WO2010052335A1 - E. coli bl21 strain lacking a functional group ii capsular gene cluster - Google Patents

E. coli bl21 strain lacking a functional group ii capsular gene cluster Download PDF

Info

Publication number
WO2010052335A1
WO2010052335A1 PCT/EP2009/064903 EP2009064903W WO2010052335A1 WO 2010052335 A1 WO2010052335 A1 WO 2010052335A1 EP 2009064903 W EP2009064903 W EP 2009064903W WO 2010052335 A1 WO2010052335 A1 WO 2010052335A1
Authority
WO
WIPO (PCT)
Prior art keywords
coli
strain
group
peptide
gene cluster
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2009/064903
Other languages
French (fr)
Inventor
Helle Fabricius Wöldike
Deng Jianhui
Zhao Xin
Liu Yun
Su Jing
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novo Nordisk AS
Original Assignee
Novo Nordisk AS
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Novo Nordisk AS filed Critical Novo Nordisk AS
Priority to CN200980144718.5A priority Critical patent/CN102209725B/en
Priority to EP09751899.7A priority patent/EP2356142B1/en
Priority to JP2011535134A priority patent/JP5808671B2/en
Priority to ES09751899.7T priority patent/ES2612252T3/en
Priority to US13/126,379 priority patent/US8535909B2/en
Publication of WO2010052335A1 publication Critical patent/WO2010052335A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P21/00Preparation of peptides or proteins
    • C12P21/02Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/24Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Enterobacteriaceae (F), e.g. Citrobacter, Serratia, Proteus, Providencia, Morganella, Yersinia
    • C07K14/245Escherichia (G)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475Growth factors; Growth regulators
    • C07K14/50Fibroblast growth factor [FGF]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/5759Products of obesity genes, e.g. leptin, obese (OB), tub, fat
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/61Growth hormone [GH], i.e. somatotropin
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/70Vectors or expression systems specially adapted for E. coli
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/24Hydrolases (3) acting on glycosyl compounds (3.2)
    • C12N9/2402Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)

