WO2010022400A2 - Rapid identification of proteins and their corresponding source organisms by gas phase fragmentation and identification of protein biomarkers - Google Patents

Rapid identification of proteins and their corresponding source organisms by gas phase fragmentation and identification of protein biomarkers Download PDF

Info

Publication number
WO2010022400A2
WO2010022400A2 PCT/US2009/054796 US2009054796W WO2010022400A2 WO 2010022400 A2 WO2010022400 A2 WO 2010022400A2 US 2009054796 W US2009054796 W US 2009054796W WO 2010022400 A2 WO2010022400 A2 WO 2010022400A2
Authority
WO
WIPO (PCT)
Prior art keywords
usda
protein
mass
identification
highest
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2009/054796
Other languages
French (fr)
Other versions
WO2010022400A3 (en
Inventor
Clifton K. Fagerquist
Leslie A. Harden
Brandon R. Garbus
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
US Department of Agriculture USDA
Original Assignee
US Department of Agriculture USDA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by US Department of Agriculture USDA filed Critical US Department of Agriculture USDA
Publication of WO2010022400A2 publication Critical patent/WO2010022400A2/en
Publication of WO2010022400A3 publication Critical patent/WO2010022400A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • HELECTRICITY
    • H01ELECTRIC ELEMENTS
    • H01JELECTRIC DISCHARGE TUBES OR DISCHARGE LAMPS
    • H01J49/00Particle spectrometers or separator tubes
    • H01J49/0027Methods for using particle spectrometers
    • H01J49/0036Step by step routines describing the handling of the data generated during a measurement
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6803General methods of protein analysis not limited to specific proteins or families of proteins
    • G01N33/6848Methods of protein analysis involving mass spectrometry
    • G01N33/6851Methods of protein analysis involving laser desorption ionisation mass spectrometry
    • GPHYSICS
    • G16INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16BBIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
    • G16B30/00ICT specially adapted for sequence analysis involving nucleotides or amino acids
    • G16B30/10Sequence alignment; Homology search
    • GPHYSICS
    • G16INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16BBIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
    • G16B50/00ICT programming tools or database systems specially adapted for bioinformatics
    • GPHYSICS
    • G16INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16BBIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
    • G16B30/00ICT specially adapted for sequence analysis involving nucleotides or amino acids

Definitions

  • the invention relates to the use of laser desorption/ionization mass spectrometry techniques for protein identification, and the detection, identification, and taxonomic classification of the corresponding source organisms from which the proteins are derived.
  • Mass spectrometry is the science of "weighing" atoms and molecules. Because of its high sensitivity and specificity, mass spectrometry has become a popular technique for detection and taxonomic classification of microorganisms (see e.g., Fenselau C, and Demirev P.A. Mass Spectrom. Rev. 2001; 20: 157; Lay Jr. JO. Mass Spectrom. Rev. 2001; 20: 172).
  • MS mass spectrometry
  • a pattern recognition approach to data analysis typically involves comparison of a MALDI-TOF-MS spectrum from an unknown sample to MALDI-TOF-MS spectra from known, identified entities and searches for similarities in prominent peaks (see e.g., Jarmon, K.H., et al. (2000) Anal. Chem. 72: 1217; and Wahl, K.L., et al. (2002) Anal. Chem. 2002; 74: 6191).
  • a high similarity between an unknown MS spectrum and a known MS spectrum suggests the identity of the unknown.
  • this pattern recognition approach is limited by the fact that it does not rely on actual identification of the peaks in an MS spectrum, but rather on the spectral pattern.
  • mass-to-charge ratio (m/z) could be associated with any of a number of biomolecules generated by the microorganism: proteins, nucleic acids, lipids, etc, accuracy of identification using the pattern recognition approach is best achieved with purified molecules.
  • microorganisms may be identified using a bioinformatic approach.
  • the bioinformatic approach to identification of microorganisms by MALDI-TOF-MS typically involves the use of protein molecular weight (MW) information contained in genomic databases to tentatively assign peaks in a spectrum to specific proteins (see e.g., Demirev, P.A., et al. (1999) Anal. Chem. 71: 2732; Peneda, F.J., et al. (2000) Anal. Chem. 72: 3739; Demirev, P.A., et al. (2001) Anal. Chem. 73: 4566; Yao Z-P, et al.
  • MW protein molecular weight
  • protein biomarkers are either enzymatically digested and the resulting tryptic peptides are analyzed by MS or by MS/MS ("bottom-up proteomics).
  • the intact protein is fragmented in the gas phase to obtain sequence-specific information from fragment ions ("top-down" proteomics).
  • MALDI tandem mass spectrometry MALDI tandem mass spectrometry (MALDI- TOF-TOF) instruments has made gas phase fragmentation less cumbersome to undertake (see e.g., Medzihradszky KF, et al. Anal. Chem. 2000: 72: 552).
  • MALDI-TOF-TOF instruments may be used to fragment small and modest-sized intact proteins (> 5 kDa) (see e.g., Lin M, et al. Rapid Comm. Mass Spectrom. 2003; 17: 1809).
  • a MALDI-TOF-TOF instrument may provide a "fingerprint" of a bacterial microorganism in MS mode, and also sequence- specific information of protein biomarkers by MS/MS (see e.g., Demirev, P.A., et al. (2005)
  • MS/MS of specific protein biomarkers allows identification of unique protein biomarkers that are specific to a particular microorganism and thus facilitates thr identification of a microorganizm in a mixed sample.
  • One embodiment of the present invention provides a method for identification of an unknown protein comprising: (i) comparing mass-to-charge (m/z) fragment ion peaks from an mass spectrum of the unknown protein to that of m/z fragment ion peaks from mass spectra of known protein sequences; and (ii) matching the m/z fragment ion peaks from the mass spectrum of the unknown protein to the m/z fragment ion peaks from the mass spectra of known protein sequences to provide mass spectrometry peak matches; (iii) scoring the mass spectrometry peak matches using aUSDA peak matching algorithm thereby providing a USDA peak matching score; and (iv) ranking the USDA peak matching score from highest to lowest; wherein the highest USDA peak matching score constitutes an identification of the unknown protein.
  • the USDA peak matching algorithm is USDA peak matching algorithm ⁇ , which has the formula:
  • USDA peak matching algorithm ⁇ which has the formula:
  • the difference between the highest USDA peak matching score and the second highest USDA peak matching score is equal to or greater than 2.
  • the mass spectra are members selected from the group consisting of MS spectra and MS/MS spectra.
  • the mass spectrum of the unknown protein is an MS spectrum and the mass spectra of known protein sequences are MS spectra of known proteins.
  • the mass spectrum of the unknown protein is an MS/MS spectrum and the mass spectra of known protein sequences are members of the group consisting of in silico MS/MS spectra generated from a genomically-derived database of protein sequences and MS/MS spectra of known proteins.
  • the mass spectra of known protein sequences are in silico MS/MS spectra generated from a genomically-derived database of protein sequences.
  • the method further comprises: (v) confirming that the highest USDA peak matching score constitutes an identification of the unknown protein.
  • the confirming comprises: plotting the difference in m/z (Am/z) between an MS/MS fragment ion of the unknown protein and its matched fragment ion from the in silico MS/MS spectra generated from a genomically-derived database of protein sequences as a function of MS/MS fragment ion m/z, thereby providing a plot of Am/z vs MS/MS fragment ion m/z, wherein a correct protein identification is indicated when the plot of Am/z vs MS/MS fragment ion m/z reveals a characteristic systematic error related to the inherent calibration error of the mass analyzer, and wherein an incorrect protein identification is indicated when the plot of Am/z vs MS/MS fragment ion m/z reveals statistically random error.
  • the method further comprises: (v) confirming that the highest USDA peak matching score constitutes an identification of the unknown protein.
  • the confirming comprises: performing steps (i) - (iv), wherein the in silico MS/MS spectra generated from a genomically-derived database of protein sequences are limited to spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, glutamate (E) residue or proline (P) residue, and (vi) observing that the difference between the highest USDA peak matching score and the second highest USDA peak matching score is equal to or greater than the difference between the highest USDA peak matching score and the second highest USDA peak matching score obtained when steps (i) - (iv) are performed using in silico MS/MS spectra generated from a genomically-derived database of protein sequences that are not limited spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, glutamate (E) residue or proline (P) residue
  • the confirming comprises: performing steps (i) - (iv), wherein the in silico MS/MS spectra generated from a genomically-derived database of protein sequences are limited to spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, and (vi) observing that the difference between the highest USDA peak matching score and the second highest USDA peak matching score is equal to or greater than the difference between the highest USDA peak matching score and the second highest USDA peak matching score obtained when steps (i) - (iv) are performed using in silico MS/MS spectra generated from a genomically-derived database of protein sequences that are not limited spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, thereby confirming that the highest USDA peak matching score constitutes an identification of the unknown protein.
  • the unknown protein is a protein toxin.
  • identification of the unknown protein is used to identify the source organism from which the unknown protein derived.
  • the source organism is a member selected from the group consisting of: viruses, microorganisms, insects, plants, and animals.
  • the source organism is a microorganism selected from the group consisting of: bacteria and fungi.
  • the source organism is a bacterium that is a member selected from the group consisting of Campylobacter, Escherichia coli, Listeria and Salmonella.
  • Another embodiment of the invention provides a computer readable storage medium storing instructions that, when executed by a computer, causes the computer to perform a method for identification of an unknown protein comprising: (i) comparing mass- to-charge (m/z) fragment ion peaks from an mass spectrum of the unknown protein to that of m/z fragment ion peaks from mass spectra of known protein sequences; and (ii) matching the m/z fragment ion peaks from the mass spectrum of the unknown protein to the m/z fragment ion peaks from the mass spectra of known protein sequences to provide mass spectrometry peak matches; (iii) scoring the mass spectrometry peak matches using a USDA peak matching algorithm thereby providing a USDA peak matching score; and (iv) ranking the USDA peak matching score from highest to lowest; wherein the highest USDA peak matching score constitutes an identification of the unknown protein.
  • m/z mass- to-charge
  • USDA peak matching algorithm ⁇ which has the formula:
  • USDA peak matching algorithm ⁇ which has the formula:
  • the difference between the highest USDA peak matching score and the second highest USDA peak matching score is equal to or greater than
  • the mass spectra are members selected from the group consisting of MS spectra and MS/MS spectra.
  • the mass spectrum of the unknown protein is an MS spectrum and wherein the mass spectra of known protein sequences are MS spectra of known proteins.
  • the mass spectrum of the unknown protein is an MS/MS spectrum and the mass spectra of known protein sequences are members of the group consisting of in silico MS/MS spectra generated from a genomically-derived database of protein sequences and MS/MS spectra of known proteins.
  • the mass spectra of known protein sequences are in silico MS/MS spectra generated from a genomically-derived database of protein sequences.
  • the method further comprises: (v) confirming that the highest USDA peak matching score constitutes an identification of the unknown protein, wherein the confirming comprises: performing steps (i) - (iv) , wherein the in silico MS/MS spectra generated from a genomically-derived database of protein sequences are limited to spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, glutamate (E) residue or proline (P) residue, and (vi) observing that the difference between the highest USDA peak matching score and the second highest USDA peak matching score is equal to or greater than the difference between the highest USDA peak matching score and the second highest USDA peak matching score obtained when steps (i) - (iv) are performed using in silico MS/MS spectra generated from a genomically-derived database of protein sequences that are not limited spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, glutamate (E) residue or proline (P) residue,
  • the confirming comprises: performing steps (i) - (iv), wherein the in silico MS/MS spectra generated from a genomically-derived database of protein sequences are limited to spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, and (vi) observing that the difference between the highest USDA peak matching score and the second highest USDA peak matching score is equal to or greater than the difference between the highest USDA peak matching score and the second highest USDA peak matching score obtained when steps (i) - (iv) are performed using in silico MS/MS spectra generated from a genomically-derived database of protein sequences that are not limited spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, thereby confirming that the highest USDA peak matching score constitutes an identification of the unknown protein.
  • the unknown protein is a protein toxin.
  • identification of the unknown protein is used to identify the source organism from which the unknown protein derived.
  • source organism is a member selected from the group consisting of: viruses, microorganisms, insects, plants, and animals.
