WO2010060209A1 - Single domain antibody - targeted nanoparticle architectures for increased pathogen detection specificity and sensitivity - Google Patents
Single domain antibody - targeted nanoparticle architectures for increased pathogen detection specificity and sensitivity Download PDFInfo
- Publication number
- WO2010060209A1 WO2010060209A1 PCT/CA2009/001712 CA2009001712W WO2010060209A1 WO 2010060209 A1 WO2010060209 A1 WO 2010060209A1 CA 2009001712 W CA2009001712 W CA 2009001712W WO 2010060209 A1 WO2010060209 A1 WO 2010060209A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cells
- conjugate
- sdab
- hvhp428spn
- spn
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K17/00—Carrier-bound or immobilised peptides; Preparation thereof
- C07K17/14—Peptides being immobilised on, or in, an inorganic carrier
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/69—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit
- A61K47/6921—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere
- A61K47/6923—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere the form being an inorganic particle, e.g. ceramic particles, silica particles, ferrite or synsorb
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B82—NANOTECHNOLOGY
- B82Y—SPECIFIC USES OR APPLICATIONS OF NANOSTRUCTURES; MEASUREMENT OR ANALYSIS OF NANOSTRUCTURES; MANUFACTURE OR TREATMENT OF NANOSTRUCTURES
- B82Y5/00—Nanobiotechnology or nanomedicine, e.g. protein engineering or drug delivery
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/543—Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals
- G01N33/54313—Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals the carrier being characterised by its particulate form
- G01N33/54346—Nanoparticles
Definitions
- the present invention relates to targeted nanoparticle architectures for use in detecting pathogens with high specificity and sensitivity. More specifically, the present invention relates to a pathogen-detecting targeted superparamagnetic nanoparticle (SPN).
- SPN superparamagnetic nanoparticle
- Nanoparticles possess diverse, material-dependent properties that can be exploited in order to label and identify a biomolecule.
- antibody-nanoparticle conjugates should be conducive to detection formats characterized by high target specificity, sensitivity and fast detection/identification output.
- nanoconjugates have been employed in the labeling and detection of cancer cells (Medley et al, 2008) and biomarkers for debilitating diseases such as Alzheimer's (Lin et al, 2006; Georganopoulou et al, 2005).
- Nanoconjugates would be of great benefit in the field of bacterial pathogen detection (Gu et al, 2006; Kalele et al, 2006; Ho et al, 2004; Su et al, 2004; Tu et al, 2003; Tu et al, 2002).
- Some prime examples for detection are those that are biological threat agents or food pathogens such as Bacillus anthracis, Francisella tularensis, Escherichia coli O157:H7, Salmonella typhimurium Campylobacter jejuni, Lysteria monocytogenes, and Staphylococcus aureus. Effective and timely preventive measures against such bacteria require that they be detected in trace amounts, thus calling for a detection system which is highly specific, sensitive and fast.
- the present invention relates to targeted nanoparticle architectures for use in detecting pathogens with high specificity and sensitivity. More specifically, the present invention relates to a pathogen-detecting targeted superparamagnetic nanoparticle (SPN).
- SPN pathogen-detecting targeted superparamagnetic nanoparticle
- the applicant has determined that the superparamagnetic nanoconjugates described herein are an attractive option as pathogen detection constructs. By virtue of their magnetic property they can magnetically confine/preconcentrate cell samples, leading to increase in detection sensitivity. With a dye doped version employed, the detection sensitivity may be increased further through signal amplification (i.e., every binding event would lead to the "deposition" of thousands of detecting dyes (signals) on the surface of cells) (Zhao et al, 2004).
- the basis of pathogen recognition is an antibody-antigen immune or pseudoimmune reaction (Ho et al., 2004).
- the targeting moiety is a single domain antibody (sdAb).
- the present invention provides a conjugate comprising a superparamagnetic core comprising iron oxide nanoparticles, coupled to at least one single-domain antibody (sdAb) specific to a pathogen or cell of interest.
- the sdAb may be specific to protein A on the surface of Staphylococcus aureus, in particular the methicillin-resistant varieties (MRSA) and may be used for their detection.
- the sdAb may comprise the sequence: QLQLQESGGGLVQPGGSLRLSCAASGFTFSSYAMSWFRQAPGKGLEWVG FIRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLRAEDTAMYYCA RRAKDGYNSPEDYWGQGTLVTVSS [SEQ ID. NO. 1] or a substantially identical sequence thereto.
- the sdAb may be sdAb HVHP428.
- the present invention comprises a method of detecting a pathogen of interest in a mixed culture or sample, by binding the pathogen with a conjugate described herein, magnetically concentrating the pathogens bound with the conjugate, and detecting the pathogens bound with the conjugate.
- the conjugate may further comprise a Surface- enhanced Raman scattering (SERS)-active Raman reporter molecule.
- SERS Surface- enhanced Raman scattering
- the SPNs may further comprise a detectable label, such as a fluorescent dye.
- the invention provides the use of conjugates as described herein to separate and purify a target of interest in a mixture or a sample.
- the target of interest may be cells such as mammalian cells, to be separated from a mixture containing several different types of cells.
- FIG 1 shows different antibody formats.
- An antibody for example an IgG, consists of two identical heavy chains (hatched and grey) and two identical light chains (black and white). Antibody domains are shown as ovals.
- the Fc region of the IgG which consists of four domains, interacts with S. aureus protein A as well as protein G and protein M present on the surface of other bacteria (Ho et al, 2004; Tashiro et al, 1995; Burova et al, 1999); this is known as the pseudoimmune reaction.
- the Fv region (white and grey) of the IgG binds the antigen through hypervariable loops/complementarity-determining regions (immune reaction).
- a scFv (a light chain binding domain plus a heavy chain binding domain covalently joined by a linker) maintains the antigen binding activity of the parent antibody.
- the two binding domains can dissociate then re- associate intermolecularly; on the surface of nanoparticles, this would lead to agglutination.
- V H which is over 10-fold smaller than an IgG, also has the ability to bind to antigen; some also have the ability to binds to protein A (pseudoimmune reaction).
- the smaller V H S display a lower number of reactive sites and as a result, unlike larger IgG or scFv, lead to insignificant nanoparticle agglutination during conjugation.
- FIG. 2 is a schematic showing the HVHP428 P pentamer versus the HVHP428SPN Fe203 superparamagnetic nanoconjugate.
- Pentameric V H S are generated recombinantly in vivo, e.g., in E. coli, by the spontaneous assembly of five identical monomelic units. The assembly is mediated by the specific interaction of the pentamerization domains which are covalently fused to the V H s at the gene level.
- multivalency is achieved by chemical linking, via amide linkages, of several V H S to the same nanoparticle.
- a magnetic core allows for the magnetic pre- concentration of pathogens and the introduction of a dye-doped silica shell would allow for the fluorescent detection of the pre-concentrated pathogen.
- Figure 3 shows results of microagglutination assays for HVHP428 P , HVLP335 P and HVHP428SPN Fe203 .
- a constant concentration of S. aureus cells was used, while the concentrations of pentamers and nanoparticles decrease two-fold from well 1 to well 11 with well 12 having only MES buffer.
- the concentrations of the pentamers and nanoparticles in wells 1 are 215 ⁇ g/mL and 2.5 x 10 12 particles/mL, respectively.
- Figure 3A shows results for HVHP428 P and HVLP335 P .
- FIG. 3B MAC values were 3 x 10 13 pentamers/mL and 1.5 x 10 11 particles/mL for HVHP428 P and HVHP428SPN Fe2 ° 3 , respectively.
- Figure 4 shows results of flow cytometry analysis of HVHP428SPN Fe . Nanoparticles were incubated with 0, 0.05, 0.1, 0.2, 0.5 and 1 ⁇ g of fluorescently active protein A (protein A R-PE) and assessed directly for binding by flow cytometry.
- Figure 4A Binding, indicated as the rightward fluorescence shifts of nanoparticle populations, can be seen with the increase in protein A R-PE concentration.
- Figure 4B Binding is shown as the mean fluorescence, extracted from data in ( Figure 4A), versus protein A R-PE concentration. Circles, HVHP428SPN Fe203 ; triangles, SPN Fe203 .
- Figure 5 shows results of TEM experiments for HVHP428SPN Fe203 .
- Representative TEM images of the nanoparticle-bacteria conjugates where there is a strong interaction between HVHP428SPN Fe203 and S. aureus cells Figure 5A
- Control TEM images were also acquired confirming that SPN Fe203 does not interact effectively with S. aureus cells in the absence of HVHP428 ( Figure 5C), suggesting that the sdAb mediates the specific interaction between the nanoparticles and the S. aureus cells.
- Figure 6 illustrates the cell capture capability of the HVHP428SPN Fe203 nanoconjugate.
- Figure 6A is a scheme representing the steps involved in capture studies. Cells were incubated with HVHP428SPN Fe2 ° 3 for binding. Following binding and magnetic capture of nanoparticles, the supernatant is separated from the captured nanoparticles and titrated to determine the number of non-captured cells. The captured nanoparticles were titrated for determining the number of captured cells. Unconjugated nanoparticle, SPN Fe203 was used as control. Capture efficiency and specificity were calculated as described in Examples.
- Figure 6B shows the capture efficiency of HVHP428SPN Fe2 ° 3 nanoconjugate towards S. aureus.
- the data are an average of 5 trials.
- the number of cells subjected to capture studies ranged from 180 - 4000.
- Figure 6C shows the capture specificity of HVHP428SPN Fe2 ° 3 in terms of the ratio of the number of S. aureus to S. typhimurium in the captured fraction.
- a mixture of both bacteria was used for capture studies and selective media were used to enumerate each of the two bacteria in the captured and non- captured fractions.
- S. aureus and S. typhimurium data were normalized for the total number of cells.
- the total number of cells in the HVHP428SPN Fe203 mixtures was 1170 S. aureus and 525 S. typhimurium cells in one trial and 2780 S. aureus and 2420 S. typhimurium in the second trial.
- the inset shows the number of cells (average of the two trials) captured with HVHP428SPN Fe2 ° 3 (white bars) and SPN Fe2 ° 3 (black
- Figure 7 shows the cell capture efficiency and specificity of HVHP428SPN Fe2 ° 3 nanoconjugate when a single wash step is included after the binding step.
- Figure 7A is a bar graph showing the total number of S. aureus cells was 338 in the HVHP428SPN Fe203 mixture and 278 in the SPN Fe2 ° 3 mixture.
- the wash step removed 6 S. aureus from the HVHP428SPN Fe203 mixture and 24 from the SPN Fe203 mixture.
- Figure 7B shows the capture specificity by comparing the number of S. aureus versus S. typhimurium in the mixed capture fraction.
- the total number of cells in the HVHP428SPN Fe203 mixture was 80 S. aureus and 56 S. typhimurium.
- the wash step removed 2 S. aureus and 4 S. typhimurium.
- Figure 8 shows surface plasmon resonance assessment of the binding activity of V H and ers. Sensorgram overlays showing the binding of HVHP428 p
- V L pentam to immobilized protein A at 1, 2, 3, 4, 6, 8 and 10 nM concentrations Figure 8A
- HVLP335 P to immobilized protein L at 1, 2, 2.5, 3, 3.5, 4 and 4.5 nM concentrations
- Figure 8B Association and dissociation rate constants, k a and ka, respectively, and equilibrium constants, K A , for the binding of HVHP428 P and HVLP335 P to proteins A and L, respectively, are shown on the graphs.
- k a s were independently calculated from plots of ko b s versus concentration. More than one k d could be calculated due to the heterogeneity in multivalent binding amongst the pentamer population.
- HVHP428 P and HVLP335 P had minimum K A s of 5 x 10 8 M “1 and 5 x 10 9 M "1 , respectively. With slower k d s, HVHP428 P and HVLP335 P had K A s as high as 1.1 x 10 9 M "1 and 1.1 x 10 10 M "1 , respectively.
- HVHP428 P pentamer shows increased apparent affinity towards protein A by at least 1000-fold compared to the monomeric version, HVHP428. RU, resonance units.
- Figure 9 shows results of microagglutination assays and TEM experiments assessing the cross-reactivity of HVHP428SPN Fe2 3 towards S. saprophyticus, S. pneumoniae and S. pyogenes.
- concentrations of HVHP428SPN Fe203 (odd rows) and HVHP428SPN Fe203 (even rows) decrease two-fold from well 1 to well 3 with well 4 having only MES buffer.
- S. pyogenes did not lend itself to the microagglutination assay and therefore its cross reactivity status was assessed by TEM experiments (left panel images).
- TEM images show lack of interactions between both HVHP428SPN Fe203 and SPN Fe2 ° 3 and S.
- Figure 10 shows results of SEM experiments to assess the cross reactivity of HVHP428SPN Fe2 ° 3 towards S. saprophyticus, S. pneumoniae and S. pyogenes. Cells and nanoparticles are shown by black and white arrows, respectively. The scale bar corresponds to 1 ⁇ m.
- 1-SPN HVHP428SPN Fe2 ° 3 ;
- SPN SPN Fe2 ° 3 .
- Figure 11 shows the UV- visible absorption spectra of HVHP428SPN Fe203 .
- HVHP428SPN Fe203 HVHP428SPN Fe203 ;
- TRITC tetramethylrhodamine isothiocyanate
- TRITC tetramethylrhodamine isothiocyanate
- TRITC tetramethylrhodamine isothiocyanate
- TRITC tetramethylrhodamine isothiocyanate
- Figure 12 shows the calibration curve for TRITC in MES buffer used to determine the average number of sdAb on each nanoparticle. The calculations are based on the UV- visible absorption data shown in Figure 11. Detailed Description of Preferred Embodiments
- the present invention relates to targeted nanoparticle architectures for use in detecting pathogens with high specificity and sensitivity. More specifically, the invention relates to a pathogen-detecting targeted superparamagnetic nanoparticle (SPN).
- SPN superparamagnetic nanoparticle
- the present invention provides a conjugate comprising a superparamagnetic core comprising, in one embodiment, iron oxide nanoparticles, coupled to at least one sdAb specific to a pathogen of interest.
- the sdAb may be specific to protein A on the surface of Staphylococcus aureus, in particular the methicillin-resistant varieties (MRSA) and may be used for their detection.
- nanoparticle means a particle having at least one dimension which is less than about 200 nm.
- SPN superparamagnetic nanoparticles
- superparamagnetic core nanoparticles that exhibit a behavior similar to paramagnetism at temperatures below the Curie or the Neel temperature. This is a small length-scale phenomenon, where the energy required to change the direction of the magnetic moment of the particle is comparable to the ambient thermal energy. Normally, coupling forces in ferromagnetic materials cause the magnetic moments of neighboring atoms to align, resulting in very large internal magnetic fields. This is what distinguishes ferromagnetic materials from paramagnetic materials. At temperatures above the Curie temperature (or the Neel temperature for antiferromagnetic materials), the thermal energy is sufficient to overcome the coupling forces, causing the atomic magnetic moments to fluctuate randomly.
- the SPN may comprise any suitable superparamagnetic nanomaterial; for example, and without wishing to be limiting in any manner, the superparamagnetic material may be
- the SPN are comprised of Fe 2 O 3 nanoparticles.
- the formation of superparamagnetic nanoparticles is well known by those skilled in the art, and need not be further described herein (see for example Hyeon, 2003, which is incorporated herein by reference where permitted).