Definitions

  • the present invention relates to the manipulation of Escherichia coli (E. coli) genome, to an improved non-pathogenic E. coli B strain, and its use thereof for the production of peptides and proteins.
  • Bacteria have been used to produce a wide range of commercial products.
  • Bacteria in their natural environment are exposed to many conditions that are not normally experienced in standard industrial or laboratory growth, and thus their genomes carry a large number of condition-dependent, stress-induced genes or otherwise non-essential genes which may not be needed in industrial or laboratory use of the organisms, or may even be unwanted.
  • Bacterial pathogens contain virulence factors such as capsular polysaccharides at the cell surface, which mediate the interactions between the bacterium and its immediate environment and have a number of functions directly related to their pathogenicity. More than 80 serologically and chemically distinct types of polysaccharide capsules have been described in E. coli and termed K antigens. The polysaccharide capsules have been classified into 4 groups, of which the group Il capsular polysaccharides are similar to those of Haemophilus influenzae and Neisseria meningitides. The group Il capsular gene clusters contain most of the capsular types associated with invasive disease and have a conserved genetic organisation consisting of three functional regions.
  • Regions 1 and 3 are conserved among group Il gene clusters and encode peptides necessary for the transport of the polysaccharide from its site of synthesis to the cell surface, while region 2 is serotype specific and encodes the enzymes responsible for biosynthesis and polymerization of the individual monosaccharides that comprise the particular polysaccharide.
  • Region 1 comprises 6 genes kpsFEDUCS, organised in a single transcriptional unit.
  • Region 2 is serotype specific and differs among group 2 antigens.
  • Region 3 contains 2 genes kpsM and kpsT organised in a single transcrip- tional unit [Andreishcheva et al. Gene (2006) 384: 113-119].
  • E. coli strains K-12 and B are not encapsulated and are commonly used strains for the production of peptides.
  • the E. coli K-12 genome has been fully sequenced and does not contain any capsular genes.
  • E. coli B BL21 (DE3) which is a pre- ferred strain for high-yield expression of recombinant peptides, contains a cluster of genes coding for group Il capsular polysaccharides and it is thought that an ancestor of E. coli B must have acquired these capsular genes by horizontal transfer.
  • the K antigens located in the capsule of E. coli are often associated with a pathogenic phenotype in strains harbouring the functional form of the genes. It has been shown that in E.
  • the region 2 of group Il capsular gene cluster has become inactive by an insertion element (IS1 ), preventing the production of the antigen, while region 1 and 3 supporting export and presentation of wildtype capsular antigen, are still intact [Andreishcheva et al. Gene (2006) 384: 1 13-119].
  • IS1 insertion element
  • the present invention provides an E. coli B BL21 (DE3) strain with permanent knock out (KO) of the group Il capsular gene cluster, bringing this strain into the same safety class as other commercially important strains such as E. coli K-12.
  • the present invention relates to an E. coli B BL21 strain having an irreversibility inactivated group Il capsular gene cluster.
  • E. coli B BL21 strain is characterised by having a total or partial deletion of the group Il capsular gene cluster.
  • E. coli B BL21 strain is characterised by having total deletion of the group Il capsular gene cluster.
  • E. coli B BL21 strain is characterised by having a partial deletion of the group Il capsular gene cluster. In a further embodiment, the E. coli B BL21 strain is characterised by having one or more point mutations in the group Il capsular gene cluster.
  • the E. coli strain is characterised by having at least 5% of group Il capsular gene cluster permanently inactivated by deletion.
  • the E. coli strain is characterised by having at least 25% of group Il capsular gene cluster permanently inactivated by deletion.
  • the E. coli strain is characterised by having at least 40% of group Il capsular gene cluster permanently inactivated by deletion.
  • the E. coli strain is characterised by having at least 55% of group Il capsular gene cluster permanently inactivated by deletion. In another embodiment, the E. coli strain is characterised by having from 75% to 100% of the group Il capsular gene cluster permanently inactivated by deletion.
  • the E. coli strain is characterised by having at least 85% of group Il capsular gene cluster permanently inactivated by deletion. In another embodiment, the E. coli strain is characterised by having at least 95% of group Il capsular gene cluster permanently inactivated by deletion.
  • 30% of the group Il capsular gene cluster is deleted.
  • 50% of the group Il capsular gene cluster is deleted.
  • 90% of the group Il capsular gene cluster is deleted.
  • the E. coli strain is E. coli B BL21 (DE3) and in a further embodiment the E. coli strain is E. coli B BL21 (DE3) ⁇ dadX ⁇ a/r.
  • the present invention also contemplates a method for producing an E. coli B strain wherein the group Il capsular gene cluster is deleted by a method comprising the steps of: a. replacing of group Il capsular gene cluster by a selection marker, b. eliminating the selection marker and c. confirming the deletion by PCR analysis.
  • the selection marker is an antibiotic resistance gene.
  • the antibiotic resistance gene is selected from the group consisting of chloramphenicol, tetracyclin, ampicillin, kanamycin, vancomycin and erythromycin.
  • the antibiotic resistance gene is chloramphenicol.
  • the invention is also related to a method for producing a peptide by introducing an expression vector comprising a DNA sequence encoding a peptide in the E. coli strain of the present invention.
  • the present invention also contemplates a method for the production of a peptide comprising culturing an E. coli B strain according to the present invention, in a suitable culture medium under condition for the expression of DNA encoding the said peptide.
  • the peptide to be expressed by the expression vector may be any peptide which can be expressed in E. coli.
  • the E. coli strain of the present invention comprises an expression vector comprising a DNA sequence encoding a peptide.
  • the peptide to be produced is hGH. In another embodiment, the peptide to be produced is FGF-21. In another embodiment, the peptide to be produced is amylin.
  • the peptide to be produced is leptin. In another embodiment, the peptide to be produced is sialidase.
  • Fig.1. shows the genetic organisation of the E. coli B BL21 (DE3) capsular gene cluster with non-coding flanking regions.
  • Open reading frames (ORFs) of the B BL21 (DE3) capsular gene cluster (large arrows); direction of transcription (arrowheads): region 1 genes (grey arrows); region 2 ORFs (black arrows); region 3 genes (white arrows); IS1 element (white box).
  • ORFs Open reading frames
  • Small arrows indicate the position of the non-coding left arm (LA) and the right arm (RA).
  • Fig.2. is a schematic representation of the workflow of the group Il capsular gene cluster knock out method: a) replacement of group Il capsular gene cluster by an antibiotic resistance gene and b) elimination of the antibiotic resistance gene.
  • Fig.3. shows PCR screening of knock out candidates.
  • the right size of 1686bp (LA+part of cat, A1-A3 in upper panel, B1-B3 in lower panel) and 1578bp (RA+part of cat, A1-A3 in upper panel, B1 -B3 in lower panel) amplified from knockout candidates (but not its parental strain) (BL or D) indicate a successful knock out of group Il gene cluster.
  • BL standard for BL21 (DE3) D standard for BL21 (DE3) ⁇ dadX ⁇ a/r strain.
  • A1-A3 are different colony numbers of BL21 (DE3) knock out candidates and B1 -B3 are knock out candidates of BL21 (DE3) ⁇ dadX ⁇ a/r strain.
  • Fig.4. is a comparison of the growth of host E. coli B strains in shake flask.
  • the symbols used refer to the following strains: •, BL21 (DE3); D, BL21 (DE3) ⁇ (7cps/W-/cpsFJ; — , BL21 (DE3) AdadXAalr; A, BL21 (DE3) AdadX AalrA(kpsM-kpsF).
  • Fig.5. shows the fermentation growth curve for the different E. coli B strains.
  • the symbols used refer to the following strains: ⁇ , BL21 (DE3); D, BL21 (DE3) ⁇ (7cps/W-/cpsFJ; — BL21 (DE3)/pNNC1 -g; o, ,BL21 (DE3) ⁇ f/cps/W-/cpsFj/pNNC1-g.
  • Fig.6 shows a SDS-polyacrylamide gel electrophoresis (PAGE) of hGH expression at different induction times: a) expression in E. coli B BL21 (DE3)/pN NC-Ig and b) expression in E. coli B BL21 (DE3) ⁇ (7cps/W-/cpsFJ/pNNC1 -g.
  • lanes 1-3 show different concentrations of hGH: 5 ⁇ g, 2.5 ⁇ g and 1.25 ⁇ g, respectively.
  • Lane 4 shows expression of hGH before induction and lanes 5-14 show the expression of hGH at different induction times from 1-10 hours, every hour. All the samples were normalized to the same loading OD.
  • Fig.7 shows the growth of the different E. coli B strains before and after induction of hGH expression.
  • the symbols used refer to the following strains: ⁇ :
  • BL21 (DE3) ⁇ dadX ⁇ a/r/pNNC1-1 h D: BL21 ⁇ dadX ⁇ a/r ⁇ (/ ⁇ s/W-/cpsFj/pNNC1 -1 h; ⁇ , BL21 (DE3) ⁇ dadX ⁇ a/r/pNNC1-1 h induced; — BL21 (DE3) ⁇ dadX ⁇ a/r ⁇ (7cps/W-/ ⁇ sFj/ pNNC1- 1 h induced.
  • Fig.8. shows the expression of hGH analyzed by SDS-PAGE at different induction times: a) E. coli B BL21 (DE3) ⁇ dadX ⁇ a/r/pNNC1 -1 h; b) E. coli B
  • lanes 1-3 show expression of hGH at different concentrations, 5 ⁇ g, 2.5 ⁇ g and 1.25 ⁇ g, respectively.
  • Lane 4 shows expression of hGH before induction and lanes 5-13 show the expression of hGH at induction times from 1-9 hours, every hour. All samples were normalized to the same loading OD.
  • Fig.9. shows the growth curve of E. coli B BL21 (DE3) ⁇ dadX ⁇ a/r ⁇ (7cps/W-/cpsFJ
  • /pNNC1 a.23 in a high cell-density fermentation in FDM1-2 medium.
  • Expression of hGH mutant, MEAE-hGH(L101 C) was induced by adding IPTG to a final concentration of 0.2mM when the cell density reached 70 OD 6 oo and continued to cultivate at 25 0 C. The final cell density reached approximately 100 OD 600 after 8 hours' induction.
  • Fig.10. shows expression of MEAE-hGH(L101 C) during high-cell density fermentation.
  • Lane 1 marker
  • lanes 2-4 purified hGH as the standard at concentrations of 5, 2.5, 1.25 ⁇ g, respectively
  • lanes 5-13 samples taken at different time intervals after being induced for 0,1 ,2,3,4,5,6,7 and 8 hours, respectively.
  • FIG.11 shows SDS-PAGE analysis of fermentation samples from expression of Ar- throbacter ureafaciens sialidase in E. coli B BL21 (DE3)zl(7cps/W-/cpsF).
  • Lane 1 marker; lane 2: pre-induction, homogenate; lane 3: post-induction, homogenate; lane 4: final sample, ho- mogenate; lane 5: pre-induction, insoluble fraction; lane 6: post-induction, insoluble fraction; lane 7: final sample, insoluble fraction; lane 8: pre-induction, soluble fraction; lane 9: post- induction, soluble fraction; lane 10: final sample, soluble fraction; lanes 11-12: sialidase standard (150 and 300 mg/l). All samples were 1 Ox diluted.
  • Fig.12. shows expression of FGF21 , amylin and leptin all from H. sapiens in E. coli B BL21 DE3 and in E. coli B BL21 DE3 ⁇ (kpsM-kpsF).
  • Lane 1 marker; lanes 3-8: expression in BL21 DE3; lanes 9-14: expression in BL21 DE3 ⁇ (kpsM-kpsF); lanes 3 and 9: uninduced;
  • Lanes 4 and 10 induced FGF21 ; lanes 5 and 11 : uninduced; lanes 6 and 12: induced amylin; lanes 7 and 13: uninduced; lanes 8 and 14: induced leptin.
  • the present invention relates to an E. coli B BL21 strain with an irreversibly inactivated group Il cluster providing a permanently safe strain for the production of peptides.
  • the impairment or inactivation of the group Il capsular gene cluster of the wildtype or any other strain of E. coli B BL21 (DE3) may be accomplished by any suitable technique including deletion of the whole cluster or a part thereof or by one or more point mutations in the gene cluster.
  • the E. coli strain of the present invention has the advantage of providing a more ro- bust and high yielding process for production of peptides, compared to commonly industrially used strains, such as E. coli K-12.
  • the E. coli B BL21 (DE3) used in the present invention may be a double knockout (2xKO) as described in WO2008/025744.
  • This E. coli B BL21 (DE3) strain has a deletion of 2 genes a/r and dadX which both code for D,L-alanine racemase.
  • This double knock out strain cannot grow without either the addition to the growth medium of D-alanine or without the presence of one of the racemase genes on a plasmid, which can supply the necessary D- alanine.
  • This 2xKO D-alanine auxotrophic E. coli strain referred to herein as E.
  • E. coli B BL21 (DE3) ⁇ a/r ⁇ dadX enables a non-antibiotic selection procedure for maintenance of plasmids in the cells.
  • one or more genes within the group Il capsular gene cluster of the wildtype E. coli B BL21 (DE3) or E. coli B BL21 (DE3) ⁇ a/r ⁇ dadX strain are deleted.
  • the E. coli strain B BL21 (DE3) is described by Studier and Moffat, [J. MoI. Biol. (1986) 189:113-130] and Studier et al. [Methods in Enzymology (1990) 185:60- 89] and is available from Stratagene and Novagen.
  • one or more genes within the group Il capsular gene cluster of the wildtype E. coli B BL21 (DE3) are deleted.
  • the gene or genes of choice for deletion within the group Il capsular gene cluster are those responsible for potential pathogenecity. Deletion of the entire 16kb group Il capsular gene cluster provides the prevention of the potential re-establishment of the pathogenic capsular phenotype.
  • Figure 1 shows the genes involved in group Il capsular gene cluster of capsular strains including region 1 genes kpsFEDUCS, region 2 ORF1 -4 and region 3 kpsM and kpsT. Any one of these genes or combinations thereof may be deleted.
  • the total deletion of the group Il capsular gene cluster means deletion of the 3 regions, ie., ⁇ (kpsM-kpsF).
  • the E. coli B strains obtained are E. coli B BL21 (DE3) ⁇ (kpsM- kpsF) and E. coli B BL21 (DE3)AalrAdadX ⁇ (kpsM-kpsF).
  • the present invention contemplates any modification sufficient to inactivate the group Il gene cluster, apart from the insertion element (IS1).
  • Bacteria are haploid organisms, i.e. they have only one chromosome, so recombination usually occurs only when new DNA is picked up from the environment, for example, through transformation. Furthermore, bacteria are not readily transformable with linear DNA, e.g., because of intracellular exonucleases that degrade linear DNA. However, recombination-proficient mutants lacking exonucleases of the recombination complex, are transformable with linear DNA. Recombinases are enzymes that catalyze natural recombination reactions and it has been shown that the ⁇ Red shows an enhanced recombination rate when compared with other recombination systems.