  • the source organism is a microorganism selected from the group consisting of: bacteria and fungi.
  • the source organism is a bacterium that is a member selected from the group consisting of Campylobacter, Escherichia coli, Listeria and Salmonella.
  • FIG. 1 provides a general overview of the framework for the USDA mass spectrometry comparison software.
  • FIG. 2 shows the database model describing how the data is stored.
  • FIG. 3 describes the USDA mass spectrometry comparison software process used to compare each dataset.
  • FIG. 4 shows an MS spectrum (as displayed in the MALDI-TOF-TOF instrument software) of the extracted cell lysate of Campylobacter upsaliensis (strain RM3195) analyzed by MALDI-TOF-MS using sinapinic acid as the MALDI matrix.
  • FIG. 5 shows the MS/MS spectrum (as displayed in the MALDI-TOF-TOF instrument software) of the protein biomarker ion of Campylobacter upsaliensis (strain RM3195) at m/z 11138.9 analyzed on a MALDI-TOF-TOF-MS using sinapinic acid as the MALDI matrix.
  • FIG. 6 shows an ASCII MS/MS spectrum (m/z vs. relative intensity as displayed in the USDA software window) of thioredoxin from Campylobacter upsaliensis (strain RM3195) previously displayed in FIG. 5.
  • the MS/MS data in FIG. 5 was centroided (i.e. converted to ASCII format: m/z vs. absolute intensity), exported from the MALDI-TOF-TOF instrument software and imported to the MS/MS databases of the USDA software.
  • the m/z and absolute intensity of MS/MS fragment ions are shown in the sidebar.
  • FIG. 7 shows the "MS/MS To In Silico Comparison" search parameter table as displayed in the USDA software window.
  • FIG. 8 shows the in silico MS/MS spectrum (as displayed in the USDA software window) of the protein thioredoxin of Campylobacter upsaliensis (strain RM3195).
  • FIG. 9 shows a plot of fragment ion error (as displayed in the USDA software) as a function of the MS/MS fragment ion mass-to-charge (m/z) of the protein biomarker thioredoxin (from Campylobacter upsaliensis strain RM3195) and its "match" to the in silico fragment ions of thioredoxin of Campylobacter upsaliensis strain RM3195 (the highest scoring identification and the correct identification).
  • Fragment ion error is the difference between m/z of an MS/MS fragment ion and the m/z of its putative in silico fragment ion "match".
  • a red square represents a "match” whose in silico fragment ion was generated from a protein backbone cleavage site that is adjacent to a D, E or P residue.
  • a black square represents a "match” whose in silico fragment ion was generated from a protein backbone cleavage site that is adjacent to only non-D,E,P residues.
  • FIG. 10 shows a plot of fragment ion error (as displayed in the USDA software) as a function of the MS/MS fragment ion mass-to-charge (m/z) of the protein biomarker thioredoxin (from Campylobacter upsaliensis strain RM3195) and its "match" to the in silico fragment ions of carbon dioxide concentrating mechanism protein of Cyanothece strain ATCC 51142 (the second highest scoring identification and an incorrect identification).
  • Fragment ion error (Am/z) is defined here as the difference between m/z of an MS/MS fragment ion and the m/z of its putative in silico fragment ion "match”.
  • FIG. 11 An MS spectrum of the extracted cell lysate of E. coli O157:H7 strain EDL-933 analyzed on the MALDI-TOF-TOF-MS instrument (in linear mode) using HCCA matrix. Data acquisition: 1000 laser shots.
  • FIG. 12 An MS/MS spectrum of the protein biomarker ion [M + H] + at m/z 7705.6 (FIG 11) from E. coli O157:H7 strain EDL-933 analyzed on the MALDI-TOF-TOF- MS instrument using HCCA matrix. Data acquisition: 32,000 laser shots. Fragmentation by post-source dissociation (PSD). Prominent fragment ions are identified by their m/z and ion type/number and amino acid residues adjacent to the site of polypeptide backbone cleavage for the amino acid sequence of the top identification: putative uncharacterized protein yahO from E. coli O157:H7 strain EDL-933 (Table 4).
  • PSD post-source dissociation
  • fragment ions are the result of a polypeptide cleavage site adjacent to an aspartic acid (D) or glutamic acid (E) residues.
  • MS/MS data was centroided, exported as an ASCII formatted file and uploaded to the USDA software for analysis.
  • FIG. 13 Primary amino acid sequence of the putative uncharacterized protein yahO of the pathogenic E. coli O157:H7 (EDL-933 strain)
  • mass spectrum refers in general, to an intensity vs. m/z (mass-to-charge ratio) plot that represents the result of a chemical analysis.
  • mass spectrum of a sample is a pattern representing the distribution of charged molecules by mass-to-charge ratio in a sample.
  • MS spectrum refers to a mass spectrum produced by mass spectrometer having a single mass analyser and single detector.
  • MS/MS spectrum refers to a mass spectrum produced by a tandem mass spectrometer.
  • the expression "matching the m/z fragment ion peaks from a mass spectrum of the unknown protein to the m/z fragment ion peaks from the mass spectra of known protein sequences” as used herein refers to a procedural step used by a person having ordinary skill in the art to make an identification of an unknown protein.
  • "matching the m/z fragment ion peaks from a mass spectrum of the unknown protein to the m/z fragment ion peaks from the mass spectra of known protein sequences” refers to comparing the m/z of fragment ions that result from ionization and fragmentation of an intact unknown protein to the theoretical/calculated m/z oiin silico generated fragment ions of known protein sequences.
  • the theoretical/calculated in silico molecular masses are based on the known atomic masses of the atoms which make up the known amino acid sequence, and as such, the calculated masses are considered to be "exact".
  • the measured m/z of fragment ions from the ionized and fragmented unknown protein is not “exact” but, rather, is subject to the mass accuracy of a given mass analyzer.
  • the mass accuracy of the mass analyzer may be determined and used to compare measured m/z values to those calculated "exact" masses. If the measured m/z value is within the analyzer's known uncertainty (mass accuracy and precision), then the comparison is considered to be a match (i.e. a "peak match").
  • USDA peak matching score refers to the number of measured m/z values which match calculated "exact” m/z values (within the instrument's measurement precision).
  • a “USDA peak matching score” is obtained by applying a "USDA peak matching algorithm”.
  • "USDA peak matching algorithm” is the “USDA peak matching algorithm alpha ( ⁇ )", which has the following formula:
  • the "USDA peak matching algorithm” is the “USDA peak matching algorithm beta ( ⁇ )" which has the following formula:
  • USDA peak matching score refers inclusively to USDA peak matching scores obtained using the "USDA peak matching algorithm alpha ( ⁇ )" and/or the “USDA peak matching algorithm beta ( ⁇ )”.
  • ranking the USDA peak matching score from highest to lowest refers to ordering of scores from highest to lowest where the highest reflects the greatest number of matches between measured m/z values and calculated masses from a known sequence.
  • in silico refers generally, to processes taking place via computer calculations.
  • DNA sequences of hundreds of organisms have been decoded and stored in databases. Indeed, the amount of information stored in "in silico databases” continues to grow exponentially as more genomes are sequenced and more proteomes are characterized. Thus, a large body of "in silico” genomic information has been obtained and stored and the amount continues to grow.
  • the information stored in an "in silico database” may be analyzed to determine inter alia genes that encode polypeptides and/or the sequence of the polypeptides encoded by the genes. Such protein sequences are referred to herein as "genomically-derived".
  • in silico protein sequences comprise a "genomically-derived” protein sequence deduced by computer calculations based on a known DNA sequence.
  • an "in silico” protein sequence may comprise the actual protein sequence as determined by a physical protein sequencing method e.g., Edman degradation, de novo sequencing by mass spectrometry, etc.
  • the expression "in silico MS/MS spectrum” as used herein refers to a theoretical or hypothetical tandem mass spectrum generated by a computer based on known protein sequences.
  • the term "in silico" fragment ion as used herein takes on the meaning as typically used in the art and thus, refers to theoretical protein fragments generated by fragmentation performed in silico on known protein sequences.
  • an in silico MS/MS spectrum shows theoretical fragment ions generated at every residue.
  • an in silico MS/MS spectrum shows theoretical fragment ions generated at selected residues.
  • mass spectra of known protein sequences refers to theoretical mass spectra generated in silico by calculated fragmentation of genomically- derived protein sequences and/or to mass spectra that are physically generated from known proteins.
  • the expression "mass spectrum of an unknown protein” as used herein, refers to the experimentally obtained mass spectrum of a protein whose identity has not been determined with certainty. Typically, an experimentally acquired MS/MS spectrum of a protein rarely shows fragment ions at every residue because the fragmentation efficiency at every residue is not the same.
  • source organism refers to an organism that has provided or that is used to provide a sample and hence proteins for analysis by laser desorption ionization mass spectrometry (e.g., Matrix-Assisted Laser Desorption/Ionization MALDI) as disclosed herein.
  • a source organism is a microorganism.
  • a source organism is a bacterium.
  • a source organism is a protein toxin, a plant, an animal, an insect, a virus or a human.
  • Instrument calibration involves comparing the observed masses of a mixture of known standards (e.g., protein standards) to their calculated exact masses. Any discrepancy between a standard's measured m/z and its known m/z is considered error.
  • the m/z error (Am/z, i.e. the difference between the measured m/z and the actual m/z) is plotted as a function of analyte ion m/z.
  • characteristic systematic error related to the inherent calibration of the instrument refers to systematic error as revealed by a linear regression analysis fit of the relevant data (e.g., Am/z vs fragment ion m/z).
  • statically random error refers to statistically random error as defined by a linear regression analysis fit of data. Regression analysis is well known in the art (see e.g., Draper, N.R. and Smith, H. Applied Regression Analysis, Wiley Series in Probability and Statistics (1998); Richard A. Berk, Regression Analysis: A Constructive Critique, Sage Publications (2004); David A. Freedman, Statistical Models: Theory and Practice, Cambridge University Press (2005))
  • polypeptide and “protein” are used interchangeably herein to refer to a functional polymer of amino acid residues.
  • a functional protein folds cooperatively and comprises multiple secondary structural elements e.g., ⁇ -helices or ⁇ - pleated sheets, that interact in the final structure.
  • the smallest known protein is TRP-Cage, a functional protein of only 20 amino acids (see e.g., Jonathan W. Nommeh et al. (2002) Nature Structural Biology 9:425 - 430).
  • protein typically refers to a polymer of amino acid residues that is above about 5 kDa molecular weight.
  • a polymer of amino acid residues that is below about 5 kDa molecular weight is typically referred to as a "peptide".
  • a “peptide” is not a “protein”, and a “peptide” is not a “polypeptide”.
  • amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
  • Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, ⁇ -carboxyglutamate, and O-phosphoserine.
  • Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
  • Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid. Amino acids are referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission.
  • microorganism refers to is an organism that is microscopic. In its broadest sense the term “microorganism” refers to a diverse array of organisms including, but not limited to bacteria, fungi, archaea, and protists, as well as some microscopic plants and animals e.g., plankton.
  • virus refers to sub-microscopic infectious agents that are typically unable to grow or reproduce outside a host cell.
  • a viral particle, or virion comprises genetic material e.g., DNA or RNA, within a protective protein coat called a capsid.
  • Viruses infect all cellular life forms and are grouped into animal, plant and bacterial types, according to the type of host infected.
  • protein toxin refers to refers to any polypeptide that is deleterious to humans or other mammals when it is injected, ingested, inhaled or when contacted with the skin.
  • Rapid, accurate identification of proteins and the source organisms from which they are derived is increasingly valuable as threats to biosecurity of the environment, public health, food production and safety, transportation and national defense all continue to increase. Rapid, accurate identification of proteins also facilitates the work of forensic scientists concerned with the protection of endangered species and/or with solving of personal crime.
  • the identity of proteins connects directly to the genetic identity of the source organism (e.g., a pathogenic organism; protein toxin e.g., prion; blood sample; etc). Identification of a protein may be used to successfully identify the source organism (e.g., a bacterium, an endangered species, etc) from which it is derived. Fortunately, variations in protein biomarker amino acid composition due to non-synonymous mutations of the biomarker gene result in variations in protein molecular weight (MW) across genus, species and strains. The ability to tap into this information on a precise level is thus invaluable for the accurate identification of source organisms.