- the size of the SPN may vary based on the type of material comprising the nanoparticles. As would be understood by a person of skill in the art, depending on the material of which the nanoparticles are comprised, the range of the nanoparticle size may vary.
- the Fe 2 O 3 SPN may have a diameter of about 5 to 20 nm; for example, the diameter of the nanoparticle may be about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17 18, 19 or 20 nm. In a specific, non-limiting example, the diameter of the SPN core may be about 10 nm.
- the SPN may also be encapsulated in a silica shell or coating.
- the silica shell may enable attachment of biomolecules and may reduce toxicity.
- the SPN may comprise a core + shell architecture familiar to the skilled artisan.
- Methods for preparing the silica shell are also well-known to those of skill in the art (see for example, Lu et al, 2002; KeIl et al, 2008).
- the thickness of the silica coating may be applied in a controlled manner over the SPN core.
- the thickness of the silica coating may be about 1 nm and 20 nm, or any value there between; for example, the silica coating may be about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 nm thick. As would be understood by one of skill in the art, as the thickness of the silica shell is increased, the magnetic confinement time for the bacteria will require longer times (KeIl et al, 2008). In a specific, non-limiting example, the thickness of the silica coating may be about 15 nm.
- the conjugate of the present invention comprises SPNs conjugated to one or more than one single-domain antibody (sdAb).
- single-domain antibody it is meant an antibody fragment comprising a single protein domain.
- Single domain antibodies may comprise any variable fragment, including V L , V H , V H H, V NAR , and may be naturally- occurring or produced by recombinant technologies.
- V H S, V L S, V H HS, V NAR S may be generated by techniques well known in the art (Holt, et al., 2003; Jespers, et al., 2004a; Jespers, et al., 2004b ; Tanha, et al., 2001 ; Tanha, et al., 2002; Tanha, et al., 2006 ; Revets, et al., 2005 ; Holliger, et al., 2005 ; Harmsen, et al., 2007 ; Liu, et al., 2007 ; Dooley, et al., 2003 ; Nuttall, et al., 2001 ; Nuttall, et al., 2000 ; Hoogenboom, 2005; Arbabi-Ghahroudi et al., 2008).
- libraries of sdAbs may be constructed in a variety of ways, "displayed" in a variety of formats such as phage display, yeast display, ribosome display, and subjected to selection to isolate binders to the targets of interest (panning).
- libraries include immune libraries derived from llama, shark or human immunized with the target antigen; non- immune/na ⁇ ve libraries derived from non-immunized llama, shark or human; or synthetic or semi-synthetic libraries such as V H , V L , V H H or V NAR libraries.
- the sdAb may comprise a heavy variable domain (V H ) denoted as HVHP428.
- V H heavy variable domain
- the sdAb in the conjugate of the present invention may comprise the amino acid sequence: OLOLQESGGGLVOPGGSLRLSCAASGFTFSSYAMSWFRQAPGKGLEWVG FIRSKAYGGTTEY AASVKGRFTISRDDSKSIAYLQMNSLRAEDTAMYYCA RRAKDGYNSPEDYWGOGTLVTVSS (SEQ ID NO: 1),
- CDRs hypervariable loops/complementarity- determining regions
- a sequence which is substantially identical to another sequence may comprise one or more conservative amino acid mutations. It is known in the art that one or more conservative amino acid mutations to a reference sequence may yield a mutant polypeptide with no substantial change in physiological, chemical, or functional properties compared to the reference sequence; in such a case, the reference and mutant sequences would be considered "substantially identical" polypeptides.
- Conservative amino acid mutation may include addition, deletion, or substitution of an amino acid; a conservative amino acid substitution is defined herein as the substitution of an amino acid residue for another amino acid residue with similar chemical properties (e.g. size, charge, or polarity).
- a conservative mutation may be an amino acid substitution.
- Such a conservative amino acid substitution may substitute a basic, neutral, hydrophobic, or acidic amino acid for another of the same group.
- basic amino acid it is meant hydrophilic amino acids having a side chain pK value of greater than 7, which are typically positively charged at physiological pH.
- Basic amino acids include histidine (His or H), arginine (Arg or R), and lysine (Lys or K).
- neutral amino acid also “polar amino acid”
- hydrophilic amino acids having a side chain that is uncharged at physiological pH, but which has at least one bond in which the pair of electrons shared in common by two atoms is held more closely by one of the atoms.
- Polar amino acids include serine (Ser or S), threonine (Thr or T), cysteine (Cys or C), tyrosine (Tyr or Y), asparagine (Asn or N), and glutamine (GIn or Q).
- hydrophobic amino acid (also “non-polar amino acid”) is meant to include amino acids exhibiting a hydrophobicity of greater than zero according to the normalized consensus hydrophobicity scale of Eisenberg (1984). Hydrophobic amino acids include proline (Pro or P), isoleucine (He or I), phenylalanine (Phe or F), valine (VaI or V), leucine (Leu or L), tryptophan (Trp or W), methionine (Met or M), alanine (Ala or A), and glycine (GIy or G).
- “Acidic amino acid” refers to hydrophilic amino acids having a side chain pK value of less than 7, which are typically negatively charged at physiological pH. Acidic amino acids include glutamate (GIu or E), and aspartate (Asp or D).
- Sequence identity is used to evaluate the similarity of two sequences; it is determined by calculating the percent of residues that are the same when the two sequences are aligned for maximum correspondence between residue positions. Any known method may be used to calculate sequence identity; for example, computer software is available to calculate sequence identity. Without wishing to be limiting, sequence identity can be calculated by software such as NCBI BLAST2 service maintained by the Swiss Institute of Bioinformatics (and as found at http://ca.expasy.org/tools/blast/), BLAST-P, Blast-N, or FASTA-N, or any other appropriate software that is known in the art.
- the substantially identical sequences of the present invention may be at least 75% identical; in another example, the substantially identical sequences may be at least 70, 75, 80, 85, 90, 95, or 100% identical at the amino acid level to sequences described herein. Importantly, the substantially identical sequences retain the activity and specificity of the reference sequence.
- the sdAb is conjugated (also referred to herein as “linked” or “coupled”) to the SPN.
- Conjugation of sdAbs to the SPN may be accomplished using methods well known in the art (see for example Hermanson, 1996). Single domain antibodies have several exposed lysine (primary amine) residues, and thus one method of covalently anchoring the sdAb to the carboxylic acid-modified nanoparticle surface is through bioconjugation chemistry.
- Suitable coupling reagents include l-ethyl-3-(3-dimethylaminopropyl) carbodiimide hydrochloride (EDC) which is often used in combination with N-hydroxysuccinimide (NHS).
- EDC l-ethyl-3-(3-dimethylaminopropyl) carbodiimide hydrochloride
- NHS N-hydroxysuccinimide
- the sdAb as described above may have, or may be engineered to have, one or more lysine residues opposite or away from its antigen binding site, which is used in covalent conjugation to the nanoparticle surface.
- the number of single domain antibodies conjugated to the surface of the nanoparticle is controllable and controlled.
- the sdAb may be conjugated to the nanoparticle surface through an amino acid with a carboxylic acid (i.e., GIu or Asp) on the sdAb and primary amines on the nanoparticle, or through binding of the sdAb (detecting entity) to a molecule, e.g., a protein already attached to the nanoparticle and has binding activity towards the sdAb.
- a carboxylic acid i.e., GIu or Asp
- a molecule e.g., a protein already attached to the nanoparticle and has binding activity towards the sdAb.
- this could be an antibody which binds to the sdAb or to tags (C-Myc tag, His6 tag) on the sdAb such as anti-C-Myc or anti-His ⁇ antibodies, or through binding of the biotinylated sdAb to a biotin binder on the surface of nanoparticles, e.g., streptavidin, neutravidin, avidin, extravidin.
- the sdAb could also be coupled to the nanoparticle by means of nickel -nitrilotriacetic acid chelation to a His6-tag.
- single-domain antibodies can also be engineered to have cysteines opposite their antigen binding sites. Conjugation via a maleimide cross-linking reaction allows the directional display of single domain antibodies where all single domain antibodies are optimally positioned to bind to their antigens. Amine-terminated nanoparticle is activated with maleimide in DMF followed by an incubation of cysteine- terminated single domain antibody to achieve covalent binding through the formation of sulfide bond formation.
- the number of sdAb molecules conjugated to the surface of the SPN may vary, based on various factors, such as the size of the nanoparticle.
- the conjugate of the present invention may comprise at least 1 to 15 sdAb molecules conjugated to the surface of the SPN; for example, the conjugate may carry at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 sdAb moieties linked to the SPN.
- the conjugate may comprise about 4 to about 12 sdAb molecules.
- the sdAb in the conjugate of the present invention may be specific to a pathogen of interest.
- pathogen means any human pathogen or those of animals or plants, including bacteria, eubacteria, archaebacteria, eukaryotic microorganisms (e.g., protozoa, fungi, yeasts, and molds), viruses, and biological toxins (e.g., bacterial or fungal toxins or plant lectins).
- the sdAb may be specific to protein A on the surface of Staphylococcus aureus, in particular the methicillin-resistant varieties (MRSA).
- S. aureus is a common human pathogen (Lowy et al, 1998). On its surface, it has covalently linked protein A (Sjoquist et al, 1972), which is (i) highly characteristic of S. aureus species, (ii) present in high abundance and (iii) capable of binding to various classes of antibodies, e.g, IgGs, through interaction with antibody Fc regions (Sjoquist et al, 1972; Cheung et al, 1997; Tashiro et al, 1995; Forsgren, 1970; Huang, 2006).
- sdAb single-domain antibody
- Single-domain antibodies are antibody fragments that possess one binding site compared to two for typical antibodies and are over 10-fold smaller in size ( ⁇ 15 kDa) (Holliger & Hudson, 2005).
- sdAbs have several properties which make them preferable over more popular antibody formats such as IgGs or scFvs ( Figure 1) as the recognition component of nanoconjugate.
- sdAbs can be conjugated on the surface of nanoparticles with a much higher binding site density (> 5 fold compared to IgGs and 2-fold compared to scFvs) and do not promote nanoparticle aggregation expected with scFvs and IgGs (Figure 1), resulting in much more active nanoconjugates.
- sdAbs can be easily engineered to contain amino acid residues for conjugation in an active orientation or for performing a variety of conjugation chemistries (Shen et al, 2008; Shen et al, 2005).
- the superparamagnetic nanoparticles described herein may also comprise a detectable label, such as a fluorescent dye or quantum dot, which in addition to target preconcentration would provide detection signals.
- the conjugates of the present invention may also comprise one or more than one SERS-active Raman reporter molecule (Tay et al, 2007).
- suitable labels may include, but are not limited to Rhodamine 6G, 4-nitrobenzenethiol, 2-methoxybenzenethiol, 3- methoxybenzenethiol, 4-methoxybenzenethiol, and 2-naphthalenethiol.
- HVHP428 V H -conjugated SPNs HVHP428SPN Fe203
- HVHP428SPN Fe203 a conjugate in accordance with the present invention
- the nanoconjugates of the present invention are highly stable, active and specific detecting agents, capable of capturing a few tens of pathogenic bacteria in a mixed cell population with very high specificity and efficiency.
- the use of sdAb eliminated the cross-reactivity "side effect" observed previously with a nanoconjugate that was based on the same type of recognition interaction but utilized whole antibody as its recognition moiety (Ho et al, 2004).
- the sdAb-SPN conjugates of the present invention may be used to detect a pathogen of interest in a mixed culture or sample, by binding the pathogen with the sdAb-SPN conjugate described herein, magnetically concentrating the sdAb-SPN conjugate bound to the pathogen, and detecting the sdAb-SPN conjugate bound to the pathogen.
- the sdAb-SPN further comprises a SERS-active Raman reporter molecule.
- the SPNs further comprise a detectable label, such as a fluorescent dye or quantum dot.
- sample means a sample that may contain an analyte of interest.
- a sample may comprise a body fluid or tissue (for example, urine, blood, plasma, serum, saliva, ocular fluid, spinal fluid, gastrointestinal fluid and the like) from humans or animals; plant tissue, environmental sample (for example, municipal and industrial water, sludge, soil, atmospheric air, ambient air, and the like); food; and beverages.
- mixed culture it is meant a mixture of different types of cells, including the target pathogen.
- the mixed culture may comprise various types of bacterial cells, or a mixture of different cell types.
- the invention comprises the use of sdAb-SPN conjugates to detect, separate and purify a target of interest in a mixture or a sample.
- the target of interest may be cells such as mammalian cells, to be separated from a mixture containing several different types of cells. These cells, once targeted by the sdAb-SPN conjugates may be magnetically separated and concentrated. For example, cells bearing a specific marker, or diseased cells, may be separated and purified from a mixture comprising non-marker cells, or non-diseased cells.
- Salmonella typhimurium ATCC19585
- Staphylococcus aureus ATCC12598
- Streptococcus pyogenes ATCC12385
- Staphylococcus saprophyticus ATCCl 5305
- Streptococcus pneumoniae 35C was from an in house stock (NRCC 4758).
- Xylose lysine desoxycholate XLD
- Baird-Parker agar and chocolate agar plates were purchased from Oxoid (Nepean, ON, Canada).
- Protein A R-PE conjugate (1 mg/mL) was purchased from Innova Biosciences Ltd. (Babraham, Cambridge, UK).
- a single S. aureus colony from a plate of brain heart infusion (BHI) media (EMD Chemicals Inc., Darmstadt, Germany) was used to inoculate 15 mL of BHI media.
- BHI brain heart infusion
- the bacteria were grown overnight at 37°C and 200 rpm. In the morning, the culture was spun down in a fixed rotor, Sorval RT6000B refrigerated centrifuge at 4,000 rpm for 10 min, the supernatant was removed and the cell pellet was re-suspended in an appropriate buffer.
- the cells were re-spun, the supernatant was removed and the cell pellet was re-suspended followed by measuring cell density at OD 6 oo- Serial dilutions of the cells were spread on BHI plates at 37°C for overnight growth. The cell titer was determined in the morning. An OD 6 Oo of 1.0 corresponded to 1 x 10 8 cells/mL.
- S. typhimurium was grown as described for S. aureus but with nutrient broth media (NB, 5 g peptone and 3 g meat extract in 1 L water, pH 7.0) (Sambrook et al,1989). For S. typhimurium, an OD 60O of 1 corresponded to 3 x 10 cells/mL.
- Staphylococcus saprophyticus was prepared as outlined for S. aureus. An OD 6 oo of 1 corresponded to 1 x 10 cells/mL. Streptococcus pyogenes was streaked onto chocolate agar plates from frozen stock and grown at 37°C overnight. Plate contents were scraped into sterile phosphate-buffered saline (PBS) and adjusted to an OD 6 oo of 1 which corresponded to 1 x
- PBS sterile phosphate-buffered saline
- SPN Fe203 nanoparticles were synthesized by encapsulating an iron-containing particle with a silica matrix through the hydrolysis and polymerization of tetraethoxyorthosilane under basic conditions; this process was described by KeIl & Simard (2007). Briefly, commercially available ferro fluid (0.4 mL water soluble ferrotec EMG403; Ferrotec, Bedford, NH) was diluted to 400 mL with Millipore water. The resulting stock solution was further diluted (12 mL diluted to 45 mL) in Millipore water, and the solution was sonicated for 30 min.