  • the method for deletion of the group Il capsular gene cluster of the strain of the present invention may be based on the Red- mediated recombination technology developed by Datsenko and Wanner [(2000) PNAS 97(12): 6640-6645] or other conventional methodologies.
  • Figure 2 shows a schematic view of how to delete the 16kb group Il capsular gene cluster of a strain of the present invention.
  • the first step in the method is the replacement of the 16 kb group Il capsular gene cluster with a selection marker that is generated by PCR by using primers with nucleotide homology extensions or regions, RA and LA (see Fig. 1). This is accomplished by Red-mediated recombination in these flanking homology extensions.
  • the second step in this method is the elimination of the selection marker by using a helper plasmid expressing the FLP recombinase, which acts on the directly repeated FRT (FLP recognition target) sites flanking the selection marker.
  • FRT FLP recognition target
  • the Red and FLP helper plasmids are cured by growth at 37°C, since they are temperature sensitive replicons.
  • the third step includes the confirmation of the deletion by PCR analysis.
  • Bacterial transformation may be referred to as a stable genetic change brought about by taking up DNA and competence refers to the state of being able to take up exogenous DNA.
  • Some bacteria are naturally capable of taking up DNA under laboratory conditions and such species carry sets of genes specifying machinery for bringing DNA across the cell's membrane or membranes, while others have to be induced by laboratory procedures in which cells are passively made permeable to DNA, using conditions that do not normally occur in nature.
  • Chilling cells in the presence of divalent cations such as Ca 2+ prepares the cell walls to become permeable to plasmid DNA.
  • Cells are incubated on ice with the DNA and then briefly heat shocked (e.g. 42 0 C for 30-120 seconds), which causes the DNA to enter the cell and is a well-known method in the art [Sambrook et al., A Laboratory Manual (1989) CSH].
  • Electroporation is another way to make holes in bacterial (and other) cells, by briefly shocking them with an electric field in the kV range. Plasmid DNA can enter the cell through these holes. This method is amenable to use with large plasmid DNA. Natural membrane-repair mechanisms will rapidly close these holes after the shock.
  • a plasmid DNA molecule must contain an origin of replication, which allows it to be replicated in the cell independently of the chromosome.
  • any targeted inactivation of part or the whole group Il gene cluster is detected by a selection marker so that the modified E. coli B BL21 strain clone can be identified and isolated.
  • the selection marker may be any suitable marker gene such as an antibiotic resis- tance gene or an auxotrophic marker.
  • Suitable antibiotic resistance genes are chloramphenicol, tetracyclin, ampicillin, kanamycin, vancomycin and erythromycin or any other representatives of the ⁇ -lactams, the aminoglycosides, the glycopeptides or the macrolide antibiotics.
  • cloning as used herein entails making multiple identical copies of a sequence of DNA.
  • the target DNA sequence is then inserted into a cloning vector. Because this vector originates from a self-replicating virus, plasmid, or higher organism cell when the appropriate size DNA is inserted the "target and vector DNA fragments are then ligated” and create a recombinant DNA molecule.
  • the recombinant DNA molecules are then put into a bacteria strain (usually E. coli) which produces several identical copies after transformation. Transformation is the DNA uptake mechanism possessed by bacteria. However, only one recombinant DNA molecule with a given replication origin can be established within a single bacteria cell, so each clone harbors just one DNA insert.
  • genome or “genetic composition” as used herein refer to the entire genetic matter, both structural and functional, which is inheritable and/or otherwise transferable, and is contained within an identified cell or microorganism.
  • the genome (genetic composition) of a microorganism is thus understood to include both chromosomal DNA and ex- trachromosomal DNA (e.g. plasmids, R factors and the like).
  • knockout means a genetically engineered bacteria strain in which one or more genes have been deleted or inactivated (have been “knocked out” of the organism). Knockout organisms are normally used as models for studying the role of genes which have been sequenced but have unknown functions. Knockout techniques may be used to remove undesired and/or potentially pathogenic genes from organisms of interest.
  • gene cluster means a set of two or more genes which are genetically and functionally coupled. Because populations from a common ancestor tend to possess varieties of the same gene clusters, they are useful for tracing back recent evolutionary history.
  • parent strain may be any bacterial strain from which the reduced genome strain is derived. Representative examples of parent strains according to the present invention include, but are not limited to, E. coli strains such as B or C, or a strain with a genome sequence substantially identical thereto.
  • level or “amount” of peptide produced in a given bacterial host cell may refer to a quantitative measure of peptide present or detectable, in accordance with the method of production selected, in the cell culture. For example, if the method of peptide production chosen results in an accumulation of peptide within the cell itself, then the level or amount of peptide produced will be that quantitative measure of peptide present with the cells themselves. If the method of peptide production involves secretion of the pep- tide, then the level of peptide production will be that quantitative measure of peptide present in the growth medium.
  • yield of peptide refers to a quantitative amount of an essentially pure peptide, which peptide is retrieved and/or purified essentially free from peptides naturally associated with the host strain.
  • a quantitative "yield” or “amount” of peptide produced by a bacterial host cell such as E. coli B BL21 strains
  • conventional peptide-specific methods such as immunoassay, high performance liquid chromatography (HPLC), enzymatic activity, spectrophotometric techniques, SDS-PAGE and the like can be employed.
  • expression control sequence means a promoter or array of transcription factor binding sites that direct transcription of a nucleic acid operatively linked thereto.
  • free end used in reference to a double-stranded nucleic acid may mean a linear nucleic acid with blunt free ends or sticky free ends, or a combination thereof.
  • gene used herein refers to a nucleic acid (e.g., DNA or RNA) that comprises a nucleic acid sequence encoding a polypeptide or precursor thereto.
  • the polypeptide can be encoded by a full length coding sequence or by any portion of the coding sequence so long as the desired activity or functional properties (e.g., enzymatic activity, ligand bind- ing, signal transduction, antigenicity etc.) of the full-length or fragment are retained.
  • the term also encompasses the sequences located adjacent to the coding region on both the 5' and 3' ends that contribute to the gene being transcribed into a full-length mRNA.
  • the term "gene” encompasses both cDNA and genomic forms of a gene.
  • a genomic form or clone of a gene may contain the coding region interrupted with non-coding sequences termed (e.g., introns).
  • open reading frame refers to a genetic sequence that does not contain stop codons.
  • peptide polypeptide or protein are used interchangeably herein and mean a peptide, polypeptide and protein, whether native or recombinant, as well as fragments, derivatives, homologues, variants and fusions thereof.
  • group Il knock out strains The growth of group Il knock out strains was evaluated in shake flasks and in high density fermentors and compared with their parental strains. The experiments showed that group Il knock out does not affect the growth of the cells in either strain background. Expression vector harbouring several peptides were transformed into group Il deleted strains for expression tests in a high density fermentor.
  • the peptides for production in the E. coli B strains of the present invention may be selected from the group consisting of, but not limited to hGH, glucagon-like peptides, interleukins, insulin analogs, wildtype adiponectin, FGF-21 , trypsin, aprotinin, amylin and leptin and analogs thereof.
  • Enzymes such as sialidase, transglutaminase (tGase), HRV (Human Rhino Virus) 3C protease, Tobacco Etch Virus (TEV) protease and variants thereof, and any other peptide or peptide for which an expression system is operable in E. coli.
  • the present invention also relates to a method of preparing human peptides as mentioned above.
  • a cloned wildtype peptide nucleic acid sequence is modified to encode the desired protein.
  • This modified sequence is then inserted into an expression vector, which is in turn transformed or transfected into host cells.
  • Operable expression systems typically include the conventional gene expression components set forth by Studier and Mof- fat [J. MoI. Biol. (1986) 189:1 13-130] and Studier et al. [Methods in Enzymology (1990) 185:60-89].
  • the peptides to be produced in the host cells can be synthesized as fusion peptides, secreted into the media or into the periplasmic space, produced in free form in the cyto- plasm, or accumulated in intracellular bodies such as in inclusion bodies. Purification of the peptides similarly involves the use of aforementioned conventional, publicly available methodologies which are adapted, again by conventional techniques, to the peptide of interest.
  • the present invention is suitable for the production of any type of peptide.
  • the peptide selected for production in the group Il knock out E. coli B BL21 host cells is human growth hormone (hGH) and in one embodiment the human growth hormone (hGH) is produced from a precursor peptide as described in EP217814, which describes how to make hGH from an hGH precursor.
  • the growth hormone is MEAE(SEQ ID 16)-hGH(L101C), which is a precursor of an hGH analogue, wherein the leucine at position 101 in the hGH molecule is substituted by cysteine.
  • the glucagon-like peptide is GLP-1 , GLP-1 and/or derivatives thereof.
  • glucagon-like peptide as used herein means the glucagon family of peptides, exendins and analogues thereof.
  • the glucagon family of peptides are encoded by the preproglucagon gene and encompasses three small peptides with a high degree of homology, i.e. glucagon (1 -29), GLP-1 (1 -37) and GLP-2 (1-33).
  • Exendins are peptides expressed in lizards and like GLP-1 , are insulinotropic. Examples of exendins are exendin-3 and exendin-4.
  • glucagon-like peptide analogue refers to a modified glu- cagon-like peptide wherein one or more amino acid residues of the glucagon-like peptide have been substituted by other amino acid residues and/or wherein one or more amino acid residues have been deleted from the glucagon-like peptide and/or wherein one or more amino acid residues have been added to the glucagon-like peptide. Such addition or deletion of amino acid residues can take place at any position of the peptide.
  • glycerol stocks of the strains a single colony was transferred into a 12ml test tube containing 2ml of LB medium with the appropriate antibiotics and grown at 37°C, with shaking at 220rpm for 2 hours.
  • the cells from a glycerol stock were streaked on LB plates with and without addition of ampicilin.
  • the overnight cells were washed with LB medium and inoculated into 500ml shake flasks containing 100ml each of fermentation complex medium with appropriate antibiotic concentration and grown at 37°C with shaking at 220rpm for 3-4 hours.
  • the cells were then inoculated into the reactor to a concentration of approximately 0.5 OD 600 .
  • Fermentations were conducted under aerobic conditions in a 5I bioreactor with an initial volume of fermentation complex medium of 2.5I, with appropriate antibiotics. At time zero, the reactor was inoculated to an OD 600 of approximately 0.5. The pH was maintained at
  • a fed-batch experiment was performed to compare the growth and peptide expression of group Il deleted strain with its parental strain in a high density fermentor.
  • the fermen- tor was charged with complex medium supplemented with 27g/l of glycerol.
  • the fermentor was inoculated to an OD 600 of 0.5.
  • Glycerol and yeast extract were added continuously in increasing steps as basic glycerol was consumed, which was indicated by an increase in dissolved oxygen.
  • the samples for determination of OD 600 and protein expression were collected from the fermentor and analyzed by spectrophotometer and by SDS-PAGE.
  • Induction of protein expression in bacteria is well known in the art.
  • the induction of protein expression is made by addition of isopropyl- ⁇ -D- thiogalactopyranoside (IPTG).
  • Plasmids and strains used in certain embodiments of the invention are listed in Tables 1 and 2, respectively.
  • the construction of plasmids was performed using standard mo- lecular biology techniques as described in Sambrook et al. [A Laboratory Manual (1989) CSH].
  • Example 1 Construction of replacement cassette The E. coli B BL21 (DE3) strain was used as a source of DNA for PCR amplification.
  • Oligonucleotide primers (LA_BL_GII_F/LA_BL_GII_R) (Table 3) were synthesized, targeting a 1001 bp region upstream of the 5' end of KpsM containing Sacll/EcoRI cloning site. This region was amplified from genomic DNA as left arm (L-A).
  • oligonucleotide primers (RA1_BL_GII_F/RA1_BL_GII_R) (Table 3) were synthesized, targeting a 1108bp region upstream of the 5' end of KpsF containing BamHI/Sacl cloning site. PCR products of the left arm and the right arm were generated.
  • the DNA amplification reaction was performed in a thermal cycler, using a program that included the following parameters: denaturation at 94°C for 50s, annealing at 57°C for 60s and primer extension at 72°C for 60s, for a total of 30 cycles.
  • the PCR amplification product with correct band size was observed by gel electrophoresis on a 1% agarose gel, from which 50 ⁇ l of the amplified product were extracted from the gel and used to construct a replacement fragment.
  • a list of oligonucleotide sequences is shown in Table 3.
  • the amplified left arm was gel-purified and ligated into plasmid pEZ-T, resulting in plasmid pEZ-T-LA.