  • MW protein molecular weight
  • an exemplary embodiment of the invention provides a method for rapid and accurate identification of proteins using laser desorption ionization mass spectrometry methods e.g., MALDI.
  • identification of the protein permits identification of the source organism from which the identified protein is derived.
  • the method comprises a peak-matching/scoring mathematical algorithm (the USDA peak matching algorithm) for comparison of MS/MS spectra of protein biomarkers and in silico MS/MS spectra of protein sequences contained in a database.
  • a USDA peak matching algorithm is the USDA ⁇ peak matching algorithm and has the formula:
  • the USDA peak matching algorithm (either or ⁇ or ⁇ ) is incorporated into a computer software program such that a MS/MS spectrum can be compared to thousands of in silico MS/MS spectra in seconds thereby allowing rapid identification of a protein and its source organism.
  • the method further comprises steps for confirming the correctness of the protein identification, thereby ensuring accuracy.
  • confirming the correctness of the protein identification is achieved through error analysis.
  • the error analysis comprises analyzing the difference in mass-to-charge (m/z) between the MS/MS fragment ions and their putative in silico fragment ion "matches". Correct identifications are characterized in that the error is typically limited to systematic error caused by the inherent calibration error of the mass analyzer. In contrast, incorrect identifications are characterized by random error caused by false "matches".
  • confirming the correctness of the protein identification is achieved by performing an identification of an unknown protein by comparing the MS/MS spectrum of the unknown protein to a full array of MS/MS in silico spectra of protein sequences contained in a database, and then performing the identification by comparing the MS/MS spectrum of the unknown protein to a set of MS/MS in silico spectra of protein sequences contained in the same database which are limited to those spectra which arise when the fragmentation occurs only at aspartic acid (D) glutamic acid (E) and proline (P) residues; and observing that the difference between the highest and the second highest USDA peak matching scores is the same or greater than the difference between the highest and the second highest USDA peak matching scores obtained in the identification using the full array of MS/MS in silico spectra of protein sequences contained in the database.
  • D aspartic acid
  • E glutamic acid
  • P proline
  • confirming the correctness of the protein identification is achieved by performing an identification of an unknown protein by comparing the MS/MS spectrum of the unknown protein to a full array of MS/MS in silico spectra of protein sequences contained in a database, and then performing the identification by comparing the MS/MS spectrum of the unknown protein to a set of MS/MS in silico spectra of protein sequences contained in the same database which are limited to those spectra which arise when the fragmentation occurs only at aspartic acid (D) residues; and observing that the difference between the highest and the second highest USDA peak matching scores is the same or greater than the difference between the highest and the second highest USDA peak matching scores obtained in the identification using the full array of MS/MS in silico spectra of protein sequences contained in the database.
  • D aspartic acid
  • Enzymatic digestion of a protein is not required for analysis and identification of proteins using the disclosed methods. Thus, in one exemplary embodiment, proteins are analyzed without prior enzymatic digestion. However, in another exemplary embodiment, proteins are analyzed following enzymatic digestion.
  • the methods and algorithms disclosed herein are contained in a computer readable storage medium thereby providing instructions that when executed by a computer, causes the computer to perform a method for identification of an unknown protein.
  • Mass spectrometry is a sensitive and specific analytical technique that is increasingly being developed for detection, identification and characterization of proteins. Thus, mass spectrometry is also becoming a powerful tool for the identification of pathogenic bacterial microorganisms, viruses, and protein toxins and also finds use in proteomics and forensic science.
  • the methods disclosed herein utilize routine techniques in the field of mass spectrometry.
  • Basic texts disclosing general mass spectrometry methods include e.g., Mass Spectrometry: A Textbook, by Jurgen H. Gross, (2002, 2004, 2006) Springer, and Mass Spectrometry: Principles and Applications by Edmond de Hoffmann, and Vincent Stroobant, (2002) John Wiley and Sons Ltd, (each of which is incorporated herein by reference).
  • Laser Desorption/Ionization is disclosed e.g., in Laser Desorption Ionization Mass Spectrometry of Bioorganic Molecules by: Michael Karas, and Ute Bahr (1993) Methods in Molecular Biology Vol.17 pages 215-228 Springer.
  • Laser desorption/ionization mass spectrometry methods which produce singly, or occasionally doubly charge ions are suitable for use in the protein identification methods disclosed herein.
  • any method that is capable of mass isolating and fragmenting singly charged protein ions in the gas phase is suitable for use in the protein identification methods disclosed herein.
  • Laser desorption/ionization methods known in the art which have the ability to produce singly charged and sometimes doubly charged ions include, but are not limited to SELDI (see e.g. Surface-enhanced laser desorption/ionization (SELDI), Ning Tang, et al. (2004) Mass Spectrometry Reviews, 23:34-44); Infrared laser desorption/ionization on silicon (see e.g., Bhattacharya SH et al. (2002) Anal Chem. May 1;74(9):2228-31); Laser desorption/ionization mass spectrometry on porous silicon (see e.g., Seetharaman Vaidyanathan, et al.
  • ESI electrospray ionization
  • MALDI Matrix-Assisted Laser Desorption/ionization
  • the laser desorption/ionization mass spectrometry method is matrix-assisted laser desorption/ionization (MALDI).
  • MALDI is a soft ionization technique, that is useful for, inter alia the analysis of biomolecules (see e.g., Cain, T.C., et al. (1994) supra; Krishnamurthy, T., et al. (1996) supra; Krishnamurthy, T., and Ross PL. (1996) 10:1992 supra; Karas, M. & Hillenkamp, F. (1988) Analytical Chemistry, 60, 2299- 2301; Karas, M, et al. (1987). Int. J. Mass Spectrom. Ion Proc.
  • MALDI involves embedding analyte molecules in a matrix of a weak organic acid that are solids at room temperature (e.g. ⁇ -cyano-4-hydroxycinnamic acid).
  • MALDI matrices typically absorb strongly in the ultraviolet electromagnetic spectrum (e.g. 337 nm or 355 nm, etc.).
  • a pulsed nitrogen (at 337 nm) or pulsed solid state YAG laser (at 355 nm) is used to irradiate a dried spot of organic acid matrix that is embedded with analyte.
  • These lasers have repetition rates from 2-100 Hz with a pulse width of 10 nanoseconds.
  • the strong absorption of the matrix at the laser wavelength results in an explosive desorption from the target plate of matrix and analyte molecules into the gas phase.
  • analyte molecules are protonated (or deprotonated).
  • the MALDI ionization process typically results in singly charged protonated analytes (in positive ion mode). Higher charge states are possible but these typically have less signal intensity.
  • protonation typically occurs at the side-chains of basic residues (e.g., arginine, lysine, histidine).
  • MALDI mass-to-charge ratio of proteins is typically beyond the mass range of most mass analyzers.
  • the type of a mass spectrometer most widely used with MALDI is the TOF (time-of-flight mass spectrometer) since this mass analyzer has a theoretically unlimited mass range.
  • MALDI has been used for the identification of proteins isolated through gel electrophoresis or other purification methods (see e.g., Demirev, P.A., et al. Anal. Chem. 1999; 71 : 2732; Peneda, F.J., et al. Anal. Chem.
  • MALDI is also used for peptide mass fingerprinting by methods known in the art (see e.g., Pappin DJ, et al. (1993). Curr. Biol. 3 (6): 327-32; Henzel WJ, et al. (1993). Proc. Natl. Acad. Sci. U.S.A. 90 (11): 5011-5; Mann M, et al.
  • Tandem MALDI e.g., MALDI-TOF-TOF instruments have been used to fragment small to medium-sized proteins (see e.g., Lin M, et al. (2003) supra).
  • MALDI has also been used for identification of Bacillus spores by fragmenting their protein biomarkers using a tandem MALDI mass spectrometer and analyzing the sequence-specific fragment ions generated by comparison to in silico fragment ions derived from protein amino acid sequences from open reading frames of genomic databases (see e.g., Demerev et al. (2005) Anal Chem 77:7455). Identifications were tested for significance by a p-value calculation, which provides a probability that an identification occurred randomly (see e.g., Demerev et al. (2005) supra).
  • mass spectrometry was only practiced by relatively small number of highly trained specialists.
  • a revolution in mass spectrometry was triggered by the development of two ionization techniques developed in the late 1980s and early 1990s: matrix-assisted laser desorption/ionization or MALDI (Tanaka, Ido, Akita, Yoshida & Yoshida, 1987), (Karas, Bachmann, Bahr & Hillenkamp, 1987), (Karas & Hillenkamp, 1988), and electrospray ionization or ESI (Fenn, Mann, Meng, Wong, & Whitehouse, 1989).
  • MALDI matrix-assisted laser desorption/ionization
  • ESI electrospray ionization
  • genomic sequencing With the rapid development of genomic sequencing (i.e. "next-generation"), the speed of genomic sequencing, and the ability to acquire longer DNA sequence "reads", will allow almost any strain of microorganism to be completely sequenced in a relatively short period of time. This capability means that the number of strains of a genus, species, subspecies, sub-type of microorganism that will be genomically sequenced will increase signficantly beyond what is currently possible. With this ever increasing amount of genomic data being made available in public and private databases, the number of unique protein amino acid sequences (open reading frames or ORFs of genomic data) is expected to increase together with the genomic sequencing efforts.
  • the USDA peak matching algorithms are faster and give comparable results in scoring/ranking of protein/organism identifications as that obtained by other methods more complicated scoring algorithms known in the art e.g., p-value calculation (see e.g., Tables IA, 2A, 3A).
  • the difference in algorithm computation speeds is further enhanced (in favor of the USDA peak matching algorithms) when only residue-specific in silico fragment ions (e.g. D,E,P-specific fragment ions) are used for comparison to MS/MS fragment ions (see e.g., Tables IB, 2B, 3B). Under these circumstances, the USDA algorithm computation speed is cut by at least about half whereas the p-value computation speed is reduced by only about ⁇ 20% at best.
  • the USDA mass spectrometry comparison software uses plots and "fits" fragment ion m/z error as a function of fragment ion m/z to confirm the correctness of the USDA peak matching algorithm identification. Such a confirmatory analysis has heretofore not been utilized or demonstrated.
  • the methods disclosed herein are simpler, faster, more accurate and more complete than than other currently available methods.
  • Samples may be prepared for MALDI ionization by any method known in the art
  • a purified sample of the analyte compound e.g. peptide, protein, small molecule
  • analyte compound e.g. peptide, protein, small molecule
  • the MALDI matrix of choice (see below) is dissolved in a separate aqueous solution (e.g. 2: 1 water/acetonitrile) to make a saturated (or sub-saturated) solution of matrix.
  • a separate aqueous solution e.g. 2: 1 water/acetonitrile
  • this solution is acidified with an acid such as e.g., 0.1% of trifluoroacetic acid
  • any suitable acidifier can be used in an effective concentration.
  • acidification facilitates protonation of analyte molecules during the desorption/ionization process.
  • the spot is allowed to dry and the target is inserted into the ionization source of the mass spectrometer.
  • a one ⁇ L aliquot of the matrix is spotted onto the stainless steel MALDI target and allowed to dry before a one ⁇ L aliquot of the sample is overlayed on top of the spot of dried matrix. The re-dissolved spot is allowed to dry before inserting the target into the mass spectrometer.
  • the sample is spotted the on the stainless steel target, and allowed to dry and then spotting the matrix on top of the dried spot of sample (see e.g., Onnerfjord, Ekstr ⁇ m, Bergquist, Nilsson, Laurell, Marko-Varga, 1999).
  • MALDI works best when contaminants (e.g. salts, small molecules, etc.) are removed from the sample before MALDI preparation. Salts, in particular, interfere with ionization by MALDI. Sample clean-up using high performance liquid chromatography (HPLC) or dialysis helps to reduce salts and small molecule contaminants that may interfere with MALDI ionization of the analyte of interest.
  • HPLC high performance liquid chromatography
  • Protein extraction may be accomplished using any suitable technique known in the art. Typically the technique chosen depends on the nature of the protein one wishes to extract. The skilled artisan will appreciate those factors that influence extraction of their protein of interest and will choose their extraction techniques accordingly.