- ferro fluid 0.4 mL water soluble ferrotec EMG403; Ferrotec, Bedford, NH
- the resulting stock solution was further diluted (12 mL diluted to 45 mL) in Millipore water, and the solution was sonicated for 30 min.
- the ferro fluid solution was transferred to a 500 mL flask containing 400 mL isopropanol and mechanically stirred. Tetraethoxyorthosilane (0.14 mL) was added to the flask and stirred for ⁇ 1 min at which time 6 mL of concentrated ammonium hydroxide was added. The nanoparticles were then stirred overnight. This lead to a core-shell nanoparticle architecture, where an iron oxide nanoparticle (-10 nm) was encapsulated in a silica shell with a thickness of -15 nm.
- AP-DEMS 3- aminopropyldiethoxymethylsilane
- succinic anhydride to yield a carboxylic acid functional group.
- six 45 mL samples of the crude nanoparticle solution described above were transferred to 50 mL Falcon tubes, and 1.0 mL of AP-DEMS was added to each tube in order to modify the surface with a functional amine group.
- the mixture was shaken for 24 h and centrifuged at 5300 g for 20 min in order to precipitate the amine-modified nanoparticles.
- the conversion efficiency for the reaction between the amine and the succinic anhydride was determined by reacting the resulting nanoparticle with fluorescamine (KeIl & Simard (2007), which did not result in a fluorescence response, suggesting that all of the accessible amine moieties had reacted with the succinic anhydride.
- the carboxylic acid- modified nanoparticles are hereafter referred to as SPN e
- the resulting SPN Fe203 were surface modified with HVHP428 by first activating spN Fe2 ⁇ 3 ⁇ 10 mL ⁇ j ⁇ l o i4 nanopart i c i es ) w j tn EDC (5 ing) and NHS (5 mg) to yield the
- HVHP428 100 ⁇ L of a 1.8 mg/mL solution in PBS
- HVHP428 is covalently bound to the nanoparticle surface through primary amines, of which there are 7.
- HVHP428 the resulting HVHP428SPN Fe2 ° 3 particles were purified via repeated centrifugation cycles to remove any unbound HVHP428.
- the nanoparticles were redispersed in 10 mL of MES buffer (30 mM MES, 70 mM NaCl, pH 6.0).
- the number of HVHP428 VH anchored to the surface of the SPN Fe2 ° 3 was elucidated by reaction of the HVHP428SPN Fe203 (Example 2) with tetramethylrhodamine isothiocyanate (TRITC).
- the reaction was carried out in MES buffer with HVHP428SPN Fe203 (6 x 10 12 nanoparticles) and TRITC (50 ⁇ g, 1.2 x 10 "7 mol) and the resulting TMR-modified HVHP428SPN Fe203 was purified and analyzed by UV-visible spectroscopy in order to elucidate the number of sdAbs on the surface of the nanoparticle.
- UV-visible absorption spectra of freshly prepare, day-old HVHP428SPN Fe2 ° 3 and one-year-old HVHP428SPN Fe203 (6 x 10 12 nanoparticles/mL) and the original HVHP428SPN Fe2 ° 3 are shown in Figure 11. Analysis of the spectra indicates that TMR has reacted with the sdAb on HVHP428SPN Fe2 ° 3 , where there is an increase in absorption centered at 550 nm in comparison to the unmodified HVHP428SPN Fe203 .
- Example 4 Comparison of HVHP428SPN Fe2Q3 to a pentameric version.
- HVHP428SPN Fe203 As the first step towards developing HVHP428SPN Fe203 , it was decided to construct a homologous benchmark against which the performance of the nanoconjugate could be compared.
- a multimerization technology was previously developed to convert, by genetic engineering, low affinity monomelic sdAbs to highly sensitive pentameric detecting agents (Zhang et al, 2004b).
- HVHP428 was created ( Figure 2) and validated by surface plasmon resonance (i.e., Biacore analysis) ( Figure 8).
- 520 resonance units (RUs) of protein A or a Fab reference were immobilized on research grade CM5 sensor chips (GE Healthcare).
- CM5 sensor chips GE Healthcare
- 680 RUs of protein L or 870 RUs of the Fab reference were immobilized. Immobilizations were carried out at protein concentrations of 25 ⁇ g/mL (protein A) or 50 ⁇ g/mL (protein L and Fab) in 10 mM sodium acetate buffer pH 4.5, using the amine coupling kit provided by the manufacturer.
- the HVHP428 sdAb has an affinity (K A ) of 5.6 x 10 5 M "1 with protein A (To et al, 2005).
- K A affinity
- the apparent K A determined by SPR experiments, is increased by at least 1000-fold following the generation of the pentameric version HVHP428 P ( Figure 8).
- the resulting HVHP428SPN Fe203 of Example 2 was also expected to improve the apparent K A between the SPN-bound HVHP428 and protein A. Elucidation of the apparent K A for HVHP428SPN Fe203 was done by microagglutination assay (Example 6).
- the particles were incubated with fluorophore-conjugated protein A (protein A R-PE) and analyzed in a series of flow cytometry experiments.
- Samples of 100 ⁇ L HVHP428SPN Fe203 or SPN Fe2 ° 3 (10 12 particles) were blocked in PBS/0.1% (v/v) Tween-20 overnight at 4°C.
- 1 ⁇ L aliquots of various concentrations of fluorescently active protein A (protein A R-PE conjugate) were added and the reaction volumes were increased by adding 200 ⁇ L of PBS/0.75% Tween-20.
- the samples were incubated for 1 h at 4°C and were directly used for flow cytometry analysis with a FACSCanto Analyzer (BD Biosciences, Mississauga, ON, Canada).
- FACSCanto Analyzer BD Biosciences, Mississauga, ON, Canada.
- the R-PE fluorescence of 100,000 events per sample was analyzed and data were generated using BD FACSDiva software (BD Biosciences).
- HVHP428-SPN Fe203 The ability of HVHP428-SPN Fe203 to effectively interact with protein A on the surface of S. aureus was next investigated by means of series of microagglutination experiments. These experiments typically involve incubating HVHP428SPN Fe2 ° 3 with S. aureus cells in a microtiter plate.
- a cell microagglutination assay was performed.
- Cell microagglutinations were performed essentially as described (Saito et al, 1995).
- Two fold dilutions of pentamers (HVHP428 P ) or nanoparticles (HVHP428SPN Fe203 ) were performed in MES buffer from wells 1 to 11 of a microtiter plate.
- Well 12 had only buffer, and the total volume in each well was 50 ⁇ L.
- 1 OD 60O unit of cells in 50 ⁇ L buffer was added to all wells and the plate was incubated overnight at 4°C. In the morning, photos of the plates were taken for further analysis.
- Minimum agglutination concentration (MAC) the minimum concentration of nanoparticles or pentamers that promoted bacterial agglutination, was used to express the agglutination activity of nanoparticles and pentamers.
- HVHP428 P would cross-link and agglutinate cells due to its multivalency. In the absence of agglutination the cells settle out over time and form a dot at the center of the well. If there is agglutination the cells settle out as a sheet. Microagglutination was performed by incubating a constant number of bacterial cells with two-fold dilutions of HVHP428 P ( Figure 3A), as described above.
- the pentamer is functional as it agglutinates S. aureus, up to well 6. Beyond well 6 the concentration of the pentamer is too low for cross-linking, hence no agglutination (cells appear sediments appear as round dots). HVHP428 P exhibits a MAC value of 3 x 10 13 pentamers/mL. A control functional active V L pentamer, HVLP325 P ( Figure 8) does not show any agglutination, demonstrating that the activity of the HVHP428 P is due to its V H binding component and not its pentamerization domains ( Figure 2).
- HVHP428SPN Fe203 also effectively interacts with S. aureus cells (evidenced by the diffuse appearance of cell sediments in wells 1 -6) and exhibits a MAC value of 1.5 x 10 11 particles/mL, 200-fold better (more strongly) than HVHP428 P pentamer.
- HVHP428SPN Fe203 is specific to S. aureus exclusively, as there is no agglutination (cell dots) in the presence of the other species of bacteria.
- SPN Fe203 was also tested for agglutination, and no cell agglutination occurs at any concentration studied for SPN Fe203 .
- the long-term stability of HVHP428SPN Fe2 ° 3 is impressive; the MAC values do not decrease even following a year of storage in a pH 6 MES buffer at 4°C.
- Example 6 Transmission Electron Microscopy experiments
- the binding (or lack of interaction) of both HVHP428SPN Fe203 and SPN Fe203 to S. aureus cells could also be qualitatively assessed by means of transmission electron microscopy (TEM) analysis.
- TEM transmission electron microscopy
- we found that the most effective TEM images of the HVHP428SPN Fe2 ° 3 or SPN Fe203 interacting with the variety of bacteria could be obtained by extracting ⁇ 1 ⁇ L of the solution in the microagglutination plates described above. That is, where the nanoparticles agglutinate effectively, 1 ⁇ L of the solution was extracted and expelled directly onto the TEM grid, dried and analysed via TEM.
- the TEM images of the nanoparticle-cell conjugates were acquired using a Philips CM20 FEG microscope operating at 200 keV.
- Example 8 Antibody Specificity
- IgG whole antibody
- S. aureus S. aureus was mediated through the Fc-protein A pseudoimmmune reaction ( Figure 1) (Ho et al, 2004). It was reported that these whole antibodies showed cross-reactivity with several other bacteria species, including Staphylococcus saprophyticus and Streptococcus pyogenes (group A Streptococcus) (Ho et al, 2004). Such constructs also cross-react with group C and G Streptococci through interaction with bacterial protein G (Tashiro et al, 1995). The microagglutination and TEM experiments were extended to S.
- HVHP428SPN Fe2 ° 3 and SPN Fe203 were first blocked with 0.1% (v/v) Tween 20 in MES buffer overnight at 4°C.
- One hundred microliters of the blocked nanoparticles (10 13 particles/mL) were mixed with 1 ⁇ L of cells in MES buffer. The mixture was incubated at room temperature for 2 h with gentle rocking followed by a 1 h-long capture on a magnet. Keeping the sample on the magnet stand, the supernatant was removed and plated on BHI media at various dilutions to determine the number of non-captured cells.
- the nanoparticles were separated from the magnet, resuspended in 100 ⁇ L of MES buffer and used to determine the number of captured cells. Capture efficiency was calculated as follows:
- Capture efficiency (no. of captured cells/ [no. of captured cells + no. of non- ccaaopttuurreedd cceellllss]l)) xx 110000
- Capture specificity no. of S. aureus in the captured fraction/no, of S. typhimurium in the captured fraction
- capture specificity was determined by direct comparison of the number of captured S. aureus versus the number of captured S. typhimurium in the mixed cell captured fraction.
- the wash step comprised of (i) resuspending the nanoparticles in 100 ⁇ L MES buffer/1% Tween 20, (ii) capturing the nanoparticles for 30 min, (iii) removing the wash solution, which was subsequently titrated. Control experiments in which cells (S. aureus alone, S. typhimurium alone or a mixture of both cells) were incubated with the MES buffer had the same total titer as the nanoparticle- treated cells.
- HVHP428SPN Fe203 against S. aureus cells (10 4 cells) was performed.
- Nonspecific capture could be completely suppressed by coating nanoparticles overnight with 0.1% Tween 20 and performing the binding in the presence of 1% Tween 20.
- the HVHP428SPN Fe2 ° 3 capture efficiency is over 90%, with as few as 180 cells.
- the capture is specific as evidenced by the poor S. aureus capture efficiency exhibited by SPN Fe2 ° 3 (-5%).
- specificity capture studies involving competition assays containing both S. aureus and S. typhimurium cells were performed. Mixtures of both bacteria were incubated with nanoparticles for binding/labeling and the captured cells were enumerated by applying bacterial samples onto selective plates (BP for S. aureus, XLD for S. typhimurium). The ratio of the S. aureus to S.
- HVHP428SPN Fe2 ° 3 discriminately captures S. aureus over S. typhimurium with a ratio of 13:1.
- the number of S. typhimurium cells captured by HVHP428SPN Fe203 is at the background level and is essentially the same as the numbers captured by SPN Fe2 ° 3 in the case of both bacteria ( Figure 6C, inset).
- the selectivity could be further improved simply by including a wash step immediately following the binding step.
- the capture efficiency was as high as 98% for HVHP428SPN Fe203 versus only 0.8% for the SPN Fe203 .
- the total number of S. aureus cells was 338 in the HVHP428SPN Fe2 ° 3 mixture and 278 in the SpN Fe2 ⁇ 3 mi ⁇ ture ) without the wash step HVHP428SPN Fe203 capture efficiency would have remained at exactly the same level, but that of SPN Fe203 would have been as high as over 9% (see Figure 7 legend). This demonstrates that there is very little nonspecific absorption contributing to the interaction between HVHP428SPN Fe203 and the S. aureus cells.
- Example 10 Capture / scanning electron microscopy (SEM) experiments We confirmed the specificity of HVHP428SPN Fe2 ° 3 through capture/SEM experiments with S. saprophyticus, S. pyogenes, and S. pneumoniae (a protein G-containing Streptococcus species of bacteria).
- Cell were grown as described in Example 1 , centrifuged in a benchtop centrifuge (800 g, 5 min), resuspended in V- ⁇ MES buffer and pelleted again. Cells were resuspended in 10 2 HVHP428SPN Fe2 ° 3 in MES buffer/0.1% Tween 20 (v/v) and incubated for binding for 30 min.
- the solutions were magnetically confined for 3 min and the supernatant removed - leaving the last 20 ⁇ L behind to ensure the confined materials are not disturbed and lost.
- the captured materials were resuspended in 200 ⁇ L MES buffer. This step was repeated but the captured materials were resuspended in 200 ⁇ L sterile double-distilled H 2 O (ddH 2 O).
- the magnetic confinement was performed once more and the captured materials were resuspended in 50 ⁇ L ddH 2 O.
- One microliter suspensions were used for SEM imaging. SEM was performed on cells plated on Si substrate with a Hitachi S-4700 field-emission scanning electron microscope. Samples were imaged with an acceleration voltage of 3 KV and at a working distance of 6 mm. Identical experiments were carried out with SPN Fe2 ° 3 .
- both HVHP428SPN Fe203 and SPN Fe203 hardly gave any captured cells and by the end of the two washes (cycles of resuspension and confinement) there was no visible pack of confined cells. Only in the case of S. saprophyticus, some capture was observed, albeit with a significant amount of cells still in the supernatant fraction. However, the capture was the same for both HVHP428SPN Fe203 and SPN Fe203 , indicating some non-specific interactions between SPN Fe203 and S. saprophyticus. An aliquot of the confined materials following the last wash was used for SEM imaging.
- Figure 10 summarizes results of the capture studies in a series of SEM images.
- the top panels of Figure 10 depict the interaction of cells with HVHP428SPN Fe2 ° 3 (labeled 1- SPN) while bottom panels are the control experiments performed with SPN Fe2 ° 3 (labeled SPN).
- S. aureus interaction with HVHP428SPN Fe2 ° 3 capture study SEM images showed each of the captured cells (dark sphere, ⁇ 1 ⁇ m) were flanked with HVHP428SPN Fe2 ° 3 with most cells partially covered by the NP aggregates, which indicated positive binding response between cells and HVHP428SPN Fe2 ° 3 .
