81%), mp 72 - 740C; 1H NMR (500 MHz, CDCl3) δ 8.43 (d, J = 8.7 Hz, IH), 7.30 (br s, IH), 6.80 (br s, IH), 6.15 (d, J = 7.9, IH), 6.04 (d, J = 7.2 Hz, IH), 3.57 - 3.52 (m, 2H), 3.44 (m, IH), 2.44 (t, J= 5.4 Hz, 2H), 2.22 (t, J= 7.1 Hz, 2H), 1.83 - 1.66 (m, 8H), 1.55 - 0.93 (m, 29H), 0.98 (s, 3H), 0.87 (d, J = 6.6 Hz, 3H), 0.84 (d, J = 2.1 Hz, 3H), 0.82 (d, J = 2.1 Hz, 3H), 0.67 (s, 3H); 13C NMR (125.8 MHz, CDCl3) δ 173.1, 171.3, 144.5, 144.4, 144.2, 136.9 (x2), 123.2, 107.8, 98.6, 56.3, 56.2, 52.2, 47.5, 42.9, 42.8, 40.1, 39.6, 36.5, 36.2 (x2), 35.9 (x2), 35.8, 35.3, 33.3, 30.9, 28.3, 28.1, 26.4, 26.2, 25.0, 24.9,
24.4, 23.9, 22.9, 22.7 (x2), 20.1, 18.8, 12.4, 11.9; IR (CDCl3) Vmax 3269, 2949, 2868, 1649, 1620, 1584, 1530,1300 cm"1; CI m/z 733.5004 (MH+, C42H65N6O5 requires 733.5016).
5-({[3-({3-[(3β-cholest-5-en-3-ylamino]propyl}amino)-3-oxopropyl]amino}carbonyl)-
2-(2,7-difluoro-6-hydroxy-3oxo-3H-xanthene-9-yl)benzoate (10). Trifluoroacetic acid in CH2Cl2 (2:25, 2 niL) was added to tert-butyl 3-[(3-{(3β)-cholest-5-en-3-yl[(2- nitrophenyl)sulfonyl]amino}propyl)amino]-3-oxopropylcarbamate (17, 11 mg, 0.014 mmol). After 2 h at 23 0C, TLC analysis (MeOH / CH2Cl2, 1:25) revealed conversion to the more polar primary amine. Aqueous NaOH (1 M, 5 mL) was added and the mixture was extracted with CH2Cl2 (2 x 10 mL). The organic extracts were combined, dried over anhydrous Na2SO4, and solvent was removed in vacuo. DMF (5 mL) was added followed by 5-carboxyoregon green succinimidyl ester (5 mg, 0.010 mmol). To this solution was added diisopropylethylamine (5 μL, 0.028 mmol). After stirring at 230C for 20 h, the reaction mixture was concentrated in vacuo. The product was purified by preparative reverse-phase HPLC (gradient: 89.9% CH3CN, 10% ddw, and 0.1% TFA to 98.9% CH3CN, 1% ddw, and 0.1% TFA over 10 min followed by isocratic at 98.9% CH3CN, 1% ddw, and 0.1% TFA for an additional 10 min; retention time = 16.2 min (215 nm)) to yield an orange oil (5.5 mg, 50%) corresponding to the nosyl-protected precursor. CI m/z 1093.4837 (MH+, C60H70F2N4O11S requires 1093.4809). To a slurry of this nosyl-protected precursor (5.5 mg, 0.005 mmol) was added K2CO3 (7.0 mg, 0.050 mmol), DMF (2 mL), and thiophenol (2.8 mg, 0.025 mmol). This mixture was stirred at 230C for 16 h, filtered, and solvent removed in vacuo to yield a crude solid that was purified by preparative reverse-phase HPLC (gradient: 89.9% CH3CN, 10% ddw, and 0.1% TFA to 98.9% CH3CN, 1% ddw, and 0.1% TFA over 10 min followed by isocratic at 98.9% CH3CN, 1% ddw, and 0.1% TFA for an additional 10 min; retention time = 11.6 min (215 nm)) to yield an orange oil (3.1 mg, 69%). 1H NMR (CDC13:CD3OD, 8:2, 400 MHz) δ 8.38 (s, IH), 8.14 (d, J = 7.4 Hz, IH), 7.20 (d, J = 7.9 Hz, IH), 6.84 - 6.70 (m, 2H), 6.34 - 6.28 (m, 2H), 5.36 (s, IH), 3.72 - 3.62 (m, 2H), 3.11 - 3.05 (m, 2H), 2.96 - 2.90 (m, 2H), 2.88 - 2.76 (m, IH), 2.57 - 2.48 (m, 2H), 2.40 - 2.31 (m, 2H), 1.98 - 0.79 (m, 40H), 0.60 (s, 3H); CI m/z 908.5085 (MH+, C54H68F2N3O7 requires 908.5026).
Synthesis of a fluorescent DNP-derived probe for fluorescence polarization assays.
The synthesis of fluorescent probe 27 is outlined in Scheme S 1. This fluorescent probe (27) was employed to determine the apparent affinity of DNP for rabbit polyclonal anti- DNP IgG by fluorescence polarization.
Scheme Sl.
3-aminopropyl-6-[(2,4-dinitrophenyl)amino]hexanamide (26). 6 (2,4- dinitrophenyl) aminohexanoic acid succinimidyl ester (200 mg, 0.510 mmol) was added to 1,3-diaminopropane (8.6 niL, 102.09 mmol). After 1 h at 230C, aqueous NaOH (1 M, 200 mL) was added followed by extraction with CH2Cl2 (5 x 50 mL). The organic extracts were combined and washed with 1 M HCl (5 x 50 mL). The acidic aqueous layers were combined, rendered basic to litmus with aqueous NaOH (1 M), and extracted with dichloromethane (5 x 50 mL). The combined organic extracts were dried over anhydrous Na2SO4, and solvent was removed in vacuo to afford 26 as a dark orange oil (93 mg, 53 %). 1H NMR (CDCI3/CD3OD, 8:2, 300 MHz) 58.95 (d, J = 2.7 Hz, IH), 8.49 (t, J = 4.7 Hz, IH), 8.14 (dd, J= 2.7 Hz, J= 9.6 Hz, IH), 7.08-7.00 (m, IH), 6.87 (d, J= 9.6 Hz, IH), 3.38-3.29 (m, 2H), 3.22-3.16 (m, 2H), 2.63 (t, J = 6.7 Hz, 2H), 2.13 (t, J = 7.4 Hz, 2H), 1.75-1.51 (m, 6H), 1.44-1.36 (m, 2H); 13C NMR (75.4 MHz) δ 173.7, 148.3, 135.6. 130.3, 130.0, 124.2, 114.1, 43.2, 38.7, 36.6, 36.0, 31.7, 28.3, 26.4, 25.1; IR (film) vmax
3413, 3321, 2937, 2868, 1702, 1655, 1546, 1367 cm"1; Cl m/z 354.1756 (MH+, C15H24N5O5 requires 354.1772).
N-{3-[5-fluoresceinisothiourea]propyl-6-[(2,4- dinitrophenyl)amino]hexanamide (27). To 3-aminopropyl-6-[(2,4- dinitrophenyl)amino]hexanamide (26, 45 mg, 0.128 mmol) in THF/MeOH (3:2, 5 mL) was added 5-fluorescein isothiocyanate (55 mg, 0.141 mmol) and diisopropylethylamine (44 μL, 0.253 mmol). After stirring at 230C for 20 h, solvent was removed in vacuo, and the crude product was purified by preparative reverse -phase HPLC (gradient: 9.9% MeCN, 90% H2O, and 0.1% TFA to 98.9% MeCN, 1% H2O, and 0.1% TFA over 40 min; retention time = 15.0 min). The product was lyophilized from water to yield 27 as an orange solid (61 mg, 64%), mp 136 - 1390C. 1H NMR (CDCI3/CD3OD, 8:2, 360 MHz) δ 8.88d, J= 2.7
Hz, IH), 8.14 (d, J = 1.9 Hz, IH), 8.04 (dd, J= 2.7 Hz, J= 9.6 Hz, IH), 7.79 (dd, J= 2.0 Hz, J= 8.3 Hz, IH), 6.99 (d, J= 8.3 Hz, IH), 6.92 (d, J= 9.0 Hz, 2H), 6.79 (m, 3H), 6.63 (dd, J= 2.2 Hz, J = 9.0 Hz, 2H), 3.50 (t, J= 5.8 Hz, 2H), 3.24 (t, J= 7.1 Hz, 2H), 3.15 - 3.13 (m, IH), 3.09 (t, J = 6.2 Hz, 2H), 2.06 (t, J = 7.3 Hz, 2H), 1.66-1.47 (m, 6H), 1.34- 1.25 (m, 2H); 13C NMR (75.4 MHz) 5 181.1, 174.4, 168.5, 164.1 (x2), 155.2 (x2), 148.3 (x2), 141.1, 135.6, 130.6 (x2), 130.3 (x2), 130.0, 129.0, 126.6, 124.2 (x 2), 121.7, 115.4 (x2), 114.2 (x2), 112.6, 102.6 (x2), 43.1, 41.1, 36.1, 36.0, 28.6, 28.3, 26.3, 25.2; IR (film) Vmax 3318, 3097, 2936, 2860, 2502, 1619, 1584 cm"1; CI m/z 743.2184 (MH+, C36H35N6Oi0 S requires 743.2130).
EXAMPLE 6: Biological Assays.
Cell culture. Jurkat lymphocytes (acute T-cell leukemia, ATCC #TIB-152) were maintained in Roswell Park Memorial Institute (RPMI) 1640 media supplemented with Fetal Bovine Serum (FBS, 10%), penicillin (100 units / mL), and streptomycin (100 μg / mL). RPMI media used for cell culture and wash steps contained antibiotics and FBS unless otherwise noted. OPTI-MEM media employed for transfection was not supplemented with FBS or antibiotics.
Microscopy. Confocal laser scanning microscopy (Figure 8, Figure 11, and Figure 7) employed an Olympus FV300 microscope fitted with a UplanFl objective (60 X). Alexa Fluor 488 was excited with a 488 nm Argon ion laser and emitted photons were collected through 510 nm LP and 530 nm SP filters. Excitation of Alexa Fluor 594 and BODIPY TR ceramide employed a 543 nm He-Ne laser and a 565 nm LP filter. Epifluorescence micrographs (Figure 9 and Figure 10) were captured through a Zeiss Fluar (100 X) objective by a Zeiss Axiocam digital camera interfaced to a Zeiss Axiovert SlOOTV microscope. Fluorophores were excited with FITC/Bodipy (Ex. 480/40, Em. 535/50) or Texas Red (Ex. 560/55, Em. 645/75) filter sets (Chroma). Images were processed with Adobe Photoshop 7.0.
Flow cytometry. Analyses were performed with Beckman-Coulter XL-MCL bench-top and EPICS Elite flow cytometers. Forward- scatter (FS) and side-scatter (SSC) dot plots afforded cellular physical properties of size and granularity that allowed gating of live cells. After gating, 10,000 cells were counted. For studies of uptake of anti-DNP / PrA-AF488 mediated by receptors 2-5, AF-488 was excited at 488 nm with a 15 mW air-
cooled argon-ion laser, the emission was split with a 550 nm dichroic and filtered through a 510 nm long pass filter and 530/30-nm band pass filter using the XL-MCL cytometer. The PMT voltage for this instrument was set to 724 for detection of AF488. Calibration with Sphere Rainbow Calibration particles (Spherotech) bearing 330,000 molecules of fluorescein/particle provided a fluorescence of 15.6 at this voltage. For studies of uptake of anti-DNP / PrA-AF633 mediated by the green fluorescent NBD-derived receptors 6-9, the EPICS Elite cytometer was employed. Fluorescence detection was derived from simultaneous excitation at 488 nm and 633 nm. A 550 nm dichroic long pass filter split the emission, sending the green light to PMT2, which was interfaced to an additional 525 nm bandpass filter. The emission passed through a 640 nm longpass dichroic which removed laser light with final filtering through a 675 nm bandpass filter. The PMT voltages for this instrument were set to 724 for AF488 and 660 for AF633. Cells treated with receptors 6-9 alone were used to subtract minimal red fluorescent cross talk (< 10%) of the NBD fluorophore. Antibody uptake assays (Figure 8, Panels A-B, Figure 10, and Figure 11).
Synthetic receptors 2-9 in DMSO were diluted in RPMI media (0.5 mL, final DMSO concentration = 1%) containing Jurkat lymphocytes (1 x 106). These receptor-treated cells were incubated at 370C for 1 h, washed with RPMI media (2 x 0.5 mL) to remove unincorporated receptors / DMSO, and resuspended in fresh media (89 μL). To these cells was added a pre-equilibrated complex (preincubated at 230C for 1 h) of anti-DNP IgG (9.6 μg) and the PrA-Alexa Fluor conjugate (PrA- AF488 or PrA-AF633, 3 μg) in phosphate- buffered saline (11 μL, pH 7.4, total volume = 100 μL). Cells were typically maintained at 370C for 4 h to promote synthetic receptor-mediated endocytosis. Prior to analysis, treated cells were washed with media (0.5 mL), washed again with media containing 6-(2,4- dinitrophenyl)aminohexanoic acid (100 μM, 3 x 0.5 mL x 20 min, 1% DMSO) to compete away any non-internalized protein, washed again with media (0.5 mL), and resuspended in media (0.6 mL) for analysis by epifluorescence microscopy, confocal microscopy, or flow cytometry. For the competitive inhibition of uptake experiments shown to the right of Figure 8, Panel B, 6-(2,4-dinitrophenyl)aminohexanoic acid was preincubated with the anti-DNP IgG / PrA-AF488 complex (23 0C for 1 h in phosphate-buffered saline) prior to addition to cells treated with receptor 2 (1 μM).
Antibody uptake kinetics (Figure 8, Panel C). To determine the relative uptake rates shown on the left of Figure 8C, Jurkat lymphocytes were subjected to the antibody uptake assay (cells were treated with receptors 2 - 5 at 10 μM for 1 h followed by addition of a pre-equilibrated complex (preincubated at 230C for 1 h) of anti-DNP-IgG / PrA- AF488 for 15 min to 4 h) and internalized cellular fluorescence was quantified by flow cytometry. Doubling the concentration of pre-equilibrated anti-DNP-IgG / PrA-AF488 did not affect the rate or magnitude of uptake (data not shown), indicating that synthetic receptors were saturated under these conditions. Observed rates of ligand uptake (kobs) were calculated with a Michaelis-Menten kinetic model assuming saturating concentrations of substrate (kobs = (F1-F0 )/t). t = time (in minutes), Ft = fluorescence at the specified time, and Fo= fluorescence at time = 0 min. The slope of plots of fluorescence vs. time provided kobs values that were divided by the basal rate of endocytosis (no receptor) to determine the relative rates of uptake.
The rate constant and the ligand internalization half-life shown on the right of Figure 8C were determined by treatment of Jurkat lymphocytes (in RPMI media, 500 μL) with receptor 2 (1 μM) for 1 h at 370C. These cells were washed with ice-cold media (500 μL) and maintained at 40C. A pre-equilibrated (1 h at 230C) ice-cold solution of RPMI media (100 μL) containing anti-DNP-IgG (7.2 μg) and PrA-AF488 (2 μg) was added. After 1 h at 40C, the cells were washed with ice-cold RPMI media (2 x 500 μL). Cells were equilibrated at 370C for 20 min prior to fluorescence measurements to dissociate excess surface-bound antibody. After equilibration, uptake experiments were initiated (this was defined as t = 0 min). Cells were subsequently incubated at 370C for fixed periods of time (0 to 3 h), cooled to 40C on ice, and washed with ice-cold RPMI media containing 6- (2,4-dinitrophenyl)aminohexanoic acid (100 μM, 1% DMSO, 3 x 0.5 mL x 10 min at 40C followed by 2 x 0.5 mL x 20 min at 230C) to remove non-internalized IgG. Intracellular fluorescence was quantified by flow cytometry. Cell surface fluorescence was calculated by subtracting this intracellular fluorescence from cellular fluorescence measured at t = 0 min (after the initial equilibration at 370C for 20 min; the competition with 6-(2,4- dinitrophenyl)aminohexanoic acid was omitted to analyze this cellular fluorescence). Curve fitting of the natural log of the calculated cell surface fluorescence against time revealed a linear relationship (r = 0.9991) indicating first order kinetics. The absolute
value of the slope provided the rate of uptake (k = 0.007327 + 0.000006 min"1), and the ligand internalization half-life (t1/2 = 95 min) was calculated as (In 2) / k.
Quantification of the percentage of receptors 6-9 on the cell surface (Figure 9, Panel B). Jurkat lymphocytes in media (1 x 106, 0.5 mL, 1% DMSO) were incubated with receptors 6-9 (10 μM) for 1 h at 370C. Cells were washed with media (0.5 mL), resuspended in media (0.5 mL), and divided into two equal portions. One portion was treated with sodium dithionite (Na2S2O4, 5 mM) in media (0.5 mL) for 10 seconds to irreversibly quench cell surface fluorophores. Cells were immediately washed with media (2 x 0.5 mL), and the fluorescence of the treated portion and control portion was analyzed by flow cytometry. The fluorescence of the treated cells was subtracted from the control (total) cellular fluorescence to determine the population of intracellular and cell surface fluorophores.