  • the restriction enzymes EcoRI/BamHI digested the FRT-cat-FRT frag- merit which was ligated into EcoRI/BamHI site of pEZ-T-LA, resulting plasmid pEZ-T-LA- FRT-cat-FRT.
  • the amplified right arm was ligated into plasmid pGEM-T and was digested with BamHI/Sacl.
  • the BamHI/Sacl-digested DNA fragment, which carries an ampicillin resistance gene was ligated into plasmid pEZ-T-LA-FRT-cat-FRT.
  • the chloramphenicol resis- tance gene provides a selectable marker for identifying the replacement fragment.
  • the resulting plasmid pEZ-T-LA-FRT-cat-FRT-RA was used to produce a knockout BL21 (DE3) strain.
  • Example 2 Production of a knock out BL21(DE3) strain E. coli BL21 (DE3) was grown in LB medium overnight at 37°C and the heat shock competent cells of BL21 (DE3) were prepared by standard methods. The plasmid pKD46 was transformed into BL21 (DE3) competent cells and the transformed cells were grown to 0.4 OD ⁇ oo nm in LB broth supplemented with 100 ⁇ g/ml ampicillin at 30 0 C. The expression of Red recombinase was induced by L -arabinose (final concentration 1 mmol/l) for one hour.
  • BL21 (DE3) competent cells For group Il gene cluster knock out, 500ng of replacement fragment amplified from pEZ-T-LA-FRT-cat-FRT-RA were transferred into BL21 (DE3) competent cells by electropora- tion.
  • the electrotraporation competent cells were prepared by standard methods. Recovery of the cells was carried out at 30 0 C for 1.5 hours.
  • the cells were plated on LB agar supplemented with 8 ⁇ g/ml chloramphenicol. Chloramphenicol-resistant colonies of BL21 (DE3) ⁇ kpsM-kpsF)::cat were formed after overnight incubation at 30°C.
  • oligonucleotide primers were designed with homology to the outside of the left and the right arms of the group Il gene cluster. Lacking the flanking sequences of E. coli B BL21 (DE3) outside the 18kb, the published sequence of E. coli 536 (Accession no. CP 000247.1 ) was used for design of the PCR screening primers, assuming a similar location of group Il cluster in the 2 genomes, based on high homology in the near flanking regions. Three chloramphenicol-resistant colonies were tested for gene replacement.
  • Phenotype test of chloramphenicol-resistant colonies was performed by growth in LB+Cm (25 ⁇ g/ml) for at least two generations. All of the chloramphenicol-resistant colonies could grow very well in LB+Cm (25 ⁇ g/ml) medium. Chloramphenicol-resistant D-alanine auxotrophic strains have also been tested in the same process with supplementation of D- alanine.
  • Oligonucleotide primers (LA_SEQ_F1/Cat_ID_R) were used to amplify a band containing left arm and part of cat gene (size 1686bp), and oligonucleotide primers (RA_SEQ_R1/Cat_SEQ_F) were used to amplify a band containing right arm and part of the cat gene (size 1578bp). For three chloramphenicol-resistant colonies right size of the bands indicated that the 16kb group Il gene cluster had been replaced by the cat gene (Fig.3).
  • the chloramphenicol-resistant strains E. coli B BL21 (DE3) ⁇ (kpsM-kpsF): .cat and BL21 (DE3) ⁇ dadX ⁇ alr ⁇ (kpsM-kpsF): :cat were confirmed by their phenotype and PCR screening, confirming that the group Il capsular gene cluster had been replaced by the cat gene.
  • Example 3 Elimination of drug-resistant marker and characterization of group Il knock out strain
  • the elec- troporation competent cells of the two knock out strains were prepared by standard methods.
  • the plasmid pCP20 (Cm R , Amp R ) was transformed into the two knock out competent strains.
  • the elimination of the drug-resistant marker was carried out by growing the transformed cells in SOC broth at 30 0 C for 1 hour with gentle shaking. The single colonies of ampicillin resistant candidate clones on the plate were selected after overnight culture at 3O 0 C. The candidate clones were grown in LB medium only or LB medium supplemented with D-alanine at 37 0 C for three hours, to eliminate the plasmid pCP20. Five single colonies, which appeared on LB medium only or LB medium supplemented with D-alanine, were further characterized by PCR screening.
  • Phenotype testing of cat elimination strains was performed by growing the single colonies in LB, LB+Cm (8 ⁇ g/ml) and LB+Amp. All the cat elimination colonies could grow only on LB medium. For cat eliminated D-alanine auxotrophic strains, all five colonies could grow only in LB medium with supplementary D-alanine. Thus, the cat gene had been eliminated.
  • Oligonucleotide primers (LA_SEQ_F2/RA_SEQ_R1) were used to amplify a band containing left arm and right arm. For all the single colonies, the appearance of a 2381 bp band indicated that the cat gene had been eliminated.
  • BL21 (DE3) ⁇ dadX ⁇ alr ⁇ (kpsM-kpsF) were confirmed by their phenotype and PCR screening.
  • Glycerol stocks of both strains were prepared for storage.
  • E. coli B BL21(DE3) and B BL21 (DE3)2 ⁇ (7cps/W-/cpsFJ cells from frozen stocks were grown on LB plate overnight at 37°C. Appropriate amounts of cells washed out from overnight plates were inoculated into 250ml baffled shake flasks containing 25ml LB medium to a concentration of approximately 0.05 OD 600 . The cells were grown at 37°C with shaking at 220rpm for 8 hours. A sample of each strain was taken every 14 hour to compare the growth of the cells at OD 600 .
  • Fig.4 show that growth of BL21 ⁇ (7cps/W-/cpsF) over time was identical to its parental strain BL21 (DE3) in shake flask using LB medium. The same conclusion could be drawn when comparing BL21 (DE3) AdadX AaIr A ⁇ kpsM-kpsF) with BL21 (DE3) AdadX AaIr.
  • Example 5 Comparison of growth and MEAE-hGH expression between host strain BL21(DE3) and BL21(DE3) ⁇ kpsM-kpsF) in high density fermentation
  • E. coli B BL21 (DE3)4(/ ⁇ s/W-/cpsF) cells from frozen stock were grown on LB plates. Heat shock competent cells of the knock out strain were prepared by standard methods.
  • the plasmid pNNC1 -g (pET11 d-MEAE-hGH(Amp R )) containing an expression cassette of hGH was transformed into B BL21 (DE3)2 ⁇ (7cps/W-/cpsF) competent cells, from which a glycerol stock of transformed cells was prepared.
  • E. coli B BL21 (DE3)/pNNC1 -g and B BL21 (DE3) ⁇ (/cps/W-/cpsFj/pNNC1-g are efficient in the production of hGH as seen on SDS-PAGE.
  • the increase in hGH expression level follows increasing induction time from 1 to 10 hours shown on the SDS-PAGE gel (Fig.6).
  • the ability of the two strains to produce hGH was identical, i.e., no significant difference was observed in the expression of hGH by host strain B BL21 (DE3) ⁇ (kps/W-/cpsF) when compared to B BL21 (DE3), harbouring the gene Il cluster.
  • Example 6 Comparison of growth and MEAE-hGH expression between host strain BL21(DE3) ⁇ a/r ⁇ dadXand BL2' ⁇ DEZ)AalrAdadXA(kpsM-kpsF) in high density fermentation
  • E. coli B BL21 (DE3) AdadX ⁇ alrA(kpsM-kpsF) cells from frozen stock were grown in LB medium supplemented with D-alanine.
  • Heat shock competent cells of the knock out strain were prepared by standard methods.
  • the pNNC1 -1 h (pET11 d-MEAE-hGH and alrP-alrCD (Amp R )) containing a D-alanine complementary gene was digested using Aatll/Psil, following by blunt end and self-ligation of the plasmid, resulting in a bla- plasmid for selection of the air gene on the plasmid.
  • the plasmid pNNC1-1 h (pET11 d-MEAE-hGH, alrP-alrCD, bla-) was transformed into BL2'] (DE3)AdadX ⁇ alrA(kpsM-kpsF) competent cells. Colonies appearing overnight on LB plate without supplementary D-alanine were isolated for the preparation of glycerol stocks.
  • BL21 (DE3) ⁇ dadX ⁇ a/r ⁇ (/ ⁇ s/W-/cpsF)/pNNC1-1 h The cell density reached approximately 120 OD 600 in the uninduced state.
  • Expression of hGH was carried out by adding IPTG to a concentration of 1 mM when the growth of cells reached 80 OD 600 . After 9 hours of IPTG induction at 3O 0 C, the cell density reached approximately 100 OD 600 .
  • E.coli B BL21 (DE3) ⁇ dadX ⁇ a/r/pNNC1-1 h and B BL21 (DE3) ⁇ dadX ⁇ a/r ⁇ (/cps/W- kpsF) /pNNC1-1 h were efficient in production of hGH as can be seen from the results by SDS-PAGE (Fig.8). Increase in hGH expression level follows increasing induction time. Both strains had identical ability to produce hGH.
  • Example 7 Evaluation of cell growth and expression of MEAE-hGH(L101C) using host strain E. coli B BL21(DE3) ⁇ alr ⁇ dadX ⁇ (/ ⁇ sM-/ ⁇ sF) in high-cell density fermentation
  • E. coli B BL21 (DE3) ⁇ dadX ⁇ alrA(kpsM-kpsF) cells from frozen stock were grown in LB medium supplemented with D-alanine. Competent cells of this triple knock-out strain for transformation using heat-shock method were prepared by standard methods.
  • the plasmid pNNC1 a.23 (pETH d-MEAE-hGH(L101C) encoding MEAE-hGH(L101C) and containing alrP- alrCD for complementing the D-alanine-deficiency of the host cell was digested using Aat ⁇ /Psi ⁇ , followed by end-blunting and self-ligation for removal of the ⁇ -lactamase gene.
  • pNNC1a.23 The resulting plasmid, pNNC1a.23 (pET1 1d-MEAE-hGH, air, bla ), was transformed into the host cell, BL2'] (DE3)AdadX ⁇ alrA(kpsM-kpsF) , by heat-shock method.
  • a single colony grown up from LB plate without supplementation with D-alanine was selected to prepare the glycerol stocks for storage at -80 0 C.
  • Example 8 Expression of Arthrobacter ureafaciens sialidase in E. coli BL21(DE3) ⁇ (kpsM-kpsF)
  • Arthrobacter ureafaciens sialidase (AUS, 53.4 kDa theoretical mass) was produced in Escherichia coli BL2'] (DE3) ⁇ (kpsM-kpsF) with a C-terminal His-tag.
  • pET-24a Novagen
  • the synthetic gene was introduced into the pET-24a expression vector as a Xbal- Xhol fragment to produce the AUS expression vector pLLC028.
  • the resulting vector was transformed into competent BL21 (DE3) ⁇ (kpsM-kpsF) and transformants were preserved in glycerol at -80 0 C.
  • One cryotube of the frozen initial cell clone was used to inoculate two yeast extract media (yeast extract 5 g/l, glucose 10 g/l, agar 20 g/l) agar flask.
  • the agar medium contained kanamycin for selection.
  • Incubation was at 30 0 C for 25 hours. After incubation, the cells were washed from the agar surface using sterile 0.9% NaCI solution.
  • a 10 I fermentation was inoculated using pre-culture from two agar flasks. The volume of the obtained inoculum was 75 m, and the OD 6 oo nm was 4.3, resulting in a start OD 6 oo nm in the fermentor of approximately 0.03.
  • the fermentation was carried out in a 20 I stainless steel vessel with a start working volume of 10 I.
  • the fermentation starts with a 8 hour long batch phase on a complex medium containing 40 g/l yeast extract, 15 g/l glycerol (87%), salts and trace metals, followed by glycerol feeding at a predetermined profile.
  • fermentation temperature was 37°C.
  • the temperature was lowered to 30 0 C.
  • the inducer IPTG was added at 0.1 mM in order to induce protein expression.
  • the duration of induction can be up to 22 hours.
  • the recovery process consists of cen- trifugation, high pressure homogenisation and crossflow microfiltration using Sartocon Slice Cassettes with a pore size of 0.2 ⁇ m.
  • the AUS fermentation was analysed using SDS-PAGE and an enzymatic activity assay.
  • SDS-PAGE analysis revealed that the expressed sialidase appears both in the soluble and pellet fraction after bead-milling.
  • Figure 11 shows a typical fermentation result from a 10L batch run at 30°C induction temperature and 0.1 mM IPTG.
  • Example 9 Expression of human fibroblast growth factor 21 (FGF21) in BL21 DE3 and BL21 DE3 ⁇ (kpsM-kpsF)
  • the native polypeptide is synthesised with a signal peptide (in italics below) of 28 amino acids for secretion, while the mature FGF21 polypeptide consists of the remaining 181 amino acids (SEQ ID 13):
  • a 550 bp coding region including at the 3'-end the ATG codon for Met, as well as Nde1 and BamH1 restriction sites at the 3'- and 5'-ends, respectively, were inserted into the expression vector pET 11c (Novagen) in Nde1 -BamH1 under control of the phage T7 promoter, and transformed into E.coli B BL21 (DE3) and into E.coli B BL21 DE3 ⁇ (kpsM-kpsF).
  • the cells were grown in LB amp 100 ug/ml to OD 450 0.5, and expression was induced with 0.3 mM IPTG for 4 hours at 37°C. Crude extracts of cells were made by sonication for analysis of FGF21 expression.
  • the Coomassie stained SDS-PAGE gel in Fig. 12 shows equally successful expres- sion of FGF21 in E.coli B BL21 DE3 and E.coli B BL21 DE3 ⁇ (kpsM-kpsF).
  • MW molecular weight
  • the current example shows that the yield for FGF21 is not affected by the genetic manipulation of the host strain.
  • Example 10 Expression of human amylin in BL21 DE3 and BL21 DE2 ⁇ (kpsM-kpsF)
  • the sequence of the 37 aminoacid amyloid peptide amylin was published by Cooper et al. in Proc. Natl. Acad. Sci. (84) : 8628-8632, (1987). The gene was cloned and fused it N- terminally to a ribosomal protein RL23 from Thermotoga maritima.
  • the 146 amino acids fusion protein has the following sequence (SEQ ID 14):
  • the fusion gene was cloned as described in example 9 as a 450 bp Nde1 - BamH1 fragment into pET 1 1c under control of the T7 promoter, and the plasmid was transformed into BL21 DE3 and BL21 DE3 ⁇ (kpsM-kpsF).
  • Example 11 Expression of human leptin in BL21 DE3 and BL21 DE2 ⁇ (kpsM-kpsF)
  • the sequence of the 146 amino acids long human leptin was published by Masuzaki et al. in Diabetes (44): 855-858 (1995).
  • the protein is secreted in humans with the addition of a 21 amino acids signal peptide.
  • the mature leptin was expressed intracellular ⁇ in E. coli has the following sequence (SEQ ID 15):
  • the leptin gene was cloned as described in example 9 as a 450 bp Nde1 -BamH1 fragment into pET11c under control of the T7 promoter, and the plasmid was transformed into BL21 DE3 and BL21 DE3 ⁇ (kpsM-kpsF).
  • group Il capsular gene cluster does not affect the growth of the cells in any growth conditions. It can also be concluded that group Il capsu- lar gene cluster elimination does not affect protein expression. Therefore, a more safe strain with complete removal of group Il capsular gene cluster is hereby produced for using E. coli B BL21 (DE3) as commercial host strain for therapeutic protein production. The operation of deleting group Il capsular genes in E. coli B BL21 (DE3) brings it into the same safety category as E. coli K12, since the group Il gene cluster is the only significant difference between the two strains.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Wood Science & Technology (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biotechnology (AREA)
  • Toxicology (AREA)
  • General Engineering & Computer Science (AREA)
  • Endocrinology (AREA)
  • Biomedical Technology (AREA)
  • Microbiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Child & Adolescent Psychology (AREA)
  • Obesity (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)