- the control experiment S. aureus vs.
- Such non-specific interaction may be further reduced by passivating the nanoparticles surfaces with agents that suppress non-specific interactions such as serum albumins.
- agents that suppress non-specific interactions such as serum albumins.
- the interaction between HVHP428SPN Fe203 and S. saprophyticus may be distinguished from the interaction between HVHP428SPN Fe2 ° 3 and S. aureus in a real detection situation simply by looking at all of these interactions together.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Nanotechnology (AREA)
- Urology & Nephrology (AREA)
- Organic Chemistry (AREA)
- Hematology (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Inorganic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Food Science & Technology (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Cell Biology (AREA)
- Epidemiology (AREA)
- Microbiology (AREA)
- Ceramic Engineering (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- General Engineering & Computer Science (AREA)
- Medical Informatics (AREA)
- Crystallography & Structural Chemistry (AREA)
- Peptides Or Proteins (AREA)
Abstract
A conjugate comprising a superparamagnetic nanoparticle (SPN) coupled to at least one single-domain antibody (sd Ab) specific to a pathogen or cell of interest. The SPN may comprise an iron oxide core and a silica shell and may be labelled with SERS-active Raman reporter molecule, or a detectable label.
Description
SINGLE DOMAIN ANTIBODY - TARGETED NANOPARTICLE ARCHITECTURES FOR
INCREASED PATHOGEN DETECTION
SPECIFICITY AND SENSITIVITY
Field of the Invention
The present invention relates to targeted nanoparticle architectures for use in detecting pathogens with high specificity and sensitivity. More specifically, the present invention relates to a pathogen-detecting targeted superparamagnetic nanoparticle (SPN).
Background of the Invention
Antibodies are highly target-specific. Nanoparticles possess diverse, material-dependent properties that can be exploited in order to label and identify a biomolecule. In combination, antibody-nanoparticle conjugates (nanoconjugates) should be conducive to detection formats characterized by high target specificity, sensitivity and fast detection/identification output. There are examples where such nanoconjugates have been employed in the labeling and detection of cancer cells (Medley et al, 2008) and biomarkers for debilitating diseases such as Alzheimer's (Lin et al, 2006; Georganopoulou et al, 2005).
Nanoconjugates would be of great benefit in the field of bacterial pathogen detection (Gu et al, 2006; Kalele et al, 2006; Ho et al, 2004; Su et al, 2004; Tu et al, 2003; Tu et al, 2002). Some prime examples for detection are those that are biological threat agents or food pathogens such as Bacillus anthracis, Francisella tularensis, Escherichia coli O157:H7, Salmonella typhimurium Campylobacter jejuni, Lysteria monocytogenes, and Staphylococcus aureus. Effective and timely preventive measures against such bacteria require that they be detected in trace amounts, thus calling for a detection system which is highly specific, sensitive and fast.
Use of antibody nanoconjugates can lead to the effective isolation of a number of pathogen species, there is generally an inherent cross reactivity to traditional IgG
antibodies. This can be somewhat problematic when a single species of bacteria is to be isolated. This was demonstrated by Ho and coworkers where an IgG antibody was shown to interact with at least 3 different species of bacteria (Ho et al, 2004).
Therefore, there remains a need in the art for a substrate and method that mitigate these limitations of the prior art.
Summary of the Invention
The present invention relates to targeted nanoparticle architectures for use in detecting pathogens with high specificity and sensitivity. More specifically, the present invention relates to a pathogen-detecting targeted superparamagnetic nanoparticle (SPN). The applicant has determined that the superparamagnetic nanoconjugates described herein are an attractive option as pathogen detection constructs. By virtue of their magnetic property they can magnetically confine/preconcentrate cell samples, leading to increase in detection sensitivity. With a dye doped version employed, the detection sensitivity may be increased further through signal amplification (i.e., every binding event would lead to the "deposition" of thousands of detecting dyes (signals) on the surface of cells) (Zhao et al, 2004).
In one embodiment, the basis of pathogen recognition is an antibody-antigen immune or pseudoimmune reaction (Ho et al., 2004). In one embodiment, the targeting moiety is a single domain antibody (sdAb).
The present invention provides a conjugate comprising a superparamagnetic core comprising iron oxide nanoparticles, coupled to at least one single-domain antibody (sdAb) specific to a pathogen or cell of interest. The sdAb may be specific to protein A on the surface of Staphylococcus aureus, in particular the methicillin-resistant varieties (MRSA) and may be used for their detection. In one embodiment, the sdAb may comprise the sequence:
QLQLQESGGGLVQPGGSLRLSCAASGFTFSSYAMSWFRQAPGKGLEWVG FIRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLRAEDTAMYYCA RRAKDGYNSPEDYWGQGTLVTVSS [SEQ ID. NO. 1] or a substantially identical sequence thereto. In another embodiment, the sdAb may be sdAb HVHP428.
In another aspect, the present invention comprises a method of detecting a pathogen of interest in a mixed culture or sample, by binding the pathogen with a conjugate described herein, magnetically concentrating the pathogens bound with the conjugate, and detecting the pathogens bound with the conjugate. The conjugate may further comprise a Surface- enhanced Raman scattering (SERS)-active Raman reporter molecule. In addition, or alternatively, the SPNs may further comprise a detectable label, such as a fluorescent dye.
In another aspect, the invention provides the use of conjugates as described herein to separate and purify a target of interest in a mixture or a sample. The target of interest may be cells such as mammalian cells, to be separated from a mixture containing several different types of cells.
Brief Description of the Drawings
In the drawings, like elements are assigned like reference numerals. The drawings are not necessarily to scale, with the emphasis instead placed upon the principles of the present invention. Additionally, the embodiments depicted are but few of a number of possible arrangements utilizing the fundamental concepts of the present invention. The drawings are briefly described as follows:
Figure 1 shows different antibody formats. An antibody, for example an IgG, consists of two identical heavy chains (hatched and grey) and two identical light chains (black and white). Antibody domains are shown as ovals. The Fc region of the IgG, which consists of four domains, interacts with S. aureus protein A as well as protein G and protein M present on the surface of other bacteria (Ho et al, 2004; Tashiro et al, 1995; Burova et al,
1999); this is known as the pseudoimmune reaction. The Fv region (white and grey) of the IgG binds the antigen through hypervariable loops/complementarity-determining regions (immune reaction). A scFv (a light chain binding domain plus a heavy chain binding domain covalently joined by a linker) maintains the antigen binding activity of the parent antibody. In many scFvs, the two binding domains can dissociate then re- associate intermolecularly; on the surface of nanoparticles, this would lead to agglutination. VH, which is over 10-fold smaller than an IgG, also has the ability to bind to antigen; some also have the ability to binds to protein A (pseudoimmune reaction). The smaller VHS display a lower number of reactive sites and as a result, unlike larger IgG or scFv, lead to insignificant nanoparticle agglutination during conjugation.
Figure 2 is a schematic showing the HVHP428P pentamer versus the HVHP428SPNFe203 superparamagnetic nanoconjugate. Pentameric VHS are generated recombinantly in vivo, e.g., in E. coli, by the spontaneous assembly of five identical monomelic units. The assembly is mediated by the specific interaction of the pentamerization domains which are covalently fused to the VHs at the gene level. In the case of the present nanoconjugates, multivalency is achieved by chemical linking, via amide linkages, of several VHS to the same nanoparticle. A magnetic core allows for the magnetic pre- concentration of pathogens and the introduction of a dye-doped silica shell would allow for the fluorescent detection of the pre-concentrated pathogen.
Figure 3 shows results of microagglutination assays for HVHP428P, HVLP335P and HVHP428SPNFe203. A constant concentration of S. aureus cells was used, while the concentrations of pentamers and nanoparticles decrease two-fold from well 1 to well 11 with well 12 having only MES buffer. The concentrations of the pentamers and nanoparticles in wells 1 are 215 μg/mL and 2.5 x 1012 particles/mL, respectively. Figure 3A shows results for HVHP428P and HVLP335P. In Figure 3B, MAC values were 3 x 1013 pentamers/mL and 1.5 x 1011 particles/mL for HVHP428P and HVHP428SPNFe2°3, respectively.
Figure 4 shows results of flow cytometry analysis of HVHP428SPNFe . Nanoparticles were incubated with 0, 0.05, 0.1, 0.2, 0.5 and 1 μg of fluorescently active protein A (protein A R-PE) and assessed directly for binding by flow cytometry. (Figure 4A) Binding, indicated as the rightward fluorescence shifts of nanoparticle populations, can be seen with the increase in protein A R-PE concentration. (Figure 4B) Binding is shown as the mean fluorescence, extracted from data in (Figure 4A), versus protein A R-PE concentration. Circles, HVHP428SPNFe203; triangles, SPNFe203.
Figure 5 shows results of TEM experiments for HVHP428SPNFe203. Representative TEM images of the nanoparticle-bacteria conjugates where there is a strong interaction between HVHP428SPNFe203 and S. aureus cells (Figure 5A) in contrast to the inefficient labeling of S. typhimurium by the same nanoparticles (Figure 5B). Control TEM images were also acquired confirming that SPNFe203 does not interact effectively with S. aureus cells in the absence of HVHP428 (Figure 5C), suggesting that the sdAb mediates the specific interaction between the nanoparticles and the S. aureus cells.
Figure 6 illustrates the cell capture capability of the HVHP428SPNFe203 nanoconjugate. Figure 6A is a scheme representing the steps involved in capture studies. Cells were incubated with HVHP428SPNFe2°3 for binding. Following binding and magnetic capture of nanoparticles, the supernatant is separated from the captured nanoparticles and titrated to determine the number of non-captured cells. The captured nanoparticles were titrated for determining the number of captured cells. Unconjugated nanoparticle, SPNFe203 was used as control. Capture efficiency and specificity were calculated as described in Examples. Figure 6B shows the capture efficiency of HVHP428SPNFe2°3 nanoconjugate towards S. aureus. The data are an average of 5 trials. The number of cells subjected to capture studies ranged from 180 - 4000. Figure 6C shows the capture specificity of HVHP428SPNFe2°3 in terms of the ratio of the number of S. aureus to S. typhimurium in the captured fraction. A mixture of both bacteria was used for capture studies and selective media were used to enumerate each of the two bacteria in the captured and non- captured fractions. S. aureus and S. typhimurium data were normalized for the total number of cells. The total number of cells in the HVHP428SPNFe203 mixtures was 1170
S. aureus and 525 S. typhimurium cells in one trial and 2780 S. aureus and 2420 S. typhimurium in the second trial. The inset shows the number of cells (average of the two trials) captured with HVHP428SPNFe2°3 (white bars) and SPNFe2°3 (black bars).
Figure 7 shows the cell capture efficiency and specificity of HVHP428SPNFe2°3 nanoconjugate when a single wash step is included after the binding step. Figure 7A is a bar graph showing the total number of S. aureus cells was 338 in the HVHP428SPNFe203 mixture and 278 in the SPNFe2°3 mixture. The wash step removed 6 S. aureus from the HVHP428SPNFe203 mixture and 24 from the SPNFe203 mixture. Figure 7B shows the capture specificity by comparing the number of S. aureus versus S. typhimurium in the mixed capture fraction. The total number of cells in the HVHP428SPNFe203 mixture was 80 S. aureus and 56 S. typhimurium. The wash step removed 2 S. aureus and 4 S. typhimurium.
Figure 8 shows surface plasmon resonance assessment of the binding activity of VH and ers. Sensorgram overlays showing the binding of HVHP428 p
VL pentam to immobilized protein A at 1, 2, 3, 4, 6, 8 and 10 nM concentrations (Figure 8A) and of HVLP335P to immobilized protein L at 1, 2, 2.5, 3, 3.5, 4 and 4.5 nM concentrations (Figure 8B). Association and dissociation rate constants, ka and ka, respectively, and equilibrium constants, KA, for the binding of HVHP428P and HVLP335P to proteins A and L, respectively, are shown on the graphs. kas were independently calculated from plots of kobs versus concentration. More than one kd could be calculated due to the heterogeneity in multivalent binding amongst the pentamer population. Therefore, more than one KA, could be obtained. HVHP428P and HVLP335P had minimum KAs of 5 x 108 M"1 and 5 x 109 M"1 , respectively. With slower kds, HVHP428P and HVLP335P had KAs as high as 1.1 x 109 M"1 and 1.1 x 1010 M"1, respectively. Thus, HVHP428P pentamer shows increased apparent affinity towards protein A by at least 1000-fold compared to the monomeric version, HVHP428. RU, resonance units.
Figure 9 shows results of microagglutination assays and TEM experiments assessing the cross-reactivity of HVHP428SPNFe2 3 towards S. saprophyticus, S. pneumoniae and S.
pyogenes. The concentrations of HVHP428SPNFe203 (odd rows) and HVHP428SPNFe203 (even rows) decrease two-fold from well 1 to well 3 with well 4 having only MES buffer. S. pyogenes did not lend itself to the microagglutination assay and therefore its cross reactivity status was assessed by TEM experiments (left panel images). TEM images show lack of interactions between both HVHP428SPNFe203 and SPNFe2°3 and S. pyogenes cells in contrast to the efficient labeling of S. aureus by HVHP428SPNFe2°3 (Figure 5A). Though there are nanoparticles present in the TEM image of the S. pyogenes bacteria, the nanoparticles are clearly not interacting with the surface of these cells to the extent that they do with S. aureus.
Figure 10 shows results of SEM experiments to assess the cross reactivity of HVHP428SPNFe2°3 towards S. saprophyticus, S. pneumoniae and S. pyogenes. Cells and nanoparticles are shown by black and white arrows, respectively. The scale bar corresponds to 1 μm. 1-SPN = HVHP428SPNFe2°3; SPN = SPNFe2°3.
Figure 11 shows the UV- visible absorption spectra of HVHP428SPNFe203. (a) HVHP428SPNFe203; (b) one-day-old HVHP428SPNFe2°3 reacted with tetramethylrhodamine isothiocyanate (TRITC); (c) and one year-old HVHP428SPNFe203 reacted with TRITC; (d) magnetically confined one-day-old HVHP428SPNFe203 reacted with TRITC; (e) magnetically confined one year-old HVHP428SPNFe203 reacted with TRITC; (f) corrected absorption spectra for one-day-old HVHP428SPNFe203 reacted with TRITC (i.e., b - a); and (g) (f) corrected absorption spectra for one-year-old HVHP428SPNFe2°3 reacted with TRITC (i.e., c - a). Note that when the nanoparticle absorption is subtracted, there is a clear absorption consistent with tetramethylrhodamine (TMR) (inset). Upon magnetic confinement, the absorption intensity of both the nanoparticle and TMR have decreased (bottom two spectra) suggesting that the TMR is covalently linked to the HVHP428SPNFe203 in both cases.
Figure 12 shows the calibration curve for TRITC in MES buffer used to determine the average number of sdAb on each nanoparticle. The calculations are based on the UV- visible absorption data shown in Figure 11.
Detailed Description of Preferred Embodiments
The present invention relates to targeted nanoparticle architectures for use in detecting pathogens with high specificity and sensitivity. More specifically, the invention relates to a pathogen-detecting targeted superparamagnetic nanoparticle (SPN).