  • proteins may be hydrophilic or hydrophobic or have regions that display both properties. Cytosolic proteins (because they reside in the aqueous cytosol of the cell) are often the easiest proteins to extract because they are hydrophilic and thus dissolve easily in aqueous solutions. Cytosolic proteins are also often high copy proteins so their relative abundance in the cellular proteome is high. In consequence, protein biomarkers of bacterial cells are often high copy cytosolic proteins. Extraction of cytosolic proteins typically involves nothing more difficult than rupturing the cellular membrane (or cell wall) to release the cytosolic proteins into the surrounding protein extraction medium (e.g. water/acetonitrile).
  • the surrounding protein extraction medium e.g. water/acetonitrile
  • Cell membrane or cell wall disruption is accomplished by any technique known in the art, e.g. bead-beating (see e.g., Mandrell, R. E., Harden, L. A., Bates, A., Miller, W. G., Haddon, W. F., & Fagerquist, C. K. (2005). Appl Environ Microbiol, 71, 6292-6307; high pressure disruption (see e.g., Smejkal, G.B., Robinson, M.H., Lawrence, N.P., Tao, F., Saravi,s C.A., Schumacher, R.T. (2006) J. Biomol. Tech., 17, 173-175; or sonication (see e.g., Balasundaram, B., Pandit, A.B. (2001) Biotechnol Bioeng. ;75 , 607-614).
  • bead-beating see e.g., Mandrell, R.
  • exemplary MALDI matrices are low molecular weight (e.g., 100-200 Da) weak organic acids which are solid at room temperature but absorb strongly at ultraviolet light at wavelengths, e.g. 337 nm (nitrogen laser) or 355 nm (3rd-harmonic of a solid state YAG laser).
  • Exemplary MALDI matrices are also typically are functionalized with polar groups, allowing their use in aqueous solutions.
  • the most popular MALDI matrices for ionizing peptides and proteins are ⁇ -cyano-4-hydroxycinnamic acid (abbreviated CHCA or CCA), 2,5-dihydroxybenzoic acid (abbreviated DHB), trans-4-hydroxy-3-methoxy-cinnamic acid (common name: ferulic acid) and 3,5 dimethoxy-4-hydroxy-cinnamic acid (common name: sinapinic acid).
  • CHCA is considered a "hot" matrix because during laser vaporization/desorption this matrix appears deposit significant amounts of energy into the peptide or protein which can result in dissociation of the peptide or protein ion after it exits the ionization chamber.
  • CHCA also generates doubly and triply protonated (charged) analytes in addition to singly protonated (charged) analytes, thus, it should be used with care in order to be suitable for use with the method disclosed herein for identification of an unknown protein.
  • sinapinic acid which is considered to be a "cold" matrix.
  • Use of sinapinic acid as a MALDI matrix tends to generate only singly protonated ions as well as high molecular weight proteins. In consequence, sinapinic acid is particularly suited to ionization of higher molecular weight proteins, e.g., above about 10 kDa.
  • Mass spectrometry is the science of "weighing" (or measuring the mass) of atoms and molecules. As is known in the art, the applications of mass spectrometry are numerous, ranging from measuring very precisely the abundances of atomic isotopes of elements found in the periodic table, to measuring with high resolution and mass accuracy the mass of large biomolecules, e.g. proteins (see e.g., Grayson, M.A. (2002) Measuring Mass , Chemical Heritage Foundation).
  • tandem mass spectrometry involves coupling two (or more) mass analyzers in tandem in order to selectively interrogate individual analyte ions observed in MS analysis.
  • a popular tandem mass spectrometer is the triple quadrupole (see e.g., Yost, R.A., Enke, CG. (1978) J. Amer. Chem. Soc, 100:2274-2275).
  • the first quadrupole of a triple quadrupole instrument When used in MS/MS mode, the first quadrupole of a triple quadrupole instrument is operated so as to allow only ions of a particular m/z to transit into the second quadrupole mass analyzer. This is called mass isolation or mass selection.
  • the mass-selected ions are fragmented in a second quadrupole typically by collision-activated dissociation (CAD).
  • CAD collision-activated dissociation
  • the fragment ions generated are then analyzed and detected by the third quadrupole mass analyzer. Because of mass- selection/isolation, the fragment ions generated in the second quadrupole are linked to the analyte precursor ions selected by the first quadrupole.
  • TOF/TOF mass spectrometry is known in the art (see e.g., U.S. Pat. No. 6,300,627).
  • a method of identifying an unknown protein employs MALDI TOF/TOF mass spectrometry.
  • MS/MS using a MALDI-TOF-TOF instruments involves using the first TOF mass analyzer to separate ions in space and time. Because ions are separated on TOF instruments on the basis of their relative velocities and this is related to an ion's m/z, a timed ion "gate" is used to mass-select/isolate ions of a specific m/z. Only ions of a specific m/z (with a specific velocity and thus arrival time at the "gate") are allowed to pass from the first TOF mass analyzer to a collision cell. All other ions arriving either "too early” or “too late” are deflected from entering the collision cell. Thus, mass-selection/isolation is attained.
  • PSD high energy collision-activated dissociation
  • PSD post-source dissociation
  • LID laser- induced dissociation
  • the method comprises confirming that the highest USDA peak matching score constitutes an identification of the unknown protein.
  • the correctness of the identification is confirmed by plotting the difference in m/z (Am/z) between an MS/MS fragment ion of the unknown protein and its matched fragment ion from the in silico MS/MS spectra generated from a genomically-derived database of protein sequences as a function of MS/MS fragment ion m/z.
  • the resulting plot of Am/z vs MS/MS fragment ion m/z is subjected to a linear regression analysis fit of the data. Linear regression analysis is known in the art (see e.g., Skoog, D.A. & West, D. M. (1986). Analytical Chemistry, 4th edition.)
  • linear regression analysis is the process by which a "best" fit straight line is fitted to data plotted in two dimensions (e.g. x-dimension and y-dimension).
  • such an analysis is used in creating a calibration curve for a mass spectrometer.
  • the simplest linear regression is the method of least squares.
  • the method of least squares is a regression analysis that minimizes the square of the vertical displacement (residuals) of the data points from the line that is being fitted to the data. This process generates the "best" fit of the line to the data points (Skoog & West, 1986, supra).
  • a correct protein identification is indicated when the plot of Am/z vs MS/MS fragment ion m/z reveals a characteristic systematic error related to the inherent calibration error of the mass analyzer.
  • the mass spectrometer prior to running a sample, is tuned to maximize sensitivity, resolution and mass accuracy. Typically, this involves either manually or automatically adjusting the instrument's ion optics using a known standard. This process ensures that the ionization source, mass analyzer and detector are all functioning properly. As part of this process, the mass analyzer is also calibrated. [0126] Calibrating the mass analyzer ensures that mass measurement is within the operating specifications of the instrument. As the skilled artisan will appreciate, instrument calibration in MS mode involves comparing the observed masses of a mixture of known standards to their actual masses. Any discrepancy between a standard's measured m/z and its known m/z is considered error.
  • the m/z error or Am/z (i.e. difference between the measured m/z and the actual m/z) is plotted as a function of analyte ion m/z.
  • a linear regression analysis e.g., higher order curve fitting
  • mass analyzer "drift" is due to changes in the temperature of the room in which the instrument is housed, however other causes could be in play.
  • TOF, TOF-TOF and hybrid quadrupole-TOF or ion trap-TOF instruments are particularly susceptible to calibration "drift” due to changes in room temperature. In consequence, the instrument may require re- calibration daily (or more often) if there is a significant change in room temperature.
  • the "drift" in calibration of TOF-based mass spectrometry instrumentation is exploited with respect to peptide and protein identification that involves comparison of an MS/MS spectrum to in silico MS/MS spectra.
  • a tryptic peptide (with a known amino acid sequence) analyzed using a hybrid quadrupole-TOF mass spectrometer in MS/MS mode generates an MS/MS spectrum that, when "matched” to its correctly identified in silico MS/MS peptide spectrum, results in a linear correlation (using linear regression analysis) between the fragment ion m/z error as a function of fragment ion m/z, and that this linear correlation was not observed when the MS/MS spectrum was "matched” to an incorrect in silico MS/MS peptide spectrum.
  • an exemplary embodiment of the invention provides a comparison of fragment ions generated from MS/MS of mature, intact proteins from cell lysates analyzed using a tandem TOF instrument to in silico fragment ions from protein amino acid sequence in a database.
  • the difference in m/z between the MS/MS fragment ions and their putative in silico fragment ion "matches" are plotted as a function of the MS/MS fragment ion m/z.
  • a linear or least-squares fit of such data is used to confirm the correctness of the USDA peak matching algorithm identification.
  • a correct identification displays evidence of a linear correlation between m/z error vs. fragment ion m/z whereas an incorrect identification will display poor correlation (i.e. random error) between m/z error vs. fragment ion m/z.
  • the method comprises confirming that the highest USDA peak matching score constitutes an identification of the unknown protein.
  • the correctness of the identification is confirmed by performing the method while limiting the in silico MS/MS spectra generated from a genomically-derived database of protein sequences to spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, glutamate (E) residue, or proline (P) residue. If the difference between the highest USDA peak matching score and the second highest USDA peak matching score is equal to or greater than the difference between the highest USDA peak matching score and the second highest USDA peak matching score obtained when the method is performed without the limitation to D, E, and/or P residues this confirms the identification of the unknown protein.
  • the method for identifying an unknown protein is contained within computer readable storage medium storing instructions that, when executed by a computer, causes the computer to perform a method for identification of an unknown protein.
  • the software allows an "MS/MS to In Silico Comparison" to compare MS/MS fragment ions to all possible in silico MS/MS fragment ions or to only residue-specific in silico MS/MS fragment ions.
  • the software allows an "MS/MS to In Silico Comparison" to compare MS/MS fragment ions to a subset of all possible in silico MS/MS comprising certain selected residue-specific in silico MS/MS fragment ions.
  • the comparison is executed by the software that compares the subset of in silico MS/MS residue-specific in silico MS/MS fragment ions comprising D,E,P- specific in silico MS/MS fragment ions to the MS/MS fragment ions.
  • the comparison is executed by the software that compares the subset of in silico MS/MS residue-specific in silico MS/MS fragment ions comprising D-specific in silico MS/MS fragment ions to the MS/MS fragment ions.
  • D aspartic acid
  • E glutamic acid
  • P proline
  • the reason for this increase is that, if it is known experimentally that a particular protein (or proteins) will preferentially fragment at particular sites along the polypeptide backbone due to specific residues adjacent to such cleavage sites, then the software can be directed to include only those residue-specific in silico MS/MS fragment ions for comparison to the experimentally measured MS/MS fragment ions, i.e. they are fewer in silico MS/MS fragment ions that are involved in the comparison to MS/MS fragment ions, thus increasing the numerical value of the "USDA Score". Such selectivity not only increases the identification score of the correct identification, but also reduces the computation time of the analysis because fewer in silico MS/MS fragment ions are being compared.
  • an in silico MS/MS database is constructed to retrieve the amino acid sequences of all bacterial proteins having a protein molecular weight the same as the protein biomarker molecular weight within a specified mass tolerance (e.g. 10,000 ⁇ 5 Da).
  • Bacterial protein amino acid sequences can be downloaded from public web-based database servers (e.g. ExPASY proteomics server, available through Swiss Institute of Bioinformatics).
  • the Tagldent software tool at the Expasy website allows the retrieval of proteins on the basis of taxonomic identification of the source organism as well as protein p/, protein molecular weight and any sequence tag information (e.g., a short sequence of adjacent amino acid residues in the protein) if it available.
  • Tagldent searches the public databases of UniProtKB/Swiss-Prot and/or UniProtKB/TrEMBL for all proteins which correspond to the specified search parameters. [0141]
  • all of the proteins that fit the specified search criteria are compiled into a single large FASTA file. This multi-protein sequence FASTA file is then imported into a mass spectrometry-based proteomics software (e.g.
  • Mass spectrometry-based proteomics software e.g., GPMAW, converts each protein amino acid sequence contained in the FASTA file into a series of in silico MS/MS fragment ions.
  • the fragment ions are identified by their m/z, ion type/number (e.g. bs2, V44, a27, y3 2 -17, b92-18, etc.) and the two amino acid residues immediately adjacent to the polypeptide cleavage site that generated the fragment ion.