Abstract

The present invention relates to a novel non-pathogenic Escherichia coli (E. coli) B BL21 strain comprising a deletion of group Il capsular gene cluster, and the use thereof for the production of peptides.

Description

E . COLI BL21 STRAIN LACKING A FUNCTIONAL GROUP Il CAPSULAR GENE CLUSTER
FIELD OF THE INVENTION
The present invention relates to the manipulation of Escherichia coli (E. coli) genome, to an improved non-pathogenic E. coli B strain, and its use thereof for the production of peptides and proteins.
BACKGROUND OF THE INVENTION
Bacteria have been used to produce a wide range of commercial products. The use of genetically engineered bacteria like E. coli as host cells for the production of biological reagents such as peptides and nucleic acids in the laboratory and industry, is well-known in the art. Bacteria in their natural environment are exposed to many conditions that are not normally experienced in standard industrial or laboratory growth, and thus their genomes carry a large number of condition-dependent, stress-induced genes or otherwise non-essential genes which may not be needed in industrial or laboratory use of the organisms, or may even be unwanted. Bacterial pathogens contain virulence factors such as capsular polysaccharides at the cell surface, which mediate the interactions between the bacterium and its immediate environment and have a number of functions directly related to their pathogenicity. More than 80 serologically and chemically distinct types of polysaccharide capsules have been described in E. coli and termed K antigens. The polysaccharide capsules have been classified into 4 groups, of which the group Il capsular polysaccharides are similar to those of Haemophilus influenzae and Neisseria meningitides. The group Il capsular gene clusters contain most of the capsular types associated with invasive disease and have a conserved genetic organisation consisting of three functional regions. Regions 1 and 3 are conserved among group Il gene clusters and encode peptides necessary for the transport of the polysaccharide from its site of synthesis to the cell surface, while region 2 is serotype specific and encodes the enzymes responsible for biosynthesis and polymerization of the individual monosaccharides that comprise the particular polysaccharide. Region 1 comprises 6 genes kpsFEDUCS, organised in a single transcriptional unit. Region 2 is serotype specific and differs among group 2 antigens. Region 3 contains 2 genes kpsM and kpsT organised in a single transcrip- tional unit [Andreishcheva et al. Gene (2006) 384: 113-119].
The E. coli strains K-12 and B are not encapsulated and are commonly used strains for the production of peptides. The E. coli K-12 genome has been fully sequenced and does not contain any capsular genes. It has been found that E. coli B BL21 (DE3), which is a pre- ferred strain for high-yield expression of recombinant peptides, contains a cluster of genes coding for group Il capsular polysaccharides and it is thought that an ancestor of E. coli B must have acquired these capsular genes by horizontal transfer. The K antigens located in the capsule of E. coli are often associated with a pathogenic phenotype in strains harbouring the functional form of the genes. It has been shown that in E. coli B BL21 , the region 2 of group Il capsular gene cluster has become inactive by an insertion element (IS1 ), preventing the production of the antigen, while region 1 and 3 supporting export and presentation of wildtype capsular antigen, are still intact [Andreishcheva et al. Gene (2006) 384: 1 13-119]. However, there is a theoretical possibility of re-establishing a functional group Il capsular gene cluster, e.g. if the IS1 in region 2 is lost and thereby the group Il cluster may be reestablished. Alternatively, if the IS1 mutated region is exchanged by an exogenous wildtype region 2, the group Il cluster may also be re-established.
The present invention provides an E. coli B BL21 (DE3) strain with permanent knock out (KO) of the group Il capsular gene cluster, bringing this strain into the same safety class as other commercially important strains such as E. coli K-12.
SUMMARY OF THE INVENTION
The present invention relates to an E. coli B BL21 strain having an irreversibility inactivated group Il capsular gene cluster.
In one embodiment E. coli B BL21 strain is characterised by having a total or partial deletion of the group Il capsular gene cluster.
In one embodiment E. coli B BL21 strain is characterised by having total deletion of the group Il capsular gene cluster.
In one embodiment E. coli B BL21 strain is characterised by having a partial deletion of the group Il capsular gene cluster. In a further embodiment, the E. coli B BL21 strain is characterised by having one or more point mutations in the group Il capsular gene cluster.
In another embodiment, the E. coli strain is characterised by having at least 5% of group Il capsular gene cluster permanently inactivated by deletion.
In another embodiment, the E. coli strain is characterised by having at least 25% of group Il capsular gene cluster permanently inactivated by deletion.
In another embodiment, the E. coli strain is characterised by having at least 40% of group Il capsular gene cluster permanently inactivated by deletion.
In another embodiment, the E. coli strain is characterised by having at least 55% of group Il capsular gene cluster permanently inactivated by deletion. In another embodiment, the E. coli strain is characterised by having from 75% to 100% of the group Il capsular gene cluster permanently inactivated by deletion.
In another embodiment, the E. coli strain is characterised by having at least 85% of group Il capsular gene cluster permanently inactivated by deletion. In another embodiment, the E. coli strain is characterised by having at least 95% of group Il capsular gene cluster permanently inactivated by deletion.
In one embodiment, 30% of the group Il capsular gene cluster is deleted.
In another embodiment, 50% of the group Il capsular gene cluster is deleted.
In another embodiment, 70% of the group Il capsular gene cluster is deleted. In another embodiment, 80% of the group Il capsular gene cluster is deleted.
In another embodiment, 90% of the group Il capsular gene cluster is deleted.
In one embodiment, the E. coli strain is E. coli B BL21 (DE3) and in a further embodiment the E. coli strain is E. coli B BL21 (DE3)ΔdadXΔa/r.
The present invention also contemplates a method for producing an E. coli B strain wherein the group Il capsular gene cluster is deleted by a method comprising the steps of: a. replacing of group Il capsular gene cluster by a selection marker, b. eliminating the selection marker and c. confirming the deletion by PCR analysis.
In one embodiment, the selection marker is an antibiotic resistance gene. In another embodiment, the antibiotic resistance gene is selected from the group consisting of chloramphenicol, tetracyclin, ampicillin, kanamycin, vancomycin and erythromycin.
In yet another embodiment, the antibiotic resistance gene is chloramphenicol. The invention is also related to a method for producing a peptide by introducing an expression vector comprising a DNA sequence encoding a peptide in the E. coli strain of the present invention.
In one embodiment the present invention also contemplates a method for the production of a peptide comprising culturing an E. coli B strain according to the present invention, in a suitable culture medium under condition for the expression of DNA encoding the said peptide. The peptide to be expressed by the expression vector may be any peptide which can be expressed in E. coli. Representative examples of such peptides are hGH, glu- cagon-like peptides, interleukins, insulin analogues, wildtype adiponectin, FGF-21 , trypsin, aprotinin, amylin and leptin and analogs thereof, as well as enzymes such as sialidase, transglutaminase (tGase), HRV (Human Rhino Virus) 3C protease, Tobacco Etch Virus (TEV) protease and variants thereof. In one embodiment, the E. coli strain of the present invention comprises an expression vector comprising a DNA sequence encoding a peptide.
In one embodiment, the peptide to be produced is hGH. In another embodiment, the peptide to be produced is FGF-21. In another embodiment, the peptide to be produced is amylin.
In another embodiment, the peptide to be produced is leptin. In another embodiment, the peptide to be produced is sialidase.
DESCRIPTION OF THE DRAWINGS
Fig.1. shows the genetic organisation of the E. coli B BL21 (DE3) capsular gene cluster with non-coding flanking regions. Open reading frames (ORFs) of the B BL21 (DE3) capsular gene cluster (large arrows); direction of transcription (arrowheads): region 1 genes (grey arrows); region 2 ORFs (black arrows); region 3 genes (white arrows); IS1 element (white box). [Andreishcheva et al. Gene (2006) 384: 113-1 19]. Small arrows indicate the position of the non-coding left arm (LA) and the right arm (RA). Fig.2. is a schematic representation of the workflow of the group Il capsular gene cluster knock out method: a) replacement of group Il capsular gene cluster by an antibiotic resistance gene and b) elimination of the antibiotic resistance gene.
Fig.3. shows PCR screening of knock out candidates. The right size of 1686bp (LA+part of cat, A1-A3 in upper panel, B1-B3 in lower panel) and 1578bp (RA+part of cat, A1-A3 in upper panel, B1 -B3 in lower panel) amplified from knockout candidates (but not its parental strain) (BL or D) indicate a successful knock out of group Il gene cluster. For the negative control, only the parental strain has a band with size around 3kb but not group Il knock out strain. BL standard for BL21 (DE3), D standard for BL21 (DE3)ΔdadXΔa/r strain. A1-A3 are different colony numbers of BL21 (DE3) knock out candidates and B1 -B3 are knock out candidates of BL21 (DE3)ΔdadXΔa/r strain.
Fig.4. is a comparison of the growth of host E. coli B strains in shake flask. The symbols used refer to the following strains: •, BL21 (DE3); D, BL21 (DE3)Δ(7cps/W-/cpsFJ; — , BL21 (DE3) AdadXAalr; A, BL21 (DE3) AdadX AalrA(kpsM-kpsF).
Fig.5. shows the fermentation growth curve for the different E. coli B strains. The symbols used refer to the following strains: ♦, BL21 (DE3); D, BL21 (DE3)Δ(7cps/W-/cpsFJ; — BL21 (DE3)/pNNC1 -g; o, ,BL21 (DE3)Δf/cps/W-/cpsFj/pNNC1-g.
Fig.6. shows a SDS-polyacrylamide gel electrophoresis (PAGE) of hGH expression at different induction times: a) expression in E. coli B BL21 (DE3)/pN NC-Ig and b) expression in E. coli B BL21 (DE3)Δ(7cps/W-/cpsFJ/pNNC1 -g. In both a) and b), lanes 1-3 show different concentrations of hGH: 5μg, 2.5μg and 1.25μg, respectively. Lane 4 shows expression of hGH before induction and lanes 5-14 show the expression of hGH at different induction times from 1-10 hours, every hour. All the samples were normalized to the same loading OD.
Fig.7. shows the growth of the different E. coli B strains before and after induction of hGH expression. The symbols used refer to the following strains: ♦:
BL21 (DE3)ΔdadXΔa/r/pNNC1-1 h; D: BL21ΔdadXΔa/rΔ(/φs/W-/cpsFj/pNNC1 -1 h; Δ, BL21 (DE3)ΔdadXΔa/r/pNNC1-1 h induced; — BL21 (DE3)ΔdadXΔa/rΔ(7cps/W-/φsFj/ pNNC1- 1 h induced.
Fig.8. shows the expression of hGH analyzed by SDS-PAGE at different induction times: a) E. coli B BL21 (DE3)ΔdadXΔa/r/pNNC1 -1 h; b) E. coli B
BL21 (DE3)ΔdadXΔa/rΔ(7cps/W-/cpsFJ /pNNC1-1 h. In both a) and b), lanes 1-3 show expression of hGH at different concentrations, 5μg, 2.5μg and 1.25μg, respectively. Lane 4 shows expression of hGH before induction and lanes 5-13 show the expression of hGH at induction times from 1-9 hours, every hour. All samples were normalized to the same loading OD. Fig.9. shows the growth curve of E. coli B BL21 (DE3)ΔdadXΔa/rΔ(7cps/W-/cpsFJ
/pNNC1 a.23 in a high cell-density fermentation in FDM1-2 medium. Expression of hGH mutant, MEAE-hGH(L101 C), was induced by adding IPTG to a final concentration of 0.2mM when the cell density reached 70 OD6oo and continued to cultivate at 250C. The final cell density reached approximately 100 OD600 after 8 hours' induction. Fig.10. shows expression of MEAE-hGH(L101 C) during high-cell density fermentation. Lane 1 : marker; lanes 2-4: purified hGH as the standard at concentrations of 5, 2.5, 1.25μg, respectively; lanes 5-13: samples taken at different time intervals after being induced for 0,1 ,2,3,4,5,6,7 and 8 hours, respectively. Arrow indicates the target protein, MEAE- hGH(L101 C). Fig.11. shows SDS-PAGE analysis of fermentation samples from expression of Ar- throbacter ureafaciens sialidase in E. coli B BL21 (DE3)zl(7cps/W-/cpsF). Lane 1 : marker; lane 2: pre-induction, homogenate; lane 3: post-induction, homogenate; lane 4: final sample, ho- mogenate; lane 5: pre-induction, insoluble fraction; lane 6: post-induction, insoluble fraction; lane 7: final sample, insoluble fraction; lane 8: pre-induction, soluble fraction; lane 9: post- induction, soluble fraction; lane 10: final sample, soluble fraction; lanes 11-12: sialidase standard (150 and 300 mg/l). All samples were 1 Ox diluted.
Fig.12. shows expression of FGF21 , amylin and leptin all from H. sapiens in E. coli B BL21 DE3 and in E. coli B BL21 DE3Δ(kpsM-kpsF). Lane 1 : marker; lanes 3-8: expression in BL21 DE3; lanes 9-14: expression in BL21 DE3 Δ(kpsM-kpsF); lanes 3 and 9: uninduced; Lanes 4 and 10: induced FGF21 ; lanes 5 and 11 : uninduced; lanes 6 and 12: induced amylin; lanes 7 and 13: uninduced; lanes 8 and 14: induced leptin.
DESCRIPTION OF THE INVENTION
The present invention relates to an E. coli B BL21 strain with an irreversibly inactivated group Il cluster providing a permanently safe strain for the production of peptides. The impairment or inactivation of the group Il capsular gene cluster of the wildtype or any other strain of E. coli B BL21 (DE3) may be accomplished by any suitable technique including deletion of the whole cluster or a part thereof or by one or more point mutations in the gene cluster.
The E. coli strain of the present invention has the advantage of providing a more ro- bust and high yielding process for production of peptides, compared to commonly industrially used strains, such as E. coli K-12.
The E. coli B BL21 (DE3) used in the present invention may be a double knockout (2xKO) as described in WO2008/025744. This E. coli B BL21 (DE3) strain has a deletion of 2 genes a/r and dadX which both code for D,L-alanine racemase. This double knock out strain cannot grow without either the addition to the growth medium of D-alanine or without the presence of one of the racemase genes on a plasmid, which can supply the necessary D- alanine. This 2xKO D-alanine auxotrophic E. coli strain, referred to herein as E. coli B BL21 (DE3)Δa/rΔdadX, enables a non-antibiotic selection procedure for maintenance of plasmids in the cells. In one embodiment of the present invention, one or more genes within the group Il capsular gene cluster of the wildtype E. coli B BL21 (DE3) or E. coli B BL21 (DE3)Δa/rΔdadX strain are deleted. The E. coli strain B BL21 (DE3) is described by Studier and Moffat, [J. MoI. Biol. (1986) 189:113-130] and Studier et al. [Methods in Enzymology (1990) 185:60- 89] and is available from Stratagene and Novagen. In one embodiment of the present invention, one or more genes within the group Il capsular gene cluster of the wildtype E. coli B BL21 (DE3) are deleted. In another embodiment of the present invention, one or more genes within the group Il capsular gene cluster of E. coli B BL21 (DE3)Δa/rΔdadXare deleted.
In another embodiment, the gene or genes of choice for deletion within the group Il capsular gene cluster are those responsible for potential pathogenecity. Deletion of the entire 16kb group Il capsular gene cluster provides the prevention of the potential re-establishment of the pathogenic capsular phenotype. Figure 1 shows the genes involved in group Il capsular gene cluster of capsular strains including region 1 genes kpsFEDUCS, region 2 ORF1 -4 and region 3 kpsM and kpsT. Any one of these genes or combinations thereof may be deleted.
The total deletion of the group Il capsular gene cluster, means deletion of the 3 regions, ie., Δ(kpsM-kpsF). The E. coli B strains obtained are E. coli B BL21 (DE3) Δ(kpsM- kpsF) and E. coli B BL21 (DE3)AalrAdadX Δ(kpsM-kpsF).
In one embodiment, the present invention contemplates any modification sufficient to inactivate the group Il gene cluster, apart from the insertion element (IS1).
Bacteria are haploid organisms, i.e. they have only one chromosome, so recombination usually occurs only when new DNA is picked up from the environment, for example, through transformation. Furthermore, bacteria are not readily transformable with linear DNA, e.g., because of intracellular exonucleases that degrade linear DNA. However, recombination-proficient mutants lacking exonucleases of the recombination complex, are transformable with linear DNA. Recombinases are enzymes that catalyze natural recombination reactions and it has been shown that the λ Red shows an enhanced recombination rate when compared with other recombination systems. The method for deletion of the group Il capsular gene cluster of the strain of the present invention may be based on the Red- mediated recombination technology developed by Datsenko and Wanner [(2000) PNAS 97(12): 6640-6645] or other conventional methodologies.