Quantification of the cellular stability of receptor 2 (Figure 9, Panel C). Jurkat lymphocytes (1 x 107) were incubated with receptor 2 in media (5 mL, 10 μM receptor, 1% DMSO) for 1 h at 370C in a 15 mL aerated centrifuge tube. Cells were washed with media (2 x 5 mL) to remove unincorporated receptor, resuspended in media (10 mL), transferred to a tissue culture flask (25 cm2), and maintained at 370C. At fixed time points, an aliquot of this culture (1 mL) was removed from the flask and cells isolated by centrifugation. These cells were resuspended in media (89 μL) and a pre-equilibrated (230C for 1 h) complex of anti-DNP IgG (9.6 μg) and PrA488 (3 μg) in phosphate buffered saline (PBS, 11 μL, pH 7.4) was added for 5 min at 370C. Treated cells were centrifuged (1300 g for 2 min), the supernatant was removed, cells were resuspended in media (0.5 mL), and cellular fluorescence was analyzed by flow cytometry. The loss of cellular fluorescence was fit to the two-phase exponential decay model provided by GraphPad Prism version 3.0 software (plateau = 0, GraphPad Software, San Diego, CA) to yield the cell surface half-life of 20 h.
Analysis of cycling of fluorescent receptor 6 between endosomes and the cell surface (Figure 10). Jurkat lymphocytes (4 x 106) were suspended in media (2 mL, 1% DMSO) containing receptor 6 (10 μM) and incubated for 1 h at 370C. Cells were washed with media (2 x 2 mL), and cooled on ice (2 min) to block plasma membrane recycling. Ice-cold media containing sodium dithionite (30 mM, 1 mL) was added and the cells were maintained at 40C for 5 min to irreversibly quench cell surface fluorophores. Cells were washed with serum free recycling media (composition described on page S 16, 2 x 1 mL),
resuspended in serum- free recycling media (368 μL), and equally partitioned into four 1.5 mL Eppendorf tubes designated A, B, C, and D. Tubes A and B were incubated at 370C for 30 min to allow internalized receptor to return to the cell surface. Tubes C and D were maintained on ice to inhibit recycling. Tubes A and B were cooled on ice (2 min), and a pre-equilibrated complex (preincubated at 230C for 1 h) of anti-DNP IgG (5 μg) and
PrA633 (2 μg) in phosphate buffered saline (PBS, 8 μL, pH 7.4) was added to tubes A and C. PBS (8 μL, pH 7.4) was added to tubes B and D as control experiments. The four tubes were maintained at 4 0C for an additional 15 min, washed with ice-cold serum free recycling media (1 mL), resuspended in ice-cold serum free recycling media (1 mL), and the fluorescence of bound anti-DNP/PrA-AF633 was analyzed by flow cytometry. The background fluorescence of cells in tubes B and D was subtracted from values obtained from cells in tubes A and C respectively to correct for minor spectral overlap (<10%) of the NBD and AF633 fluorophores.
Quantification of efflux kinetics of receptor 10 from endosomes to the plasma membrane by back exchange (Figure 11). The efficiency of removal of 10 from the plasma membrane was examined prior to analysis of efflux kinetics. Jurkat lymphocytes (3 x 106) were suspended in ice-cold serum free recycling media (1.5 mL) and maintained on ice (2 min) to block plasma membrane recycling. These cells were resuspended in ice-cold serum free recycling media (1.5 mL, 1% DMSO) containing 10 (1 μM) and maintained on ice (10 min) to allow association of 10 with the plasma membrane. Receptor-treated cells were washed with ice-cold serum free recycling media (2 x 0.5 mL), resuspended in ice- cold serum free recycling media (1.5 mL), and analyzed by flow cytometry. Cells were isolated by centrifugation, resuspended in ice-cold back-exchange media (serum free recycling media containing 2 mM Me-β-cyclodextrin and 1% BSA, 1.5 mL), maintained on ice (2 min), and analyzed by flow cytometry (this single wash with back-exchange media resulted in a 44% loss of total cellular fluorescence). The cells were maintained on ice, washed again with ice-cold back exchange media (3 x 10 min x 1.5 mL), and analyzed by flow cytometry (this combination of four total wash steps with back-exchange media resulted in a 84% loss of total cellular fluorescence; additional wash steps resulted in >90% removal of receptor from the cell surface).
To determine the half- life of receptor recycling back to the plasma membrane, Jurkat lymphocytes (3 x 106) were resuspended in serum free recycling media containing
10 (1 μM, 1% DMSO, 1.5 niL) and incubated for 10 min at 370C. These cells were washed with serum free recycling media (2 x 1 mL) to remove unincorporated receptor (10). These receptor- treated cells were cooled on ice (5 min) to halt recycling and washed with ice-cold back-exchange media (6 x 1.5 mL x 10 min) to selectively remove 10 from the cell surface without affecting the population of 10 in intracellular endosomes. These cells were resuspended in warm back exchange media (370C, 1.5 mL) to initiate plasma membrane recycling and immediately analyzed by flow cytometry (defined as t = 0 min). Cells were isolated by centrifugation, resuspended in warm back exchange media (1.5 mL, 370C), incubated at 370C, and analyzed by flow cytometry as a function of time. The loss of cellular fluorescence was fit to a one-phase exponential decay model using GraphPad Prism version 3.0 software (GraphPad Software, San Diego, CA), to yield a recycling half- life of 2.8 ± 0.8 min.
Serum free recycling media. This media was prepared as previously described7 and included NaCl (150 mM), KCl (5 mM), CaCl2 (1 mM), MgCl2 (1 mM), glucose (2g / L), and Hepes (20 mM, pH 7.4).
Isolation of lipid rafts by sucrose density gradient ultracentrifugation (Figure 12). A previously reported8 method was modified to analyze the association of protein ligands with lipid raft subdomains of cellular plasma membranes. Rabbit polyclonal anti-DNP IgG was directly conjugated to AF488 with a N-hydroxysuccinimidyl ester labeling kit (Molecular Probes). This fluorescent protein was compared with Cholera toxin-AF488
(CT-AF488) and Transferrin-AF488 from Molecular Probes. Jurkat lymphocytes (1 x 107) in 15 mL Corning tubes (5 mL media, 1% DMSO) were incubated with synthetic receptors 2-5 (1 μM) for 1 h at 370C. These cells were washed with media (2 x 5 mL) and resuspended in ice-cold media (285 μL). To synthetic receptor- treated cells was added anti- DNP-AF488 conjugate in PBS (15 μL, 1 mg/mL). To control cells was added CT-AF488 or transferrin- AF488 in PBS (15 μL, 1 mg/mL). Cells were maintained at 4 0C for 30 min and washed with ice-cold media (2 x 0.5 mL). Cells were lysed at 4 0C in an ultracentrifugation tube (ultra clear 14x89 mm, Beckmann Instruments) by addition of TNEV lysis buffer (2 mL, 0.2% Triton X-100 (v/v), 150 mM NaCl, 5 mM EDTA, 5 mM Na3VO4, 25 mM Tris-HCl, pH 7.4) followed by vortex mixing for 20 seconds every 20 min for 1 h. This lysate was combined with a solution of 80% sucrose in TNEV lysis buffer (2 mL, w/v) to yield 4 mL of a 40% sucrose solution at the bottom of the ultracentrifugation
tube. This 40% sucrose solution was overlayed with 30% sucrose in TNEV lysis buffer (4 rnL), followed by 5% sucrose in TNEV lysis buffer (2 rnL), and a final solution of 2% sucrose in TNEV lysis buffer (2 rnL) by syringe. Masses of ultracentrifugation tubes were balanced to within 1 mg by the addition of 2% sucrose solution in TNEV lysis buffer. Tubes were centrifuged at 33,000 rpm (134,409 g) for 20 h at 40C in a Beckman Optima™ LE-80K preparative ultra centrifuge using a SW41 swinging bucket rotor. Fractions (12 x 1 rnL) were harvested by aspiration with a capillary tube and small pump beginning with the highest density fraction at the bottom of the ultracentrifugation tube. The fluorescence of these fractions were quantified with a Packard Fusion microtiterplate reader fitted with a 480 nm excitation filter and 535 nm emission filter.
Fluorescence polarization assays (Figure 9). Fluorescence polarization binding experiments employed a Packard Fusion microtiterplate reader equipped with a 485 nm excitation filter and a 535 nm polarization emission filter. Apparent dissociation constants for binding of NBD and DNP derivatives to rabbit polyclonal anti-DNP IgG were determined by analyzing a fixed concentration of FITC-DNP (27, 20 nM) or 6-(7- nitrobenzofuran-4-ylamino)hexanoic acid (28, 100 nM) in PBS (pH 7.4, 100 μL). Fluorescent probes were equilibrated for 30 min with varying concentrations of rabbit anti- DNP IgG in black 96 well plates (Costar) prior to fluorescence polarization measurements in triplicate. Dissociation constants were calculated by nonlinear regression using a sigmoidal dose-response model with variable slope (GraphPad Prism 3.0 software).
Polarization values for binding of 28 to rabbit anti-DNP were corrected to compensate for partial binding-induced quenching of the NBD fluorophore.2'3
Transient Transfection of Jurkat Lymphocytes with EGFP-lgpl20 as a green fluorescent marker of late endosomes and lysosomes (Figure 11). The plasmid vector pEGFP-lgpl204 (2 μg in 100 μL OPTI-MEM media) was combined with a solution of DMRIE-C (Invitrogen, 2 μL in 100 μL OPTI-MEM) in a single well on a 24- well plate. This solution was incubated at 230C for 45 min. Jurkat lymphocytes (4 x 10 ) resuspended in OPTI-MEM (60 μL) were added to this well with gentle swirling to mix the components. The 24-well plate was incubated at 370C in a humidified CO2 incubator for 4 h. RPMI media (400 μL) containing FBS (15%), PHA-L (1 μg / mL), and PMA (5 ng / mL), but no antibiotics, was added to the plate. Maximal transfection efficiency (-40%) was obtained after incubation for 24 to 36 h (370C, 5% CO2).
Analysis of receptor cytotoxicity. Jurkat lymphocytes were treated with receptor 3 (10 μM) for 1 h followed by Anti-DNP-IgG / PrA488 for 4 h under the antibody uptake assay conditions. These cells were washed twice with media and incubated for an additional 24 h at 370C. The dead-cell stain propidium iodide (10 μg / mL) was added to cells prior to analysis, and viability was quantified from flow cytometry forward and side- scatter dot plots. Greater than 95% of cells remained viable under these conditions. Additionally, cells were examined after treatment with receptor 2 (10 μM) for 1 h, removal of unincorporated 2 by resuspension in receptor-free cell culture media, and longer-term growth in culture. After an additional 96 h in culture, >90% of these cells remained viable and were morphologically indistinguishable from untreated cells.
EXAMPLE 7: Kinetics of Ligand Uptake for Synthetic Receptors. Synthetic receptors were evaluated as mediators of cellular uptake of protein ligands in living Jurkat lymphocytes, a human T cell line. Confocal laser scanning microscopy and flow cytometry were employed to analyze cells treated with compounds 2-9 for 1 hour followed by addition of anti-DNP IgG complexed with fluorescent conjugates of the IgG-binding protein A (PrA) from S. aureus. Treatment of cells with green fluorescent NBD derivatives 6 (10 μM) and anti-DNP IgG labeled red fluorescent with PrA-Alexa Fluor-594 (PrA-AF594) revealed that the receptor 6 becomes localized both on the cell surface and embedded in the plasma membrane and in intracellular compartments (Figure 9, Panel A). Red fluorescent IgG delivered into these intracellular compartments only partially co- localized with receptor 6 suggesting intracellular dissociation of the receptor from the ligand. (Figure 9, Panel A). This intracellular red fluorescence was 59-fold lower in the absence of receptor 6 consistent with a synthetic receptor-mediated uptake mechanism. The IgG-loaded intracellular compartments were identified as late endosomes and lysosomes by co-localization studies in cells transfected with EGFP- lgp 120, a fluorescent protein marker of these compartments. Excess anti-DNP IgG/PrA-AF594 added to cells treated with 6 did not appreciably deplete this receptor from the cell surface despite extensive uptake of this protein complex. These results are consistent with a delivery mechanism involving the binding of IgG/PrA to receptor 6 at the cell surface, internalization of the complex by endocytosis, dissociation of IgG from 6 in acidic endosomes, and return of receptor 6 to the cell surface by plasma membrane recycling.
EXAMPLE 8: Efficiency of Uptake Mediated by the DNF '-based receptors 2-5. To investigate the efficiency of uptake mediated by the higher affinity DNP-based receptors 2- 5, the magnitude and kinetics of delivery of a green fluorescent anti-DNP/PrA-AF488 complex was quantified by flow cytometry as shown in FIG. 8., panels B and C. These experiments revealed that the longest of the receptors (2) was by far the most efficient in terms of both magnitude and relative rate of delivery of IgG into cells. After treatment of cells for 1 hour with 10 μM of 2, this receptor (2) enhanced the cellular uptake of anti-DNP IgG by 208-fold in magnitude and 391 -fold in rate compared with basal levels of endocytosis. No significant cellular toxicity was observed. Sequential removal of beta- alanine subunits from the linker of 2 to afford receptors 3 and 4 dramatically diminished the effectiveness of these compounds as mediators of ligand uptake. Furthermore, the conversion of the secondary amine of receptor 4 to the secondary amide group of receptor 5 essentially abolished internalization of IgG, reducing delivery by over 50-fold at 10 μM as shown in FIG. 9, panel B.
EXAMPLE 9: Effect of Linker Structure on Subcellular Localization of Synthetic Receptors. Cells were treated with structurally similar green fluorescent receptors (6-9). Epifluorescence microscopy and fluorescence quenching assays were employed to investigate the differences in cellular fluorescence and subcellular localization. As shown in FIG. 10., Panel A, the overall fluorescence resulting from treatment with 10 μM of these compounds was within 2-fold. However, the subcellular localization of these compounds differed dramatically. Receptor 6 bearing two β-alanine linker subunits was observed predominantly on the cell surface. However, the single β-alanine containing receptor 7 exhibited lower cell surface localization, and the absence of B-alanine in the linker of 8 rendered this compound primarily intracellular. Remarkably, the amide analog 9 was essentially completely associated with internal membranes which explain the inability of this analog to mediate significant cellular uptake of the anti-IgG ligand. This amide analog nearly completely localized with a red fluorescent probe of the cellular golgi apparatus and nuclear membrane, indicating a unique intracellular destination of this receptor.
The fraction of receptors 6-9 at the cell surface was quantified by irreversible quenching of exposed NBD fluorophores on the cell surface. This was accomplished by
brief treatment of cells with relatively cell-impermeable reducing agent (sodium hypodisulfite, NaO2S-SO2Na), which rapidly reduces the nitro functionality of extracellular NBD headgroups to the amine, enabling quantification of differences in cell surface and intracellular fluorescence. Quantitative dithionite quenching assays demonstrated dramatic differences in receptor subcellular localization that paralleled the magnitude and kinetics of IgG uptake observed with receptors 2-5, as shown in FIG. 10, Panel B. Thus, differences in trafficking to intracellular membranes control the efficiency of these synthetic receptors.
EXAMPLE 10: Temporal Stability of Receptor 2. To evaluate the temporal stability of receptor 2 on the cell surface, the half- life of this compound on Jurkat lymphocytes was quantified by addition of a soluble antibody. Cells were treated with this receptor for 1 hour (10 μM), unincorporated receptor was removed by washing cells with fresh media, and the abundance of 2 as a function of time was detected with a green fluorescent anti-DNP/PrA-AF488 complex. As shown in FIG. 10., Panel C, curve fitting of the flow cytometry data revealed a cell surface half-life of 20 hours. This value is similar to the 24 hour half- life of natural folate receptor that is anchored to the cell surface by covalently attached GPI lipids.
EXAMPLE 11: Cycling of Receptor 6 Between the Cell Surface and Intracellular Endosomes in Jurkat Lymphocytes. To examine whether the green fluorescent receptor 6 might under dynamic cycling, a fluorescent-quenching assay with sodium dithionite was employed. As shown in FIG 11, Jurkat cells were treated with receptor 6 (10 μM) and cooled to 40C to stop plasma membrane recycling. Fluorescence at the cell surface was quenched by treatment with ice-cold sodium dithionite, and cells were washed with cold media to remove this reducing agent (FIG. 11, Panel A). This cell culture was split into two equal portions; one portion was maintained at 40C, shown in FIG 11, Panel B, for 30 minutes, and the other portion was allowed to return to 370C for 30 minutes to reactivate plasma membrane recycling as shown in FIG.l 1, Panel C. Significant return of green fluorescence back to the plasma membrane was observed only in the panel warmed to 370C. Compare Panels B and C in FIG 11. NBD headgroups that have returned to the cell's surface were detected with an NBD-binding red fluorescent anti-DNP/PrA-AF633 complex. These results demonstrate that the intracellular fraction of synthetic receptors is
in dynamic exchange with the cellular plasma membrane, consistent with synthetic cell surface receptors accessing an active plasma membrane recycling pathway.