  • Each protein sequence (and its associated in silico MS/MS fragment ion information) is exported by the mass spectrometry-based proteomics software e.g., GPMAW, software as a separate datafile.
  • GPMAW mass spectrometry-based proteomics software
  • a single multi-protein sequence FASTA file containing 700 protein sequences will result in 700 in silico MS/MS datafiles when processed by GPMAW.
  • These in silico MS/MS datafiles are then imported into the in silico MS/MS database of the USDA mass spectrometry comparison software using Java client ("InSilicoUpload.jar", i.e.
  • the amino acid sequence of a protein is determined by genetic or genomic sequencing of the gene whose product is protein.
  • the genomically-derived amino acid sequence of protein is determined and/or confirmed by proteomic techniques such as Edman sequencing or "bottom-up” or “top-down” mass spectrometry-based proteomic techniques.
  • An MS and/or MS/MS spectrum of a protein whose identity was previously determined based on genomic sequencing of the protein's gene or Edman sequencing of the protein's N-terminal sequence is an exemplary mass spectrum of a known protein.
  • a "temporary database” is simply tabulated data that is stored temporarily in random access memory (RAM). Processing such tabulated data when it is stored in RAM is significantly faster than processing the same data when it is stored on a hard drive.
  • the invention provides a computer readable storage medium storing instructions that, when executed by a computer, causes the computer to perform a method for identification of an unknown protein.
  • the method for identifying the unknown protein comprises: (i) comparing mass-to-charge (m/z) fragment ion peaks from an mass spectrum of the unknown protein to that of m/z fragment ion peaks from mass spectra of known protein sequences; and (ii) matching the m/z fragment ion peaks from the mass spectrometry spectrum of the unknown protein to the m/z fragment ion peaks from the mass spectrometry spectra of known protein sequences to provide mass spectrometry peak matches; (iii) scoring the mass spectrometry peak matches using the formula:
  • the invention provides a computer readable storage medium storing instructions that, when executed by a computer, causes the computer to perform a method for identification of an unknown protein.
  • the method for identifying the unknown protein comprises: (i) comparing mass-to-charge (m/z) fragment ion peaks from an mass spectrum of the unknown protein to that of m/z fragment ion peaks from mass spectra of known protein sequences; and (ii) matching the m/z fragment ion peaks from the mass spectrometry spectrum of the unknown protein to the m/z fragment ion peaks from the mass spectrometry spectra of known protein sequences to provide mass spectrometry peak matches; (iii) scoring the mass spectrometry peak matches using the formula:
  • the instructions on the computer readable storage medium comprise a computer software program for the identification of proteins by analysis of fragment ions generated from gas phase fragmentation of singly charged protein ions generated by matrix-assisted laser desorption/ionization (MALDI) and analyzed by tandem time-of- flight (TOF) mass spectrometry (MS/MS). Prior enzymatic digestion of the proteins is not required.
  • the software also provides instructions for performing a pair-wise comparison of an unknown MALDI-TOF-MS spectrum to that of known MALDI-TOF-MS spectra and rank spectra according to spectral similarity thereby enabling a user to identify an unknown spectrum.
  • the USDA mass spectrometry comparison software (which in exemplary embodiments may utilize either the USDA ⁇ or the USDA ⁇ peak matching algorithms) is written in JAVA and JSP computer language. However, in other exemplary embodiments the software is written in C, C++, PHP, Assembly or any other web-based software languages known in the art. To ensure that the web based/cross platform component is available a web server based language is utilized e.g., ASP, JSP, PHP, etc. [0151] The code for software embodiments is disclosed herein in the computer program listing appendix.
  • the USDA mass spectrometry comparison software (which in exemplary embodiments may utilize either the USDA ⁇ or the USDA ⁇ peak matching algorithms) comprises the following features, functionalities and attributes: [0152] A web browser interface and associated databases that utilize MySQL for database management.
  • the USDA mass spectrometry comparison software enables efficient entry, deletion, retrieval and searching of organism (e.g., microorganism) isolate information, e.g. in the case of a microorganism taxonomy, origin, source, etc.
  • organism e.g., microorganism
  • the USDA mass spectrometry comparison software enables the entry of ASCII formatted m/z and intensity MS and MS/MS data files to databases for subsequent searching, retrieval or deletion.
  • the USDA mass spectrometry comparison software enables the entry of single data files (or multiple data files) of ASCII formatted m/z MS/MS in silico data files to a database for subsequent searching, retrieval or deletion.
  • Th is Thomson the unit of m/z of the precursor protein ion.
  • Th is Thomson the unit of m/z of the precursor protein ion.
  • the USDA ⁇ peak matching algorithm has the formula:
  • the highest scoring protein/microorganism identification obtained using either the USDA ⁇ or USDA ⁇ peak matching algoritms, that is significantly higher than the second highest scoring protein/microorganism identification constitutes a presumptive correct identification.
  • significantly higher is a difference in score between the highest scoring identification and the second highest scoring identification that is equal to or greater than 2.
  • significantly higher is a difference in score between the highest scoring identification and the second highest scoring identification that is equal to or greater than 3.
  • significantly higher is a difference in score between the highest scoring identification and the second highest scoring identification that is equal to or greater than 4 or more.
  • a probability-based significance testing algorithm (e.g., p-value calculation see Demirev et al. (2005) supra) is incorporated into the USDA mass spectrometry comparison software.
  • the USDA peak matching score and the p-value calculation are completely independent.
  • the results of each calculation are displayed side-by-side in the identification results window.
  • the USDA mass spectrometry comparison software enables a user to rank the protein/microorganism identifications according to either the USDA peak matching score or the probability -based significance testing algorithm.
  • the USDA mass spectrometry comparison software enables a user to enter and retrieve data, and search or delete a database containing ASCII formatted m/z and intensity MALDI-TOF-MS data.
  • the USDA mass spectrometry comparison software performs a pair-wise comparison of a MALDI-TOF-MS spectrum from an unknown protein to that of MALDI-TOF-MS spectra from samples of known proteins and to rank the spectra according to spectral similarity thereby providing a taxonomic classification of the unknown protein and hence of the source organism from which the unknown protein is derived.
  • the algorithms used for such a pairwise comparison are disclosed above.
  • the USDA mass spectrometry comparison software assigns the identity of m/z peaks in a MALDI-TOF-MS spectrum by comparison to another database of theoretical protein molecular weights derived from genomic data (e.g., open-reading frames or ORFs).
  • the USDA mass spectrometry comparison software displays a side-by-side comparison of the measured fragment ion m/z and the m/z of an in silico fragment ions to which it matches.
  • a plot of the m/z error (Am/z) i.e. the difference in m/z between the measured fragment ions and their in silico fragment ion matches, reveals a characteristic systematic error caused by the inherent calibration error of the instrument.
  • Incorrect protein identifications in contrast, are seen to display only statistically random error caused by false "matches".
  • the confirmation of the correctness of the unknown protein identification by systematic error is independent of the mathematical algorithm used for unknown protein identification.
  • FIG. 1 provides a general overview of the framework for the USDA mass spectrometry comparison software.
  • the software stored on a computer readable storage medium provides instructions that when executed by a computer, causes the computer to perform a method for identification of an unknown protein.
  • the instructions comprising the USDA mass spectrometry comparison software utilizing either the USDA ⁇ or USDA& peak matching algorithms are provided herein in the computer program listing appendix.
  • FIG. 2 shows the database model describing how the data is stored.
  • a MySQL Database Management System (MySQL DBMS) is used as the back-end (i.e.
  • a Tomcat Apache (TA) web server delivers the user/operator interface to any computer platform (e.g. PCs, Macintosh, Unix).
  • the front-end i.e. the software with which the user/operator interacts
  • JSP Java Server Pages
  • a second front-end is a Java client (i.e.
  • the web client allows the user/operator to search, archive, retrieve and edit microorganism strain information as well as perform spectral similarity analysis of MS and MS/MS data of microorganism proteins or toxin proteins, e.g. comparison of MS a ⁇ -> MSb or MS/MS a ⁇ -> MS/MSb or MS/MS ⁇ -> In Silico MS/MS.
  • the web client also allows a user/operator to display plots of archived MS, MS/MS and in silico MS/MS data.
  • the web client also facilitates visual comparison of putative "matched" data by displaying stacked or mirrored plots of MS ⁇ -> MS, MS/MS ⁇ -> MS/MS or MS/MS ⁇ -> In Silico MS/MS data.
  • FIG. 3 describes the USDA mass spectrometry comparison software process used to compare each dataset.
  • Spectral similarity analysis of MS or MS/MS data involves multiple steps.
  • the user/operator selects the parameters under which the data analysis is to be conducted.
  • Exemplary parameters include, but are not limited to: 1. the specific microorganisms MS/MS data as determined by a primary key (i.e. an integer that uniquely identifies a dataset); 2. the mass range to be compared; 3. the minimum relative intensity threshold of MS peaks to be compared; 4. the tolerance of the mass-to-charge (Am/z) when comparing the m/z of two fragment ion peaks; 5. the scoring algorithm to be used in the analysis; 6. the sorting the identifications by their scores.
  • the user/operator may also choose search parameters that affect the list of reference data sets, for example, 1. taxonomical identification of the microorganism; 2. identification number; 3. protein name; 4. text notes of the references.
  • the primary keys (an integer that uniquely identifies a dataset) of the datasets are stored in random access memory (RAM) and looped through and their respective data to be individually compared against the user/operator selected dataset iteratively.
  • Both datasets the one chosen by the user/operator to run for a comparison and the current iteration for comparison against the whole database, are "filtered" by the parameters selected by the user/operator as described above.
  • Memory table is a term being used to describe a MySQL DB table that utilizes the memory based storage engine (e.g. RAM). This increases the speed of the comparison.
  • the USDA peak matching algorithm counts the total number of in silico fragment ions and adds this number to the total number of MS/MS fragment ions whose intensity is equal to or greater than the minimum intensity threshold. [0166] The algorithm then counts the total number of in silico fragment ions that are within Am/z of MS/MS fragment ions, i.e. the number of "matches" between two datasets. The number of counted "matches" is multiplied by two and divided by the previously mentioned summation of in silico MS/MS and MS/MS fragment ions. This number is then multiplied by 100% to give the USDA peak matching score.
  • the USDA peak matching score has a theoretical range from 0 to 100% with 0% meaning no matches were identified and 100% meaning every single peak was matched between the two datasets.
  • a non-zero Am/z means that it is possible for an MS/MS fragment ion peak to "match" to two (or more) in silico fragment ion peaks (or vice versa). Such "multiple" matches are counted only once by the USDA peak matching algorithm, otherwise a USDA peak matching score greater than 100% may occur. This counting/matching/scoring process is identical to the method used for comparing two MS spectra of MALDI-TOF MS data.
  • the peak matching algorithm involves counting the number of MS/MS fragment ions whose intensity is equal to or greater than a relative intensity threshold (e.g. 2%). The algorithm then counts the number of in silico fragment ions whose m/z falls within a specified m/z tolerance (e.g. ⁇ 2.5 Th) to that of the m/z of MS/MS fragment ions, i.e. counting the number of "peak matches” between MS/MS fragment ions and in silico fragment ions of the two datasets. The number of " peak matches " is then divided by the total number of MS/MS fragment ions above the specified intensity threshold. This number is then multiplied by 100% to give the peak matching score shown below:
  • the USDA ⁇ peak matching score has a theoretical range from 0 to 100%. Zero percent indicates no peak matches were identified and 100% indicates every single MS/MS fragment ion was matched to an in silico fragment ion of an identification. A non-zero fragment ion m/z tolerance indicates that it is possible for an MS/MS fragment ion m/z to "match" to the m/z of two (or more) in silico fragment ions (or vice versa). Such multiple matches are counted only once by the algorithm, otherwise a score greater than 100% may result.
  • the highest scoring protein/microorganism identification that is significantly higher than the second highest scoring protein/microorganism identification constitutes a presumptive correct identification. "Significantly” as used herein refers a relative difference in score between the top identification and the second highest scoring identification, typically of about 15-20% (or greater).
  • the USDA peak matching algorithms are less computationally complex than other protein identification algoritms known in the art e.g., a p-value calculation (see e.g., Demirev et al. (2005) supra).