Figure 2 shows a schematic view of how to delete the 16kb group Il capsular gene cluster of a strain of the present invention. In one embodiment, the first step in the method is the replacement of the 16 kb group Il capsular gene cluster with a selection marker that is generated by PCR by using primers with nucleotide homology extensions or regions, RA and LA (see Fig. 1). This is accomplished by Red-mediated recombination in these flanking homology extensions. After selection, the second step in this method is the elimination of the selection marker by using a helper plasmid expressing the FLP recombinase, which acts on the directly repeated FRT (FLP recognition target) sites flanking the selection marker. The Red and FLP helper plasmids are cured by growth at 37°C, since they are temperature sensitive replicons. The third step includes the confirmation of the deletion by PCR analysis. Bacterial transformation may be referred to as a stable genetic change brought about by taking up DNA and competence refers to the state of being able to take up exogenous DNA. Some bacteria are naturally capable of taking up DNA under laboratory conditions and such species carry sets of genes specifying machinery for bringing DNA across the cell's membrane or membranes, while others have to be induced by laboratory procedures in which cells are passively made permeable to DNA, using conditions that do not normally occur in nature. Chilling cells in the presence of divalent cations such as Ca2+ (in CaCI2) prepares the cell walls to become permeable to plasmid DNA. Cells are incubated on ice with the DNA and then briefly heat shocked (e.g. 42 0C for 30-120 seconds), which causes the DNA to enter the cell and is a well-known method in the art [Sambrook et al., A Laboratory Manual (1989) CSH]. Electroporation is another way to make holes in bacterial (and other) cells, by briefly shocking them with an electric field in the kV range. Plasmid DNA can enter the cell through these holes. This method is amenable to use with large plasmid DNA. Natural membrane-repair mechanisms will rapidly close these holes after the shock. In order to persist and be stably maintained in the cell, a plasmid DNA molecule must contain an origin of replication, which allows it to be replicated in the cell independently of the chromosome.
When employing any of the gene inactivation methodologies described herein, any targeted inactivation of part or the whole group Il gene cluster is detected by a selection marker so that the modified E. coli B BL21 strain clone can be identified and isolated.
The selection marker may be any suitable marker gene such as an antibiotic resis- tance gene or an auxotrophic marker.
Suitable antibiotic resistance genes are chloramphenicol, tetracyclin, ampicillin, kanamycin, vancomycin and erythromycin or any other representatives of the β-lactams, the aminoglycosides, the glycopeptides or the macrolide antibiotics.
The term "cloning" as used herein entails making multiple identical copies of a sequence of DNA. The target DNA sequence is then inserted into a cloning vector. Because this vector originates from a self-replicating virus, plasmid, or higher organism cell when the appropriate size DNA is inserted the "target and vector DNA fragments are then ligated" and create a recombinant DNA molecule. The recombinant DNA molecules are then put into a bacteria strain (usually E. coli) which produces several identical copies after transformation. Transformation is the DNA uptake mechanism possessed by bacteria. However, only one recombinant DNA molecule with a given replication origin can be established within a single bacteria cell, so each clone harbors just one DNA insert.
The terms "genome" or "genetic composition" as used herein refer to the entire genetic matter, both structural and functional, which is inheritable and/or otherwise transferable, and is contained within an identified cell or microorganism. The genome (genetic composition) of a microorganism is thus understood to include both chromosomal DNA and ex- trachromosomal DNA (e.g. plasmids, R factors and the like).
The term "about" as used herein means in reasonable vicinity of the stated numerical value, such as plus or minus 10%. The term "knockout" as used herein, means a genetically engineered bacteria strain in which one or more genes have been deleted or inactivated (have been "knocked out" of the organism). Knockout organisms are normally used as models for studying the role of genes which have been sequenced but have unknown functions. Knockout techniques may be used to remove undesired and/or potentially pathogenic genes from organisms of interest.
The term "gene cluster" as used herein means a set of two or more genes which are genetically and functionally coupled. Because populations from a common ancestor tend to possess varieties of the same gene clusters, they are useful for tracing back recent evolutionary history. The term "parental strain" may be any bacterial strain from which the reduced genome strain is derived. Representative examples of parent strains according to the present invention include, but are not limited to, E. coli strains such as B or C, or a strain with a genome sequence substantially identical thereto.
The terms "level" or "amount" of peptide produced in a given bacterial host cell, as used herein may refer to a quantitative measure of peptide present or detectable, in accordance with the method of production selected, in the cell culture. For example, if the method of peptide production chosen results in an accumulation of peptide within the cell itself, then the level or amount of peptide produced will be that quantitative measure of peptide present with the cells themselves. If the method of peptide production involves secretion of the pep- tide, then the level of peptide production will be that quantitative measure of peptide present in the growth medium.
The term "yield" of peptide, as used herein refers to a quantitative amount of an essentially pure peptide, which peptide is retrieved and/or purified essentially free from peptides naturally associated with the host strain. In ascertaining a quantitative "yield" or "amount" of peptide produced by a bacterial host cell, such as E. coli B BL21 strains, conventional peptide-specific methods such as immunoassay, high performance liquid chromatography (HPLC), enzymatic activity, spectrophotometric techniques, SDS-PAGE and the like can be employed.
The term "expression control sequence" used herein means a promoter or array of transcription factor binding sites that direct transcription of a nucleic acid operatively linked thereto.
The term "free end" used in reference to a double-stranded nucleic acid may mean a linear nucleic acid with blunt free ends or sticky free ends, or a combination thereof. The term "gene" used herein refers to a nucleic acid (e.g., DNA or RNA) that comprises a nucleic acid sequence encoding a polypeptide or precursor thereto. The polypeptide can be encoded by a full length coding sequence or by any portion of the coding sequence so long as the desired activity or functional properties (e.g., enzymatic activity, ligand bind- ing, signal transduction, antigenicity etc.) of the full-length or fragment are retained. The term also encompasses the sequences located adjacent to the coding region on both the 5' and 3' ends that contribute to the gene being transcribed into a full-length mRNA. The term "gene" encompasses both cDNA and genomic forms of a gene. A genomic form or clone of a gene may contain the coding region interrupted with non-coding sequences termed (e.g., introns). The terms "introduce" or "introduced", when used in reference to adding a nucleic acid to a strain, means that the nucleic acid may be integrated into the chromosome of the strain or contained on a vector, such as a plasmid, in the strain.
The terms "open reading frame" or "ORF" as used herein refers to a genetic sequence that does not contain stop codons. The terms "peptide", "polypeptide" or "protein" are used interchangeably herein and mean a peptide, polypeptide and protein, whether native or recombinant, as well as fragments, derivatives, homologues, variants and fusions thereof.
The growth of group Il knock out strains was evaluated in shake flasks and in high density fermentors and compared with their parental strains. The experiments showed that group Il knock out does not affect the growth of the cells in either strain background. Expression vector harbouring several peptides were transformed into group Il deleted strains for expression tests in a high density fermentor.
In one embodiment, the peptides for production in the E. coli B strains of the present invention may be selected from the group consisting of, but not limited to hGH, glucagon-like peptides, interleukins, insulin analogs, wildtype adiponectin, FGF-21 , trypsin, aprotinin, amylin and leptin and analogs thereof. Enzymes such as sialidase, transglutaminase (tGase), HRV (Human Rhino Virus) 3C protease, Tobacco Etch Virus (TEV) protease and variants thereof, and any other peptide or peptide for which an expression system is operable in E. coli. The present invention also relates to a method of preparing human peptides as mentioned above. In general, a cloned wildtype peptide nucleic acid sequence is modified to encode the desired protein. This modified sequence is then inserted into an expression vector, which is in turn transformed or transfected into host cells. Operable expression systems typically include the conventional gene expression components set forth by Studier and Mof- fat [J. MoI. Biol. (1986) 189:1 13-130] and Studier et al. [Methods in Enzymology (1990) 185:60-89].
The peptides to be produced in the host cells can be synthesized as fusion peptides, secreted into the media or into the periplasmic space, produced in free form in the cyto- plasm, or accumulated in intracellular bodies such as in inclusion bodies. Purification of the peptides similarly involves the use of aforementioned conventional, publicly available methodologies which are adapted, again by conventional techniques, to the peptide of interest. The present invention is suitable for the production of any type of peptide. In one embodiment, the peptide selected for production in the group Il knock out E. coli B BL21 host cells is human growth hormone (hGH) and in one embodiment the human growth hormone (hGH) is produced from a precursor peptide as described in EP217814, which describes how to make hGH from an hGH precursor.
In a further embodiment the growth hormone is MEAE(SEQ ID 16)-hGH(L101C), which is a precursor of an hGH analogue, wherein the leucine at position 101 in the hGH molecule is substituted by cysteine.
In another embodiment the glucagon-like peptide is GLP-1 , GLP-1 and/or derivatives thereof.
The term "glucagon-like peptide" as used herein means the glucagon family of peptides, exendins and analogues thereof. The glucagon family of peptides are encoded by the preproglucagon gene and encompasses three small peptides with a high degree of homology, i.e. glucagon (1 -29), GLP-1 (1 -37) and GLP-2 (1-33). Exendins are peptides expressed in lizards and like GLP-1 , are insulinotropic. Examples of exendins are exendin-3 and exendin-4.
The term "glucagon-like peptide analogue" as used herein refers to a modified glu- cagon-like peptide wherein one or more amino acid residues of the glucagon-like peptide have been substituted by other amino acid residues and/or wherein one or more amino acid residues have been deleted from the glucagon-like peptide and/or wherein one or more amino acid residues have been added to the glucagon-like peptide. Such addition or deletion of amino acid residues can take place at any position of the peptide.
EXPERIMENTAL PART
For the preparation of glycerol stocks of the strains, a single colony was transferred into a 12ml test tube containing 2ml of LB medium with the appropriate antibiotics and grown at 37°C, with shaking at 220rpm for 2 hours.
For the preparation of fermentation inoculae, the cells from a glycerol stock were streaked on LB plates with and without addition of ampicilin. The overnight cells were washed with LB medium and inoculated into 500ml shake flasks containing 100ml each of fermentation complex medium with appropriate antibiotic concentration and grown at 37°C with shaking at 220rpm for 3-4 hours. The cells were then inoculated into the reactor to a concentration of approximately 0.5 OD600.
Fermentations were conducted under aerobic conditions in a 5I bioreactor with an initial volume of fermentation complex medium of 2.5I, with appropriate antibiotics. At time zero, the reactor was inoculated to an OD600 of approximately 0.5. The pH was maintained at
7.0 with 5N NH3 and H2SO4 and a constant air flow rate of 6ml/min. was sparged through the culture during the fermentation period. The temperature was maintained at 37°C. The agitation was cascade-controlled by maintaining dissolved oxygen level up to 20% of saturated O2.
A fed-batch experiment was performed to compare the growth and peptide expression of group Il deleted strain with its parental strain in a high density fermentor. The fermen- tor was charged with complex medium supplemented with 27g/l of glycerol. At time zero, the fermentor was inoculated to an OD600 of 0.5. Glycerol and yeast extract were added continuously in increasing steps as basic glycerol was consumed, which was indicated by an increase in dissolved oxygen. The samples for determination of OD600 and protein expression were collected from the fermentor and analyzed by spectrophotometer and by SDS-PAGE. Induction of protein expression in bacteria is well known in the art. In the present invention the induction of protein expression is made by addition of isopropyl-β-D- thiogalactopyranoside (IPTG).
Plasmids and strains used in certain embodiments of the invention are listed in Tables 1 and 2, respectively. The construction of plasmids was performed using standard mo- lecular biology techniques as described in Sambrook et al. [A Laboratory Manual (1989) CSH].
Table 1. Plasmids used in the examples
Figure imgf000014_0001
Table 2. Strains used in the examples
Figure imgf000014_0002
Table 3. List of primers used to carry out the invention
Figure imgf000015_0001
EXAMPLES
Example 1 : Construction of replacement cassette The E. coli B BL21 (DE3) strain was used as a source of DNA for PCR amplification.
Oligonucleotide primers (LA_BL_GII_F/LA_BL_GII_R) (Table 3) were synthesized, targeting a 1001 bp region upstream of the 5' end of KpsM containing Sacll/EcoRI cloning site. This region was amplified from genomic DNA as left arm (L-A). For the right arm (RA), oligonucleotide primers (RA1_BL_GII_F/RA1_BL_GII_R) (Table 3) were synthesized, targeting a 1108bp region upstream of the 5' end of KpsF containing BamHI/Sacl cloning site. PCR products of the left arm and the right arm were generated. The DNA amplification reaction was performed in a thermal cycler, using a program that included the following parameters: denaturation at 94°C for 50s, annealing at 57°C for 60s and primer extension at 72°C for 60s, for a total of 30 cycles. The PCR amplification product with correct band size was observed by gel electrophoresis on a 1% agarose gel, from which 50μl of the amplified product were extracted from the gel and used to construct a replacement fragment. A list of oligonucleotide sequences is shown in Table 3.
The amplified left arm was gel-purified and ligated into plasmid pEZ-T, resulting in plasmid pEZ-T-LA. The restriction enzymes EcoRI/BamHI digested the FRT-cat-FRT frag- merit which was ligated into EcoRI/BamHI site of pEZ-T-LA, resulting plasmid pEZ-T-LA- FRT-cat-FRT. The amplified right arm was ligated into plasmid pGEM-T and was digested with BamHI/Sacl. The BamHI/Sacl-digested DNA fragment, which carries an ampicillin resistance gene was ligated into plasmid pEZ-T-LA-FRT-cat-FRT. The chloramphenicol resis- tance gene provides a selectable marker for identifying the replacement fragment. The resulting plasmid pEZ-T-LA-FRT-cat-FRT-RA, was used to produce a knockout BL21 (DE3) strain.
Example 2: Production of a knock out BL21(DE3) strain E. coli BL21 (DE3) was grown in LB medium overnight at 37°C and the heat shock competent cells of BL21 (DE3) were prepared by standard methods. The plasmid pKD46 was transformed into BL21 (DE3) competent cells and the transformed cells were grown to 0.4 ODβoonm in LB broth supplemented with 100μg/ml ampicillin at 300C. The expression of Red recombinase was induced by L -arabinose (final concentration 1 mmol/l) for one hour. For group Il gene cluster knock out, 500ng of replacement fragment amplified from pEZ-T-LA-FRT-cat-FRT-RA were transferred into BL21 (DE3) competent cells by electropora- tion. The electrotraporation competent cells were prepared by standard methods. Recovery of the cells was carried out at 300C for 1.5 hours. The cells were plated on LB agar supplemented with 8μg/ml chloramphenicol. Chloramphenicol-resistant colonies of BL21 (DE3)ΔkpsM-kpsF)::cat were formed after overnight incubation at 30°C.
To ensure complete knock out of the group Il gene cluster at the right position of the chromosome, oligonucleotide primers were designed with homology to the outside of the left and the right arms of the group Il gene cluster. Lacking the flanking sequences of E. coli B BL21 (DE3) outside the 18kb, the published sequence of E. coli 536 (Accession no. CP 000247.1 ) was used for design of the PCR screening primers, assuming a similar location of group Il cluster in the 2 genomes, based on high homology in the near flanking regions. Three chloramphenicol-resistant colonies were tested for gene replacement.