EXAMPLE 12: Quantifying the rate of plasma membrane recycling of receptor 10. To quantify the rate of plasma membrane recycling, oregon green-derived receptor 10 was employed. Unlike the more strongly cell-associated DNP and NBD-based receptors, the compound 10 binds proteins in cell culture media and can be rapidly and efficiently depleted from cell surfaces by washing cells with "back exchange" media containing bovine serum albumin (BSA, 1%) and methyl-beta-cyclodextrin (Me-beta-CD, 2 mM). This concentration of Me-beta-CD is known to affect neither endocytosis nor plasma membrane recycling. The oregon green-fluorophore of 10 was also chosen for these studies because unlike structurally similar carboxydfluorescein the fluorescence of oregon green is not appreciably quenched in acidic environment of endosomal compartments. Cells treated with 10 (1 μM) exhibited bright green fluorescence both at the cell surface and in intracellular (endosomal) compartments; patterns of cellular fluorescence were similar to treatment with the structurally related receptor 7 (data not shown). Cells were treated with 10 and cooled to 40C to stop dynamic plasma recycling. These cells were washed four times with ice-cold back exchange media to extensively deplete 10 from the cell surface without affecting the population of this compound in intracellular endosomes. Back exchange media pre-warmed to 370C was subsequently added to these cells to reactivate plasma membrane recycling. This temperature jump resulted in rapid return of 10 to the plasma membrane by endocytosis, and the added back exchange media rapidly removed the recycled receptors from the cell surface. Quantification of cellular fluorescence as a function of time provided the fluorescence decay curve shown in Figure 12. Fitting of this data with one-site exponential decay model yielded a recycling half life of 2.8 ± 0.8 minutes, indicating rapid recycling of synthetic cell surface receptors. This recycling rate is similar to the rate of plasma membrane recycling of the fluorescent lipid C6-NBD sphingomyelin.
EXAMPLE 13: Synthetic receptor/ligand complexes co-fractionate with lipid raft components of cellular plasma membranes. Another hallmark of many natural cell surface receptors is the proposed association of these biomolecules with cholesterol and
sphingolipid-enriched lipid raft subdomains of cellular plasma membranes. These subdomains are generally biochemically characterized as low density fractions of the plasma membrane insoluble in buffers containing non-ionic detergents such as Triton-X at 40C. Ganglioside GMl (1) is prototypical example of a small lipid raft- associated cell surface receptor, and complexes of this glycolipid with a fluorescent cholera toxin protein are often used as a marker for lipid rafts. In addition, macromolecules receptors including B-cell receptors, T cell receptors, and growth factor receptors are thought to associate with these membrane subdomains. In certain cases, binding of ligands to receptors initiates formation of lipid rafts. This ligand-mediated concentration of specific membrane lipids has been proposed to recruit intracellular raft-associated kinases to activate cellular signaling pathways.
To determine whether synthetic cell surface receptors (2-5) might co-fractionate with ganglioside GM 1 (1) in lipid rafts, sucrose density gradient ultracentrifugation was employed to fractionate cellular membranes containing receptor-ligand complexes (FIG. 13). As positive and negative control experiments, Jurkat cells were treated with green fluorescent cholera toxin B subunit protein and green fluorescent transferrin protein. Unlike binding of cholera toxin to ganglioside GM 1 (1), binding of transferrin to the transferrin receptor on the cell surface does not result in association with lipid rafts. As shown in FIG. 13, a low density fluorescent membrane fraction (#5) was observed upon treatment of the cells with cholera toxin B subunit, but this fraction was not observed until upon treatment with transferrin, consistent with previous studies of lipid raft association of these proteins. Application of this analysis to receptors 2-5 (1 μM) revealed that only receptors 2 and 3 enabled the isolation of this fluorescent low-density membrane fraction (#5). These results paralleled the magnitude of protein uptake mediated by synthetic receptors 2-5 (FIG. 9, Panel B). Unlike the IgG-bound receptors, fractionation of cells treated with green fluorescent receptor 6 alone did not reveal any significant lipid raft association of the free receptor (data not shown). Free receptors may be associated with less well-ordered "lipid shell" domains of cellular membranes. These results suggest additional mechanistic similarities between the IgG-bound synthetic receptors and uptake of cholera toxin mediated by ganglioside GM 1 (Figure 1).
EXAMPLE 14: References for examples 1-13.
(1) Sjoback, R.; Nygren, J.; Kubista, M. Spectrochimica Acta Part a-Molecular and Biomolecular Spectroscopy 1995, 57, L7-L21.
(2) Dandliker, W. B.; Hsu, M. L.; Levin, J.; Rao, B. R. Methods Enzymol. 1981, 74 Pt C, 3-28. (3) Panvera Corp., M., WI 53711 1998.
(4) Patterson, G. H.; Lippincott-Schwartz, J. Science 2002, 297, 1873-1877.
(5) Wu, S.; Lee, S.; Beak, P. /. Am. Chem. Soc. 1996, 118, 715-721.
(6) Hussey, S. L.; Peterson, B. R. /. Am. Chem. Soc. 2002, 124, 6265-6273.
(7) Hao, M.; Maxfield, F. R. /. Biol. Chem. 2000, 275, 15279-15286. (8) Blank, N.; Gabler, C; Schiller, M.; Kriegel, M.; Kalden, J. R.; Lorenz, H. M. /. Immunol. Methods 2002, 271, 25-35.
EXAMPLE 15: Design and synthesis of receptors for vancomycin and related glycopeptide antibiotic ligands. The numbered receptors in examples 15-21 refer to those shown in Figures 14-19 and in Examples 15-21. We hypothesized that the delivery of vancomycin (1) into endosomes of cells infected with pathogenic bacteria might enable access of this cell-impermeable antibiotic to the cytoplasm. To explore this hypothesis, we synthesized a fluorescent derivative of vancomycin (2) and an artificial cell surface receptor (3) comprising the vancomycin-binding motif D-Phe-D-Ala linked to 3β- cholesterylamine. The D-Phe-D-Ala dipeptide was chosen because of its improved affinity for vancomycin (Kd~7 μM) compared with the natural D-AIa-D-AIa substrate.6 This binding group was coupled to 3β-cholesterylamine to add a membrane anchor previously shown by our laboratory to access a membrane trafficking pathway involving rapid cycling between the plasma membrane and endosomes of mammalian cells.7 Control compounds that do not bind vancomycin (L- Ala- L- Ala analogue 4) or that exhibit lower affinity for the cellular plasma membrane (amide analogue 5) were also synthesized for comparison. Addition of synthetic receptor 3 to healthy (non-infected) mammalian cells was envisioned to accomplish the following: (a) the vancomycin-binding motif would be projected from the cell surface; (b) interactions of the receptor (3) with vancomycin (1) would shuttle this drug into endosomes; (c) the antibiotic would dissociate from the receptor in endosomes allowing the free receptor to cycle back to the cell surface for additional rounds of delivery; and (d) vancomycin would become trapped in endosomes/lysosomes and
degraded. In contrast, in cells infected with a microbial pathogen, we hypothesized that step (d) would be altered by the secretion of membrane disruptive proteins by the pathogen. These proteins were predicted to disrupt vancomycin-loaded endosomes and release the antibiotic into the cytoplasm harboring the bacterial parasite. This strategy, termed synthetic receptor targeting,7 is illustrated in Figure 16.
EXAMPLE 16: Confocal laser scanning and differential interference contrast (DIC) microscopy of living J -774 murine macrophages. Confocal laser scanning microscopy was used to examine the delivery of fluorescent vancomycin derivative 2 into J774 mouse macrophage cells. As shown in Figure 17, cells treated with both receptor 3 and ligand 2 exhibited substantial uptake of this fluorescent probe. In healthy (non- infected) cells, this intracellular fluorescence was localized to endosomes and lysosomes as evidenced by colocalization with a red fluorescent marker of these compartments (supporting information). However, when these cells were also infected by L. monocytogenes, the fluorescent vancomycin (2) was distributed throughout the cytoplasm and nucleus.
EXAMPLE 17: Dose-dependent effectiveness of delivery of receptor 2 into mouse J-774 cells and human HeLa cells. The dose-dependent effectiveness of delivery of 2 into mouse J-774 cells and human HeLa cells mediated by receptor 2 was examined quantitatively by flow cytometry. As shown in Figure 18, preequilibration of the receptor (3) with the ligand (2) prior to addition to cells was ca. 2-fold more effective for delivery compared with preloading of cellular plasma membranes with the receptor (3) followed by addition of the ligand (2). However both of these conditions engendered substantial receptor- mediated enhancements of ligand uptake. These effects were blocked by addition of AcNH-D-PhC-D-AIa-CO2H as a soluble competitor, and the L-Phe-L-Ala-analogue 4 was ineffective, demonstrating specificity of recognition. Additionally, consistent with previous studies of derivatives of 3b-cholesterylamine,7 the amide analogue 5 was much less active.
EXAMPLE 18: Delivery of vancomycin via synthetic receptor 3 into HeLa cells infected by L. monocytogenes to determine effects on antibiotic activity against this
pathogen. The synthetic receptor 3 was employed to deliver vancomycin (1) into HeLa cells infected by L. monocytogenes to investigate effects on antibiotic activity against this pathogen. As shown in Figure 19, treatment of HeLa cells with this receptor (10 μM) enabled vancomycin (50 μM) to eliminate this intracellular parasite and rescue HeLa cells from the lethal effects of this pathogen.
EXAMPLE 19: Delivery of fluorescent Vancomycin derivative 2 by synthetic receptor 3 in vivo to mice. The delivery of fluorescent Vancomycin derivative 2 by synthetic receptor 3 was investigated in vivo (Figure 20). These and related compounds were injected into mice and the fluorescence of cells isolated from specific tissues was examined by flow cytometry. As shown in Figure 20, synthetic receptor-mediated targeting of the fluorescent vancomycin (2) to specific tissues was observed, indicating that N-alkyl-3b-cholesterylamine derivatives such as 3 provide novel tools for drug delivery in vivo. These results demonstrate that a synthetic cell surface receptor can enhance the in vitro effectiveness of a clinically used drug against an intracellular pathogen. This receptor also enables targeting of the drug to specific tissues in vivo. This approach provides a novel tool to combat microorganisms that invade mammalian cells.
EXAMPLE 20: General information for histidine/metal chelators. Chemical reagents were obtained from Acros, Aldrich, Alfa Aesar, or TCI America. Solvents were from EM Science. Media and antibiotics were purchased from Mediatech. Dil-loaded human low-density lipoprotein was from Invitrogen. Commercial grade reagents were used without further purification unless otherwise noted. Anhydrous solvents were obtained after passage through a drying column of a solvent purification system from GlassContour (Laguna Beach, CA). All reactions were performed under an atmosphere of dry argon or nitrogen. Reactions were monitored by analytical thin-layer chromatography on plates coated with 0.25 mm silica gel 60 F254 (EM Science). TLC plates were visualized by UV irradiation (254 nm) or stained with a solution of phosphomolybdic acid and sulfuric acid in ethanol (1:1:20). Flash column chromatography employed ICN SiliTech Silica Gel (32-63 μm). Purification by preparative reverse phase HPLC employed an
Agilent 1100 preparative pump / gradient extension instrument equipped with a Hamilton PRP-I (polystyrene-divinylbenzene) reverse phase column (7 μm particle size, 21.5 mm x
25 cm). The HPLC flow rate was increased from 10 niL/min (t = 0 min) to 20 mL/min (t = 2 min) and maintained at 20 mL/min for the remainder of the run unless otherwise noted. Melting points were measured with a Thomas Hoover capillary melting point apparatus and are uncorrected. Infrared spectra were obtained with a Perkin Elmer 1600 Series FTIR. NMR spectra were obtained with Bruker CDPX-300, DPX-300, AMX-360, or DRX-400 instruments with chemical shifts reported in parts per million (ppm, δ) referenced to either CDCl3 (1H 7.27 ppm; 13C 77.23 ppm), DMSOd6 (1H 2.50 ppm; 13C 39.51 ppm), or (CH3)4Si. High-resolution mass spectra were obtained from the University of Texas at Austin and Penn State University Mass Spectrometry Facilities (ESI and CI). Peaks are reported as m/z.
EXAMPLE 21: Synthetic procedures and compound characterization data:
Ethyl 5-{(tert-butoxycarbonyl)[(3β)-cholest-5-en-3-yl]amino}pentanoate (3). To DMF (10 mL) was added 3β-amino-5-cholestene (2, 386 mg, 1.0 mmol),1 ethyl 5 -bromo valerate (174 μL, 1.1 mmol) and K2CO3 (276 mg, 2.0 mmol). The solution was heated to 6O0C and stirred for 24 h. The reaction was cooled to 230C and DMF was removed in vacuo. To the resulting solid residue was added CH2Cl2 (10 mL), insoluble salts were removed by filtration, and solids were washed with additional CH2Cl2 (5 mL). To this solution containing the crude secondary amine product was added (Boc)2O (327 mg, 1.5 mmol) and DIEA (0.5 mL, 3.0 mmol). The reaction was stirred for 3 h at 230C and concentrated in vacuo. Flash column chromatography (hexanes / ethyl acetate, 10:1) afforded 3 (417 mg, 68%) as a white solid, mp 78-790C; 1H NMR (400 MHz, CDCl3) δ 5.30 (d, IH), 4.10 (q, J = 7.1 Hz, 2H), 3.73 (br s, IH), 3.09 (br s, 2H), 2.30 (t, J= 7.1 Hz, 2H), 2.01-0.83 (m, 56H), 0.66 (s, 3H); 13C NMR (100 MHz, CDCl3) δ 173.6, 155.5, 141.3, 121.4, 79.3, 60.4, 56.9, 56.3 (x 2), 50.3, 42.6 (x 2), 39.9, 39.7, 38.6, 37.1, 36.8, 36.3, 35.9, 34.2, 32.0 (x 2), 28.7 (Boc Me3), 28.4, 28.1 (x 2), 26.9, 24.4, 24.0, 23.0, 22.7, 22.6, 21.2, 19.6, 18.9, 14.4, 12.0; IR (film) v max 2935, 2867, 1737, 1692, 1466, 1409, 1365, 1247, 1173 cm"1; CI m/z 614.5146 (MH+, C39H68NO4 requires 614.5148).
N-Fmoc-β-alanine-β-alanine ethyl ester (5). ./V-Fmoc-β-alanine (311 mg, 1.0 mmol) in anhydrous CH2Cl2 (20 niL) under N2 was cooled to O0C. HOBt (168 mg, 1.1 mmol) and EDC (230 mg, 1.2 mmol) were added and the solution was stirred for 30 min at O0C. β- Alanine ethyl ester hydrochloride (169 mg, 1.1 mmol) in anhydrous CH2Cl2 (10 mL) and DIEA (180 μL, 1.1 mmol) were added. The reaction was warmed to 230C and stirred for 16 h. The reaction solution was diluted with CH2Cl2 (30 mL) and washed with aqueous HCl (5%, 30 mL), followed by aqueous NaOH (0.1 M, 30 mL), and deionized H2O (30 mL). The organic layer was dried over anhydrous Na2SO4 and concentrated in vacuo. Flash column chromatography (hexanes / ethyl acetate, 1:2) afforded 5 (394 mg, 96 %) as a white solid, mp 158.5-1590C; 1H NMR (300 MHz, CDCl3) δ 7.74 (d, /=7.5 Hz, 2H), 7.58 (d, / =7.5 Hz, 2H), 7.38 (m, J= 7.5 Hz, 2H), 7.29 (m, J= 7.5 Hz, 2H), 6.53 (br m, IH), 5.77 (br m, IH), 4.34 (d, / =7.1 Hz, 2H), 4.18 (t, J = 7.1 Hz, IH), 4.11 (q, / =7.1 Hz, 2H), 3.50 (m, 4H), 2.52 (t, / =6.0 Hz, 2H), 2.40 (t, /=5.7 Hz, 2H), 1.23 (t, / =7.1 Hz, 3H); 13C NMR (75 MHz, CDCl3) δ 172.6, 171.6, 156.7, 144.0, 141.3, 127.8, 127.1, 125.2, 120.1, 66.8, 60.9, 47.3, 37.2, 36.0, 35.0, 34.1, 14.3; IR (film) v max 3319, 3069, 2978, 2955, 2884, 1732, 1689, 1634, 1538, 1446, 1270, 1190 cm"1; CI 411.1922 m/z (MH+A3H27N2O5 requires 411.1920).
Ethyl 5-[(3β)-cholest-5-en-3-yl]-2,2-dimethyl-4,10,14-trioxo-3-oxa-5,ll,15- triazaoctadecan-18-oate (7).