  • the computation time of the USDA peak matching algorithms are rapid as well as accurate. Indeed, in an exemplary embodiment, computation time is as much as 50% faster than the same p-value calculation.
  • algorithm computation time plays an increasingly important factor in rapid and efficient protein/microorganism identification.
  • microorganism identification protocol for the identification of a microorganism using matrix assisted laser desorption ionization (MALDI) mass spectrometry to identify an unknown protein and it corresponding source organism.
  • MALDI matrix assisted laser desorption ionization
  • a 0.5 ⁇ L aliquot of supernatant is deposited onto stainless steel target pre-spotted with MALDI matrix.
  • Raw MS and MS/MS data is processed and converted to ASCII formatted mass- to-charge (m/z) vs. intensity data.
  • the ASCII formatted MS and MS/MS data are uploaded to their respective MySQL MS database (DB) and MySQL MS/MS DB of the USDA software.
  • the MW [(PPI m/z - 1) + 131] ⁇ 5 Da FASTA file is edited to remove N- terminal methionine from all protein amino acid sequences.
  • the protein identification is also modified to highlight this in silico post-translational modification (PTM).
  • Each multi-sequence Fasta file is processed using a beta-version of the commercial software GPMAW.
  • the beta-version (8.0 Ia5) has enhanced features developed by ⁇ Lighthouse Data at USDA's request.
  • Each processed FASTA file generates ⁇ 600-700 text files.
  • Each text file contains the taxonomic identification of the microorganism, the protein identification and its MW (average) and its in silico fragment ions as identified by their m/z (average), their ion type (a, b, b-18, y, y-17, y-18) and the two amino acid residues immediately adjacent to the site of polypeptide backbone cleavage which generated the specific fragment ion.
  • the MW (PPI m/z - 1) ⁇ 5 Da text files are sorted by file size in order to identify any proteins having a putative signal peptide (SP). These SP-associated text files are excluded from upload to the MySQL In Silico DB. Instead the SP-identified proteins are individually downloaded from the ExPASy web server as single sequence FASTA files. These single sequence FASTA files are edited to remove the SP, and the protein identification is modified to highlight this in silico post-translational modification (PTM). These new sequences are compiled into a single FASTA file and processed by GPMAW. The text files generated are then ready for upload to the MySQL In Silico DB.
  • SP putative signal peptide
  • the MW [(PPI m/z - 1) + 131] ⁇ 5 Da text files are sorted by file size in order to identify a small number of proteins having a putative SP. These SP-associated text files are excluded from upload to the MySQL In Silico DB. The non-SP-associated text files are ready for upload to the MySQL In Silico DB.
  • Protein/bacteria IDs are sorted and displayed on the basis of their USDA score ( ⁇ or ⁇ ) and/or p-value.
  • Protein/bacteria IDs are also confirmed by plots of fragment ion error analysis: systematic error (i.e. instrument calibration error) versus random error.
  • Protein/bacteria IDs are also confirmed by residue-specific fragment ions, e.g. the number and percentage of D,E,P-specific fragment ions.
  • Bacterial proteins were extracted from Campylobacter cells using a technique that has been previously reported (see e.g., Mandrell RE, et al. Applied Environ. Microbio. 2005; 71: 6292; Fagerquist CK, et al. Anal. Chem. 2005; 77: 4897; Fagerquist CK, et al. J. Proteome Research. 2006; 5: 2527. Briefly, C. jejuni (strain RM1221), C. coli (strain RM2228), C. upsaliensis (strain RM3195) and C.
  • lari (strain RM2100) were each cultured on non-selective growth media for 24-48 hours.
  • One ⁇ L of cells were transferred to a microcentrifuge tube containing 0.5 mL of extraction solvents (67% water, 33 % acetonitrile and 0.1 % TFA) and 40 mg of 0.1 mm zirconia/silica beads (BioSpec Products Inc., Bartlesville, OK).
  • the tube was capped and agitated for 60 seconds with a bead-beater. The tube was then centrifuged at 10,000 rpm for 4-5 minutes.
  • the following example illustrates an exemplary mass analysis using high energy collision-induced dissociation as well as post-source dissociation on a MALDI tandem-TOF mass spectrometer to generate MS/MS spectra in reflectron-mode in positive ion mode.
  • Samples were analyzed using an Applied Biosystems 4800 TOF-TOFTM Analyzer mass spectrometer (Foster City, CA). Spectra were analyzed in both MS linear-mode and MS/MS in reflectron-mode in positive ion mode. Source acceleration in the first source in linear-mode was 20.00 kV.
  • MS/MS reflectron-mode ions were initially accelerated at 8.00 kV in the first source, mass-selected with a timed ion selector, the mass-selected ions were then decelerated to 1.70 kV, fragmented with the target gas (air) in the floating collision cell at 2 kV and the fragment ions formed were re-accelerated to 15 kV in the second source.
  • Data was collected with the metastable (precursor ion) suppressor, located after the 2nd source, in both "on" and "off mode.
  • a two-stage reflectron mirror assembly was operated at 10.910 kV (mirror 1) at 18.750 kV (mirror 2). Both linear and reflectron detectors were operated at 2.190 kV.
  • the intact protein biomarker, thioredoxin from Campylobacter upsaliensis strain RM3195 was mass-selected and fragmented in the gas phase using a MALDI-TOF-TOF mass spectrometer by methods known in the art (see e.g., Example 3 above).
  • the protein was identified previously by "bottom-up" proteomics techniques (see e.g., Fagerquist, CK. J. Proteome Research. 2007; 6: 2539-2549). Since the identity of the proteins had been determined previously, it served as a control protein for confirmation of the accuracy and rapidity of identification achievable by the method for identification of an unknown protein disclosed herein.
  • the sequence-specific fragment ions generated were used to identify the protein (and thus the microorganism) by comparison against a database containing in silico fragment ions derived from protein sequences from bacterial genomic databases.
  • FIG. 4 shows an MS spectrum (as displayed in the MALDI-TOF-TOF instrument software) of the extracted cell lysate of Campylobacter upsaliensis (strain RM3195) analyzed by MALDI-TOF-MS using sinapinic acid as the MALDI matrix.
  • the protein biomarker ion at m/z 11138.9 was analyzed by tandem mass spectrometry.
  • the MS/MS spectrum of protein biomarker ion at m/z 11138.9 is shown in FIG. 5.
  • FIG. 5 shows the MS/MS spectrum (as displayed in the MALDI-TOF-TOF instrument software) of the protein biomarker ion of Campylobacter upsaliensis (strain RM3195) at m/z 11138.9 analyzed on a MALDI-TOF-TOF-MS using sinapinic acid as the MALDI matrix.
  • Prominent fragment ions are identified by their m/z, ion type and number and amino acid residues immediately adjacent to the site of polypeptide backbone cleavage giving rise to the fragment ion.
  • FIG. 6 shows an ASCII MS/MS spectrum (m/z vs. relative intensity as displayed in the USDA software window) of thioredoxin from Campylobacter upsaliensis (strain RM3195) previously displayed in FIG. 5.
  • the MS/MS data in FIG. 5 was centroided (i.e.
  • FIG. 7 shows The "MS/MS To In Silico Comparison" search parameter table as displayed in the USDA mass spectrometry comparison software window. The user/operator defines the m/z range to be compared, the number of results to be displayed, the average molecular weight of the protein to be searched (with an associated molecular weight tolerance, e.g.
  • fragment ion m/z tolerance in Th
  • restrictions if any) on residue-specific fragment ions, i.e. fragment ions generated from polypeptide cleavage immediately adjacent to specific amino acid residues.
  • residue-specific fragment ions i.e. fragment ions generated from polypeptide cleavage immediately adjacent to specific amino acid residues.
  • the absence of an entry in the "Residues" field indicates that all fragment ions generated from the polypeptide (protein) are to be included in the search.
  • the user/operator can also select which scoring algorithm to use for analysis, i.e. USDA peak matching algorithm or the p-value algorithm (or both).
  • the scores/identifications can also be ranked/sorted.
  • FIG. 8 shows the in silico MS/MS spectrum (as displayed in the USDA software window) of the protein thioredoxin of Campylobacter upsaliensis (strain RM3195).
  • the in silico sequence was post-translationally modified (PTM) to remove the N-terminal methionine.
  • In silico fragment ions m/z are shown in the sidebar.
  • Table IA (below) displays the top five identifications of a protein biomarker of Campylobacter upsaliensis (strain RM3195) at m/z 11138.9 (as shown in FIG. 4) and analyzed by MS/MS using MALDI-TOF-TOF mass spectrometry (as shown in FIG.
  • Table IB (below) displays the top five identifications of the same protein biomarker of Campylobacter upsaliensis (strain RM3195) at m/z 11138.9 (as shown in FIG. 4) and analyzed by MS/MS using MALDI-TOF-TOF mass spectrometry (as shown in FIG. 5 and FIG. 6) and compared to all 1409 in silico MS/MS fragment ions of bacterial protein sequences having the same molecular weight as the biomarker (within ⁇ 5 Da).
  • Table IB compares peak matching scores obtained using the USDA ⁇ peak matching algorithm to the p-value calculation known in the art.
  • FIG. 9 shows a plot of fragment ion error (as displayed in the USDA software) as a function of the MS/MS fragment ion mass-to-charge (m/z) of the protein biomarker thioredoxin (from Campylobacter upsaliensis strain RM3195) and its "match" to the in silico fragment ions of thioredoxin of Campylobacter upsaliensis strain RM3195 (the highest scoring identification and the correct identification).
  • Fragment ion error (Am/z) is defined here as the difference between m/z of an MS/MS fragment ion and the m/z of its putative in silico fragment ion "match”.
  • a red square represents a "match” whose in silico fragment ion was generated from a protein backbone cleavage site that is adjacent to a D, E or P residue.
  • a black square represents a "match” whose in silico fragment ion was generated from a protein backbone cleavage site that is adjacent to only non-D,E,P residues. Note the high number (27) and percentage (87.1%) of "matches" that are associated with D,E,P residues supporting the correctness of the identification.
  • FIG. 10 shows plot of fragment ion error (as displayed in the USDA software) as a function of the MS/MS fragment ion mass-to-charge (m/z) of the protein biomarker thioredoxin (from Campylobacter upsaliensis strain RM3195) and its "match" to the in silico fragment ions of carbon dioxide concentrating mechanism protein of Cyanothece strain ATCC 51142 (the second highest scoring identification and an incorrect identification).
  • Fragment ion error (Am/z) is defined here as the difference between m/z of an MS/MS fragment ion and the m/z of its putative in silico fragment ion "match”.
  • a red square represents a "match” whose in silico fragment ion was generated from a protein backbone cleavage site that is adjacent to a D, E or P residue.
  • a black square represents a "match” whose in silico fragment ion was generated from a protein backbone cleavage site that is adjacent to only non-D,E,P residues. Note the low number (5) and percentage (26.3%) of "matches" that are D,E,P-associated supporting that this is not the correct identification.
  • Table 1C displays the top five identifications of a protein biomarker of Campylobacter upsaliensis (strain RM3195) at m/z 11138.9 (as shown in FIG. 4) and analyzed by MS/MS using MALDI-TOF-TOF mass spectrometry (as shown in FIG. 5 and FIG. 6) compared to D,E,P-specific in silico MS/MS fragment ions of bacterial protein sequences having the same molecular weight as the biomarker (within ⁇ 5 Da). This corresponded to 1409 in silico protein sequences.
  • the protein biomarker had been identified previously by "bottom-up" proteomics techniques as thioredoxin (Fagerquist, C.
  • Table 1 C compares peak matching scores obtained using the USDA ⁇ peak matching algorithm to the p-value calculation known in the art.
  • Table ID displays the top five identifications of the same protein biomarker as in Table 1C of Campylobacter upsaliensis (strain RM3195) at m/z 11138.9 (as shown in FIG. 4) and analyzed by MS/MS using MALDI-TOF-TOF mass spectrometry (as shown in FIG. 5 and FIG. 6) compared to D,E,P-specific in silico MS/MS fragment ions of bacterial protein sequences having the same molecular weight as the biomarker (within ⁇ 5 Da). This corresponded to 1409 in silico protein sequences.