Phenotype test of chloramphenicol-resistant colonies was performed by growth in LB+Cm (25μg/ml) for at least two generations. All of the chloramphenicol-resistant colonies could grow very well in LB+Cm (25μg/ml) medium. Chloramphenicol-resistant D-alanine auxotrophic strains have also been tested in the same process with supplementation of D- alanine.
A successful replacement was confirmed by bands of 1686bp and 1578bp. Oligonucleotide primers (LA_SEQ_F1/Cat_ID_R) were used to amplify a band containing left arm and part of cat gene (size 1686bp), and oligonucleotide primers (RA_SEQ_R1/Cat_SEQ_F) were used to amplify a band containing right arm and part of the cat gene (size 1578bp). For three chloramphenicol-resistant colonies right size of the bands indicated that the 16kb group Il gene cluster had been replaced by the cat gene (Fig.3). A negative control of 3000 bp band which contained the right arm including kpsF and part of kpsE, was created and should appear only in the control strain (before replacement) but not in the chloramphenicol-resistant strain. Oligonucleotide primers
(RA6_BL_GII_F/RA6_BL_GII_R) (Table 3) were used to amplify kpsF and kpsE. The PCR results showed that only the control strain had this band, not the chloramphenicol-resistant strain.
The same elimination process was applied to the D-alanine auxotrophic strain BL2'] (DE3)ΔdadxΔalr, which needs a supplement of D-alanine during growth in LB medium.
The chloramphenicol-resistant strains E. coli B BL21 (DE3)Δ(kpsM-kpsF): .cat and BL21 (DE3)ΔdadXΔalrΔ(kpsM-kpsF): :cat were confirmed by their phenotype and PCR screening, confirming that the group Il capsular gene cluster had been replaced by the cat gene.
Example 3: Elimination of drug-resistant marker and characterization of group Il knock out strain
E.coli BL2λ {DE3)Δ(kpsM-kpsF)::cat and BL2λ {DE3)ΔdadXΔalr(kpsM-kpsF)::cat cells from frozen stock were grown in LB medium overnight at 37°C with 25μg/ml chloramphenicol or 25μg/ml chloramphenicol, plus 10OmM D-alanine for the second strain. The elec- troporation competent cells of the two knock out strains were prepared by standard methods. The plasmid pCP20 (CmR, AmpR) was transformed into the two knock out competent strains. The elimination of the drug-resistant marker was carried out by growing the transformed cells in SOC broth at 300C for 1 hour with gentle shaking. The single colonies of ampicillin resistant candidate clones on the plate were selected after overnight culture at 3O0C. The candidate clones were grown in LB medium only or LB medium supplemented with D-alanine at 370C for three hours, to eliminate the plasmid pCP20. Five single colonies, which appeared on LB medium only or LB medium supplemented with D-alanine, were further characterized by PCR screening.
Phenotype testing of cat elimination strains was performed by growing the single colonies in LB, LB+Cm (8μg/ml) and LB+Amp. All the cat elimination colonies could grow only on LB medium. For cat eliminated D-alanine auxotrophic strains, all five colonies could grow only in LB medium with supplementary D-alanine. Thus, the cat gene had been eliminated.
A successful elimination of the cat gene should be confirmed by a 2381 bp band. Oligonucleotide primers (LA_SEQ_F2/RA_SEQ_R1) were used to amplify a band containing left arm and right arm. For all the single colonies, the appearance of a 2381 bp band indicated that the cat gene had been eliminated.
The knock out strains E. coli B BL21 (DE3)2.(7cps/W-/cpsFJ and B
BL21 (DE3)ΔdadXΔalrΔ(kpsM-kpsF) were confirmed by their phenotype and PCR screening. Glycerol stocks of both strains were prepared for storage.
Example 4: Growth of the knock out host strains in shake flask
E. coli B BL21(DE3) and B BL21 (DE3)2\(7cps/W-/cpsFJ cells from frozen stocks were grown on LB plate overnight at 37°C. Appropriate amounts of cells washed out from overnight plates were inoculated into 250ml baffled shake flasks containing 25ml LB medium to a concentration of approximately 0.05 OD600. The cells were grown at 37°C with shaking at 220rpm for 8 hours. A sample of each strain was taken every 14 hour to compare the growth of the cells at OD600.
The same working flow was applied to E. coli B BL21 (DE3)ΔdadXΔa/r and B BL21 (DE3)ΔdadXΔalfΔ(kpsM-kpsF) supplemented with D-alanine for comparison of growth in shake flask.
The results in Fig.4 show that growth of BL21Δ(7cps/W-/cpsF) over time was identical to its parental strain BL21 (DE3) in shake flask using LB medium. The same conclusion could be drawn when comparing BL21 (DE3) AdadX AaIr A{kpsM-kpsF) with BL21 (DE3) AdadX AaIr.
Example 5: Comparison of growth and MEAE-hGH expression between host strain BL21(DE3) and BL21(DE3) ΔkpsM-kpsF) in high density fermentation
E. coli B BL21 (DE3)4(/φs/W-/cpsF) cells from frozen stock were grown on LB plates. Heat shock competent cells of the knock out strain were prepared by standard methods. The plasmid pNNC1 -g (pET11 d-MEAE-hGH(AmpR)) containing an expression cassette of hGH was transformed into B BL21 (DE3)2\(7cps/W-/cpsF) competent cells, from which a glycerol stock of transformed cells was prepared.
High density fermentations were conducted under aerobic conditions as described above. Figure 5 shows that the growth of BL21Δ(7cps/W-/cpsF) over time was identical to its parental strain BL21 (DE3) in high density fermentor in complex medium. The same conclusion could be drawn when comparing BL21 (DE3)Δf/cps/W-/cpsFypNNC1 -g with BL21 (DE3)/pNNC1 -g. The cell density reached approximately 140 OD600 in the uninduced state. Expression of hGH was carried out by adding IPTG to a concentration of 1 mM when the growth of cells reached 80 OD600. After 10 hours of IPTG induction at 3O0C, the cell density reached approximately 100 OD600.
E. coli B BL21 (DE3)/pNNC1 -g and B BL21 (DE3)Δ(/cps/W-/cpsFj/pNNC1-g are efficient in the production of hGH as seen on SDS-PAGE. The increase in hGH expression level follows increasing induction time from 1 to 10 hours shown on the SDS-PAGE gel (Fig.6). The ability of the two strains to produce hGH was identical, i.e., no significant difference was observed in the expression of hGH by host strain B BL21 (DE3)Δ(kps/W-/cpsF) when compared to B BL21 (DE3), harbouring the gene Il cluster.
Example 6: Comparison of growth and MEAE-hGH expression between host strain BL21(DE3)Δa/rΔdadXand BL2'\{DEZ)AalrAdadXA(kpsM-kpsF) in high density fermentation
E. coli B BL21 (DE3) AdadXΔalrA(kpsM-kpsF) cells from frozen stock were grown in LB medium supplemented with D-alanine. Heat shock competent cells of the knock out strain were prepared by standard methods. The pNNC1 -1 h (pET11 d-MEAE-hGH and alrP-alrCD (AmpR)) containing a D-alanine complementary gene was digested using Aatll/Psil, following by blunt end and self-ligation of the plasmid, resulting in a bla- plasmid for selection of the air gene on the plasmid. The plasmid pNNC1-1 h (pET11 d-MEAE-hGH, alrP-alrCD, bla-) was transformed into BL2'] (DE3)AdadXΔalrA(kpsM-kpsF) competent cells. Colonies appearing overnight on LB plate without supplementary D-alanine were isolated for the preparation of glycerol stocks.
High density fermentations were conducted as described in Example 5. Figure 7 shows that the growth of E. coli B BL21 {DE3)AdadXAalrA(kpsM-kpsF) /pNNC1 -1 h over time was identical to its parental strain BL21 (DE3)ΔdadXΔa/r/pNNC1 -1 h in a high density fermentor in FCM1 medium. The same conclusion could be drawn under in- duction of hGH when comparing B BL21 (DE3)ΔdadXΔa/r/pNNC1-1 h with
BL21 (DE3)ΔdadXΔa/rΔ(/φs/W-/cpsF)/pNNC1-1 h. The cell density reached approximately 120 OD600 in the uninduced state. Expression of hGH was carried out by adding IPTG to a concentration of 1 mM when the growth of cells reached 80 OD600. After 9 hours of IPTG induction at 3O0C, the cell density reached approximately 100 OD600. E.coli B BL21 (DE3)ΔdadXάa/r/pNNC1-1 h and B BL21 (DE3)ΔdadXάa/rΔ(/cps/W- kpsF) /pNNC1-1 h were efficient in production of hGH as can be seen from the results by SDS-PAGE (Fig.8). Increase in hGH expression level follows increasing induction time. Both strains had identical ability to produce hGH.
Example 7: Evaluation of cell growth and expression of MEAE-hGH(L101C) using host strain E. coli B BL21(DE3)ΔalrΔdadXΔ(/φsM-/φsF) in high-cell density fermentation
E. coli B BL21 (DE3) ΔdadXΔalrA(kpsM-kpsF) cells from frozen stock were grown in LB medium supplemented with D-alanine. Competent cells of this triple knock-out strain for transformation using heat-shock method were prepared by standard methods. To delete the β-lactamase gene coding for ampicilin-resistance, the plasmid pNNC1 a.23 (pETH d-MEAE-hGH(L101C) encoding MEAE-hGH(L101C) and containing alrP- alrCD for complementing the D-alanine-deficiency of the host cell was digested using Aat\\/Psi\, followed by end-blunting and self-ligation for removal of the β-lactamase gene. The resulting plasmid, pNNC1a.23 (pET1 1d-MEAE-hGH, air, bla ), was transformed into the host cell, BL2'] (DE3)AdadXΔalrA(kpsM-kpsF) , by heat-shock method. A single colony grown up from LB plate without supplementation with D-alanine was selected to prepare the glycerol stocks for storage at -800C.
Two batches of high-cell density fermentation were conducted as described in Example 5. Cell growth was monitored during the process and the results are shown in Fig.9. Expression of MEAE-hGH(L101 C) by strain E.coli B BL21 (DE3)AdadXΔalrA(kpsM- kpsF) harbouring plasmid pNNC1 a.23 was evaluated in high-cell density fermentation. The result showed that the cell density at harvest can reach to about 100 measured at OD600nm, and the expression level of the target protein, MEAE-hGH(L101 C), reached about 7g/l after 8 hours' induction, as shown in Fig.10.
Example 8: Expression of Arthrobacter ureafaciens sialidase in E. coli BL21(DE3) \(kpsM-kpsF)
Arthrobacter ureafaciens sialidase (AUS, 53.4 kDa theoretical mass) was produced in Escherichia coli BL2'] (DE3)Δ(kpsM-kpsF) with a C-terminal His-tag. The Arthrobacter ure- afaciens sialidase gene, with a His6-tag in the C-terminus, was cloned in expression vector pET-24a (Novagen) under control of the T7 promoter. In order to produce the sialidase enzyme from Arthrobacter ureafaciens a synthetic codon optimized gene encoding the following protein sequence was generated (SEQ ID 12):
MAPTPPNSPTLPPGSFSETNLAADRTAANFFYRIPALTYLGNDWLAAWDGRPGS AADAPNPNSIVQRRSTDGGKTWGPVQVIAAGHVADASGPRYGYSDPSYIYDAEANKVFAFF VYSKDQGFGGSQFGNDDADRNVISSAVIESSDAGVTWSQPRLITSVTKPGTSKTNPAAGDV RSNFASSGEGIQLKYGPHKGRLIQQYAGDVRQADGSNKIQAYSVYSDDHGVTWHKGANVG DRMDENKTVELSDGRVLLNSRDNANRGYRKVAVSTDGGATYGPVSQDTELPDPANNGAIA RMFPNAAQGSADAKKLIFTNANSKTGRENVSARVSCDDGETWPGVRTIRSGFSAYSTVTRL ADGKFGVLYEGNYTDNMPFATFDDAWLNYVCAPLAVPAVNIAPSATQEVPVTVTNQEATTL SGATATVYTPSGWSATTVPVPDVAPGASVTVTVALTAPADASGPRSLNAAFTTADGRVSQF TFTATTPVAPQVGLTITGSALEHHHHHH
The synthetic gene was introduced into the pET-24a expression vector as a Xbal- Xhol fragment to produce the AUS expression vector pLLC028. The resulting vector was transformed into competent BL21 (DE3)Δ(kpsM-kpsF) and transformants were preserved in glycerol at -800C.
One cryotube of the frozen initial cell clone (ICC) was used to inoculate two yeast extract media (yeast extract 5 g/l, glucose 10 g/l, agar 20 g/l) agar flask. The agar medium contained kanamycin for selection. Incubation was at 300C for 25 hours. After incubation, the cells were washed from the agar surface using sterile 0.9% NaCI solution. A 10 I fermentation was inoculated using pre-culture from two agar flasks. The volume of the obtained inoculum was 75 m, and the OD6oonm was 4.3, resulting in a start OD6oonm in the fermentor of approximately 0.03. The fermentation was carried out in a 20 I stainless steel vessel with a start working volume of 10 I. The fermentation starts with a 8 hour long batch phase on a complex medium containing 40 g/l yeast extract, 15 g/l glycerol (87%), salts and trace metals, followed by glycerol feeding at a predetermined profile. During the first 17 hours, fermentation temperature was 37°C. After that, the temperature was lowered to 300C. At 18 hours elapsed fermentation time, the inducer IPTG was added at 0.1 mM in order to induce protein expression. The duration of induction can be up to 22 hours. The recovery process consists of cen- trifugation, high pressure homogenisation and crossflow microfiltration using Sartocon Slice Cassettes with a pore size of 0.2 μm.
The AUS fermentation was analysed using SDS-PAGE and an enzymatic activity assay. SDS-PAGE analysis revealed that the expressed sialidase appears both in the soluble and pellet fraction after bead-milling. Figure 11 shows a typical fermentation result from a 10L batch run at 30°C induction temperature and 0.1 mM IPTG.
Example 9: Expression of human fibroblast growth factor 21 (FGF21) in BL21 DE3 and BL21 DE3Δ(kpsM-kpsF)
The DNA and amino acid sequences for human FGF21 are disclosed by e.g., Ni- shimura et al in Biochim. Biophys. Acta 1492(1):203-206 (2000). The sequences are also available from public databases (Accession nos. EMBLAB021975 and UNIPROT:Q9NSA1 , respectively).
The native polypeptide is synthesised with a signal peptide (in italics below) of 28 amino acids for secretion, while the mature FGF21 polypeptide consists of the remaining 181 amino acids (SEQ ID 13):
MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYIDDA QQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHF DPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPA- LPEPPGILAPQPPDVGSSDPLSMVGPS QGRSPSYAS The mature FGF21 polypeptide was cloned and expressed as an intracellular protein in E. coli, without the signal peptide, but with an added N-terminal methionine. In particular, a 550 bp coding region including at the 3'-end the ATG codon for Met, as well as Nde1 and BamH1 restriction sites at the 3'- and 5'-ends, respectively, were inserted into the expression vector pET 11c (Novagen) in Nde1 -BamH1 under control of the phage T7 promoter, and transformed into E.coli B BL21 (DE3) and into E.coli B BL21 DE3Δ(kpsM-kpsF). The cells were grown in LB amp 100 ug/ml to OD450 0.5, and expression was induced with 0.3 mM IPTG for 4 hours at 37°C. Crude extracts of cells were made by sonication for analysis of FGF21 expression.
The Coomassie stained SDS-PAGE gel in Fig. 12 shows equally successful expres- sion of FGF21 in E.coli B BL21 DE3 and E.coli B BL21 DE3Δ(kpsM-kpsF). Although the calculated molecular weight (MW) of the thus expressed FGF21 (Met-FGF21) is 19.5 kD, it migrated on the gel as a 25 kD protein, which is likely due to the high content of prolines, delaying the movement of the protein.
The current example shows that the yield for FGF21 is not affected by the genetic manipulation of the host strain.
Example 10: Expression of human amylin in BL21 DE3 and BL21 DE2Δ(kpsM-kpsF)
The sequence of the 37 aminoacid amyloid peptide amylin was published by Cooper et al. in Proc. Natl. Acad. Sci. (84) : 8628-8632, (1987). The gene was cloned and fused it N- terminally to a ribosomal protein RL23 from Thermotoga maritima. The 146 amino acids fusion protein has the following sequence (SEQ ID 14):
KQEKLSLHDVLIRPIITEKALILREQRKYVFEVNPLANKNLVKEAVEKLFNVKVEKVNI LNMKPKPKRRGIFEGKTRSWKKAWTLKEGYTIKELEGEHSSSSDDDDKKCNTAT- CATQRLA-NFLVHSSNNFGAILSSTNVGSNTY The fusion gene was cloned as described in example 9 as a 450 bp Nde1 - BamH1 fragment into pET 1 1c under control of the T7 promoter, and the plasmid was transformed into BL21 DE3 and BL21 DE3Δ(kpsM-kpsF).
Expression was performed as described in example 9, and the result is shown in Fig.12, again demonstrating equally high yield expression in the two E. coli B hosts BL21 DE3 and BL21 DE3 A(kpsM-kpsF).
Example 11 : Expression of human leptin in BL21 DE3 and BL21 DE2Δ(kpsM-kpsF)
The sequence of the 146 amino acids long human leptin was published by Masuzaki et al. in Diabetes (44): 855-858 (1995). The protein is secreted in humans with the addition of a 21 amino acids signal peptide. The mature leptin was expressed intracellular^ in E. coli has the following sequence (SEQ ID 15):
MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTL AVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYST EWALSRLQGSLQDMLWQLDLSPGC
The leptin gene was cloned as described in example 9 as a 450 bp Nde1 -BamH1 fragment into pET11c under control of the T7 promoter, and the plasmid was transformed into BL21 DE3 and BL21 DE3Δ(kpsM-kpsF).
Expression was performed as described in example 9, and the result is shown in Fig.12, again illustrating equally high yield expression in the two E. coli hosts BL21 DE3 and BL21 DE3Δ(kpsM-kpsF).
It is concluded that the elimination of group Il capsular gene cluster does not affect the growth of the cells in any growth conditions. It can also be concluded that group Il capsu- lar gene cluster elimination does not affect protein expression. Therefore, a more safe strain with complete removal of group Il capsular gene cluster is hereby produced for using E. coli B BL21 (DE3) as commercial host strain for therapeutic protein production. The operation of deleting group Il capsular genes in E. coli B BL21 (DE3) brings it into the same safety category as E. coli K12, since the group Il gene cluster is the only significant difference between the two strains.