Aqueous LiOH (10 mL, 0.5 M) was added dropwise to a solution of 3 (315 mg, 0.51 mmol) in a mixture of MeOH (15 mL) and THF (10 mL). The solution was stirred for 4 h
at 230C and the organic solvents were removed in vacuo. The remaining aqueous solution was acidified with aqueous HCl (10%) and the resulting carboxylic acid precipitated as a white solid. This solid was collected by vacuum filtration, washed with cold water, and dried in vacuo. The dried solid was dissolved in anhydrous CH2Cl2 (20 ml) under dry N2 and cooled to O0C. HOBt (92 mg, 0.6 mmol) and EDC (125 mg, 0.65 mmol) were added and the solution was stirred at O0C for 30 min. To this solution was added β-alanine-β- alanine ethyl ester (6, 141 mg, 0.75 mmol, prepared by treatment of 5 (310 mg) in DMF (8 mL) with piperidine (2 mL) for 10 min, followed by removal of solvent under high vacuum) in anhydrous CH2Cl2 (15 mL) over 15 min. The reaction was allowed to warmed to 230C and stirred for an additional 16 h. The solution was diluted with CH2Cl2 (50 mL) and washed with aqueous NaOH (0.1 M, 40 mL) followed by deionized H2O (40 mL). The organic layer was dried over anhydrous Na2SO4 and concentrated in vacuo. Flash column chromatography (CH2Cl2/ MeOH, 30:1) afforded 7 (330 mg, 86%) as colorless oil; 1H NMR (300 MHz, CDCl3) δ 6.62 (br m, 2H), 5.29 (d, J = 4.9 Hz IH), 4.11 (q, J = 7.1 Hz, 2H), 3.48 (m, 4H), 3.33 (br, IH), 3.07 (br s, 2H), 2.49 (t, J= 6.0 Hz, 2H), 2.35 (t, J= 5.4 Hz, 2H), 2.16 (br, 2H), 1.99-0.75 (m, 56H), 0.64 (s, 3H); 13C NMR (75 MHz, CDCl3) δ 173.1, 172.6, 171.8, 155.6, 141.5, 121.4, 79.4, 60.9, 56.8, 56.3 (x 2), 50.2, 42.4 (x 2), 39.9, 39.6 (x 2), 38.5 (x 2), 37.2, 36.8, 36.3, 35.9, 35.6, 35.2, 34.2, 32.0 (x 2), 28.7 (Boc Me3), 28.4, 28.1 (x 2), 26.9, 24.4, 23.9, 23.2, 22.9, 22.7, 21.2, 19.6, 18.8, 14.3, 12.0; IR (film) v max 3293, 3082, 2868, 1737, 1693, 1644, 1549, 1466, 1412, 1366, 1251, 1175, 1156 cm"1; CI m/z 756.5891 (MH+, C45H78N3O6 requires 756.5891).
Di-tert-butyl 2-(2-tert-butoxy-2-oxoethyl)-22-[(3β)-cholest-5-en-3-yl]-25,25-dimethyl- 9,13,17,23-tetraoxo-24-oxa-2,8,12,16,22-pentaazahexacosane-l,3-dicarboxylate (8). To a solution of 7 (83 mg, 0.11 mmol) in a mixture of MeOH (6 mL) and THF (4 mL) was slowly added aqueous LiOH (2 mL, 0.5 M). The solution was stirred for 4 h at 230C. Solvents were removed in vacuo, the solid residue was resuspended in aqueous HCl (10%, 10 mL), and the resulting carboxylic acid was extracted with ethyl acetate (2 x 20 mL).
The organic layer was dried over anhydrous Na2SO4 and solvents were removed in vacuo. The solid residue was dissolved in of anhydrous CH2Cl2 (10 rnL) under dry N2 and cooled to O0C. HOBt (22 mg, 0.14 mmol) and EDC (29 mg, 0.15 mmol) were added, the solution was stirred for 30 min at O0C, and iV**, Λ^-bisKtert-butoxycarbony^methylJ-L-lysine tert- butyl ester (75 mg, 0.17 mmol) was added. This amine was prepared from Na,Na-Bis[(tert- butoxycarbonyl)methyl]-./V-ε-benzyloxycarbonyl-L-lysine tert-butyl ester (the Cbz precursor) as previously reported,2 but the Cbz precursor (3.4 g) in EtOH (50 mL) was deprotected by catalytic hydrogenation (Pd(C), 10%) using 300 psi H2 for 12 h to afford 2.51 g of amine (97%). The reaction was warmed to 230C and stirred for 16 h. The solution was diluted with CH2Cl2 (20 mL) and washed with aqueous NaOH (0.1 M, 15 mL) followed by deionized H2O (15 mL). The organic layer was dried over anhydrous Na2SO4 and concentrated in vacuo. Flash column chromatography (CH2Cl2/ MeOH, 30:1) afforded 8 (102 mg, 85%) as colorless oil; 1H NMR (400 MHz, CDCl3) δ 6.86 (br s, IH), 6.65 (br m, 2H), 5.31 (d, J = 4.9 Hz IH), 3.50 (m, 4H), 3.42 (s, 2H), 3.43 (s, 2H), 3.32 (m, 2H), 3.28-3.16 (m, 2H), 3.08 (br s, 2H), 2.42 (m, 2H), 2.35 (t, J= 5.9 Hz, 2H), 2.17 (br, 2H), 2.01-0.84 (m, 86H), 0.66 (s, 3H); 13C NMR (100 MHz, CDCl3) δ 172.4, 172.2, 171.9, 170.7 (x 3), 155.7, 141.8, 121.4, 81.7, 81.3 (x 2), 79.4, 64.9, 56.9, 56.3 (x 2), 54.2 (x 2), 50.3, 42.5 (x 2), 39.9, 39.7 (x 2), 39.2, 38.6 (x 2), 37.3, 36.8, 36.3, 36.0, 35.9, 35.6, 35.1, 32.0 (x 2), 29.4, 28.7 (Boc Me3), 28.5, 28.4 (t -Bu Me3), 28.3 (t-Bu Me3 x 2), 28.2 (x 2), 27.8, 26.9, 24.4, 24.0, 23.4, 23.0, 22.7, 22.6, 21.2, 19.7, 18.9, 12.0; IR (film) v max 3288, 3082, 2934, 2868, 1744, 1687, 1642, 1550, 1458, 1367, 1250, 1222, 1148 cm"1 ; Cl m/z 1140.8524 (MH+, C65Hn4N5O11 requires 1140.8515).
4-Carboxy-3-(carboxymethyl)-22-[(3β)-cholest-5-en-3-ylamino]-10,14,18-trioxo- 3,9,13,17-tetraazadocosan-l-oic acid (1). TFA (1.5 mL) was added dropwise to a solution of 5 (22 mg, 0.019 mmol) in CH2Cl2 (5 mL). The solution was stirred for 16 h and the solvent was removed in vacuo. Purification by preparative reverse-phase HPLC (gradient: 49.9% MeCN, 50% H2O, and 0.1% TFA to 99.9% MeCN, 0% H2O, and 0.1%
TFA over 30 min; retention time = 16.3 min (215 nm)) afforded 1 (15.6 mg, 94%) as a white solid, mp 101-103 0C; 1H NMR (300 MHz, CDCl3) δ 5.34 (br s, IH), 3.48 (m, 4H), 3.35 (br m, 5H), 3.10 (br s, 2H), 2.85 (br s, 3H), 2.31 (br m, 7H), 2.16 (br m, 2H), 1.94- 0.75 (m, 50H), 0.65 (s, 3H); 13C NMR (75 MHz, CDCl3) δ 174.7 (x 3), 172.2, 172.0 (x 2), 137.6, 123.8, 57.9, 56.4, 55.9, 55.0, 54.9 (x 2), 49.7, 44.1, 42.0, 40.0 (x 2), 39.4, 39.3 (x 2), 38.6, 36.8, 36.5, 36.0, 35.8, 35.6, 35.4, 34.9, 34.7, 31.6, 31.5, 29.2, 28.2, 28.0, 27.8 (x 2), 24.9, 24.0, 23.6, 23.1, 22.5, 22.3, 20.7, 18.8, 18.4, 11.6; IR (film) v max 3700-2500 (br), 3295, 3084, 2938, 2868, 1732, 1686, 1634, 1556, 1468, 1441, 1382, 1202, 1143 cm"1; ESI+ m/z 872.6093 (MH+, C48H82N5O9 requires 872.6107). EXAMPLE 22: Biological assays and protocols
The numbered receptors in examples 22-24 refer to those shown in Figures 20-25 and in Examples 22-24.
General. Standard protocols were employed for microbiological techniques and plasmid construction. Oligonucleotide synthesis and sequencing of all new plasmid constructs was by the Pennsylvania State University Huck Institute Nucleic Acid Facility. Genes were constructed using the Polymerase Chain Reaction (PCR) with either Pfu polymerase (Stratagene) or Platinum Taq polymerase (Gene Choice). E. coli strain DH5-CC (Clontech / BD biosciences) was used for subcloning, and proteins were expressed in E. coli strain BL21(DE3)pLysS (Novagen). Cell culture. Jurkat lymphocytes (human acute T-cell leukemia, ATCC #TIB- 152) were maintained in Roswell Park Memorial Institute (RPMI) 1640 media supplemented with Fetal Bovine Serum (FBS, 10%), penicillin (100 units / mL), and streptomycin (100 μg / mL). RPMI media used for cell culture and wash steps contained antibiotics and FBS unless otherwise noted. Microscopy. A Zeiss LSM 5 Pascal confocal laser- scanning microscope fitted with a Plan Apochromat objective (63 X) was employed. Alexa Fluor 488 was excited with a 488 nm Argon ion laser and emitted photons were collected through 505 nm LP filter. Excitation of Dil-loaded LDL employed a 543 nm HeNe laser and a 560 nm LP filter. Flow cytometry. Analyses were performed with a Beckman-Coulter XL-MCL bench-top flow cytometer. Forward- scatter (FS) and side-scatter (SSC) dot plots afforded cellular physical properties of size and granularity that allowed gating of live cells. After gating, 10,000 cells were counted. For studies of uptake of AcGFP His tag fusion proteins,
AcGFP was excited at 488 nm with a 15 mW air-cooled argon-ion laser, the emission was split with a 550 nm dichroic and filtered through a 510 nm long pass filter and 530/30-nm band pass filter. The PMT voltage for this instrument was set to 724 for detection of AcGFP. Calibration with Sphere Rainbow Calibration particles (Spherotech) bearing 330,000 molecules of fluorescein/particle provided a fluorescence of 16.7 at this voltage. Assays of uptake of AcGFP - oligohistidine fusion proteins- Preload conditions: To Jurkat lymphocytes (7 x 105) in RPMI media (0.5 mL) was added synthetic receptor 1 (typical final [Receptor 1] = 10 μM) in DMSO (final [DMSO] = 1%). These cells were incubated at 370C for 1 h to load the receptor into cellular plasma membranes. The cells were washed with RPMI media (0.5 mL) to remove unincorporated receptor / DMSO and resuspended in fresh media (87.6 μL). To these cells was added a solution containing aqueous Ni(OAc)2 (4 μL, 2.5 mM, typical final [Ni(OAc)2] = 100 μM) and oligohistidine tagged AcGFP (8.4 μL of 1.19 mg/mL, typical final [AcGFP] = 3.2 μM). Cells were maintained at 370C for 4 h to promote synthetic receptor- mediated endocytosis. Prior to analysis, treated cells were washed with disodium NTA in media
(400 μM, 0.5 mL) and further incubated in media containing disodium NTA (400 μM, 0.5 mL) for 30 min to compete away any non-internalized protein. Cells were centrifuged, the supernatant was discarded, and the cells were resuspended in media (0.5 mL) for analysis by confocal microscopy and flow cytometry. For the competitive inhibition of uptake experiment shown in Figure 25, Panel A (labeled: + NTA (0.4 mM)), disodium NTA (400 μM) was included in the media during the 4 h incubation with AcGFP and Ni(OAc)2. In Figure 25, Panels A-D, the concentration of oligohistidine-tagged AcGFP protein was 3.2 μM. In Panels A, C, and D, the metal acetate concentration was 100 μM. In Panels B-D, the concentration of synthetic receptor 1 was 10 μM. Premix conditions (Figure 25, Panel A, last bar on the right): Jurkat lymphocytes
(7 x 105) in RPMI media (100 μL total volume) were incubated 370C with a preequilibrated solution of synthetic receptor 1 (10 μM), Ni(OAc)2 (100 μM), AcGFP(HiS)10 (3.2 μM), and DMSO (1%) for 4 h. Prior to analysis, treated cells were washed with disodium NTA in media (400 μM, 0.5 mL) followed by an additional 30 min incubation with media containing disodium NTA (400 μM, 0.5 mL) to compete away any non-internalized protein. Cells were centrifuged, the supernatant was discarded, and the cells were resuspended in media (0.5 mL) for analysis by flow cytometry.
Analysis of cytotoxicity of protein delivery. Jurkat lymphocytes were treated under the preload protein uptake assay conditions ([Receptor 1] = 10 μM (preloaded for 1 h); [AcGFP] = 3.2 μM; [Ni(OAc)2] = 100 μM (protein and metal acetate added for an additional 4 h). These cells were washed with disodium NTA, washed with fresh media, and incubated for an additional 48 h at 370C. The dead-cell stain propidium iodide (10 μg / mL) was added to cells prior to analysis, and viability was quantified by flow cytometry forward and side- scatter dot plots. No significant effects on viability or cellular morphology were observed under these conditions.
Quantification of the number of receptors on the surface of Jurkat lymphocytes. Jurkat lymphocytes (7 x 105) in RPMI media (0.5 mL) were treated with synthetic receptor 1 (10 μM final cone.) in DMSO (1% final DMSO cone). These receptor-treated cells were incubated at 370C for 1 h, washed with ice-cold RPMI media (0.5 mL) to remove unincorporated receptor / DMSO, and resuspended in ice-cold media (100 μL) containing Ni(OAc)2 (100 μM) and excess AcGFP(His)10 (final concentration = 19.2 μM). Cells were maintained at 40C for 1 h to saturate the NTA sites on the cell surface. Prior to analysis by confocal microscopy and flow cytometry, treated cells were washed ice-cold media (0.5 mL). As shown in Figure 22, confocal microscopy revealed that AcGFP(HiS)1O was exclusively localized on the cell surface, and analysis by flow cytometry revealed a cellular fluorescence of 377 '.1. Construction of a fluorescence calibration curve with Sphere Rainbow Calibration particles (Spherotech) enabled calculation of 39,300,000 molecules of equivalent fluorescein (MEFL) per cell (based on analysis of 680,000 cells). From the fluorescence quantum yield of fluorescein of 0.93 and the fluorescence quantum yield of 0.82 for AcGFP, the average number of receptors per cell was calculated to be ~ 45,000,000. Plasmid construction.
The gene encoding AcGFP was amplified by PCR using primers 5'-EcoRI-XhoI-AcGFP (5 ' - AGTCGAATTCGGTCTCGAGATGGTGAGCAAGGGC-S ' ), 3 ' -SalINoStop- AcGFP (5'-GACTGTCGACCTTGTACAGCTCATC-S'), and pAcGFPl(BD biosciences) as the template to append flanking EcoRI and Sail restriction sites. This PCR product was digested with EcoRI and Sail and inserted into EcoRI / X/zoI-digested vectors pSA4 and pSLH2, derivatives of vector pLM3 that add decahistidine (pSA4) or hexahistidine (pSLH2) peptides, followed by a stop codon, to the C-terminus of the gene. The resulting
AcGFP(His)10 and AcGFP(HiS)6 genes were digested with EcoRI I Sail and ligated to the EcoRI I Sα/I-digested vector pSMl, a derivative of pLM3 modified by S. Martin to add a hemagglutinin (HA) epitope tag (flanked by in-frame restriction sites: Mf el- MASYPYD VPD YASP-EcoRI) to the N-terminus of these proteins. Protein overexpression.
E. coli strain BL21(DE3)pLysS was transformed with plasmids encoding AcGFP(HiS)6 or AcGFP(HiS)1O. These transformed cells were grown to saturation in Luria Broth medium (LB, Difco/BD biosciences) containing ampicillin and chloramphenicol. Saturated cultures (8 mL) were inoculated into LB (100 mL) containing ampicillin (100 μg / mL) and chloramphenicol (20 μg / mL) and incubated with shaking at 370C to an optical density of 0.6 (600 nm). Protein expression was induced by addition of IPTG (Invitrogen, final concentration = 1 mM). The cultures were shaken at 3O0C for 5 h and cells harvested by centrifugation (4400 rpm, 10 min). The cell pellets were resuspended in Bacterial Protein Extraction Reagent (BPER, Pierce, 3 mL). The cells were shaken at 3O0C for 30 min, centrifuged (10,000 rpm, 5 min) and the supernatant was applied to packed Talon resin (7.5 mL, Clontech / BD biosciences) prewashed with phosphate buffered saline (DPBS, pH 8). The resin was washed with cold DPBS (5 x 5 mL), and the protein was eluted from the resin by washing with DPBS containing imidazole (300 mM, 2 x 2 mL). The eluate was concentrated by centrifugation against a protein-impermeable membrane (Millipore centricon concentrator, 10K) and washed at 40C with cold DPBS (5 x 1.5 mL) to remove the imidazole. As shown in Figure 21, proteins were analyzed by SDS PAGE on a 15% polyacrylamide gel (Cambrex) and detected by staining with coomassie dye. The concentration of the protein was quantified using the Coomassie Plus protein assay reagent (Pierce). The purified proteins were stored at final concentrations of: 1.19 mg / mL (AcGFP(His)io, 1000 μL) and 1.09 mg / mL, (AcGFP(His)6, 750 μL). Amino acid sequences of AcGFP proteins expressed in E. coli.