When describing the present invention, all terms not defined herein have their common art-recognized meanings. To the extent that the following description is of a specific embodiment or a particular use of the invention, it is intended to be illustrative only, and not limiting of the claimed invention. The following description is intended to cover all alternatives, modifications and equivalents that are included in the spirit and scope of the invention, as defined in the appended claims.
The present invention provides a conjugate comprising a superparamagnetic core comprising, in one embodiment, iron oxide nanoparticles, coupled to at least one sdAb specific to a pathogen of interest. The sdAb may be specific to protein A on the surface of Staphylococcus aureus, in particular the methicillin-resistant varieties (MRSA) and may be used for their detection.
As used herein, the term "nanoparticle" means a particle having at least one dimension which is less than about 200 nm.
By the term "superparamagnetic nanoparticles" (SPN) or "superparamagnetic core", it is meant nanoparticles that exhibit a behavior similar to paramagnetism at temperatures below the Curie or the Neel temperature. This is a small length-scale phenomenon, where the energy required to change the direction of the magnetic moment of the particle is comparable to the ambient thermal energy. Normally, coupling forces in ferromagnetic materials cause the magnetic moments of neighboring atoms to align, resulting in very large internal magnetic fields. This is what distinguishes ferromagnetic materials from paramagnetic materials. At temperatures above the Curie temperature (or the Neel temperature for antiferromagnetic materials), the thermal energy is sufficient to overcome
the coupling forces, causing the atomic magnetic moments to fluctuate randomly. Because there is no longer any magnetic order, the internal magnetic field no longer exists and the material exhibits paramagnetic behavior. If the material is non- homogeneous, one can observe a mixture of ferromagnetic and paramagnetic clusters of atoms at the same temperature, the superparamagnetic stage. Superparamagnetic nanoparticles are described in CM. Sorensen (2001), the contents of which are incorporated herein by reference, where permitted.
The SPN may comprise any suitable superparamagnetic nanomaterial; for example, and without wishing to be limiting in any manner, the superparamagnetic material may be
Fe2O3, Fe3O4, FePt, or nanoparticle clusters containing any and all combinations of these nanoparticles. In a specific, non-limiting example, the SPN are comprised of Fe2O3 nanoparticles. The formation of superparamagnetic nanoparticles is well known by those skilled in the art, and need not be further described herein (see for example Hyeon, 2003, which is incorporated herein by reference where permitted).
The size of the SPN may vary based on the type of material comprising the nanoparticles. As would be understood by a person of skill in the art, depending on the material of which the nanoparticles are comprised, the range of the nanoparticle size may vary. For example, and without wishing to be limiting in any manner, the Fe2O3 SPN may have a diameter of about 5 to 20 nm; for example, the diameter of the nanoparticle may be about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17 18, 19 or 20 nm. In a specific, non-limiting example, the diameter of the SPN core may be about 10 nm.
In one embodiment, the SPN may also be encapsulated in a silica shell or coating. Without wishing to be bound by theory, the silica shell may enable attachment of biomolecules and may reduce toxicity. Thus, the SPN may comprise a core + shell architecture familiar to the skilled artisan. Methods for preparing the silica shell are also well-known to those of skill in the art (see for example, Lu et al, 2002; KeIl et al, 2008). For example, and without wishing to be limiting in any manner, the thickness of the silica coating may be applied in a controlled manner over the SPN core. The thickness of the
silica coating, once complete, may be about 1 nm and 20 nm, or any value there between; for example, the silica coating may be about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 nm thick. As would be understood by one of skill in the art, as the thickness of the silica shell is increased, the magnetic confinement time for the bacteria will require longer times (KeIl et al, 2008). In a specific, non-limiting example, the thickness of the silica coating may be about 15 nm.
The conjugate of the present invention comprises SPNs conjugated to one or more than one single-domain antibody (sdAb). By the term "single-domain antibody", it is meant an antibody fragment comprising a single protein domain. Single domain antibodies may comprise any variable fragment, including VL, VH, VHH, VNAR, and may be naturally- occurring or produced by recombinant technologies. For example VHS, VLS, VHHS, VNARS, may be generated by techniques well known in the art (Holt, et al., 2003; Jespers, et al., 2004a; Jespers, et al., 2004b ; Tanha, et al., 2001 ; Tanha, et al., 2002; Tanha, et al., 2006 ; Revets, et al., 2005 ; Holliger, et al., 2005 ; Harmsen, et al., 2007 ; Liu, et al., 2007 ; Dooley, et al., 2003 ; Nuttall, et al., 2001 ; Nuttall, et al., 2000 ; Hoogenboom, 2005; Arbabi-Ghahroudi et al., 2008). In the recombinant DNA technology approach, libraries of sdAbs may be constructed in a variety of ways, "displayed" in a variety of formats such as phage display, yeast display, ribosome display, and subjected to selection to isolate binders to the targets of interest (panning). Examples of libraries include immune libraries derived from llama, shark or human immunized with the target antigen; non- immune/naϊve libraries derived from non-immunized llama, shark or human; or synthetic or semi-synthetic libraries such as VH, VL, VHH or VNAR libraries.
In one embodiment, the sdAb may comprise a heavy variable domain (VH) denoted as HVHP428. HVHP428 belongs to a small subset of VHs that can interact with protein A on S. aureus cell surfaces and has binding specificity towards S. aureus protein A (KA = 5.6 x 105 M"1) (To et al, 2005). The sdAb in the conjugate of the present invention may comprise the amino acid sequence:
OLOLQESGGGLVOPGGSLRLSCAASGFTFSSYAMSWFRQAPGKGLEWVG FIRSKAYGGTTEY AASVKGRFTISRDDSKSIAYLQMNSLRAEDTAMYYCA RRAKDGYNSPEDYWGOGTLVTVSS (SEQ ID NO: 1),
or a sequence substantially identical thereto. The hypervariable loops/complementarity- determining regions (CDRs) are underlined.
A sequence which is substantially identical to another sequence may comprise one or more conservative amino acid mutations. It is known in the art that one or more conservative amino acid mutations to a reference sequence may yield a mutant polypeptide with no substantial change in physiological, chemical, or functional properties compared to the reference sequence; in such a case, the reference and mutant sequences would be considered "substantially identical" polypeptides. Conservative amino acid mutation may include addition, deletion, or substitution of an amino acid; a conservative amino acid substitution is defined herein as the substitution of an amino acid residue for another amino acid residue with similar chemical properties (e.g. size, charge, or polarity).
In a non-limiting example, a conservative mutation may be an amino acid substitution. Such a conservative amino acid substitution may substitute a basic, neutral, hydrophobic, or acidic amino acid for another of the same group. By the term "basic amino acid" it is meant hydrophilic amino acids having a side chain pK value of greater than 7, which are typically positively charged at physiological pH. Basic amino acids include histidine (His or H), arginine (Arg or R), and lysine (Lys or K). By the term "neutral amino acid" (also "polar amino acid"), it is meant hydrophilic amino acids having a side chain that is uncharged at physiological pH, but which has at least one bond in which the pair of electrons shared in common by two atoms is held more closely by one of the atoms. Polar amino acids include serine (Ser or S), threonine (Thr or T), cysteine (Cys or C), tyrosine (Tyr or Y), asparagine (Asn or N), and glutamine (GIn or Q). The term "hydrophobic amino acid" (also "non-polar amino acid") is meant to include amino acids exhibiting a hydrophobicity of greater than zero according to the normalized consensus
hydrophobicity scale of Eisenberg (1984). Hydrophobic amino acids include proline (Pro or P), isoleucine (He or I), phenylalanine (Phe or F), valine (VaI or V), leucine (Leu or L), tryptophan (Trp or W), methionine (Met or M), alanine (Ala or A), and glycine (GIy or G). "Acidic amino acid" refers to hydrophilic amino acids having a side chain pK value of less than 7, which are typically negatively charged at physiological pH. Acidic amino acids include glutamate (GIu or E), and aspartate (Asp or D).
Sequence identity is used to evaluate the similarity of two sequences; it is determined by calculating the percent of residues that are the same when the two sequences are aligned for maximum correspondence between residue positions. Any known method may be used to calculate sequence identity; for example, computer software is available to calculate sequence identity. Without wishing to be limiting, sequence identity can be calculated by software such as NCBI BLAST2 service maintained by the Swiss Institute of Bioinformatics (and as found at http://ca.expasy.org/tools/blast/), BLAST-P, Blast-N, or FASTA-N, or any other appropriate software that is known in the art.
The substantially identical sequences of the present invention may be at least 75% identical; in another example, the substantially identical sequences may be at least 70, 75, 80, 85, 90, 95, or 100% identical at the amino acid level to sequences described herein. Importantly, the substantially identical sequences retain the activity and specificity of the reference sequence.
The sdAb is conjugated (also referred to herein as "linked" or "coupled") to the SPN.
Conjugation of sdAbs to the SPN may be accomplished using methods well known in the art (see for example Hermanson, 1996). Single domain antibodies have several exposed lysine (primary amine) residues, and thus one method of covalently anchoring the sdAb to the carboxylic acid-modified nanoparticle surface is through bioconjugation chemistry.
Suitable coupling reagents include l-ethyl-3-(3-dimethylaminopropyl) carbodiimide hydrochloride (EDC) which is often used in combination with N-hydroxysuccinimide (NHS). For example, the sdAb as described above may have, or may be engineered to have, one or more lysine residues opposite or away from its antigen binding site, which is
used in covalent conjugation to the nanoparticle surface. In one embodiment, the number of single domain antibodies conjugated to the surface of the nanoparticle is controllable and controlled.
Alternatively, the sdAb may be conjugated to the nanoparticle surface through an amino acid with a carboxylic acid (i.e., GIu or Asp) on the sdAb and primary amines on the nanoparticle, or through binding of the sdAb (detecting entity) to a molecule, e.g., a protein already attached to the nanoparticle and has binding activity towards the sdAb. For example, this could be an antibody which binds to the sdAb or to tags (C-Myc tag, His6 tag) on the sdAb such as anti-C-Myc or anti-Hisό antibodies, or through binding of the biotinylated sdAb to a biotin binder on the surface of nanoparticles, e.g., streptavidin, neutravidin, avidin, extravidin. The sdAb could also be coupled to the nanoparticle by means of nickel -nitrilotriacetic acid chelation to a His6-tag.
In another alternative, single-domain antibodies can also be engineered to have cysteines opposite their antigen binding sites. Conjugation via a maleimide cross-linking reaction allows the directional display of single domain antibodies where all single domain antibodies are optimally positioned to bind to their antigens. Amine-terminated nanoparticle is activated with maleimide in DMF followed by an incubation of cysteine- terminated single domain antibody to achieve covalent binding through the formation of sulfide bond formation.
The number of sdAb molecules conjugated to the surface of the SPN may vary, based on various factors, such as the size of the nanoparticle. In one embodiment, the conjugate of the present invention may comprise at least 1 to 15 sdAb molecules conjugated to the surface of the SPN; for example, the conjugate may carry at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 sdAb moieties linked to the SPN. In a specific, non-limiting embodiment, the conjugate may comprise about 4 to about 12 sdAb molecules. As a person of skill in the art would recognize, it may be possible to conjugate more sdAb molecules to the surface of the nanoparticle, depending on particle size, sdAb size and
characteristics, and on immobilization efficiency. It is to be noted that each of the sdAb molecules linked to the nanoparticle may be the same, or may differ from one another.
The sdAb in the conjugate of the present invention may be specific to a pathogen of interest. As used herein, the term "pathogen" means any human pathogen or those of animals or plants, including bacteria, eubacteria, archaebacteria, eukaryotic microorganisms (e.g., protozoa, fungi, yeasts, and molds), viruses, and biological toxins (e.g., bacterial or fungal toxins or plant lectins).
In one non-limiting example, the sdAb may be specific to protein A on the surface of Staphylococcus aureus, in particular the methicillin-resistant varieties (MRSA). S. aureus is a common human pathogen (Lowy et al, 1998). On its surface, it has covalently linked protein A (Sjoquist et al, 1972), which is (i) highly characteristic of S. aureus species, (ii) present in high abundance and (iii) capable of binding to various classes of antibodies, e.g, IgGs, through interaction with antibody Fc regions (Sjoquist et al, 1972; Cheung et al, 1997; Tashiro et al, 1995; Forsgren, 1970; Huang, 2006). These characteristics make protein A an attractive marker for S. aureus detection (Ho et al, 2004; Huang, 2006; Fukuda et al, 2000; Mongodin et al, 2000; Chang et al, 1996). Previously, S. aureus detection by a pseudoimmune reaction has been based on the interaction between the Fc region of whole antibodies and protein A (Ho et al, 2004; Mongodin et al, 2000).
However, the present invention does not involve the antibody Fc region. Rather, a single- domain antibody (sdAb) is employed as the recognition component of the nanoconjugate (Figure 1). Single-domain antibodies (sdAbs) are antibody fragments that possess one binding site compared to two for typical antibodies and are over 10-fold smaller in size (~15 kDa) (Holliger & Hudson, 2005). Though sdAbs of different types with desired specificity similar to traditional antibodies are easily obtainable by recombinant approaches (Holliger & Hudson, 2005), sdAbs have several properties which make them preferable over more popular antibody formats such as IgGs or scFvs (Figure 1) as the recognition component of nanoconjugate. First, they are highly stable against proteases and chemical denaturants; under nonphysiological conditions they regain their activity
following removal from denaturing conditions (Tay et al, 2007; Arbabi-Ghahroudi et al, 2005). This allows for flexibility in terms of choosing optimal conjugation chemistry conditions (Tay et al, 2007), leads to a more active end product and translates into more efficacious detection as nanoconjugates come into contact with bacterial samples which may be destabilizing and/or contain proteases. Second, sdAbs can be conjugated on the surface of nanoparticles with a much higher binding site density (> 5 fold compared to IgGs and 2-fold compared to scFvs) and do not promote nanoparticle aggregation expected with scFvs and IgGs (Figure 1), resulting in much more active nanoconjugates. Third, sdAbs can be easily engineered to contain amino acid residues for conjugation in an active orientation or for performing a variety of conjugation chemistries (Shen et al, 2008; Shen et al, 2005).
The superparamagnetic nanoparticles described herein may also comprise a detectable label, such as a fluorescent dye or quantum dot, which in addition to target preconcentration would provide detection signals. The conjugates of the present invention may also comprise one or more than one SERS-active Raman reporter molecule (Tay et al, 2007). For example, suitable labels may include, but are not limited to Rhodamine 6G, 4-nitrobenzenethiol, 2-methoxybenzenethiol, 3- methoxybenzenethiol, 4-methoxybenzenethiol, and 2-naphthalenethiol.
It is presently shown that HVHP428 VH-conjugated SPNs (HVHP428SPNFe203), a conjugate in accordance with the present invention, displays unprecedented superior properties. The nanoconjugates of the present invention are highly stable, active and specific detecting agents, capable of capturing a few tens of pathogenic bacteria in a mixed cell population with very high specificity and efficiency. The use of sdAb eliminated the cross-reactivity "side effect" observed previously with a nanoconjugate that was based on the same type of recognition interaction but utilized whole antibody as its recognition moiety (Ho et al, 2004). Without wishing to be bound by theory, these nanoconjugates are believed to provide excellent performance as a result of a combination of multivalency and the unique properties of its sdAb component.