  • the protein biomarker had been identified previously by "bottom-up" proteomics techniques as thioredoxin (Fagerquist, C. K., 2007, J. Proteome Res., 6, 2539-2549). The top identification correctly identifies the protein biomarker and its source microorganism. Table ID compares peak matching scores obtained using the USDA ⁇ peak matching algorithm to the p-value calculation known in the art.
  • Table 2A displays the top five identifications of a protein biomarker of Campylobacter upsaliensis (strain RM3195) at m/z 12855.3 (as shown in FIG. 4) and analyzed by MS/MS using MALDI-TOF-TOF mass spectrometry and compared to ALL in silico MS/MS fragment ions of bacterial protein sequences having the same molecular weight as the biomarker (within ⁇ 5 Da). This corresponded to 1315 in silico protein sequences.
  • the protein biomarker had been identified previously by "bottom-up" proteomics techniques as ribosomal protein 50S L7/L12 (Fagerquist, C. K., 2007, J. Proteome Res., 6, 2539-2549). The top identification correctly identifies the protein biomarker and its source microorganism.
  • Table 2B displays the top five identifications of a protein biomarker of Campylobacter upsaliensis (strain RM3195) at m/z 12855.3 (as shown in FIG. 4) and analyzed by MS/MS using MALDI-TOF-TOF mass spectrometry and compared to D,E,P- specific in silico MS/MS fragment ions of bacterial protein sequences having the same molecular weight as the biomarker (within ⁇ 5 Da). This corresponded to 1315 in silico protein sequences.
  • the protein biomarker had been identified previously by "bottom-up" proteomics techniques as ribosomal protein 50S L7/L12 (Fagerquist, C. K., 2007, J. Proteome Res., 6, 2539-2549). The top identification correctly identifies the protein biomarker and its source microorganism.
  • Table 3A displays the top five identifications of a protein biomarker of Campylobacter upsaliensis (strain RM3195) at m/z 9298.3 (as shown in FIG. 4) and analyzed by MS/MS using MALDI-TOF-TOF mass spectrometry and compared to all in silico MS/MS fragment ions of bacterial protein sequences having the same molecular weight as the biomarker (within ⁇ 5 Da). This corresponded to 1404 in silico protein sequences.
  • the protein biomarker had been identified previously by "bottom-up" proteomics techniques as 10 kD chaperonin (Fagerquist, C. K., 2007, J. Proteome Res., 6, 2539-2549). The top identification correctly identifies the protein biomarker and its source microorganism.
  • Table 3B displays the top five identifications of a protein biomarker of Campylobacter upsaliensis (strain RM3195) at m/z 9298.3 (as shown in FIG. 4) and analyzed by MS/MS using MALDI-TOF-TOF mass spectrometry and compared to D,E,P-specific in silico MS/MS fragment ions of bacterial protein sequences having the same molecular weight as the biomarker (within ⁇ 5 Da). This corresponded to 1404 in silico protein sequences.
  • the protein biomarker had been identified previously by "bottom-up" proteomics techniques as 10 kD chaperonin (Fagerquist, C. K., 2007, J. Proteome Res., 6, 2539-2549). The top identification correctly identifies the protein biomarker and its source microorganism.
  • the following Example illustrates a "top-down" proteomic approach for protein/microorganism identification of foodborne pathogens.
  • the Example illustrates the identification of a protein biomarker (putative uncharacterized protein yahO) whose amino acid sequence is unique to E. coli O157:H7 strains and thus can be used to distinguish O157:H7 strains from non-O157:H7 strains.
  • the Example illustrates that if multiple microorganisms are present in a culture, it is possible to identify multiple microorganisms on the basis of identification of at least one unique protein biomarker from each microorganism.
  • E. coli strains were preserved at -80 0 C in MicrobankTM Microbial Preservation System beads (Pro-Lab Diagnostics, Richmond Hill, Ontario, Canada). The strains were propagated using a bead and streaking for isolation on LB agar (Becton Dickinson, Sparks MD). The inoculated agar plates were incubated overnight at 37 0 C in normal atmosphere. Three E. coli strains were used in this study: two O157:H7 strains (EDL-933 and a Salinas strain) and one non-0157:H7, non-pathogenic E. coli strain. The genomically sequenced strain E.
  • EDL-933 (designated RM1272 in our strain collection) was originally isolated from raw hamburger associated with hemorrhagic colitis outbreak and binds to anti-0157 and anti-H7 MAbs.
  • the EDL-933 strain was generously provided by Jim Keen, Clay Center, Kansas.
  • the other O157:H7 strain (designated RM5603 in our strain collection) was isolated from a water sample taken from the Salinas River (Salinas, CA) in 2006.
  • RM5603 is a negative for shiga toxin 1, positive for shiga toxin 2, positive for the intimin gene (eae) and highly positive by PCR.
  • RM5603 was analyzed by multi- locus variable-number tandem repeat analysis (MLVA).
  • the non-pathogenic E. coli strain RM3061 was isolated from Romaine lettuce as part of a USDA microbiological survey of produce conducted in 2002. This sample was analyzed by Biolog microbial ID (Hayward, CA) and identified as a non-pathogenic E. coli.
  • Bacterial cells were harvested and their proteins extracted as described in detail previously. Briefly, a 1 ⁇ L loop of bacterial cells were bead-beat for 1 minute in 0.5 mL of extraction solution (67% water, 33 % acetonitrile and 0.1 % TFA) with 40 mg of 0.1 mm zirconia/silica beads (BioSpec Products Inc., Bartlesville, OK). After bead-beating, the sample was centrifuged at 10,000 rpm for 5 minutes.
  • extraction solution 67% water, 33 % acetonitrile and 0.1 % TFA
  • ions were accelerated from the source at 20 kV after delayed ion extraction for improved ion focussing. Ions were separated over an effective field free length of 1.5 m before striking a multichannel plate detector operated at 2.190 kV.
  • ions were accelerated from the source at 8.0 kV after delayed extraction. Ions were separated in a field free region between the source and the collision cell.
  • a timed ion selector (TIS) before the collision cell deflects (mass-selects) ions on the basis of arrival time so that only ions with a pre-selected m/z (i.e. arrival time) pass through the TIS.
  • TIS timed ion selector
  • the TIS window was typically operated at ⁇ 100 Da for MS/MS analysis. Ions passing through the TIS were decelerated to 1.70 kV prior to entry into a floating collision cell at 2.0 kV. Ions were fragmented by post-source dissociation (PSD) at higher than normal laser fluence. Ions exiting the collision cell were re-accelerated to 15 kV. An ion gate, after the second acceleration region, was used to suppress the un-fragmented protein ion signal.
  • a two-stage reflectron mirror assembly (mirror 1 : 10.910 kV, mirror 2: 18.750 kV) separates and deflects the fragment ions toward the reflectron multichannel plate detector also operated at 2.190 kV.
  • MS data was collected and summed from 1000-2000 laser shots which provided excellent signal-to-noise (S/N).
  • S/N signal-to-noise
  • the ultrafast MALDI target rastering allowed higher than normal laser fluence, required for protein ion fragmentation by PSD, without exhausting the sample spot.
  • Processed MS and MS/MS spectra were centroided and exported as an ASCII file (m/z vs. absolute intensity).
  • MS and MS/MS ASCII files were uploaded to their respective databases in the USDA software.
  • FIG. 11 shows the spectrum from MALDI-TOF-TOF-MS analysis of the extracted cell lysate of E. coli O157:H7 strain EDL-933 (genomically sequenced by Perna and coworkers in 2001, Perna, N.T. et al. (2001) Nature. 409(6819):529-533).
  • the MS data was collected in linear mode with HCCA MALDI matrix.
  • FIG. 12 shows the MS/MS spectrum, as viewed in the instrument software, of the protein biomarker ion a m/z 7705.6 shown in FIG. 11.
  • Prominent fragment ions are identified by their m/z and ion type/number and amino acid residues adjacent to the site of polypeptide backbone cleavage for the protein amino acid sequence of the top identification shown in Table 4: putative uncharacterized protein yahO of the pathogenic E. coli O157:H7 strain EDL-933.
  • many of the fragment ions are the result of polypeptide cleavage adjacent to aspartic (D) and/or glutamic acid (E) residues.
  • the MS/MS data in FIG. 12 was centroided, exported from the instrument software as an ASCII formatted file (m/z vs. absolute intensity) and uploaded to the USDA software for analysis.
  • Table 4 shows the top five identifications of the protein biomarker of E. coli O157:H7 strain EDL-933 at m/z 7705.6 (shown in FIG. 11) and analyzed by MS/MS using MALDI-TOF-TOF mass spectrometry and compared to all in silico fragment ions of bacterial protein sequences having the same MW as the biomarker within a tolerance of ⁇ 5 Da.
  • the protein biomarker was identified as the putative uncharacterized protein yahO.
  • the scores of the 1st and 2nd identification are significantly different compared to the other runner-up identifications.
  • FIG. 13 shows the primary amino acid sequence of the putative uncharacterized protein yahO of the pathogenic E.coli O157:H7 strain EDL-933 strain (SEQ ID NO: l)and the UPF0379 protein yahO of the non-pathogenic E. coli strain K-12 strain (SEQ ID NO:2). Both proteins have a 21 residue N-terminal signal peptide (boxed). The two proteins are different by two amino acid substitutions. A F o L substitution at residue in the signal peptide and a D o N substitution that results in a protein MW difference of 1 Da in the mature protein. Such slight differences in protein biomarker MW are difficult to detect by MALDI-TOF-MS, however sequence-specific fragmentation by MS/MS allows these two proteins (and their source microorganisms) to be differentiated.
  • the FastA file was then processed by methods known in the art and uploaded to the USDA software that in this instance utilized the USDA peak matching algorithm ⁇ .
  • the MS/MS data was re-analyzed and the results are displayed in Table 4. Further inspection of Expasy database revealed nine other strains of E. coli O157:H7 whose yahO unprocessed sequence is identical to the yahO sequence of strain EDL-933. They are: EC4196, EC4113, EC4076, EC4401, EC4486, EC4501, EC869, EC508 and EC4115/EHEC. Thus, it would not be possible to distinguish between different strains of is. coli O157:H7 using only the yahO protein biomarker.
  • N ⁇ -> D amino acid sequences of the mature yahO protein of E. coli strain K-12 and E. coli O157:H7 strain EDL- 933 (SEQ ID NO: 1) (FIG. 13)
  • Aspartic acid residues facilitate fragmentation of singly protonated protein ions. Without being bound by theory it is believed that fragmentation is facilitated because the short acidic side chain allows transfer of its acidic proton to the polypeptide backbone thereby increasing the fragmentation efficiency of the polypeptide backbone.
  • the other consequence of the N ⁇ -> D substitution is that the difference in mass of the mature yahO proteins is only 1 Da. Such slight differences in protein biomarker MW are nearly impossible to detect by MALDI- TOF-MS, however sequence-specific fragmentation by MS/MS allows these two yahO proteins (and their source microorganisms) to be differentiated.
  • JProgressBarO setDef aul tCl oseOpe rati on ( j avax . swi ng . Wi ndowConstants . EXIT_ON_CLOSE) ; setTitleC'lnsilico Data Uploader”); jLabell. setText("Enter a Directory:"); txt_Di r . setText ("C : ⁇ ") ; txt_Status . setCol umns (20) ; txt_Status . setRows (5) ; jScrollPanel.