In addition to the C-terminal oligohistidine sequence, these proteins also include an N- terminal hemagglutinin (HA) epitope tag (sequence: YPYDVPDYA). AcGFP(HJs)n MRGSGTELQLMASYPYDVPDYASPEFGLEMVSKGAELFTGIVPILIELNGDVNGHK FSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSYGVQCFSRYPDHMKQH DFFKSAMPEGYIQERTIFFEDDGNYKSRAEVKFEGDTLVNRIELTGTDFKEDGNILG
NKMEYNYNAHNVYIMTDKAKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGP VLLPDNHYLSTQSALSKDPNEKRDHMIYFGFVTAAAITHGMDELYKVEGTHHHH
HH
AcGFPiHMiO MRGSGTELQLMASYPYDVPDYASPEFGLEMVSKGAELFTGIVPILIELNGDVNGHK FSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSYGVQCFSRYPDHMKQH DFFKSAMPEGYIQERTIFFEDDGNYKSRAEVKFEGDTLVNRIELTGTDFKEDGNILG NKMEYNYNAHNVYIMTDKAKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGP VLLPDNHYLSTQSALSKDPNEKRDHMIYFGFVTAAAITHGMDELYKVEGTHHHH HHHHHH
EXAMPLE 23: Oligohistidine peptides are often fused to proteins to provide affinity tags that facilitate protein purification. To enable these peptides to function as CPPs, we synthesized an artificial cell surface receptor (1) comprising the plasma membrane anchor iV-alkyl-3β-cholesterylamine linked to the metal chelator nitrilotriacetic acid (NTA). iV-Alkyl-3β-cholesterylamine derivatives can function as prosthetic molecules active on the surface of living mammalian cells because this steroid can insert into cellular plasma membranes, project linked headgroups from the cell surface, and rapidly cycle between the plasma membrane and intracellular endosomes, similar to many naturally- occuring cell surface receptors.8 The NTA motif binds tightly to nickel, cobalt, copper, and zinc dications, and immobilized metal chelate chromatography (IMAC) with NTA- linked supports is widely used to purify proteins fused to His-tags. Other lipids linked to NTA headgroups have also been reported.9'10
Receptor 1 was synthesized from 3β-cholesterylamine (2)8 as shown in Scheme 1. Alkylation of 2 with ethyl 5-bromovalerate, followed by Boc protection of the secondary amine to afford 3, was found to provide an improved route to protected iV-alkyl derivatives of the membrane anchor. Addition of a linker shown to increase the population of these compounds on the cell surface,8 acylation with a protected NTA derivative, and final deprotection afforded 1 in 47% overall yield. As representative His-tagged proteins, we overexpressed the monomeric green fluorescent protein AcGFP fused to C-terminal (His)6 and (HiS)1O peptides and purified these proteins by IMAC. The (His)10 peptide binds Ni-NTA complexes ~ 6-fold more
tightly than (His)6. For example, (His)6 and (His)10 peptides fused to 5HT3R serotonin receptors exhibit affinities for Ni-NTA derivatives of Kd = 1.05 μM and Kd = 166 nM, respectively.11
To qualitatively examine the ability of receptor 1 to mediate the cellular uptake of His-tagged proteins, human Jurkat T-lymphocytes were treated with 1 (10 μM) for one hour to load this compound into the outer leaflet of the cellular plasma membrane. These cells were washed and subsequently treated with a solution of AcGFP(His)10 (3.2 μM) and Ni(OAc)2 (100 μM) for an additional four hours. As shown in Figure 24 (panel A), examination of these cells by confocal laser scanning microscopy revealed fluorescent protein both on cell surface and in defined intracellular compartments. Washing the cells with disodium NTA (400 μM) as a chelator removed the bound protein from the cell surface, enabling closer examination of the intracellular distribution (Figure 24, panel B). Delivery of AcGFP(His)6 under these conditions provided similar results, but the cells were 4-fold less fluorescent (Figure 25, Panel D). The fate of internalized AcGFP(His)10 was examined by coadministration with Dil-loaded low density lipoprotein (LDL), a protein internalized by receptor-mediated endocytosis, as a red fluorescent marker of endosomes and lysosomes.12 Substantial colocalization of red and green, fluorophores was observed under these conditions (supporting information). This delivery to endosomes and lysosomes represents a common destination of proteins fused to CPPs.13 Quantitative analysis by flow cytometry of synthetic receptor-mediated uptake is shown in Figure 25. Intracellular delivery of AcGFP(HiS)1O > 600-fold above basal levels of endocytosis was achieved by preloading the cellular plasma membrane with receptor 1 (10 μM) for 1 h followed by addition of the protein (3.2 μM) and Ni(OAc)2 (100 μM). Higher receptor concentrations, addition of disodium NTA as a competitor, or premixing the receptor with the protein and metal resulted in lower levels of uptake (panel A).
Significantly higher or lower concentrations of Ni(OAc)2 were less effective mediators of uptake (panel B), and omission control experiments confirmed the importance of all three components (panel C). Comparison of diacetates of Ni, Co, Cu, and Zn revealed that Ni(OAc)2 was the most effective metal for delivery of both (His)6 and (His)10 fusion proteins.
Consistent with the mechanism of synthetic receptor-mediated endocytosis,8 uptake of His-tagged AcGFP proteins was blocked by cooling cells to 40C (data provided in the
supporting information). These conditions enabled quantification of the number of synthetic receptors on the cell surface. Jurkat lymphocytes were treated with 1 (10 μM) for 1 h at 370C, the cells were washed, chilled to 40C, and excess AcGFP(His)10 (19 μM) and Ni(OAc)2 (100 μM) was added to saturate the surface-bound NTA groups. Comparison of these cells with fluorescent bead standards by flow cytometry revealed an average of 45,000,000 synthetic receptors per cell surface. Previous studies of related compounds suggest that a similar population of synthetic receptors resides in intracellular endosomes.8
Heavy metals such as Ni2+ exhibit dose-dependent toxicity to biological systems. To examine the toxicity of this metal acetate and protein delivery, cellular viability was examined by flow cytometry. In these experiments, Jurkat lymphocytes were treated with receptor 1 (10 μM, 1 h), followed by AcGFP(His)i0 (3.2 μM), and Ni(OAc)2 (100 μM, 4 h) to enhance protein uptake by 600-fold. Cells were washed with disodium NTA to remove cell surface protein and were cultured for an additional 48 h. Cellular viability was determined by light scattering and staining the nuclei of membrane-compromised dead cells with the fluorophore propidium iodide. Under these conditions, 97% of the cells were viable, compared with 98.6% of untreated controls, and no effects on cellular morphology were observed. Other studies have similarly reported low toxicity of nickel salts at < 160 μM in cell culture.14 By enabling common oligohistidine affinity tags to function as cell penetrating peptides, synthetic receptor 1 provides a potentially versatile new probe of cellular biology.
EXAMPLE 24: References for examples 16-23. (1) Boonyarattanakalin, S.; Martin, S. E.; Dykstra, S. A.; Peterson, B. R. /. Am. Chem.
Soc. 2004, 126, 16379-16386. (2) Dorn, I. T.; Neumaier, K. R.; Tampe, R. /. Am. Chem. Soc. 1998, 120, 2753-2763. (3) Sodeoka, M.; Larson, C. J.; Chen, L.; Leclair, K. P.; Verdine, G. L. Bioorg. Med.
Chem. Lett. 1993, 3, 1089-1094.
EXAMPLE 25: A Synthetic Scheme Describing the Synthesis of the Lipid- mimicking synthetic receptors, e.g. CRP receptors (lipid mimics that promote cellular apoptosis in the presence of C-reactive protein)
EXAMPLE 26: Lipid- mimicking receptors
EXAMPLE 27: References
(1) Brooks, H.; Lebleu, B.; Vives, E. Adv. Drug Deliv. Rev. 2005, 57, 559-577.
(2) Wender, P. A.; Mitchell, D. J.; Pattabiraman, K.; Pelkey, E. T.; Steinman, L.; Rothbard, J. B. Proc. Natl. Acad. Sci. U.S.A. 2000, 97, 13003-13008.
(3) Umezawa, N.; Gelman, M. A.; Haigis, M. C; Raines, R. T.; Gellman, S. H. J. Am. Chem. Soc. 2002, 124, 368-369.
(4) Jiang, H.; O1NeU E, J.; Divittorio, K. M.; Smith, B. D. Org. Lett. 2005, 7, 3013-
3016.
(5) Fuchs, S. M.; Raines, R. T. Biochemistry 2004, 43, 2438-2444.
(6) Maiolo, J. R.; Ferrer, M.; Ottinger, E. A. Biochim. Biophys. Acta 2005, 1712, 161- 172. (7) Rothbard, J. B.; Jessop, T. C; Wender, P. A. Adv. Drug Deliv. Rev. 2005, 57, 495- 504.
(8) Boonyarattanakalin, S.; Martin, S. E.; Dykstra, S. A.; Peterson, B. R. J. Am. Chem. Soc. 2004, 126, 16379-16386.
(9) Hodges, H. B.; Zhou, M.; Haldar, S.; Anderson, J. L.; Thompson, D. H.; Hrycyna, C. A. Bioconjug. Chem. 2005, 16, 490-493.
(10) van Broekhoven, C. L.; Parish, C. R.; Vassiliou, G.; Altin, J. G. J. Immunol. 2000, 164, 2433-2443.
(11) Guignet, E. G.; Hovius, R.; Vogel, H. Nat. Biotechnol. 2004, 22, 440-444.
(12) Ghosh, R. N.; Gelman, D. L.; Maxfield, F. R. J. Cell Sci. 1994, 107, 2177-2189. (13) Young, J. C; Moarefi, L; Hartl, F. U. J. Cell Biol. 2001, 154, 267-273.
(14) Shiao, Y. H.; Lee, S. H.; Kasprzak, K. S. Carcinogenesis 1998, 19, 1203-1207.
(15) Williams, D. H.; Bardsley, B. Angew. Chem. Int. Ed. 1999, 38, (9), 1173-1193.
(16) Knit, O.; Sommer, H.; Kronke, M. J. Antimicrob. Chemo. 2004, 53, (2), 167-173.
(17) Kintarak, S.; Whawell, S. A.; Speight, P. M.; Packer, S.; Nair, S. P. Infect. Immun. 2004, 72, (10), 5668-5675.
(18) Conner, S. D.; Schmid, S. L. Nature 2003, 422, (6927), 37-44.
(19) Young, J. C; Moarefi, L; Hartl, F. U. J. Cell Biol. 2001, 154, (2), 267-273.
(20) Chu, Y. H.; Dunayevskiy, Y. M.; Kirby, D. P.; Vouros, P.; Karger, B. L. J. Am. Chem. Soc. 1996, 118, (33), 7827-7835. (21) Boonyarattanakalin, S.; Martin, S. E.; Dykstra, S. A.; Peterson, B. R. J. Am. Chem. Soc. 2004, 126, (50), 16379-16386.
(22) Conner, S. D.; Schmid, S. L. Nature 2003, 422, 37-44.
(23) Smith, D. C; Lord, J. M.; Roberts, L. M.; Johannes, L. Semin. Cell. Dev. Biol. 2004, 15, 397-408. (24) Sandvig, K.; van Deurs, B. FEBS Lett 2002, 529, 49-53.
(25) Maxfield, F. R.; McGraw, T. E. Nat. Rev. MoI. Cell. Biol. 2004, 5, 121-132.
(26) Vyas, S. P.; Singh, A.; Sihorkar, V. Crit. Rev. Ther. Drug Carrier. Syst. 2001, 18,
1-76.
(27) Lu, Y.; Sega, E.; Leamon, C. P.; Low, P. S. Adv. Drug Deliv. Rev. 2004, 56, 1161- 1176.
(28) Rui, Y. J.; Wang, S.; Low, P. S.; Thompson, D. H. J. Am. Chem. Soc. 1998, 120, 11213-11218.
(29) Lee, R. J.; Low, P. S. J. Biol. Chem. 1994, 269, 3198-3204.
(30) Qian, Z. M.; Li, H.; Sun, H.; Ho, K. Pharmacol. Rev. 2002, 54, 561-587.
(31) Chung, N. S.; Wasan, K. M. Adv. Drug Deliv. Rev. 2004, 56, 1315-1334.
(32) Hussey, S. L.; He, E.; Peterson, B. R. J. Am. Chem. Soc. 2001, 123, 12712-12713.
(33) Martin, S. E.; Peterson, B. R. Bioconjugate Chem. 2003, 14, 67-74.
(34) Hussey, S. L.; Peterson, B. R. J. Am. Chem. Soc. 2002, 124, 6265-6273.
(35) de Kruif, J.; Tijmensen, M.; Goldsein, J.; Logtenberg, T. Nat. Med. 2000, 6, 223-
227.
(36) Saxon, E.; Bertozzi, C. R. Science 2000, 287, 2007-2010.
(37) Mahal, L. K.; Yarema, K. J.; Bertozzi, C. R. Science 1997, 276, 1125-1128.
(38) Prescher, J. A.; Dube, D. H.; Bertozzi, C. R. Nature 2004, 430, 873-877.
(39) George, N.; Pick, H.; Vogel, H.; Johnsson, N.; Johnsson, K. J. Am. Chem. Soc.
2004, 126, 8896-8897.
(40) Kellam, B.; De Bank, P. A.; Shakesheff, K. M. Chem. Soc. Rev. 2003, 32, 327-337.
(41) Kato, M.; Mrksich, M. J. Am. Chem. Soc. 2004, 126, 6504-6505.
(42) Manes, S.; del Real, G.; Martinez, A. C. Nat. Rev. Immunol. 2003, 3, 557-568.
(43) Brown, D. A.; London, E. Annu. Rev. Cell Dev. Biol. 1998, 14, 111-136.
(44) Simons, K.; Ikonen, E. Science 2000, 290, 1721-1726.
(45) Kirchhausen, T. Annu. Rev. Biochem. 2000, 69, 699-727.
(46) Schmid, S. L. Annu. Rev. Biochem. 1997, 66, 511-548.
(47) Brown, D. A.; London, E. J. Biol. Chem. 2000, 275, 17221-17224.
(48) Maxfield, F. R. Curr. Opin. Cell Biol. 2002, 14, 483-487.
(49) Gaus, K.; Gratton, E.; Kable, E. P.; Jones, A. S.; Gelissen, L; Kritharides, L.;
Jessup, W. Proc. Natl. Acad. Sci. U.S.A. 2003, 100, 15554-15559.
(50) Edidin, M. Annu. Rev. Biophys. Biomol. Struct. 2003, 32, 257-283.
(51) Zacharias, D. A.; Violin, J. D.; Newton, A. C; Tsien, R. Y. Science 2002, 296,
913-916.
(52) Simons, K.; Toomre, D. Nat. Rev. MoI. Cell. Biol. 2000, 1, 31-39.
(53) Ikonen, E. Curr. Opin. Cell Biol. 2001, 13, 470-477.
(54) Singh, R. D.; Puri, V.; Valiyaveettil, J. T.; Marks, D. L.; Bittman, R.; Pagano, R. E. MoI. Biol. Cell 2003, 14, 3254-3265. (55) Nichols, B. J. Curr. Biol. 2003, 13, 686-690.
(56) Lancet, D.; Pecht, I. Biochemistry 1977, 16, 5150-5157.
(57) Yang, T.; Baryshnikova, O. K.; Mao, H.; Holden, M. A.; Cremer, P. S. J. Am. Chem. Soc. 2003, 125, 4779-4784.
(58) Kan, C. C; Yan, J.; Bittman, R. Biochemistry 1992, 31, 1866-1874. (59) Mancuso, A. J.; Swern, D. Synthesis 1981, 3, 165-185.
(60) Fukuyama, T.; Jow, C. K.; Cheung, M. Tetrahedron Lett. 1995, 36, 6373-6374.
(61) Cedergren, L.; Andersson, R.; Jansson, B.; Uhlen, M.; Nilsson, B. Protein Eng. 1993, 6, 441-448.
(62) Tashiro, M.; Montelione, G. T. Curr. Opin. Struct. Biol. 1995, 5, 471-481. (63) Patterson, G. H.; Lippincott-Schwartz, J. Science 2002, 297, 1873-1877.
(64) Lentz, B. R.; Talbot, W.; Lee, J.; Zheng, L. X. Biochemistry 1997, 36, 2076-2083.
(65) Alakoskela, J. L; Kinnunen, P. K. Biophys. J. 2001, 80, 294-304.
(66) Chung, K. N.; Roberts, S.; Kim, C. H.; Kirassova, M.; Trepel, J.; Elwood, P. C. Arch. Biochem. Biophys. 1995, 322, 228-234. (67) Rodal, S. K.; Skretting, G.; Garred, O.; Vilhardt, F.; van Deurs, B.; Sandvig, K. MoI. Biol. Cell. 1999, 10, 961-974.
(68) Sun, W. C; Gee, K. R.; Klaubert, D. H.; Haugland, R. P. J. Org. Chem. 1997, 62, 6469-6475.
(69) Hao, M.; Maxfield, F. R. J. Biol. Chem. 2000, 275, 15279-15286. (70) Munro, S. Cell 2003, 115, 377-388.
(71) Harder, T.; Scheiffele, P.; Verkade, P.; Simons, K. J. Cell Biol. 1998, 141, 929-942.
(72) Dietrich, C; Volovyk, Z. N.; Levi, M.; Thompson, N. L.; Jacobson, K. Proc. Natl. Acad. Sci. U.S.A. 2001, 98, 10642-10647.
(73) Anderson, R. G.; Jacobson, K. Science 2002, 296, 1821-1825. (74) Hao, M.; Lin, S. X.; Karylowski, O. J.; Wustner, D.; McGraw, T. E.; Maxfield, F.