The sdAb-SPN conjugates of the present invention may be used to detect a pathogen of interest in a mixed culture or sample, by binding the pathogen with the sdAb-SPN conjugate described herein, magnetically concentrating the sdAb-SPN conjugate bound to the pathogen, and detecting the sdAb-SPN conjugate bound to the pathogen. In one embodiment, the sdAb-SPN further comprises a SERS-active Raman reporter molecule. In another embodiment, the SPNs further comprise a detectable label, such as a fluorescent dye or quantum dot.
As used herein, the term "sample" means a sample that may contain an analyte of interest. A sample may comprise a body fluid or tissue (for example, urine, blood, plasma, serum, saliva, ocular fluid, spinal fluid, gastrointestinal fluid and the like) from humans or animals; plant tissue, environmental sample (for example, municipal and industrial water, sludge, soil, atmospheric air, ambient air, and the like); food; and beverages. By the term "mixed culture", it is meant a mixture of different types of cells, including the target pathogen. The mixed culture may comprise various types of bacterial cells, or a mixture of different cell types.
In another aspect, the invention comprises the use of sdAb-SPN conjugates to detect, separate and purify a target of interest in a mixture or a sample. In one embodiment, the target of interest may be cells such as mammalian cells, to be separated from a mixture containing several different types of cells. These cells, once targeted by the sdAb-SPN conjugates may be magnetically separated and concentrated. For example, cells bearing a specific marker, or diseased cells, may be separated and purified from a mixture comprising non-marker cells, or non-diseased cells.
As will be apparent to those skilled in the art, various modifications, adaptations and variations of the foregoing specific disclosure can be made without departing from the scope of the invention claimed herein.
The following examples are intended to exemplify embodiments of the invention, and not to limit the claimed invention in any manner.
Example 1 - Growth of Cells
Salmonella typhimurium (ATCC19585), Staphylococcus aureus (ATCC12598), Streptococcus pyogenes (ATCC12385) and Staphylococcus saprophyticus (ATCCl 5305) were obtained from American Type Culture Collection (Manassas, VA). Streptococcus pneumoniae 35C was from an in house stock (NRCC 4758). Xylose lysine desoxycholate (XLD), Baird-Parker (BP) agar and chocolate agar plates were purchased from Oxoid (Nepean, ON, Canada). Protein A R-PE conjugate (1 mg/mL) was purchased from Innova Biosciences Ltd. (Babraham, Cambridge, UK).
A single S. aureus colony from a plate of brain heart infusion (BHI) media (EMD Chemicals Inc., Darmstadt, Germany) was used to inoculate 15 mL of BHI media. The bacteria were grown overnight at 37°C and 200 rpm. In the morning, the culture was spun down in a fixed rotor, Sorval RT6000B refrigerated centrifuge at 4,000 rpm for 10 min, the supernatant was removed and the cell pellet was re-suspended in an appropriate buffer. The cells were re-spun, the supernatant was removed and the cell pellet was re-suspended followed by measuring cell density at OD6oo- Serial dilutions of the cells were spread on BHI plates at 37°C for overnight growth. The cell titer was determined in the morning. An OD6Oo of 1.0 corresponded to 1 x 108 cells/mL. S. typhimurium was grown as described for S. aureus but with nutrient broth media (NB, 5 g peptone and 3 g meat extract in 1 L water, pH 7.0) (Sambrook et al,1989). For S. typhimurium, an OD60O of 1 corresponded to 3 x 10 cells/mL. Staphylococcus saprophyticus was prepared as outlined for S. aureus. An OD6oo of 1 corresponded to 1 x 10 cells/mL. Streptococcus pyogenes was streaked onto chocolate agar plates from frozen stock and grown at 37°C overnight. Plate contents were scraped into sterile phosphate-buffered saline (PBS) and adjusted to an OD6oo of 1 which corresponded to 1 x
10 cells/mL. Streptococcus pneumoniae was grown in media (Columbia broth 17.5g, Todd Hewitt broth 15g, 1% glucose in 1 litre, pH 7.0) at 37°C, 5% CO2, without shaking. The cells were spun down as stated for S. aureus. An OD600 of 1 corresponded to 1 x 108 cells/mL. Cells were used in microagglutination assays, transmission electron microscopy (TEM) experiments, scanning electron microscopy (SEM) experiments and capture studies.
Example 2 - Synthesis of the carboxylic acid-modified superparamagnetic nanoparticle SPNFe2°3. and its conjugate derivative HVHP428SPNFe203
SPNFe203 nanoparticles were synthesized by encapsulating an iron-containing particle with a silica matrix through the hydrolysis and polymerization of tetraethoxyorthosilane under basic conditions; this process was described by KeIl & Simard (2007). Briefly, commercially available ferro fluid (0.4 mL water soluble ferrotec EMG403; Ferrotec, Bedford, NH) was diluted to 400 mL with Millipore water. The resulting stock solution was further diluted (12 mL diluted to 45 mL) in Millipore water, and the solution was sonicated for 30 min. Following sonication, the ferro fluid solution was transferred to a 500 mL flask containing 400 mL isopropanol and mechanically stirred. Tetraethoxyorthosilane (0.14 mL) was added to the flask and stirred for ~ 1 min at which time 6 mL of concentrated ammonium hydroxide was added. The nanoparticles were then stirred overnight. This lead to a core-shell nanoparticle architecture, where an iron oxide nanoparticle (-10 nm) was encapsulated in a silica shell with a thickness of -15 nm.
The surface of these nanoparticles was then modified with 3- aminopropyldiethoxymethylsilane (AP-DEMS; provides an amine functional group) and subsequently with succinic anhydride to yield a carboxylic acid functional group. Briefly, six 45 mL samples of the crude nanoparticle solution described above were transferred to 50 mL Falcon tubes, and 1.0 mL of AP-DEMS was added to each tube in order to modify the surface with a functional amine group. The mixture was shaken for 24 h and centrifuged at 5300 g for 20 min in order to precipitate the amine-modified nanoparticles. The contents of all of the tubes were combined and washed with ethanol (15 mL) and dimethylformamide (DMF, 15 mL) through repeated centrifugations. Following purification, the amine-modified nanoparticles were dispersed in a 1% solution of succinic anhydride in DMF and shaken overnight. The resulting carboxylic acid- modified nanoparticles were washed with fresh DMF several times to ensure all succinic anhydride had been removed. The nanoparticles were then dispersed in MES buffer (30 mM MES, 70 mM NaCl, pH 6.0) and centrifuged and re-dispersed in fresh MES buffer. The conversion efficiency for the reaction between the amine and the succinic anhydride was determined by reacting the resulting nanoparticle with fluorescamine (KeIl &
Simard (2007), which did not result in a fluorescence response, suggesting that all of the accessible amine moieties had reacted with the succinic anhydride. The carboxylic acid- modified nanoparticles are hereafter referred to as SPN e
The resulting SPNFe203 were surface modified with HVHP428 by first activating spN Fe2θ3 ^10 mL^ j χ l o i4 nanoparticies) wjtn EDC (5 ing) and NHS (5 mg) to yield the
NHS-ester modified SPNFe2°3. Following purification to remove any unreacted EDC and NHS, the nanoparticles were mixed with HVHP428 (100 μL of a 1.8 mg/mL solution in PBS) and gently vortexed for at least five hours. It is believed that HVHP428 is covalently bound to the nanoparticle surface through primary amines, of which there are 7. Following modification with HVHP428, the resulting HVHP428SPNFe2°3 particles were purified via repeated centrifugation cycles to remove any unbound HVHP428. Finally, the nanoparticles were redispersed in 10 mL of MES buffer (30 mM MES, 70 mM NaCl, pH 6.0).
Example 3 - Characterization of HVHP428SPNFe2°3
The number of HVHP428 VH anchored to the surface of the SPNFe2°3 was elucidated by reaction of the HVHP428SPNFe203 (Example 2) with tetramethylrhodamine isothiocyanate (TRITC). The reaction was carried out in MES buffer with HVHP428SPNFe203 (6 x 1012 nanoparticles) and TRITC (50 μg, 1.2 x 10"7 mol) and the resulting TMR-modified HVHP428SPNFe203 was purified and analyzed by UV-visible spectroscopy in order to elucidate the number of sdAbs on the surface of the nanoparticle. The UV-visible absorption spectra of freshly prepare, day-old HVHP428SPNFe2°3 and one-year-old HVHP428SPNFe203 (6 x 1012 nanoparticles/mL) and the original HVHP428SPNFe2°3 are shown in Figure 11. Analysis of the spectra indicates that TMR has reacted with the sdAb on HVHP428SPNFe2°3, where there is an increase in absorption centered at 550 nm in comparison to the unmodified HVHP428SPNFe203. When the number of TMR molecules was known, the number of sdAb per nanoparticle could be elucidated by assuming that only one of the six amine groups on HVHP428 is responsible for anchoring it to the surface of the nanoparticle. Construction of a
calibration curve for TRITC (Figure 12) in MES-buffered water and the comparison of the absorption intensity for the HVHP428SPN Fe2O3 samples indicate the following:
Table 1. Calculations to determine the average number of sdAb on each nanoparticle
Based on the present calculations, there are 12 and 4 sdAbs per HVHP428SPNFe203 for one-day-old nanoparticles and nanoparticles stored in MES buffer at pH 6 for one year, respectively. The slow loss of HVHP428 over several months is consistent with the slow hydrolysis of silica surface ligands in aqueous solution.
Example 4 - Comparison of HVHP428SPNFe2Q3 to a pentameric version. As the first step towards developing HVHP428SPNFe203, it was decided to construct a homologous benchmark against which the performance of the nanoconjugate could be compared. A multimerization technology was previously developed to convert, by genetic engineering, low affinity monomelic sdAbs to highly sensitive pentameric detecting agents (Zhang et al, 2004b). Thus, a pentameric version of HVHP428, p
HVHP428 , was created (Figure 2) and validated by surface plasmon resonance (i.e., Biacore analysis) (Figure 8).
Standard cloning techniques were used to construct VH and VL pentamers, HVHP428P and HVLP335P, respectively (Zhang et al, 2004) Pentamers were expressed, purified and quantified as described (Zhang et al, 2004; Pace et al, 1995). The binding kinetics for the
interaction of HVHP428P with protein A and HVLP335P with protein L were determined from surface plasmon resonance (SPR) data collected with BIACORE 3000 biosensor system (GE Healthcare, Baie d'Urfe, QC, Canada). For the HVHP428P analysis, 520 resonance units (RUs) of protein A or a Fab reference were immobilized on research grade CM5 sensor chips (GE Healthcare). For the HVLP335P analysis, 680 RUs of protein L or 870 RUs of the Fab reference were immobilized. Immobilizations were carried out at protein concentrations of 25 μg/mL (protein A) or 50 μg/mL (protein L and Fab) in 10 mM sodium acetate buffer pH 4.5, using the amine coupling kit provided by the manufacturer. In all instances, analyses were carried out at 250C in 10 mM HEPES, pH 7.4, containing 150 mM NaCl, 3 mM EDTA and 0.005% P20 at a flow rate of 20 μL/min, and surfaces were regenerated by washing with 50 mM HCl for 3 s. Data were evaluated using BIAevaluation 4.1 software (GE Healthcare). Association rate constants, kas, were independtly calculated from plots of Kobs vs concentration. More than one dissociation rate constant, ka, could be calculated due to the heterogeneity in multivalent binding among the pentamer population. Therefore, more than one affinity (KA) could be obtained (see Figure 8).
The HVHP428 sdAb has an affinity (KA) of 5.6 x 105 M"1 with protein A (To et al, 2005). The apparent KA, determined by SPR experiments, is increased by at least 1000-fold following the generation of the pentameric version HVHP428P (Figure 8). The resulting HVHP428SPNFe203 of Example 2 was also expected to improve the apparent KA between the SPN-bound HVHP428 and protein A. Elucidation of the apparent KA for HVHP428SPNFe203 was done by microagglutination assay (Example 6).
Example 5 - Flow Cytometry
To verify that the interaction between the sdAb-modified nanoparticles and S. aureus is indeed mediated through protein A and the HVHP428SPNFe203 particles, the particles were incubated with fluorophore-conjugated protein A (protein A R-PE) and analyzed in a series of flow cytometry experiments.
Samples of 100 μL HVHP428SPNFe203 or SPNFe2°3 (1012 particles) were blocked in PBS/0.1% (v/v) Tween-20 overnight at 4°C. To these, 1 μL aliquots of various concentrations of fluorescently active protein A (protein A R-PE conjugate) were added and the reaction volumes were increased by adding 200 μL of PBS/0.75% Tween-20. The samples were incubated for 1 h at 4°C and were directly used for flow cytometry analysis with a FACSCanto Analyzer (BD Biosciences, Mississauga, ON, Canada). The R-PE fluorescence of 100,000 events per sample was analyzed and data were generated using BD FACSDiva software (BD Biosciences).
As highlighted in Figure 4, there is a gradual shift in the population of fluorescently active nanoconjugate for HVHP428SPNFe203 as a function of protein A R-PE concentration, whereas the nanoparticle without the HVHP428 VH on its surface (SPNFe2°3) does not show any binding activity (i.e. there is no shift in the fluorescence, suggesting the protein A does not interact with the nanoparticles). This strongly suggests that the HVHP428 interacts effectively with protein A.
Example 6 - Microagglutination Experiments
The ability of HVHP428-SPNFe203 to effectively interact with protein A on the surface of S. aureus was next investigated by means of series of microagglutination experiments. These experiments typically involve incubating HVHP428SPNFe2°3 with S. aureus cells in a microtiter plate.
To test its activity towards S. aureus, a cell microagglutination assay was performed. Cell microagglutinations were performed essentially as described (Saito et al, 1995). Two fold dilutions of pentamers (HVHP428P) or nanoparticles (HVHP428SPNFe203) were performed in MES buffer from wells 1 to 11 of a microtiter plate. Well 12 had only buffer, and the total volume in each well was 50 μL. Subsequently, 1 OD60O unit of cells (see Growth of cells) in 50 μL buffer was added to all wells and the plate was incubated overnight at 4°C. In the morning, photos of the plates were taken for further analysis. Minimum agglutination concentration (MAC), the minimum concentration of
nanoparticles or pentamers that promoted bacterial agglutination, was used to express the agglutination activity of nanoparticles and pentamers.
If functional, HVHP428P would cross-link and agglutinate cells due to its multivalency. In the absence of agglutination the cells settle out over time and form a dot at the center of the well. If there is agglutination the cells settle out as a sheet. Microagglutination was performed by incubating a constant number of bacterial cells with two-fold dilutions of HVHP428P (Figure 3A), as described above.
The pentamer is functional as it agglutinates S. aureus, up to well 6. Beyond well 6 the concentration of the pentamer is too low for cross-linking, hence no agglutination (cells appear sediments appear as round dots). HVHP428P exhibits a MAC value of 3 x 1013 pentamers/mL. A control functional active VL pentamer, HVLP325P (Figure 8) does not show any agglutination, demonstrating that the activity of the HVHP428P is due to its VH binding component and not its pentamerization domains (Figure 2).