Claims

1. An E. coli B BL21 strain characterised by having an irreversibly inactivated group Il capsular gene cluster.
2. An E. coli B BL21 strain according to claim 1 , characterised by having a total or partial deletion of group Il capsular gene cluster.
3. An E. coli B BL21 strain according to claim 1 , characterised by having a total deletion of group Il capsular gene cluster.
4. An E. coli B BL21 strain according to any of the preceding claims, wherein the E. coli is E. coli B BL21 (DE3).
5. An E. coli strain according to any of the claims 1-3, wherein the E. coli is E. coli B BL21 (DE3) AdadXAalr.
6. An E. coli B BL21 strain according to any of the preceding claims, wherein the strain further comprises an expression vector with an inserted DNA sequence encoding a peptide.
7. An E. coli B BL21 strain according to any of the preceding claims, wherein the peptide is selected from the group consisting of hGH, glucagon-like peptides, interleukins, insulin analogs, wildtype adiponectin, FGF-21 , trypsin, aprotinin, amylin and leptin and analogs thereof and enzymes such as sialidase, transglutaminase (tGase), HRV (Human Rhino Virus) 3C protease, Tobacco Etch Virus (TEV) protease and variants thereof.
8. A method for producing an E. coli B strain according to any of the preceding claims, wherein the group Il capsular gene cluster is deleted by a method comprising the steps of: a. replacing of group Il capsular gene cluster by a selection marker, b. eliminating the selection marker and c. confirming the deletion by PCR analysis.
9. A method for production of an E. coli B strain according to claim 8, where the selection marker is an antibiotic resistance gene.
10. A method for production of an E. coli B strain according to claim 9, where the antibiotic resistance gene is selected from the group consisting of chloramphenicol, tetracyclin, ampicillin, kanamycin, vancomycin and erythromycin.
11. A method for production of an E. coli B strain according to claim 9, where the antibiotic is chloramphenicol.
12. A method for the production of a peptide comprising culturing in a suitable culture medium, an E. coli B strain according to any of claims 1-7 followed by isolation and purification of the expressed peptide by well-known technique.
13. A method according to claim 12 wherein the peptide is hGH.
14. A method according to claim 12 wherein the peptide is FGF-21.
15. A method according to claim 12 wherein the peptide is amylin.
1/7
Figure imgf000026_0001
Fig. 1/12
Fermentation growth curve
□ , BL21 (DE3)ΔdadXΔalrΔ(kpsM-kpsF)/pNNC1 a.23
Figure imgf000026_0002
10 15 20 25 30 35
Age hr
Fig. 9/12
PCT/EP2009/064903 2008-11-10 2009-11-10 E. coli bl21 strain lacking a functional group ii capsular gene cluster Ceased WO2010052335A1 (en)

Priority Applications (5)

Application Number Priority Date Filing Date Title
CN200980144718.5A CN102209725B (en) 2008-11-10 2009-11-10 Escherichia coli BL21 strain lacking a functional group II capsular gene cluster
EP09751899.7A EP2356142B1 (en) 2008-11-10 2009-11-10 E. coli bl21 strain lacking a functional group ii capsular gene cluster.
JP2011535134A JP5808671B2 (en) 2008-11-10 2009-11-10 No functional group II capsular gene cluster COLIBL21 strain
ES09751899.7T ES2612252T3 (en) 2008-11-10 2009-11-10 E. coli strain BL21 lacking a functional gene complex of group II capsular genes
US13/126,379 US8535909B2 (en) 2008-11-10 2009-11-10 E. coli BL21 strain lacking a functional group II capsular gene cluster

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP08168750.1 2008-11-10
EP08168750 2008-11-10

Publications (1)

Publication Number Publication Date
WO2010052335A1 true WO2010052335A1 (en) 2010-05-14

Family

ID=40170900

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2009/064903 Ceased WO2010052335A1 (en) 2008-11-10 2009-11-10 E. coli bl21 strain lacking a functional group ii capsular gene cluster

Country Status (6)

Country Link
US (1) US8535909B2 (en)
EP (1) EP2356142B1 (en)
JP (1) JP5808671B2 (en)
CN (1) CN102209725B (en)
ES (1) ES2612252T3 (en)
WO (1) WO2010052335A1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017055582A1 (en) 2015-10-01 2017-04-06 Novo Nordisk A/S Protein conjugates
WO2020169658A2 (en) 2019-02-20 2020-08-27 Novo Nordisk A/S Aminoacyl-trna synthetases and uses hereof

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9616114B1 (en) 2014-09-18 2017-04-11 David Gordon Bermudes Modified bacteria having improved pharmacokinetics and tumor colonization enhancing antitumor activity
US10676723B2 (en) 2015-05-11 2020-06-09 David Gordon Bermudes Chimeric protein toxins for expression by therapeutic bacteria
EP3356543A4 (en) 2015-09-28 2019-05-29 The Trustees of Columbia University in the City of New York EXPRESSION SYSTEM FOR MODIFIED BACTERIAL PROTEINS
US11180535B1 (en) 2016-12-07 2021-11-23 David Gordon Bermudes Saccharide binding, tumor penetration, and cytotoxic antitumor chimeric peptides from therapeutic bacteria
US11129906B1 (en) 2016-12-07 2021-09-28 David Gordon Bermudes Chimeric protein toxins for expression by therapeutic bacteria
CN118995880A (en) * 2024-09-05 2024-11-22 北京国科星联科技有限公司 A method for detecting sialic acid

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1997049416A1 (en) * 1996-06-27 1997-12-31 Virginia Tech Intellectual Properties, Inc. Recombinant vaccine for diseases caused by encapsulated organisms
WO2002014468A2 (en) * 2000-08-15 2002-02-21 Phage Biotechnology Corporation Phage-dependent superproduction of biologically active protein and peptides

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4743481A (en) * 1986-11-26 1988-05-10 Flex Technologies, Inc. Molding process for articles having an irregular shaped internal passage
EP1638598B1 (en) * 2003-07-02 2006-12-06 Biotechnology Research And Development Corporation ACAPSULAR i P. MULTOCIDA HYAE /i DELETION MUTANTS
WO2008025744A1 (en) * 2006-08-28 2008-03-06 Novo Nordisk A/S Extra-cellular production of recombinant proteins

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1997049416A1 (en) * 1996-06-27 1997-12-31 Virginia Tech Intellectual Properties, Inc. Recombinant vaccine for diseases caused by encapsulated organisms
WO2002014468A2 (en) * 2000-08-15 2002-02-21 Phage Biotechnology Corporation Phage-dependent superproduction of biologically active protein and peptides

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
ANDREISHCHEVA ET AL: "Escherichia coli BL21(DE3) chromosome contains a group II capsular gene cluster", GENE, ELSEVIER, AMSTERDAM, NL, vol. 384, 24 November 2006 (2006-11-24), pages 113 - 119, XP005764907, ISSN: 0378-1119 *
DATSENKO KIRILL A ET AL: "One-step inactivation of chromosomal genes in Escherichia coli K-12 using PCR products", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF USA, NATIONAL ACADEMY OF SCIENCE, WASHINGTON, DC.; US, vol. 97, no. 12, 6 June 2000 (2000-06-06), pages 6640 - 6645, XP002210218, ISSN: 0027-8424 *
LOPEST D H J ET AL: "Amyloidogenicity and cytotoxicity of recombinant mature human islet amyloid polypeptide (rhIAPP)", JOURNAL OF BIOLOGICAL CHEMISTRY 20041008 AMERICAN SOCIETY FOR BIOCHEMISTRY AND MOLECULAR BIOLOGY INC. US, vol. 279, no. 41, 8 October 2004 (2004-10-08), pages 42803 - 42810, XP002574331 *
MUEHLDORFER I ET AL: "GENETIC ASPECTS OF ESCHERICHIA COLI VIRULENCE", MICROBIAL PATHOGENESIS, ACADEMIC PRESS LIMITED, NEW YORK, NY, US, vol. 16, 1 March 1994 (1994-03-01), pages 171 - 181, XP000983208, ISSN: 0882-4010 *

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017055582A1 (en) 2015-10-01 2017-04-06 Novo Nordisk A/S Protein conjugates
WO2020169658A2 (en) 2019-02-20 2020-08-27 Novo Nordisk A/S Aminoacyl-trna synthetases and uses hereof

Also Published As

Publication number Publication date
US8535909B2 (en) 2013-09-17
JP5808671B2 (en) 2015-11-10
US20110236929A1 (en) 2011-09-29
EP2356142B1 (en) 2016-08-10
CN102209725A (en) 2011-10-05
JP2012508001A (en) 2012-04-05
CN102209725B (en) 2016-02-24
ES2612252T3 (en) 2017-05-16
EP2356142A1 (en) 2011-08-17

Similar Documents

Publication Publication Date Title
EP2356142B1 (en) E. coli bl21 strain lacking a functional group ii capsular gene cluster.
EP3113800B1 (en) Enhanced production of recombinant crm197 in e. coli
EP2938363B1 (en) Methods and compositions relating to crm197
KR101739128B1 (en) High level expression of recombinant crm197
JP2005287333A5 (en)
KR101696986B1 (en) Modified bordetella pertussis strains
CN115678817A (en) A kind of recombinant microorganism and its preparation method and application in threonine production
US7868148B2 (en) Plasmids, their derivatives and fragments, their methods of manufacture and application
US20180148696A1 (en) Microorganism including genetic modification that increases activity of cellulose synthase and method for producing cellulose by using the same
CN100513572C (en) Expression system for cholera toxin B subunit
KR20100121642A (en) Compositions and methods for amino acid biosynthesis
KR20140135716A (en) Method for reduction of 1→2 reading frame shifts
KR102933941B1 (en) Surface-display overexpression technique by using lipoprotein PrsA expression system
RU2263147C1 (en) RECOMBINANT PLASMID DNA pHINSO5 ENCODING HYBRID POLYPEPTIDE COMPRISING HUMAN PROINSULIN, ESHERICHIA COLI CELL TRANSFORMED WITH RECOMBINANT PLASMID DNA pHINS05 AND STRAIN OF BACTERIUM ESCHERICHIA COLI JM109/pHINS05 AS PRODUCER OF HYBRID POLYPEPTIDE COMPRISING HUMAN PROINSULIN
CN104136460A (en) Method for reduction of 1->3 reading frame shifts
KR101419214B1 (en) Method for producing toxic protein using the LacI protein mutant
JP4267241B2 (en) Method for preparing fusion gene
AU2001269305B2 (en) Expression system
US20060121572A1 (en) Production of heterologous proteins in Caulobacter
HK1234659B (en) Enhanced production of recombinant crm197 in e. coli
AU2001269305A1 (en) Expression system
HK1234659A1 (en) Enhanced production of recombinant crm197 in e. coli

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200980144718.5

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 09751899

Country of ref document: EP

Kind code of ref document: A1

REEP Request for entry into the european phase

Ref document number: 2009751899

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2009751899

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2011535134

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 13126379

Country of ref document: US