R. J. Biol. Chem. 2002, 277, 609-617. (75) Puri, V.; Watanabe, R.; Dominguez, M.; Sun, X.; Wheatley, C. L.; Marks, D. L.;
Pagano, R. E. Nat. Cell Biol. 1999, 1, 386-388.
(76) Reaven, E.; Tsai, L.; Azhar, S. J. Biol. Chem. 1996, 271, 16208-16217.
(77) Brown, M. S.; Goldstein, J. L. Angew. Chem. Int. Ed. Engl. 1986, 25, 583-602.
(78) Sato, S. B.; Ishii, K.; Makino, A.; Iwabuchi, K.; Yamaji-Hasegawa, A.; Senoh, Y.; Nagaoka, L; Sakuraba, H.; Kobayashi, T. J. Biol. Chem. 2004, 279, 23790-23796.
(79) Lenz, M.; Miehe, W. P.; Vahrenwald, F.; Bruchelt, G.; Schweizer, P.; Girgert, R. Anticancer Res. 1997, 17, 1143-1146.
(80) Boonyarattanakalin S, Martin SE, Dykstra SA, Peterson BR. Synthetic mimics of small Mammalian cell surface receptors. J Am Chem Soc. 2004, 126(50): 16379- 86.
EXAMPLE 28: Synthesis of 3β-amino-5-cholestene and Derivatives from cholesterol (yields represented on a 1 mmol scale).
Synthesis methods for 3β-amino-5-cholestene (7) by i-steroid and retro-j-steroid rearrangements were further examined. The schematic of example 4 is illustrated above and conveys to one of ordinary skill in the art the process. In one aspect, the method for synthesis of 3β-amino-5-cholestene (7) by i-steroid and retro-j-steroid rearrangements
comprises reacting cholesterol (1) or a cholesterol bearing a leaving group at the 3- position, for example, cholesterol mesylate (2), cholesterol triflate, cholesterol tosylate or cholesterol esters, with a Lewis acid, for example, boron trifluoride etherate, in the presence of an azide, for example, a silyl azide such as trimethlysilyl azide, at a temperature between minus 1500C to plus 2000C and a Lewis acid, such as boron trifluoride etherate, in a solvent such as dichloromethane, to obtain a reaction mixture comprising 3β-azido-5-cholestene (3). 3β-azido-5-cholestene (3) is then reacted with a reducing agent such as lithium aluminium hydride in a solvent such as diethyl ether to produce 3β-amino-5-cholestene (7). Alternatively, the reduction of 3β-azido-5-cholestene (3) by catalytic hydrogenation may be performed in tetrahydrofuran over 10% palladium on carbon or another suitable catalyst.
The above described scheme results in unexpectedly high yields. When using lithium aluminium hydride, yields of 96% (1 mmol scale) were observed. Using catalytic hydrogenation in tetrahydrofuran, yields of 89% were observed. These efficiencies allow for production of 3β-amino-5-cholestene on a 100-gram or larger scales.
The novel method for synthesis of 3β-chloro-5-cholestene (4) by i-steroid and retro- i- steroid rearrangements was further examined. In one aspect, the method for synthesis of 3β-chloro-5-cholestene (4) comprises reacting cholesterol (1) or a cholesterol-bearing a leaving group at the 3-position, for example, cholesterol mesylate (2), cholesterol triflate, cholesterol tosylate or cholesterol esters, with titanium (IV) chloride, trimethylsilyl chloride, and dichloromethane, achieving a 95% yield. The synthesis methods for 3β- bromo-5-cholestene (5) by i-steroid and retro-j-steroid rearrangements may comprise reacting cholesterol (1) or a cholesterol bearing a leaving group at the 3-position, for example, cholesterol mesylate (2), cholesterol triflate, cholesterol tosylate or cholesterol esters, with boron trifluoride-diethyl ether complex, trimethylsilyl bromide, and dichloromethane, achieving a 92% yield. Further, the novel method for synthesis of 3β- iodo-5-cholestene (6) by i-steroid and retro-j-steroid rearrangements may comprise reacting cholesterol (1) or a cholesterol bearing a leaving group at the 3-position, for example, cholesterol mesylate (2), cholesterol triflate, cholesterol tosylate or cholesterol esters, with boron trifluoride-diethyl ether complex, trimethylsilyl iodide, and dichloromethane, achieving an 82% yield.
EXAMPLE 29: Additional Synthetic procedures and compound characterization data. Chemical reagents were obtained from Acros, Aldrich or Alfa Aesar. Solvents were from EM Science. Commercial reagents were used without further purification unless otherwise noted. Cholest-5-en-3β-ol, tosylate, cholest-5-en-3β-ol acetate, and epicholesterol were synthesized as previously reported.1"3 Andydrous solvents were obtained after passage through a drying column of a solvent purification system from GlassContour (Laguna Beach, CA). All reactions were performed under an atmosphere of dry argon or nitrogen. Reactions were monitored by analytical thin-layer chromatography on plates coated with 0.25 mm silica gel 60 F254 (EM Science). TLC plates were visualized by UV irradiation (254 nm) or stained with a solution of 20% phosphomolybdic acid in ethanol. Column chromatography employed ICN SiliTech Silica Gel (32-63 μm). Melting points were measured with a Thomas Hoover capillary melting point apparatus and are uncorrected. Infrared spectra were obtained with a Perkin Elmer 1600 Series FTIR. NMR spectra were obtained with Bruker CDPX-300 and AV-400 instruments with chemical shifts reported in parts per million (ppm, δ) referenced to either CDCl3 (1H 7.27 ppm; 13C 77.23 ppm) or TMS (0 ppm). EI spectra were obtained on a ZAB HS mass spectrometer (VG Anlytical Ltd, Manchester, UK) or an Agilent 6890N GC interfaced with quadrupole mass analyzer (Quattro Micro GC, Waters corp., Milford, MA); ESI spectra were obtained on a LCT Premier time of flight mass spectrometer (Waters Corp., Milford, MA). Peaks are reported as m/z.
Cholest-5-en-3β-ol, methanesulfonate (2). To a solution of cholesterol (100.0 g, 0.259 mol) in anhydrous CH2Cl2 (1 L) at 4 0C was added freshly distilled triethylamine (54 mL, 0.388 mol), followed by the addition of a solution of methanesulfonyl chloride (21.3 mL, 0.272 mol) in anhydrous CH2Cl2 (100 mL) dropwise. The reaction was maintained at 4 0C for 30 min, warmed to ambient temperature (22 0C), and stirred for 16 h. When the cholesterol was consumed as evidenced by TLC (eluent: hexanes / ethyl acetate, 5:1), the
reaction was concentrated in vacuo. The resulting residue was dissolved in CH2Cl2 (80 rnL), the product was recrystallized by addition of MeOH (500 rnL) and collected by vacuum filtration. The filtrate was concentrated in vacuo. Recrystallization from methanol afforded a second crop of product. The combined solids were dried in vacuo to afford 2 (117.7 g, 98%) as a white solid, mp 118-119 0C (a 98% yield was also obtained on a 386 mg (1 mmol) scale); 1H NMR (300 MHz, CDCl3) δ 5.42 (s, IH), 4.52 (m, IH), 3.00 (s, 3H), 2.50 (m, 2H), 2.04-0.85 (m, 38H), 0.68 (s, 3H); 13C NMR (75 MHz, CDCl3) δ 138.6, 123.7, 81.9, 56.5, 56.0, 49.9, 42.2, 39.6, 39.4, 39.1, 38.7, 36.8, 36.3, 36.1, 35.7, 31.8, 31.7, 28.9, 28.1, 27.9, 24.2, 23.8, 22.8, 22.5, 20.9, 19.1, 18.6, 11.8; IR (film) v max 3029, 2944, 2908, 2861, 1468, 1440, 1415, 1353, 1330, 1173 cm-1; LRMS (ESI+) m/z 487.3 ((M+Na)+, C28H48O3SNa requires 487.3).
Cholest-5-en-3α-ol, methanesulfonate (8). To a solution of epicholesterol (386mg, 1 mmol) in anhydrous CH2Cl2 (1OmL) at 40C was added freshly distilled triethylamine (280 μL, 2 mmol), followed by the addition of methane sulfonylchloride (85 μL, 1.1 mmol). The reaction was maintained at 40C for 30 min, warmed to ambient temperature (220C), and stirred for 6 h. When epicholesterol was completely consumed as evidenced by TLC (eluent: hexanes / ethylacetate, 5:1), the reaction was diluted with CH2Cl2 (40 mL). The organic phase was washed with saturated aqueous NaHCO3 solution (50 mL), dried over anhydrous Na2SO4, and concentrated in vacuo. Column chromatography (eluent: hexanes / ethylacetate, 8:1) afforded 8 (440 mg, 95%) as a white solid, mp 108-1090C (Decomp.); 1HNMR (400 MHz, CDCl3) δ 5.36 (m, IH), 5.00 (m, IH), 2.99(s, 3H), 2.57 (m, 1H),2.37 (m, IH), 2.04-0.86 (m, 38H),0.68 (s,3H); 13C NMR (100 MHz, CDCl3) δ 136.7, 123.6, 79.6, 56.7, 56.1, 49.7, 42.3, 39.7, 39.5, 38.8, 37.3, 36.8, 36.2, 35.8, 32.8, 31.8, 31.7, 28.2, 28.0, 27.3, 24.2, 23.8, 22.8, 22.6, 20,7, 8.9, 18.7, 11.8; IR (film) v max 3412, 3016, 2961, 2932, 2868, 1457, 1432, 1369, 1344, 1328, 1202, 1174, 1165, 1147, 988, 963, 921, 912,
897, 867, 760cm"1; LRMS (EI+, ZAB HS) m/z 464.1 (M+, C28H48O3S requires 464.3).
5α-Cholestan-3β-ol, methanesulfonate (9). To a solution of dihydrocholesterol (3.88 g, 10 mmol) in anhydrous CH2Cl2 (50 rnL) at 40C was added triethylamine (2.8 rnL, 20 mmol), followed by methanesulfonylchloride (0.85 rnL, 11 mmol). The reaction was maintained at 40C for 30 min, warmed to ambient temperature (220C), and stirred for 4 h. When the dihydrocholesterol was completely consumed as evidenced by TLC (eluent: hexanes/ethylacetate, 5:1), the reaction was concentrated in vacuo. The resulting residue was dissolved in CH2Cl2 (5 mL). The product was recrystallized by addition of MeOH (50 mL) and collected by vacuum filtration. The solid was washed with MeOH (5 mL), and the filtrate was concentrated in vacuo. Recrystallization from methanol afforded a second crop of the product. The combined solids were dried under vacuum to afford 9 (4.38 g, 94%) as a white solid, mp 113-1140C (reported 4 mp 116.5-118.50C); 1HNMR (400 MHz, CDCl3) δ 4.61 (m, IH), 2.99 (s, 3H), 1.96 (m, 2H), 1.84-0.59 (m, 44H); 13C NMR (100 MHz, CDCl3) δ 82.2, 56.3, 56.2, 54.1, 44.8, 42.6, 39.9, 39.5, 38.8, 36.8, 36.2, 35.8, 35.4, 35.2, 35.1, 31.9, 28.7, 28.5, 28.2, 28.0, 24.2, 23.8, 22.8, 22.6, 21.2, 18,12.2, 12.1; IR (film) v max 3027, 2950, 2933, 2863, 1470, 1449, 1416, 1355, 1333, 1215, 1173, 1132, 968, 934, 867, 845, 798, 758 cm"1; LRMS (EI+, ZABHS) m/z 466.0 (M+, C28H50O3S requires 466.3).
3β-Azido-5-cholestene (3). To a solution of 3β-cholest-5-en-3-ol, methanesulfonate (2, 117.7 g, 253 mmol) in anhydrous CH2Cl2 (800 mL) was added TMSN3 (37.1 mL, 277 mmol), followed by BF3OEt2 (63 mL, 506 mmol). The reaction was stirred at ambient temperature (22 0C) for 3 h. When starting material was completely consumed as
evidenced by TLC (eluent: hexanes), the reaction was slowly poured into aqueous NaOH (2.0 M, 500 rnL) and stirred for 5 min. The organic layer was removed, and the aqueous layer was extracted with CH2Cl2 (200 rnL). The combined organic extracts were washed with saturated aqueous NaCl solution (500 mL), dried over anhydrous Na2SO4, and concentrated in vacuo to afford crude 3 as a light yellow solid. This crude product was dissolved in a minimal amount of hexanes and filtered through a short (10 cm) pad of silica gel layered in a fritted glass funnel (diameter = 15 cm). The azide was eluted with hexanes under reduced pressure. Fractions containing the product were identified by TLC, combined, and concentrated to afforded 3 (88.5 g, 85%) as a white solid, mp 84-85.5 0C (reported3'5 mp 84-85 0C; a 93% yield was obtained on a 465 mg (1 mmol) scale); 1H NMR (300 MHz, CDCl3) δ 5.38 (d, IH), 3.20 (m, IH), 2.29 (d, J = 7.9 Hz, 2H), 2.04-0.85 (m, 38H), 0.68 (s, 3H); 13C NMR (75.4 MHz, CDCl3) δ 139.8, 122.5, 61.1, 56.7, 56.1, 50.1, 42.3, 39.7, 39.5, 38.1, 37.6, 36.6, 36.2, 35.8, 31.8, 31.7, 28.2, 28.0, 27.9, 24.2, 23.8, 22.8, 22.5, 21.0, 19.2, 18.7, 11.8; IR (film) v max 2934, 2896, 2861, 2097, 1464, 1443, 1377, 1367,1243, 1231 cm-1; LRMS (EI+, ZAB HS) m/z 411.4 (M+, C27H45N3 requires 411.4).
3β-Amino-5-cholestene (7). To a solution of 3β-azido-5a-cholestene (3, 88.5 g, 0.215 mol) in anhydrous diethyl ether (800 mL) in a 2 L round bottom flask at 4 0C was added LiAlH4 powder (10.0 g, 0.263 mol) in five equal portions. The reaction was maintained at 4 0C for 30 min, warmed to ambient temperature (22 0C), and stirred for 2 h. When the starting material was completely consumed as evidenced by TLC (eluent: hexanes), the reaction was cooled to 4 0C and very carefully quenched by slow dropwise addition of ice-cold water. When evolution of H2 gas ceased, the resulting solution was poured into ice water (500 mL). The organic layer was separated, and the aqueous phase was extracted with ethyl acetate (2 x 300 mL). The organic extracts were combined, washed with saturated aqueous NaCl solution (500 mL), dried over anhydrous Na2SO4, and concentrated in vacuo. The resulting solid was dissolved in CHCl3 (200 mL) and residual inorganic salts were removed by filtration. Concentration of the filtrate afforded 7 (71.2 g, 86% as a white solid, mp 91-
92 0C (reported6 mp 90-91 0C; a 96% yield was obtained on a 411 mg (1 mmol) scale). Compound 7 could alternatively be prepared by hydrogenation of 3 as follows: To a solution of 3β-azido-5a-cholestene (3, 10.5 g, 25.5 mmol) in anhydrous THF (120 mL) in a round bottom flask (250 mL) was added Pd (10%) on activated carbon (2.65 g, 2.5 mmol). The suspension was stirred under one atmosphere of hydrogen for 24 h at ambient temperature (22 0C). When the starting material was completely consumed as evidenced by TLC (eluent: hexanes), the solution was filtered through a pad of celite. The celite was washed with THF (3 x 50 mL). The filtrates were combined and concentrated in vacuo to afford 7 (8.8 g, 89%) as an off white solid; 1H NMR (300 MHz, CDCl3) δ 5.27 (s, IH), 2.60 (m, IH), 2.17-0.85 (m, 40H), 0.64 (s, 3H); 13C NMR (75 MHz, CDCl3) δ 141.8,
120.7, 56.8, 56.2, 52.0, 50.3, 43.4, 42.3, 39.8, 39.5, 38.2, 36.6, 36.2, 35.8, 32.7, 31.9 (x 2), 28.3, 28.0, 24.3, 23.9, 22.8, 22.6, 21.0, 19.5, 18.7, 11.9; IR (film) r 3354, 3260, 3154, 2936, 2896, 2849, 1464, 1437, 1381 cm"1; LRMS (ESI+) m/z 386.4 ((M+H)+, C27H48N requires 386.4).
όβ-Azido-ScijS-cyclo-Sα-cholestane (12). To a solution of cholest-5-en-3β-ol, methanesulfonate, (2, 5.Og, 10.8 mmol) in MeOH (100 mL) was added NaN3 (13 g, 200 mmol). The reaction was refluxed for 8h. When the starting material was completely consumed as evidenced by TLC (eluent: hexanes/ethylacetate, 5:1), the solution was concentrated in vacuo. The residue was dissolved in CH2Cl2 (100 mL) and washed with saturated aqueous NaHCO3 solution (100 mL). The organic phase was dried over anhydrous Na2SO4 and concentrated in vacuo. Column chromatography (eluent: hexanes) afforded 12 (790 mg, 18%) as a white solid; mp 66-670C (reported mp 67-680C); 1H NMR (400 MHz, CDCl3) δ 3.27 (t, J = 2.8 Hz, IH), 2.00 (m, IH), 1.88-0.78 (m, 38H), 0.72 (s, 3H), 0.70 (dd, Ji=4.2 Hz, J2 = 4.9 Hz, IH), 0.53 (dd, Λ=5.5 Hz, J2= 8.0 Hz, IH); 13C NMR (100 MHz, CDCl3) δ 64.4, 56.3, 56.1, 47.6, 43.0, 42.7, 40.1, 39.5, 36.2, 36.2, 35.8, 35.3, 33.2, 30.8, 28.3, 28.0, 24.8, 24.2, 23.9, 22.8, 22.6, 22.5, 22.2, 19.0, 18.7, 12, 12.2; IR
(film) v max 3319, 3060, 2950, 2869, 2093, 1467, 1382, 1337, 1292, 1268, 1249, 1220, 1019, 969 cm"1; LRMS (EI+, ZABHS) m/z 411.2 (M+, C27H45N3 requires 411.4).