As highlighted in Figure 3B, HVHP428SPNFe203 also effectively interacts with S. aureus cells (evidenced by the diffuse appearance of cell sediments in wells 1 -6) and exhibits a MAC value of 1.5 x 1011 particles/mL, 200-fold better (more strongly) than HVHP428P pentamer. Importantly, HVHP428SPNFe203 is specific to S. aureus exclusively, as there is no agglutination (cell dots) in the presence of the other species of bacteria. To verify that the interaction was indeed mediated by HVHP428 anchored to the nanoparticle, SPNFe203 was also tested for agglutination, and no cell agglutination occurs at any concentration studied for SPNFe203. The long-term stability of HVHP428SPNFe2°3 is impressive; the MAC values do not decrease even following a year of storage in a pH 6 MES buffer at 4°C.
Example 6 - Transmission Electron Microscopy (TEM) experiments The binding (or lack of interaction) of both HVHP428SPNFe203 and SPNFe203 to S. aureus cells could also be qualitatively assessed by means of transmission electron microscopy (TEM) analysis. In general, we found that the most effective TEM images of the
HVHP428SPNFe2°3 or SPNFe203 interacting with the variety of bacteria could be obtained by extracting ~1 μL of the solution in the microagglutination plates described above. That is, where the nanoparticles agglutinate effectively, 1 μL of the solution was extracted and expelled directly onto the TEM grid, dried and analysed via TEM. In the case where poor or no microagglutination is observed, the 1 μL of solution is extracted from the precipitate that has settled to the bottom of the microtiter plate. Here, because both HVHP428SPNFe203 and SPNFe203 are colloidally stable, there are significantly less nanoparticles interacting with the bacteria than is the case where agglutination is effective.
The TEM images of the nanoparticle-cell conjugates were acquired using a Philips CM20 FEG microscope operating at 200 keV.
Examples of these TEM binding experiments are provided in Figure 5. From these images, two factors are clear. Firstly, HVHP428SPNFe2°3 (Figure 5A) interacts much more effectively over the entire surface of the S. aureus cells as opposed to SPNFe203 (Figure 5B).
Secondly, in agreement with the microagglutination investigation highlighted above, the TEM analysis suggests that there is very little interaction between HVHP428SPNFe203 and the S. typhimurium cells (Figure 5C). Also as expected, there was essentially no interaction between SPNFe203 and S. typhimurium (data not shown).
Example 8 - Antibody Specificity A previously-described superparamagnetic nanoconjugate employed a traditional whole antibody (IgG), where the interaction between the nanoconjugate and S. aureus was mediated through the Fc-protein A pseudoimmmune reaction (Figure 1) (Ho et al, 2004). It was reported that these whole antibodies showed cross-reactivity with several other bacteria species, including Staphylococcus saprophyticus and Streptococcus pyogenes (group A Streptococcus) (Ho et al, 2004). Such constructs also cross-react with group C and G Streptococci through interaction with bacterial protein G (Tashiro et al, 1995).
The microagglutination and TEM experiments were extended to S. saprophytics, S. pyogenes and Streptococcus pneumoniae (a protein G-containing Streptococcus) and we found that the nanoconjugates of the present invention did not cross-react with any of these cells. There is very little evidence for interaction between both HVHP428SPNFe203 and SPNFe203 nanoparticles and S. saprophytics, S. pneumoniae or S. pyogenes cells (Figure 9).
Example 9 - Magnetic Confinement Capture Studies
The examples above demonstrate excellent selectivity, therefore, we continued to elucidate how effectively and selectively the nanoparticles could magnetically confine very low concentrations of S. aureus cells in competition with other bacterial cells. In these experiments (Figure 6A), HVHP428SPNFe203 particles were incubated with S. aureus (and S. typhimurium) cells for binding/labeling and were subsequently confined into a very small volume by means of a permanent rare-earth magnet. The number of S. aureus cells that can be confined from a given sample was determined by cell titration and used to determine capture efficiency and specificity.
HVHP428SPNFe2°3 and SPNFe203 were first blocked with 0.1% (v/v) Tween 20 in MES buffer overnight at 4°C. One hundred microliters of the blocked nanoparticles (1013 particles/mL) were mixed with 1 μL of cells in MES buffer. The mixture was incubated at room temperature for 2 h with gentle rocking followed by a 1 h-long capture on a magnet. Keeping the sample on the magnet stand, the supernatant was removed and plated on BHI media at various dilutions to determine the number of non-captured cells. The nanoparticles were separated from the magnet, resuspended in 100 μL of MES buffer and used to determine the number of captured cells. Capture efficiency was calculated as follows:
Capture efficiency = (no. of captured cells/ [no. of captured cells + no. of non- ccaaopttuurreedd cceellllss]l)) xx 110000
In specificity capture studies, 1 μL of each of S. aureus and S. typhimurium cells was added to 99 μL of overnight blocked conjugated or unconjugated nanoparticles (1013
particles/mL) in MES buffer/ 1% Tween 20. Incubation, nanoparticle capture and fractionation of mixtures into captured and non-captured cells were performed as above. Cell titration was performed as above except that the fractionated cells were plated on both XLD (selective for S. typhimurium) and BP (selective for S. aureus) media. Capture specificity was calculated based on the relative number of S. aureus and S. typhimurium in the captured fraction, after normalizing for the total number of cells:
Capture specificity = no. of S. aureus in the captured fraction/no, of S. typhimurium in the captured fraction
Alternatively, capture specificity was determined by direct comparison of the number of captured S. aureus versus the number of captured S. typhimurium in the mixed cell captured fraction. In some instances a single wash step between the binding step and the fractionation step was included. The wash step comprised of (i) resuspending the nanoparticles in 100 μL MES buffer/1% Tween 20, (ii) capturing the nanoparticles for 30 min, (iii) removing the wash solution, which was subsequently titrated. Control experiments in which cells (S. aureus alone, S. typhimurium alone or a mixture of both cells) were incubated with the MES buffer had the same total titer as the nanoparticle- treated cells.
Initially, a titration of HVHP428SPNFe203 against S. aureus cells (104 cells) was performed. Interestingly, we require at least 1 x 1012 HVHP428SPNFe2°3 particles per 10 cells in order to label the S. aureus cells with sufficient superparamagnetic nanoparticles to facilitate efficient confinement of the cells. No capture was observed at nanoparticle concentrations of 103-10π particles/mL (capture efficiency: <1%). Nonspecific capture could be completely suppressed by coating nanoparticles overnight with 0.1% Tween 20 and performing the binding in the presence of 1% Tween 20. As can be seen in Figure 6B, the HVHP428SPNFe2°3 capture efficiency is over 90%, with as few as 180 cells. The capture is specific as evidenced by the poor S. aureus capture efficiency exhibited by SPNFe2°3 (-5%).
To determine if the magnetic confinement is specific to S. aureus, specificity capture studies involving competition assays containing both S. aureus and S. typhimurium cells were performed. Mixtures of both bacteria were incubated with nanoparticles for binding/labeling and the captured cells were enumerated by applying bacterial samples onto selective plates (BP for S. aureus, XLD for S. typhimurium). The ratio of the S. aureus to S. typhimurium in the captured fraction was used to determine capture specificity. As can be seen in Figure 6C, HVHP428SPNFe2°3 discriminately captures S. aureus over S. typhimurium with a ratio of 13:1. The number of S. typhimurium cells captured by HVHP428SPNFe203 is at the background level and is essentially the same as the numbers captured by SPNFe2°3 in the case of both bacteria (Figure 6C, inset).
The selectivity could be further improved simply by including a wash step immediately following the binding step. As highlighted in Figure 7A, the capture efficiency was as high as 98% for HVHP428SPNFe203 versus only 0.8% for the SPNFe203. (The total number of S. aureus cells was 338 in the HVHP428SPNFe2°3 mixture and 278 in the SpN Fe2θ3 miχture) without the wash step HVHP428SPNFe203 capture efficiency would have remained at exactly the same level, but that of SPNFe203 would have been as high as over 9% (see Figure 7 legend). This demonstrates that there is very little nonspecific absorption contributing to the interaction between HVHP428SPNFe203 and the S. aureus cells. In the case of specificity capture studies, we used a mixture of cells with as few as 80 S. aureus cells and 56 S. typhimurium cells. The capture specificity was adequate (80 S. aureus/4 S. typhimurium) immediately following incubation and magnetic confinement and extremely high following the washing step after confinement (78 S. aureus and no S. typhimurium). Thus, without the wash step the capture specificity ratio would have been significantly lower.
Example 10 - Capture / scanning electron microscopy (SEM) experiments We confirmed the specificity of HVHP428SPNFe2°3 through capture/SEM experiments with S. saprophyticus, S. pyogenes, and S. pneumoniae (a protein G-containing Streptococcus species of bacteria).
Cell were grown as described in Example 1 , centrifuged in a benchtop centrifuge (800 g, 5 min), resuspended in V-∑ MES buffer and pelleted again. Cells were resuspended in 10 2 HVHP428SPNFe2°3 in MES buffer/0.1% Tween 20 (v/v) and incubated for binding for 30 min. The solutions were magnetically confined for 3 min and the supernatant removed - leaving the last 20 μL behind to ensure the confined materials are not disturbed and lost. The captured materials were resuspended in 200 μL MES buffer. This step was repeated but the captured materials were resuspended in 200 μL sterile double-distilled H2O (ddH2O). The magnetic confinement was performed once more and the captured materials were resuspended in 50 μL ddH2O. One microliter suspensions were used for SEM imaging. SEM was performed on cells plated on Si substrate with a Hitachi S-4700 field-emission scanning electron microscope. Samples were imaged with an acceleration voltage of 3 KV and at a working distance of 6 mm. Identical experiments were carried out with SPNFe2°3.
Mixtures of nanoparticles (1012) and cells (108) were incubated for binding and were subsequently subjected to magnetic confinement, as just described. While in the case of HVHP428SPNFe2O3/5'. aureus, the solution became clear in a couple of minutes following the magnetic confinement with cells clumped against the vessel wall, indicating a very strong binding interaction between HVHP428SPNFe203 and S. aureus, in the case of SPNFe2O3/5'. aureus, the solution stayed cloudy over the course of the confinement and there was no visible captured cells. With S. pyogenes and S. pneumoniae, both HVHP428SPNFe203 and SPNFe203 hardly gave any captured cells and by the end of the two washes (cycles of resuspension and confinement) there was no visible pack of confined cells. Only in the case of S. saprophyticus, some capture was observed, albeit with a significant amount of cells still in the supernatant fraction. However, the capture was the same for both HVHP428SPNFe203 and SPNFe203, indicating some non-specific interactions between SPNFe203 and S. saprophyticus. An aliquot of the confined materials following the last wash was used for SEM imaging.
Figure 10 summarizes results of the capture studies in a series of SEM images. The top panels of Figure 10 depict the interaction of cells with HVHP428SPNFe2°3 (labeled 1-
SPN) while bottom panels are the control experiments performed with SPNFe2°3 (labeled SPN). In the S. aureus interaction with HVHP428SPNFe2°3 capture study, SEM images showed each of the captured cells (dark sphere, ~1 μm) were flanked with HVHP428SPNFe2°3 with most cells partially covered by the NP aggregates, which indicated positive binding response between cells and HVHP428SPNFe2°3. In contrast, in the control experiment (S. aureus vs. SPNFe203), very large aggregates of SPNFe2°3 were observed with a few cells embedded in the SPNFe2°3 aggregates. Unlike the S. aureus vs. HVHP428SPNFe203 interaction, the captured cells in the control experiment had no SPNFe203 on their surface nor were they flanked by the nanoparticles. This indicates a lack of interaction between the control nanoparticles and 5. aureus. It is possible that the few cells trapped in the control experiment were from the remaining 20 μL of the solution left after the capture step rather than been magnetically confined. SEM images of the interaction between HVHP428SPNFe2°3 with S. pyogenes and S. pneumoniae showed very similar patterns. Both images show clusters of cells without any nanoparticles binding to their surfaces nor flanked in between the cells which suggests the non- interactive nature of the HVHP428SPNFe2°3 to both S. pyogenes and S. pneumoniae. Control experiment of both species exposed to SPN e2° also showed similar noninteraction pattern. Despite the observation of very large aggregates of SPNFe2°3 in the images of the control study, there were no nanoparticles binding to the surface of the cells as observed in the case of S. aureus vs. HVHP428SPNFe203 image. Since there is no binding seen in the images as well as during the earlier confinement step in the case of both S. pyogenes and S. pneumoniae, it is very likely that the cells seen in the images are carry over from the non-binding fraction (see above). However, some interaction between both HVHP428SPNFe203 and SPNFe2°3 with S. saprophytics was suggested by Figure 10. In both S. saprophytics vs. HVHP428SPNFe2°3 and S. saprophytics vs. SPNFe203 images, cells are flanked and partially covered by the nanoparticles indicating a positive interaction between the nanoparticles and cell. Because this is observed in both experiments, these interactions are likely non-specific, a conclusion that is also supported by the results of the capture step above. Such non-specific interaction may be further reduced by passivating the nanoparticles surfaces with agents that suppress non-specific interactions such as serum albumins. The interaction between HVHP428SPNFe203 and S.
saprophyticus may be distinguished from the interaction between HVHP428SPNFe2°3 and S. aureus in a real detection situation simply by looking at all of these interactions together.
References
The following references are incorporated herein by reference (where permitted) as if reproduced in their entirety. All references are indicative of the level of skill of those skilled in the art to which this invention pertains.
Arbabi-Ghahroudi, M., To, R., Gaudette, N., Hirama, T., Ding, W., MacKenzie R., and Tanha, J. (2009). Aggregation-resistant VHS selected by in vitro evolution tend to have disulfide-bonded loops and acidic isoelectric points. Protein Eng Des SeI. 22, 59-66.
Arbabi-Ghahroudi, M.; Tanha, J.; MacKenzie, R. Cancer Metastasis Rev. 2005, 24, 501. Burova, L. A.; Nagornev, V. A.; Pigarevskii, P. V.; Gladilina, M. M.; Molchanova, I. V.; Selivestrova, V. G.; Tern, A.; Lindahl, G.; Totolian, A. A. Biull. Eksp. Biol. Med. 1999, 128, 548.
CM. Sorensen, Nanoscale Materials in Chemistry (Ed. K. J. Klabunde), Wiley, New York, 2001, pp. 169-222 Chang, Y. H.; Chang, T. C; Kao, E. F.; Chou, C. Biosci. Biotechnol. Biochem. 1996, 60, 1571.
Cheung, A. L.; Eberhardt, K.; Heinrichs, J. H. Infect. Immun. 1997, 65, 2243.
Dooley, H., Flajnik, M. F., and Porter, A. J. (2003). Selection and characterization of naturally occurring single-domain (IgNAR) antibody fragments from immunized sharks by phage display. MoI. Immunol. 40: 25-33.
Forsgren, A. Infec. Immun. 1970, 2, 672.
Fukuda, S.; Tatsumi, H.; Igarashi, H.; Igimi, S. Lett. Appl. Microbiol. 2000, 31, 134.
Georganopoulou, D. G.; Chang, L.; Nam, J. M.; Thaxton, C. S.; Mufson, E. J.; Klein, W. L.; Mirkin, C. A. Proc. Natl. Acad. ScL U.S.A. 2005, 102, 2273. Gu, H.; Xu, K.; Xu, C; Xu, B. Chem. Commun. (Camb.) 2006, 941.