3β-Chloro-5-cholestene(4). To a solution of 3β-cholest-5-en-3-ol, methanesulfonate (2, 465 mg, 1.0 mmol) in anhydrous CH2Cl2 (10 mL) was added TMSCl (140 μL, 1.1 mmol). The reaction was cooled to-20°C. TiCl4 (1.0 M, 0.5 mL, 0.5 mmol) was added dropwise. After 5 min, CH2Cl2 (25 mL) and saturated NaHCO3 aqueous solution (20 mL) were added to quench the reaction. The organic phase was separated and the aqueous phase was extracted with CH2Cl2 (20 mL). The organic extracts were combined, washed with saturated aqueous NaCl solution, dried over anhydrous Na2SO4, and concentrated in vacuo. Column chromatography (eluent: hexanes) afforded 4 (384 mg, 95%) as a white solid, mp 94.5-95.50C (reported mp 95-95.50C); 1H NMR (400 MHz, CDCl3) δ 5.37 (m, IH), 3.75 (m, IH), 2.59-2.45 (m, 2H), 2.08-1.78 (m, 6H), 1.61-0.85 (m, 32H), 0.67(s, 3H); 13C NMR (100 MHz, CDCl3) δ 140.8, 122.4, 60.2, 56.7, 56.1, 50.1, 43.4, 42.3, 39.7, 39.5, 39.1, 36.3, 36.2, 35.8, 33.4, 31.8, 31,7, 28.2, 28.0, 24.3, 23.9, 22.8, 22.6, 21.0, 19.2, .7, 11.9; IR(film) v 3033, 2950, 2935, 2868, 2848, 1668, 1468, 1445, 1432, 1378, 1334, 1216, 1158, 1133, 1026, 1005, 990, 960, 881, 870, 827, 799, 760 cm-1; LRMS (EI+, Quattro) m/z 404.4 (M+, C27H45Cl requires 404.3).
3β-Bromo-5-cholestene (5). To a solution of 3β-cholest-5-en-3-ol, methanesulfonate (2, 465 mg, 1.0 mmol) in anhydrous CH2Cl2 (10 mL), was added TMSBr (145 μL, 1.1 mmol), followed by BF3»OEt2(250 μL, 2.0 mmol). The reaction was stirred at ambient temperature (220C) for 1 h. When the starting material was completely consumed as evidenced by TLC
(eluent: hexanes), the reaction was quenched by adding CH2Cl2 (25 rnL) and saturated aqueous NaHCO3 solution (20 rnL). The organic phase was separated and the aqueous phase was extracted with CH2Cl2 (20 mL). The organic extracts were combined, dried over anhydrous Na2SO4, and concentrated in vacuo. Column chromatography (eluent:hexanes) afforded 5 (412 mg, 92%) as a white solid, mp 99.5-100.50C (reported mp 1000C); 1H NMR (400 MHz, CDCl3) δ 5.36(m, IH), 3.92(m, IH), 2.74(m, IH), 2.58(m, IH), 2.20- 0.85(m, 38H), 0.67 (s, 3H); 13C NMR (100 MHz, CDCl3) δ 141.6, 122.3, 56.7, 56.1, 52.6, 50.2, 44.3, 42.3, 40.3, 39.7, 39.5, 36.4, 36.2, 35.8, 34.4, 31.8, 31.7, 28.2, 28.0, 24.3, 23.8, 22.8, 22.6, 20.9, 19.3, .7, 11.9; IR (film) v max 3033, 2950, 2902, 2867, 2850, 1665, 1466, 1432, 1376, 1330, 1187, 1151, 1025, 1001, 988, 960, 863, 817 cm-1; LRMS (EI+, Quattro) m/z 448.3 (M+, C27H45Br requires 448.3).
3β-Iodo-5-cholestene (6). To a solution of 3β-cholest-5-en-3-ol, methanesulfonate (2, 465 mg, 1.0 mmol) in anhydrous CH2Cl2 (10 mL) at-20°C was added TMSI (160 μL, 1.1 mmol), immediately followed by BF3»OEt2(250 μL, 2.0 mmol). After 10 min, the reaction was quenched by addition of CH2Cl2 (25 mL) and saturated aqueous NaHCO3 solution (20 mL). The organic phase was removed and the aqueous phase was washed with CH2Cl2 (20 mL). The organic extracts were combined, dried over anhydrous Na2SO4, and concentrated in vacuo. Column chromatography (eluent: hexanes) afforded 6 (407 mg, 82%) as a white solid, mp 105.5-106.50C (reported mp 106-1070C); 1H NMR (400 MHz, CDCl3) δ 5.33 (d, IH), 4.04 (m, IH), 2.93 (m, IH), 2.67 (m, 1H),2.3O-O.85 (m, 38H), 0.69 (s, 3H); 13C NMR (100 MHz, CDC13) δ 142.8, 121.7, 56.7, 56.1, 50.3, 46.4, 42.3, 41.9, 39.6, 39.5, 36.6, 36.4, 36.2, 35.8, 31.7, 31.6, 30.5, 28.2, 28.0, 24.2, 23.8, 22.8, 22.6, 20.8, 19.2, .7, 11.8; IR (film) v max 3033, 2948, 2907, 2850, 1663, 1460, 1429, 1374, 1328, 1179, 1136, 1117, 1020, 996, 988, 957, 818, 798cm- 1; LRMS (EI+, ZABHS) m/z 369.2 ((M-I)+, C27H45 requires 369.4).
EXAMPLE 30: References for Example 29.
(1) Poza, J. et al, Bioorg. Med. Chem. 2007, 15, 4722-4720.
(2) Barragan-Montero, V. et al, Med. Chem. 2005, 40, 1022-1029.
(3) Frieberg, L.A., Am. J. Org. Chem. 1965, 30, 2476-2479.
(4) Pinkus, J.L. et al., J. Org. Chem. 1962, 27, 4356-4360.
(5) Kan, C. et al., Biochem. 1992, 31, 1866-1874.
(6) Haworth, R. et al., J. Chem. Soc. 1953, 1110-1115.
(7) Powell, D. A. et al., J. Am. Chem. Soc. 2005, 127, 510-511.
(8) Wagner, A. et al., J. Org. Chem. 1952, 17, 529-541.
Claims
1. A method for synthesis of 3β-amino-5-cholestene or a related 3β-halide comprising: reacting cholesterol or a cholesterol derivative with a Lewis acid and an azide to form 3β- azido-5-cholestene; and reducing 3β-azido-5-cholestene to obtain 3β-amino-5-cholestene or reacting cholesterol or a cholesterol derivative with a Lewis acid to afford a related 3β-halide.
2. The method of claim 1 wherein said lewis acid is a member selected from the group consisting of boron trifluoride etherate (BF3OEt2), tin tetrachloride, aluminum trichloride, titanium tetrachloride, trimethylsilyl triflate, BBr3, SnCl4, ZnCl2, MgCl2, or MgBr2 Et2O or any salt thereof, functional derivatives of the same and combinations of the same.
3. The method of claim 1 wherein said lewis acid is boron trifluoride etherate.
4 The method of claim 1 wherein said azide is trimethylsilyl azide, a trialkylsilyl azide, a metal azide or derivative or salt thereof.
5. The method of claim 1 wherein the related 3β-halide is 3β-chloro-5-cholestene.
6. The method of claim 1 wherein the related 3β-halide is 3β-bromo-5-cholestene.
7. The method of claim 1 wherein the related 3β-halide is 3β-iodo-5-cholestene.
8. A method of synthesizing a β- stereochemistry cholestene-derived membrane- binding element comprising: undergoing i- steroid or retro-i- steroid rearrangement of cholesterol or a cholesterol derivative using a Lewis acid and azide to generate a 3β-azido-5-cholestene; and reducing said 3β-azido-5-cholestene to obtain a 3β-amino-5-cholestene or related membrane-binding element.
9. The method of claim 8 wherein said Lewis acid is boron trifluoride etherate.
10. The method of claim 8 wherein said azide is trimethylsilyl azide, a trialkylsilyl azide, a metal azide or derivative or salt thereof.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US12245808P | 2008-12-15 | 2008-12-15 | |
| US61/122,458 | 2008-12-15 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2010071772A2 true WO2010071772A2 (en) | 2010-06-24 |
| WO2010071772A3 WO2010071772A3 (en) | 2010-10-21 |
Family
ID=42269274
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2009/067897 Ceased WO2010071772A2 (en) | 2008-12-15 | 2009-12-14 | Synthesis of 3b-amino-5-cholestene and related 3b-halides involving i-steroid and retro-i-steroid rearrangements |
Country Status (1)
| Country | Link |
|---|---|
| WO (1) | WO2010071772A2 (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2019519503A (en) * | 2016-05-16 | 2019-07-11 | ザ ボード オブ リージェンツ オブ ザ ユニバーシティー オブ テキサス システム | Cationic sulfonamide amino lipid and amphiphilic zwitterionic amino lipid |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7514400B2 (en) * | 2004-10-06 | 2009-04-07 | The Penn State Research Foundation | Synthetic mimics of mammalian cell surface receptors: method and compositions |
-
2009
- 2009-12-14 WO PCT/US2009/067897 patent/WO2010071772A2/en not_active Ceased
Non-Patent Citations (134)
| Title |
|---|
| ALAKOSKELA, J. I.; KINNUNEN, P. K., BIOPHYS. J., vol. 80, 2001, pages 294 - 304 |
| ANDERSON, R. G.; JACOBSON, K., SCIENCE, vol. 296, 2002, pages 1821 - 1825 |
| ANN N Y ACAD SCI., vol. 1058, 2005, pages 62 - 75 |
| BARRAGAN-MONTERO, V. ET AL., MED. CHEM., vol. 40, 2005, pages 1022 - 1029 |
| BLANK, N.; GABLER, C.; SCHILLER, M.; KRIEGEL, M.; KALDEN, J. R.; LORENZ, H. M., J. IMMUNOL. METHODS, vol. 271, 2002, pages 25 - 35 |
| BOONYARATTANAKALIN S; MARTIN SE; DYKSTRA SA; PETERSON BR: "Synthetic mimics of small Mammalian cell surface receptors", J AM CHEM SOC., vol. 126, no. 50, 2004, pages 16379 - 86 |
| BOONYARATTANAKALIN, S.; MARTIN, S. E.; DYKSTRA, S. A.; PETERSON, B. R, J. AM. CHEM. SOC., vol. 126, 2004, pages 16379 - 16386 |
| BOONYARATTANAKALIN, S.; MARTIN, S. E.; DYKSTRA, S. A.; PETERSON, B. R., J. AM. CHEM. SOC., vol. 126, 2004, pages 16379 - 16386 |
| BOONYARATTANAKALIN, S.; MARTIN, S. E.; DYKSTRA, S. A.; PETERSON, B. R., J. AM. CHEM. SOC., vol. 126, no. 50, 2004, pages 16379 - 16386 |
| BROOKS, H.; LEBLEU, B.; VIVES, E., ADV. DRUG DELIV. REV., vol. 57, 2005, pages 559 - 577 |
| BROWN, D. A.; LONDON, E., ANNU. REV. CELL DEV. BIOL., vol. 14, 1998, pages 111 - 136 |
| BROWN, D. A.; LONDON, E., J. BIOL. CHEM., vol. 275, 2000, pages 17221 - 17224 |
| BROWN, M. S.; GOLDSTEIN, J. L., ANGEW. CHEM. INT. ED. ENGL., vol. 25, 1986, pages 583 - 602 |
| CEDERGREN, L.; ANDERSSON, R.; JANSSON, B.; UHLEN, M.; NILSSON, B., PROTEIN ENG., vol. 6, 1993, pages 441 - 448 |
| CHIEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 9578 - 9582 |
| CHU, Y. H.; DUNAYEVSKIY, Y. M.; KIRBY, D. P.; VOUROS, P.; KARGER, B. L., J. AM. CHEM. SOC., vol. 118, no. 33, 1996, pages 7827 - 7835 |
| CHUNG, K. N.; ROBERTS, S.; KIM, C. H.; KIRASSOVA, M.; TREPEL, J.; ELWOOD, P. C., ARCH. BIOCHEM. BIOPHYS., vol. 322, 1995, pages 228 - 234 |
| CHUNG, N. S.; WASAN, K. M., ADV. DRUG DELIV., vol. 56, 2004, pages 1315 - 1334 |
| CONNER, S. D.; SCHMID, S. L., NATURE, vol. 422, 2003, pages 37 - 44 |
| CONNER, S. D.; SCHMID, S. L., NATURE, vol. 422, no. 6927, 2003, pages 37 - 44 |
| CREIGHTON, PROTEINS, 1984 |
| DANDLIKER, W. B.; HSU, M. L.; LEVIN, J.; RAO, B. R., METHODS ENZYMOL., vol. 74, 1981, pages 3 - 28 |
| DAVID ET AL., BIOCHEMISTRY, vol. 13, 1974, pages 1014 |
| DE KRUIF, J.; TIJMENSEN, M.; GOLDSEIN, J.; LOGTENBERG, T., NAT. MED., vol. 6, 2000, pages 223 - 227 |
| DIETRICH, C.; VOLOVYK, Z. N.; LEVI, M.; THOMPSON, N. L.; JACOBSON, K., PROC. NATL. ACAD. SCI. U.S.A., vol. 98, 2001, pages 10642 - 10647 |
| DORN, I. T.; NEUMAIER, K. R.; TAMPE, R., J. AM. CHEM. SOC., vol. 120, 1998, pages 2753 - 2763 |
| EDIDIN, M., ANNU. REV. BIOPHYS. BIOMOL. STRUCT., vol. 32, 2003, pages 257 - 283 |
| EVAN ET AL., MOLECULAR AND CELLULAR BIOLOGY, vol. 5, 1985, pages 3610 - 3616 |
| FIELD ET AL., MOL. CELL. BIOL., vol. 8, 1988, pages 2159 - 2165 |
| FIELD; SONG, NATURE, vol. 340, 1989, pages 245 - 246 |
| FIRESTONE, R.A., BIOCONJUG. CHEM., vol. 5, 1994, pages 105 - 113 |
| FRIEBERG, L.A., AM. J. ORG. CHEM., vol. 30, 1965, pages 2476 - 2479 |
| FUCHS, S. M.; RAINES, R. T., BIOCHEMISTRY, vol. 43, 2004, pages 2438 - 2444 |
| FUKUYAMA, T.; JOW, C. K.; CHEUNG, M., TETRAHEDRON LETT., vol. 36, 1995, pages 6373 - 6374 |
| GAUS, K.; GRATTON, E.; KABLE, E. P.; JONES, A. S.; GELISSEN, I.; KRITHARIDES, L.; JESSUP, W., PROC. NATL. ACAD. SCI. U.S.A., vol. 100, 2003, pages 15554 - 15559 |
| GEORGE, N.; PICK, H.; VOGEL, H.; JOHNSSON, N.; JOHNSSON, K., J. AM. CHEM. SOC., vol. 126, 2004, pages 8896 - 8897 |
| GHOSH, R. N.; GELMAN, D. L.; MAXFIELD, F. R., CELL SCI., vol. 107, 1994, pages 2177 - 2189 |
| GUIGNET, E. G.; HOVIUS, R.; VOGEL, H., NAT. BIOTECHNOL., vol. 22, 2004, pages 440 - 444 |
| HAO, M.; LIN, S. X.; KARYLOWSKI, O. J.; WUSTNER, D.; MCGRAW, T. E.; MAXFIELD, F. R., J. BIOL. CHEM., vol. 277, 2002, pages 609 - 617 |
| HAO, M.; MAXFIELD, F. R., J. BIOL. CHEM., vol. 275, 2000, pages 15279 - 15286 |
| HARDER, T.; SCHEIFFELE, P.; VERKADE, P.; SIMONS, K, J. CELL BIOL., vol. 141, 1998, pages 929 - 942 |
| HAWORTH, R. ET AL., J. CHEM. SOC., 1953, pages 1110 - 1115 |
| HODGES, H. B.; ZHOU, M.; HALDAR, S.; ANDERSON, J. L.; THOMPSON, D. H.; HRYCYNA, C. A., BIOCONJUG. CHEM., vol. 16, 2005, pages 490 - 493 |
| HOPP ET AL., BIOTECHNOLOGY, vol. 6, 1988, pages 1204 - 1210 |
| HOUGHTEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, no. 51, 1985, pages 32 |
| HUNTER ET AL., NATURE, vol. 144, 1962, pages 945 |
| HUSSEY, S. L.; HE, E.; PETERSON, B. R., J. AM. CHEM. SOC., vol. 123, 2001, pages 12712 - 12713 |
| HUSSEY, S. L.; PETERSON, B. R., J. AM. CHEM. SOC., vol. 124, 2002, pages 6265 - 6273 |
| IKONEN, E., CURR. OPIN. CELL BIOL, vol. 13, 2001, pages 470 - 477 |
| J. COMB. CHEM., vol. 6, 2004, pages 862 - 868 |
| J. IMMUNOL., vol. 169, 2002, pages 4905 - 4912 |
| JIANG, H.; O'NEIL E, J.; DIVITTORIO, K. M.; SMITH, B. D., ORG. LETT., vol. 7, 2005, pages 3013 - 3016 |
| KAKUDO T; CHAKI S; FUTAKI S; NAKASE I; AKAJI K; KAWAKAMI T; MARUYAMA K; KAMIYA H; HARASHIMA H: "Transferrin-modified Liposomes Equipped with a pH-sensitive Fusogenic Peptide: an Artificial Viral-like Delivery System", BIOCHEMISTRY, vol. 43, 2004, pages 5618 - 5628, XP003000487, DOI: doi:10.1021/bi035802w |
| KAN ET AL., BIOCHEMISTRY, vol. 31, 1992, pages 1866 - 1874 |
| KAN, C. C.; YAN, J.; BITTMAN, R., BIOCHEMISTRY, vol. 31, 1992, pages 1866 - 1874 |
| KAN, C. ET AL., BIOCHEM., vol. 31, 1992, pages 1866 - 1874 |
| KAN, C. ET AL., BIOCHEMISTRY, vol. 31, 1992, pages 1866 - 1874 |
| KATO, M.; MRKSICH, M., J. AM. CHEM. SOC., vol. 126, 2004, pages 6504 - 6505 |
| KELLAM, B.; DE BANK, P. A.; SHAKESHEFF, K. M., CHEM. SOC. REV., vol. 32, 2003, pages 327 - 337 |
| KINTARAK, S.; WHAWELL, S. A.; SPEIGHT, P. M.; PACKER, S.; NAIR, S. P., INFECT. IMMUN., vol. 72, no. 10, 2004, pages 5668 - 5675 |
| KIRCHHAUSEN, T., ANNU. REV. BIOCHEM., vol. 69, 2000, pages 699 - 727 |
| KRUT, O.; SOMMER, H.; KRONKE, M., J. ANTIMICROB. CHEMO, vol. 53, no. 2, 2004, pages 167 - 173 |
| LAM K. S., ANTICANCER DRUG RES., vol. 12, 1997, pages 145 - 167 |
| LANCET, D.; PECHT, I., BIOCHEMISTRY, vol. 16, 1977, pages 5150 - 5157 |
| LEE, R. J.; LOW, P. S., J. BIOL. CHEM., vol. 269, 1994, pages 3198 - 3204 |
| LENTZ, B. R.; TALBOT, W.; LEE, J.; ZHENG, L. X, BIOCHEMISTRY, vol. 36, 1997, pages 2076 - 2083 |
| LENZ, M.; MIEHE, W. P.; VAHRENWALD, F.; BRUCHELT, G.; SCHWEIZER, P.; GIRGERT, R., ANTICANCER RES., vol. 17, 1997, pages 1143 - 1146 |
| LU, Y.; SEGA, E.; LEAMON, C. P.; LOW, P. S., ADV. DRUG DELIV. REV., vol. 56, 2004, pages 1161 - 1176 |
| LUTZ-FREYERMUTH ET AL., PROC. NATL. ACAD. SCI. USA, vol. 87, 1990, pages 6393 - 6397 |
| MAHAL, L. K.; YAREMA, K. J.; BERTOZZI, C. R., SCIENCE, vol. 276, 1997, pages 1125 - 1128 |
| MAIOLO, J. R.; FERRER, M.; OTTINGER, E. A., BIOCHIM. BIOPHYS. ACTA, vol. 1712, 2005, pages 161 - 172 |
| MANCUSO, A. J.; SWERN, D., SYNTHESIS, vol. 3, 1981, pages 165 - 185 |
| MANES, S.; DEL REAL, G.; MARTINEZ, A. C., NAT. REV. IMMUNOL., vol. 3, 2003, pages 557 - 568 |
| MARTIN ET AL., SCIENCE, vol. 255, 1992, pages 192 - 194 |
| MARTIN, S. E.; PETERSON, B. R., BIOCONJUGATE CHEM., vol. 14, 2003, pages 67 - 74 |
| MATHIS G., CLIN. CHEM., vol. 41, 1995, pages 139 - 147 |
| MAXFIELD, F. R., CURR. OPIN. CELL BIOL., vol. 14, 2002, pages 483 - 487 |
| MAXFIELD, F. R.; MCGRAW, T. E., NAT. REV. MOL. CELL. BIOL., vol. 5, 2004, pages 121 - 132 |
| MERRIFIELD ET AL., J. AM. CHEM. SOC., vol. 85, 1964, pages 2149 |
| MUNRO, S., CELL, vol. 115, 2003, pages 377 - 388 |
| NICHOLS, B., J. CURR. BIOL., vol. 13, 2003, pages 686 - 690 |
| NYGREN, J. HISTOCHEM. AND CYTOCHEM., vol. 30, 1982, pages 407 |
| PABORSKY ET AL., PROTEIN ENGINEERING, vol. 3, no. 6, 1990, pages 547 - 553 |
| PAIN ET AL., J. IMMUNOL. METLZ., vol. 40, 1981, pages 219 |
| PANVERA CORP., 1998, pages 53711 |
| PATTERSON, G. H.; LIPPINCOTT-SCHWARTZ, J. SCIENCE, vol. 297, 2002, pages 1873 - 1877 |
| PETERSON, B., ORG. BIOMOL. CHEM., vol. 3, 2005, pages 3607 - 3612 |
| PHIZICKY ET AL., MICROBIOL. REV., vol. 59, 1995, pages 94 - 123 |
| PINKUS, J.L. ET AL., J. ORG. CHEM., vol. 27, 1962, pages 4356 - 4360 |
| PITARD, B. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 96, 1999, pages 2621 - 2626 |
| POWELL, D. A. ET AL., J. AM. CHEM. SOC., vol. 127, 2005, pages 510 - 511 |
| POZA, J. ET AL., BIOORG. MED. CHEM., vol. 15, 2007, pages 4722 - 4720 |
| PRESCHER, J. A.; DUBE, D. H.; BERTOZZI, C. R., NATURE, vol. 430, 2004, pages 873 - 877 |
| PURI, V.; WATANABE, R; DOMINGUEZ, M.; SUN, X.; WHEATLEY, C. L.; MARKS, D. L.; PAGANO, R. E., NAT. CELL BIOL., vol. 1, 1999, pages 386 - 388 |
| QIAN, Z. M.; LI, H.; SUN, H.; HO, K., PHARMACOL. REV., vol. 54, 2002, pages 561 - 587 |
| REAVEN, E.; TSAI, L.; AZHAR, S., J. BIOL. CHEM., vol. 271, 1996, pages 16208 - 16217 |
| RODAL, S. K.; SKRETTING, G.; GARRED, 0.; VILHARDT, F.; VAN DEURS, B.; SANDVIG, K., MOL. BIOL. CELL, vol. 10, 1999, pages 961 - 974 |
| ROTHBARD, J. B.; JESSOP, T. C.; WENDER, P. A., ADV. DRUG DELIV. REV., vol. 57, 2005, pages 495 - 504 |
| RUBIN, BRITISH MED. BULLE., vol. 53, 1997, pages 617 - 631 |
| RUI, Y. J.; WANG, S.; LOW, P. S.; THOMPSON, D. H., J. AM. CHEM. SOC., vol. 120, 1998, pages 11213 - 11218 |
| SALMI, C. ET AL., LETT. DRUG DESIGN DISCOV., vol. 5, 2008, pages 169 - 172 |
| SANDVIG, K.; VAN DEURS, B., FEBS LETT, vol. 529, 2002, pages 49 - 53 |
| SATO, S. B.; ISHII, K.; MAKINO, A.; IWABUCHI, K.; YAMAJI-HASEGAWA, A.; SENOH, Y.; NAGAOKA, I.; SAKURABA, H.; KOBAYASHI, T., J. BIOL. CHEM., vol. 279, 2004, pages 23790 - 23796 |
| SATO, S. ET AL., J. BIOL. CHEM., vol. 479, 2004, pages 23790 - 23796 |
| SAXON, E.; BERTOZZI, C. R., SCIENCE, vol. 287, 2000, pages 2007 - 2010 |
| SCHMID, S. L., ANNU. REV. BIOCHEM., vol. 66, 1997, pages 511 - 548 |
| SHIAO, Y. H.; LEE, S. H.; KASPRZAK, K. S., CARCINOGENESIS, vol. 19, 1998, pages 1203 - 1207 |
| SIMONS, K.; IKONEN, E., SCIENCE, vol. 290, 2000, pages 1721 - 1726 |
| SIMONS, K.; TOOMRE, D., NAT. REV. MOL. CELL. BIOL., vol. 1, 2000, pages 31 - 39 |
| SINGH, R. D.; PURI, V.; VALIYAVEETTIL, J. T.; MARKS, D. L.; BITTMAN, R.; PAGANO, R. E., MOL. BIOL. CELL, vol. 14, 2003, pages 3254 - 3265 |
| SJOBACK, R.; NYGREN, J.; KUBISTA, M., SPECTROCHIMICA ACIA PART A-MOLECULAR AND BIOMOLECULAR SPECTROSCOPY, vol. 51, 1995, pages L7 - L21 |
| SKINNER ET AL., J. BIOL. CHEM., vol. 266, 1991, pages 15163 - 15166 |
| SMITH, D. C.; LORD, J. M.; ROBERTS, L. M.; JOHANNES, L., SEMIN. CELL. DEV. BIOL., vol. 15, 2004, pages 397 - 408 |
| SODEOKA, M.; LARSON, C. J.; CHEN, L.; LECLAIR, K. P.; VERDINE, G. L., BIOORG. MED. CHEM. LETT., vol. 3, 1993, pages 1089 - 1094 |
| SPENCER ET AL., J. LIPID RES., vol. 45, 2004, pages 1510 - 1518 |
| SPENCER, T. ET AL., J. LIPID RES., vol. 45, 2004, pages 1510 - 1518 |
| SUN ET AL., J. AM. CHEM. SOC., vol. 130, 2008, pages 10064 - 10065 |
| SUN, W. C.; GEE, K. R.; KLAUBERT, D. H.; HAUGLAND, R. P., J. ORG. CHEM., vol. 62, 1997, pages 6469 - 6475 |
| TASHIRO, M.; MONTELIONE, G. T., CURR. OPIN. STRUCT. BIOL., vol. 5, 1995, pages 471 - 481 |
| TAYLOR ET AL., J. NEUROCHEM., vol. 68, 1997, pages 1598 - 605 |
| UMEZAWA, N.; GELMAN, M. A.; HAIGIS, M. C.; RAINES, R. T.; GELLMAN, S. H., J. AM. CHEM. SOC., vol. 124, 2002, pages 368 - 369 |
| VAN BROEKHOVEN, C. L.; PARISH, C. R.; VASSILIOU, G.; ALTIN, J. G., J. IMMUNOL., vol. 164, 2000, pages 2433 - 2443 |
| VYAS, S. P.; SINGH, A.; SIHORKAR, V., CRIT. REV. THER. DRUG CARRIER. SYST., vol. 18, 2001, pages 1 - 76 |
| WAGNER, A. ET AL., J. ORG. CHEM., vol. 17, 1952, pages 529 - 541 |
| WENDER, P. A.; MITCHELL, D. J.; PATTABIRAMAN, K.; PELKEY, E. T.; STEINMAN, L.; ROTHBARD, J. B., PROC. NATL. ACAD. SCI. U.S.A., vol. 97, 2000, pages 13003 - 13008 |
| WILLIAMS, D. H.; BARDSLEY, B., ANGEW. CHEM. INT. ED., vol. 38, no. 9, 1999, pages 1173 - 1193 |
| WINDAUS ET AL.: "first reported that reacting cholesteryl chloride with ammonia, or reduction of cholestenone oxime, provides 3-substituted cholesterylamines in modest yields", BERICHTE DER DEUTSCHEN CHEMISCHEN GESELLSCHAFT, vol. 44, 1911, pages 3051 - 3058 |
| WOLFRUM, C. ET AL., NAT. BIOTECHNOL., vol. 25, 2007, pages 1149 - 1157 |
| WU, S.; LEE, S.; BEAK, P., J. AM. CHEM. SOC., vol. 118, 1996, pages 715 - 721 |
| YANG, T.; BARYSHNIKOVA, O. K.; MAO, H.; HOLDEN, M. A.; CREMER, P. S., J. AM. CHEM. SOC., vol. 125, 2003, pages 4779 - 4784 |
| YOUNG K H, BIOL. REPROD., vol. 58, 1998, pages 302 - 311 |
| YOUNG, J. C.; MOAREFI, I.; HARTL, F. U., J. CELL BIOL., vol. 154, 2001, pages 267 - 273 |
| YOUNG, J. C.; MOAREFI, I.; HARTL, F. U., J. CELL BIOL., vol. 154, no. 2, 2001, pages 267 - 273 |
| ZACHARIAS, D. A.; VIOLIN, J. D.; NEWTON, A. C.; TSIEN, R. Y., SCIENCE, vol. 296, 2002, pages 913 - 916 |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2019519503A (en) * | 2016-05-16 | 2019-07-11 | ザ ボード オブ リージェンツ オブ ザ ユニバーシティー オブ テキサス システム | Cationic sulfonamide amino lipid and amphiphilic zwitterionic amino lipid |
| JP7080826B2 (en) | 2016-05-16 | 2022-06-06 | ザ ボード オブ リージェンツ オブ ザ ユニバーシティー オブ テキサス システム | Cationic sulfonamide aminolipids and amphoteric zwitterionic aminolipids |
| US11542229B2 (en) | 2016-05-16 | 2023-01-03 | The Board Of Regents Of The University Of Texas System | Cationic sulfonamide amino lipids and amphiphilic zwitterionic amino lipids |
| US11685710B2 (en) | 2016-05-16 | 2023-06-27 | The Board Of Regents Of The University Of Texas System | Cationic sulfonamide amino lipids and amphiphilic zwitterionic amino lipids |
| US12252464B2 (en) | 2016-05-16 | 2025-03-18 | The Board Of Regents Of The University Of Texas System | Cationic sulfonamide amino lipids and amphiphilic zwitterionic amino lipids |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2010071772A3 (en) | 2010-10-21 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US7947647B2 (en) | Synthetic mimics of mammalian cell surface receptors: method and compositions | |
| US20240209026A1 (en) | A4b7 thioether peptide dimer antagonists | |
| Greenwood et al. | The cyclic cystine knot miniprotein MCoTI-II is internalized into cells by macropinocytosis | |
| AU2013329135B2 (en) | Novel a4B7 peptide dimer antagonists | |
| US12115224B2 (en) | Polypeptide conjugates for intracellular delivery of stapled peptides | |
| KR20110093832A (en) | CJCR4 receptor compound | |
| KR20160125361A (en) | Var2csa-drug conjugates | |
| Doan et al. | Design and characterization of novel cell-penetrating peptides from pituitary adenylate cyclase-activating polypeptide | |
| CN108712913B (en) | Tri-part modulators of endosomal G protein-coupled receptors | |
| EP1636252A1 (en) | Statine derivatives for the treatment of alzheimer s disease | |
| US20100160657A1 (en) | Synthetic mimics of mammalian cell surface receptors: method and compositions | |
| WO2010071772A2 (en) | Synthesis of 3b-amino-5-cholestene and related 3b-halides involving i-steroid and retro-i-steroid rearrangements | |
| EP0592791A2 (en) | Tricyclic compounds and peptide derivatives thereof | |
| US10525144B2 (en) | Selective targeting of an anti-inflammatory receptor in human mitochondria and preservation of mitochondrial functions | |
| MXPA05013914A (en) | Leukocyte internalized peptide-drug conjugates. | |
| TW201919682A (en) | Novel compounds activating the Nrf2 pathway | |
| JP2003530329A (en) | Bile acid-containing prodrugs with increased bioavailability | |
| KR102043992B1 (en) | Novel staple peptides for inhibiting NCOA1/STAT6 protein-protein interaction and uses thereof | |
| Boonyarattanakalin | Synthetic mimics of mammalian cell surface receptors | |
| HK40069654A (en) | Alpha4beta7 integrin thioether peptide antagonists | |
| IL322770A (en) | Human transferrin receptor-binding peptide | |
| Ram et al. | Maurocalcine-derivatives as biotechnological tools for the penetration of cell-impermeable compounds | |
| Cai | Novel Artificial Cell Surface Receptors and Related Molecular Probes | |
| HK1235801B (en) | Alpha4beta7 integrin thioether peptide antagonists | |
| NZ726337B2 (en) | a4ß7 INTEGRIN THIOETHER PEPTIDE ANTAGONISTS |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 09828424 Country of ref document: EP Kind code of ref document: A2 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 09828424 Country of ref document: EP Kind code of ref document: A2 |












































