G. T. Hermanson, Bioconjugate Techniques, Academic Press, San Diego, 1996.
Harmsen, M. M. and de Haard, H. J. (2007). Properties, production, and applications of camelid single-domain antibody fragments. Appl.Microbiol.Biotechnol. 77: 13-
22.
Ho, K. C; Tsai, P. J.; Lin, Y. S.; Chen, Y. C. Anal. Chem. 2004, 76, 7162. Holliger, P. and Hudson, P. J. (2005). Engineered antibody fragments and the rise of single domains. Nat.Biotechnol. 23: 1126-1136.
Holliger, P.; Hudson, P. J. Nat. Biotechnol. 2005, 23, 1126.
Holt, L. J., Herring, C, Jespers, L. S., Woolven, B. P., and Tomlinson, I. M. (2003). Domain antibodies: proteins for therapy. Trends Biotechnol. 21 : 484-490. Hoogenboom, H. R. (2005). Selecting and screening recombinant antibody libraries. Nat.Biotechnol. 23: 1105-1116.
Huang, S. H. CHn. Chim. Acta 2006, 373, 139.
Hyeon, T. Chem. Commun., 2003, 927 - 934, N. A. Frey, S. Peng, K. Cheng, S. Sun, "Magnetic Nanoparticles: Synthesis and Applications in Bioimaging and Magnetic Energy Storage", Chem. Soc. Rev. 2009, 38, 2532
Jespers, L., Schon, O., Famm, K., and Winter, G. (2004a). Aggregation-resistant domain antibodies selected on phage by heat denaturation. Nat.Biotechnol. 22: 1161- 1165.
Jespers, L., Schon, O., James, L. C, Veprintsev, D., and Winter, G. (2004b). Crystal Structure of HEL4, a Soluble, Refoldable Human V(H) Single Domain with a
Germ-line Scaffold. J.Mol.Biol. 337: 893-903.
Kalele, S. A.; Kundu, A. A.; Gosavi, S. W.; Deobagkar, D. N.; Deobagkar, D. D.; Kulkarni, S. K. Small 2006, 2, 335.
KeIl, A. J.; Simard, B. Chem. Comm. 2007, 1227 A. J. KeIl, K. Somaskandan, G. Stewart, M. G. Bergeron and B. Simard, Langmuir, 2008, 24, 3493-3502
Kronvall, G.; Quie, P. G.; Williams, R. C, Jr. J. Immunol. 1970, 104, 273.
Lin, P. C; Chou, P. H.; Chen, S. H.; Liao, H. K.; Wang, K. Y.; Chen, Y. J.; Lin, C. C.
Small 2006, 2, 485. Liu, J. L., Anderson, G. P., Delehanty, J. B., Baumann, R., Hayhurst, A., and Goldman, E. R. (2007). Selection of cholera toxin specific IgNAR single-domain antibodies from a naive shark library. MoI. Immunol. 44: 1775-1783.
Lowy, F. D. N. Engl. J. Med. 1998, 339, 520.
Y. Lu, Y. Yin, B. T. Mayers and Y. Xia, Nano. Lett, 2002, 2, 183 - 186.D. Ma, T. Veres, L. Clime, F. Normandin, J. Guan, D. Kingston and B. Simard, J. Phys. Chem. C, 2007, 111, 1999-2007.
Medley, CD; Smith, J.E.; Tang, Z.; Wu, Y.; Bamrungasap, S.; Tan, W. Anal. Chem. 2008, 80, 1067.
Mongodin, E.; Bajolet, O.; Hinnrasky, J.; Puchelle, E.; de Bentzmann, S. J. Histochem. Cytochem. 2000, 48, 523.
Nuttall, S. D., Irving, R. A., and Hudson, P. J. (2000). Immunoglobulin VH domains and beyond: design and selection of single-domain binding and targeting reagents. Curr.Pharm.Biotechnol. 1 : 253-263.
Nuttall, S. D., Krishnan, U. V., Hattarki, M., De Gori, R., Irving, R. A., and Hudson, P. J. (2001). Isolation of the new antigen receptor from wobbegong sharks, and use as a scaffold for the display of protein loop libraries. MoI. Immunol. 38: 313-326.
Pace, C. N.; Vajdos, F.; Fee, L.; Grimsley, G.; Gray, T. Protein Sci. 1995, 4, 2411. Revets, H., De Baetselier, P., and Muyldermans, S. (2005). Nanobodies as novel agents for cancer therapy. Expert. Opin.Biol.Ther. 5: 111-124.
Saito, T.; Kawabata, S.; Hirata, M.; Iwanaga, S. J. Biol. Chem. 1995, 270, 14493.
Sambrook, J.; Fritsch, E. F.; Maniatis, T. Molecular Cloning: A Laboratory Manual, 2nd ed.; Cold Spring Harbor Laboratory, Cold Spring Harbor: New York, 1989 Shen, Z.; Mernaugh, R. L.; Yan, H.; Yu, L.; Zhang, Y.; Zeng, X. Anal. Chem. 2005, 77, 6834.
Shen, Z.; Yan, H.; Zhang, Y.; Mernaugh, R. L.; Zeng, X. Anal. Chem. 2008, 80, 1910. Sjoquist, J.; Movitz, J.; Johansson, I. B.; Hjelm, H. Eur. J. Biochem. 1972, 30, 190. Su, X. L.; Li, Y. Anal. Chem. 2004, 76, 4806. Tanha, J., Dubuc, G., Hirama, T., Narang, S. A., and MacKenzie, C. R. (2002). Selection by phage display of llama conventional V(H) fragments with heavy chain antibody V(H)H properties. J.Immunol.Methods 263: 97-109.
Tanha, J., Nguyen, T. D., Ng, A., Ryan, S., Ni, F., and MacKenzie, R. (2006). Improving solubility and refolding efficiency of human V(H)s by a novel mutational approach. Protein Eng Des SeI 19: 503-509.
Tanha, J., Xu, P., Chen, Z. G., Ni, F., Kaplan, H., Narang, S. A., and MacKenzie, C. R. (2001). Optimal design features of camelized human single-domain antibody libraries. J.Biol.Chem 276: 24774-24780.
Tashiro, M.; Montelione, G. T. Curr. Opin. Struct. Biol. 1995, 5, 471.
Tay, L.; Tanha, J.; Ryan, S.; Veres, T. (2007) Detection of Staphylococci aureus cells with single domain antibody functionalized Raman nanoparobes. Photonics North, Ed. J. Armitage, Proceedings of the SPIE, 6796: 67960C. To R; Hirama, T.; Arbabi-Ghahroudi, M.' MacKnezie, R.; Wang, P.; Xu, P.; Feng, N.; and Tanha, J. J. Biol. Chem. 2005, 280, 41395.
Tu, S.-I.; Uknalis, J.; Gore, M.; Irwin, P., J. Rapid Meth. Autom. Microbiol. 2002, 10, 185.
Tu, S.-I.; Uknalis, J.; Gore, M.; Irwin, P.; Feder, I. J. Rapid Meth. Autom. Microbiol. 2003, 77, 35.
Zhang, J.; Li, Q.; Nguyen, T. D.; Tremblay, T. L.; Stone, E.; To, R.; Kelly, J.; MacKenzie, C. R. J. MoI. Biol. 2004, 341, 161.
Zhang, J.; Tanha, J.; Hirama, T.; Khieu, N. H.; To, R.; Tong-Sevinc, H.; Stone, E.; Brisson, J. R.; MacKenzie, C. R. J. MoI. Biol. 2004b, 335, 49. Zhao, X.; Hilliard, L. R.; Mechery, S. J.; Wang, Y.; Bagwe, R. P.; Jin, S.; Tan, W. A Proc. Natl. Acad. ScL U.S.A. 2004, 101, 15027
Claims
1. A conjugate comprising a superparamagnetic nanoparticle (SPN) coupled to at least one sdAb specific to a pathogen or cell of interest.
2. The conjugate of claim 1, wherein the SPN comprises an iron oxide core and a silica shell.
3. The conjugate of claim 1 or 2, wherein the sdAb is specific to protein A on the surface of Staphylococcus aureus.
4. The conjugate of any one of claims 1 to 3, wherein the sdAb comprises the amino acid sequences;
GFTFSSYAMS, FIRSKAYGGTTEYAASVKG, and RAKDGYNSPEDY or substantially identical sequences thereto.
5. The conjugate of claim 4 wherein the sdAb comprises SEQ ID NO. 1 or a substantially identical sequence thereto.
6. The conjugate of any one of claims 1 to 5, wherein the sdAb is HVHP428.
7. The conjugate of any one of claims 1 to 6, wherein the nanoparticle further comprises a SERS-active Raman reporter molecule, or a detectable label.
8. The conjugate of claim 7 wherein the nanoparticle comprises a detectable label comprising a fluorescent label.
9. A method of detecting a pathogen of interest in a mixed culture or sample, comprising the steps of: a) binding the pathogen with a conjugate of any one of claims 1 to 8, wherein the sdAb is specific to the pathogen of interest; b) magnetically concentrating the pathogens bound with the conjugate; and c) detecting the pathogens bound with the conjugate.
10. A use of a conjugate of any one of claims 1 to 8 wherein the sdAb is specific to the pathogen of interest, for separating and purifying a pathogen of interest in a mixed culture or a sample.
11. A use of a conjugate of any one of claims 1 to 8 for separating mammalian cells from a mixture containing several different types of cells, wherein the sdAb is specific to the mammalian cells of interest.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US11827808P | 2008-11-26 | 2008-11-26 | |
| US61/118,278 | 2008-11-26 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2010060209A1 true WO2010060209A1 (en) | 2010-06-03 |
Family
ID=42225171
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/CA2009/001712 Ceased WO2010060209A1 (en) | 2008-11-26 | 2009-11-24 | Single domain antibody - targeted nanoparticle architectures for increased pathogen detection specificity and sensitivity |
Country Status (1)
| Country | Link |
|---|---|
| WO (1) | WO2010060209A1 (en) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013014538A3 (en) * | 2011-07-25 | 2013-07-04 | American University In Cairo | Single-domain antibodies and graphene coated magnetic metal nanoparticles conjugate and methods for using the same |
| WO2015026252A1 (en) | 2013-08-23 | 2015-02-26 | Instituto Superior Tecnico | Multifunctional superparamagnetic nanosystem as contrast agent for magnetic resonance imaging and its production method |
| CN120173098A (en) * | 2025-03-12 | 2025-06-20 | 南京大学 | A nanoantibody specifically recognizing Staphylococcus aureus and its application |
-
2009
- 2009-11-24 WO PCT/CA2009/001712 patent/WO2010060209A1/en not_active Ceased
Non-Patent Citations (3)
| Title |
|---|
| KELL, A.J. ET AL.: "Multifunctional Nanoparticle Platforms for Pathogen Diagnostic Applications (Edited by NanoScience and Technology Inst. CRC press)", NANOTECHNOLOGY 2008: TECHNICAL PROCEEDINGS OF THE 2008 NSTI NANOTECHNOLOGY CONFERENCE AND TRADE SHOW, vol. 2, 1 June 2008 (2008-06-01) - 5 June 2008 (2008-06-05), BOSTON, pages 210 - 213 * |
| LIANG, S. ET AL.: "Surface Modified Superparamagnetic Iron Oxide Nanopanicles: as a New Carrier for Bio-magnetically Targeted Therapy", J. MATER. SCI.: MATER. MED., vol. 18, no. 12, 2007, pages 2279 - 2302 * |
| TO, R. ET AL.: "Isolation of monomeric human V(H)s by a phage selection", J. BIOL. CHEM., vol. 280, no. 50, 2005, pages 41395 - 41403 * |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013014538A3 (en) * | 2011-07-25 | 2013-07-04 | American University In Cairo | Single-domain antibodies and graphene coated magnetic metal nanoparticles conjugate and methods for using the same |
| WO2015026252A1 (en) | 2013-08-23 | 2015-02-26 | Instituto Superior Tecnico | Multifunctional superparamagnetic nanosystem as contrast agent for magnetic resonance imaging and its production method |
| CN120173098A (en) * | 2025-03-12 | 2025-06-20 | 南京大学 | A nanoantibody specifically recognizing Staphylococcus aureus and its application |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Wang et al. | M13 phage-based nanoprobe for SERS detection and inactivation of Staphylococcus aureus | |
| Lee et al. | Colorimetric allergenic fungal spore detection using peptide-modified gold nanoparticles | |
| Liu et al. | Gold nanoprobe functionalized with specific fusion protein selection from phage display and its application in rapid, selective and sensitive colorimetric biosensing of Staphylococcus aureus | |
| Gu et al. | Biofunctional magnetic nanoparticles for protein separation and pathogen detection | |
| Wu et al. | Double phage displayed peptides co-targeting-based biosensor with signal enhancement activity for colorimetric detection of Staphylococcus aureus | |
| Chen et al. | Indirect immunofluorescence detection of E. coli O157: H7 with fluorescent silica nanoparticles | |
| US20110269148A1 (en) | Nanoaggregate Embedded Beads Conjugated To Single Domain Antibodies | |
| Rashid et al. | Facile fabrication of nickel immobilized on magnetic nanoparticles as an efficient affinity adsorbent for purification of his-tagged protein | |
| Muzard et al. | M13 Bacteriophage‐Activated Superparamagnetic Beads for Affinity Separation | |
| Fatemi et al. | Construction of genetically engineered M13K07 helper phage for simultaneous phage display of gold binding peptide 1 and nuclear matrix protein 22 ScFv antibody | |
| Bakthavathsalam et al. | Immunomagnetic nanoparticle based quantitative PCR for rapid detection of Salmonella. | |
| EP2089714B1 (en) | Magnetic recognition system | |
| JP2004329072A (en) | Magnetic substance-biological substance complex type structure, peptide fragment having amino acid sequence capable of binding to magnetic substance and gene thereof, and method for producing magnetic substance-biological substance complex type structure | |
| Cheng et al. | Au nanocluster-embedded chitosan nanocapsules as labels for the ultrasensitive fluorescence immunoassay of Escherichia coli O157: H7 | |
| Li et al. | Surface sieving coordinated IMAC material for purification of His-tagged proteins | |
| JP4371694B2 (en) | Target component separation method, detection method, screening method | |
| Zanker et al. | Direct capture and selective elution of a secreted polyglutamate‐tagged nanobody using bare magnetic nanoparticles | |
| EP3512869B1 (en) | Magnetic particle-binding peptides | |
| KR102522579B1 (en) | Peptide binding histamine specifically and compound for detecting histamine using the same | |
| CN113388616B (en) | Aptamer specifically binding to helicobacter pylori, biological element, biosensor and detection method | |
| Liang et al. | Fluorescence immunoassay for the targeted determination of trace Listeria monocytogenes based on immunomagnetic separation and CdZnTe quantum dot indication | |
| US20110294110A1 (en) | Set of magnetic labels | |
| Dehal et al. | Magnetizable antibody‐like proteins | |
| Jehle et al. | Genetically engineered organization: protein template, biological recognition sites, and nanoparticles | |
| Niide et al. | Organic crystal-binding peptides: morphology control and one-pot formation of protein-displaying organic crystals |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 09828500 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 09828500 Country of ref document: EP Kind code of ref document: A1 |