  • addPreferredGap (javax. swi ng. LayoutStyle. ComponentPlacement. RELATED)
  • addComponent (txt_Di r , javax. swing. GroupLayout. DEFAULT_SIZE, 428, Short. MAX_VALUE))
  • addComponent (pb_upi oad, javax. swing. GroupLayout. DEFAULT_SIZE, 421, Short. MAX_VALUE)
  • addPreferredGap (javax. swi ng. LayoutStyle. ComponentPlacement. RELATED)
  • addComponent (txt_Di r , javax. swing. GroupLayout. PREFERRED_SIZE, javax. swing. GroupLayout. DEFAULT_SIZE, javax. swing. GroupLayout. PREFERRED_SIZE))
  • addPreferredGap (javax. swi ng. LayoutStyle. ComponentPlacement. RELATED)
  • addComponent (pb_upi oad, j avax . swi ng .GroupLayout . DEFAULT_SIZE , j avax . swi ng .GroupLayout . DEFAULT_SIZE , Short. MAX_VALUE)
  • addComponent (btn_Upl oad, javax. swi ng. GroupLayout . DEFAULT_SIZE, javax. swi ng. GroupLayout . DEFAULT_SIZE, Short. MAX_VALUE))
  • addComponent (j Sc roll Panel, javax. swing. GroupLayout. DEFAULT_SIZE, 251, Short. MAX_VALUE)
  • File mfile new File(txt_Di r.get ⁇ ext() . toLowerCaseO) ;
  • BufferedReader in new BufferedReader( new FileReader(mfiles[i])) ;
  • J J stmt myConn.createStatementO; stmt.executeupdate(inststmt) ;
  • -pre-init called before initialization of project properties -post-init: called after initialization of project properties -pre-compile: called before javac compilation -post-compile: called after javac compilation -pre-compi 1 e-si ngl e : called before javac compilation of single file -post-compi 1 e-si ngl e : called after javac compilation of single file -pre-compi 1 e-test : called before javac compilation of JUnit tests -post-compi 1 e-test : called after javac compilation of JUnit tests -pre-compi 1 e-test-si ngl e : called before javac compilation of single JUnit test
  • the targets of interest are:
  • nii t-macrodef-javac defines macro for javac compilation -i,n,,iit-macrodef-junit: defines macro for junit execution -i ni t-macrodef-debug : defines macro for class debugging -i ni t-macrodef-Java: defines macro for class execution -do-jar-wi th-mani fest : JAR building (if you are using a manifest) -do-jar-wi thout-mani fest : JAR building (if you are not using a manifest) run. execution of project
  • the taglib directive below imports the JSTL library, if you uncomment it, you must also add the JSTL library to the project.
  • the Add Library... action on Libraries node in Projects view can be used to add the JSTL 1.1 library.
  • the taglib directive below imports the JSTL library, if you uncomment it, you must also add the JSTL library to the project.
  • the Add Library... action on Libraries node in Projects view can be used to add the JSTL 1.1 library.
  • ⁇ td style verical -align: top; text-align: left; width: 80px; ">  ⁇ /td>
  • ⁇ td style verical -align: top; text-align: left;
  • xspan style font-family: Arial Black;
  • x/spanximg style width: 385px; height: 27px;
  • alt Produce Safety and Microbiology
  • src images/psm.gif"x/td> ⁇ /tr> ⁇ tr>
  • ⁇ td style verical -align: top; text-align: left;
  • ximg style width: 210px; height: 43px;
  • alt Strain Database”
  • s rc i mages/Li nkHeader .
  • j pg x/td> ⁇ /tr> ⁇ tr>
  • ⁇ td style text-align: center;
  • valign top
  • xa href i nsertnucleotidedata.
  • ⁇ td style text-align: center; vertical-align: top;
  • ⁇ td style text-align: center; vertical -align: middle; "> ⁇ /td> ⁇ /tr> ⁇ /tbody> ⁇ /table> ⁇ /td> ⁇ /tr> ⁇ tr>
  • ArrayList mz f rMaldi .getMaldiMZ() ;
  • ArrayList mID dbBean. getAll MaI diDataID( request. getParameter ("andor") , request. getParameter ("identif ier”) , request. getParameter (“lowRM”) , request. getParameter (" hi ghRM”) , request. getParameter ("genus”) , request. getParameter ("s pecies”) , request. getParameter (“subspecies”) , request. getParameter (“other”) , request. ge tParameter (“notes ) , request. getParameter (“hi story”) , request. getParameter (“date”)) ;

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Physics & Mathematics (AREA)
  • Molecular Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Bioinformatics & Computational Biology (AREA)
  • Chemical & Material Sciences (AREA)
  • Spectroscopy & Molecular Physics (AREA)
  • Analytical Chemistry (AREA)
  • Biotechnology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biophysics (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Biomedical Technology (AREA)
  • Theoretical Computer Science (AREA)
  • Medical Informatics (AREA)
  • Evolutionary Biology (AREA)
  • Food Science & Technology (AREA)
  • Cell Biology (AREA)
  • Optics & Photonics (AREA)
  • Microbiology (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Bioethics (AREA)
  • Databases & Information Systems (AREA)
  • Other Investigation Or Analysis Of Materials By Electrical Means (AREA)

Abstract

Embodiments of the present invention relate to the identification of proteins using laser desorption ionization mass spectrometry, the identification of source organisms comprising the identified proteins and a computer readable storage medium storing instructions that, when executed by a computer cause the computer to perform a method for the identification of proteins using mass spectra generated through the application of laser desorption ionization mass spectrometry of the proteins.

Description

RAPID IDENTIFICATION OF PROTEINS AND THEIR CORRESPONDING SOURCE ORGANISMS BY GAS PHASE FRAGMENTATION AND IDENTIFICATION OF
PROTEIN BIOMARKERS
FIELD OF THE INVENTION
[0001] The invention relates to the use of laser desorption/ionization mass spectrometry techniques for protein identification, and the detection, identification, and taxonomic classification of the corresponding source organisms from which the proteins are derived.
BACKGROUND OF THE INVENTION
[0002] Rapid, accurate identification of microorganisms is an increasingly important area of research. Indeed, safeguarding of the environment, public health, food production and safety, transportation and national defense all depend on the ability to rapidly and accurately identify pathogens, microbial and otherwise.
[0003] For example, foodborne illness is a serious and continuing problem that causes great suffering, death and otherwise exacts enormous societal costs e.g. losses in worker productivity due to illness, recall of food products determined (or suspected) to be contaminated, etc. An estimated 76 million cases of foodborne illness occur each year in the US alone (see e.g., Mead, P.S. et al. (1999) Emerging Infectious Diseases 5(5): 607-625) Frighteningly, foodborne disease caused by bacterial microorganisms is likely to increase with the rise in global temperatures.
[0004] Thus, there is a critical need for methods that sensitively detect and rapidly and accurately identify foodborne pathogens before, during and after an outbreak of foodborne illness.
[0005] A number of techniques have been developed for detection and identification of microorganisms and other disease agents (e.g., viruses, e.g., Avian influenza virus; protein toxins, prions etc). Pre-eminent among these techniques is mass spectrometry. Mass spectrometry is the science of "weighing" atoms and molecules. Because of its high sensitivity and specificity, mass spectrometry has become a popular technique for detection and taxonomic classification of microorganisms (see e.g., Fenselau C, and Demirev P.A. Mass Spectrom. Rev. 2001; 20: 157; Lay Jr. JO. Mass Spectrom. Rev. 2001; 20: 172). [0006] As is well known in the art, the use of mass spectrometry (MS) in the analysis of microorganisms is a relatively recent application that was facilitated by the development of two ionization techniques in the late 1980s and early 1990s: electrospray ionization (ESI) (see e.g., Fenn, J. B., et al. (1989). Science, 246, 64-71) and matrix-assisted laser desorption/ionization (MALDI) (see e.g., Tanaka, K., et al. (1987) Second Japan-China Joint Symposium on Mass Spectrometry (abstract), Osaka, Japan and Karas, M., et al. (1987) International Journal of Mass Spectrometry and Ion Processes., 78, 53-68). MALDI, coupled with time-of-flight (TOF) mass spectrometry, is a powerful tool in "fingerprinting" microorganisms using either cell extracts or lysis of intact cells (see e.g., Cain, T. C, et al. (1994) Rapid Commun. Mass Spectrom. 8: 1026; Krishnamurthy, T., et al. (1996) Rapid Commun. Mass Spectrom. 10: 883; Krishnamurthy, T., and Ross PL. Rapid Commun. Mass Spectrom. 1996; 10: 1992; Holland, R.D., et al.(1996) Rapid Commun. Mass Spectrom. 10: 1227; Arnold, R., and Reilly, J. (1998) Rapid Commun. Mass Spectrom. 12: 630;Welham, K., et al. (1998) Rapid Commun. Mass Spectrom. 12: 176; Haag, A., et al. (1998) J Mass Spectrom. 33: 750; Wang Z, et al. (1998) Rapid Commun. Mass Spectrom. 1998; 12: 456; Dai Y, et al. Rapid Commun. Mass Spectrom. 1999; 13: 73; Ramirez, J., and Fenselau C. (2001) J Mass Spectrom. 36: 929; Mandrell, R.E., et al. (2005) Applied Environ. Microbio. 71: 6292; Fagerquist, C.K., et al. (2005) Anal. Chem. 11: 4897; and Fagerquist, C.K., et al. (2006) J Proteome Research. 5: 2527). As is known in the art, MALDI-TOF-MS fingerprinting of microorganisms, viruses, proteins and peptides is typically achieved using either pattern recognition or bioinformatic algorithms.
[0007] A pattern recognition approach to data analysis typically involves comparison of a MALDI-TOF-MS spectrum from an unknown sample to MALDI-TOF-MS spectra from known, identified entities and searches for similarities in prominent peaks (see e.g., Jarmon, K.H., et al. (2000) Anal. Chem. 72: 1217; and Wahl, K.L., et al. (2002) Anal. Chem. 2002; 74: 6191). A high similarity between an unknown MS spectrum and a known MS spectrum suggests the identity of the unknown. Unfortunately however, this pattern recognition approach is limited by the fact that it does not rely on actual identification of the peaks in an MS spectrum, but rather on the spectral pattern. Thus, because a particular mass-to-charge ratio (m/z) could be associated with any of a number of biomolecules generated by the microorganism: proteins, nucleic acids, lipids, etc, accuracy of identification using the pattern recognition approach is best achieved with purified molecules.
[0008] In addition to the pattern recognition approach, microorganisms may be identified using a bioinformatic approach. The bioinformatic approach to identification of microorganisms by MALDI-TOF-MS, typically involves the use of protein molecular weight (MW) information contained in genomic databases to tentatively assign peaks in a spectrum to specific proteins (see e.g., Demirev, P.A., et al. (1999) Anal. Chem. 71: 2732; Peneda, F.J., et al. (2000) Anal. Chem. 72: 3739; Demirev, P.A., et al. (2001) Anal. Chem. 73: 4566; Yao Z-P, et al. (2002) Anal. Chem.; 74: 2529; and Peneda, F.J., et al. (2003) Anal. Chem. 75: 3817). As is known in the art, a protein, and by implication the microorganism, are identified when a significant number of peaks in a MS spectrum correspond to the protein MWs derived from the open reading frames (ORFs) of a particular microorganism genome. [0009] The bioinformatic approach may account for simple post-translational modifications, e.g. N-terminal methionine cleavage (see e.g., Demirev et al. (2001) supra), but many proteins of interest have extensive post translational modifications. Thus, since protein biomarker identification relies solely on protein MW, identification of any individual biomarker may only at best, be considered as a tentative assignment. [0010] Pattern recognition and bioinformatic MALDI-TOF-MS analysis work well for the identification of pure strains. Unfortunately however, data analysis using either of these methods is complicated when multiple bacterial microorganisms are present in a sample. Indeed, MALDI-TOF-MS analysis of bacterial mixtures typically results in the detection of protein biomarkers from multiple bacteria, thus making the pattern of m/z peaks presented in an MS spectrum difficult to interpret. Similarly, the bioinformatic approach may tentatively assign spectral peaks as being proteins on the basis of predicted protein MWs from the ORFs found in multiple bacterial genomes. Furthermore, the presence (and/or relative abundance) of proteins from multiple microorganisms affects on protein ionization efficiency resulting in changes in the proteins ionized and detected. Thus, analysis of samples containing multiple bacterial (or other microorganisms) presents increased challenges for MALDI-TOF-MS. [0011] To overcome the increased challenges for MALDI-TOF-MS when multiple organisms are present, protein biomarkers are either enzymatically digested and the resulting tryptic peptides are analyzed by MS or by MS/MS ("bottom-up proteomics). Alternatively, the intact protein is fragmented in the gas phase to obtain sequence-specific information from fragment ions ("top-down" proteomics).
[0012] Until recently, gas phase fragmentation was only accomplished using very expensive mass spectrometric instrumentation and/or complicated gas phase ion dissociation techniques. However, the development of MALDI tandem mass spectrometry (MALDI- TOF-TOF) instruments has made gas phase fragmentation less cumbersome to undertake (see e.g., Medzihradszky KF, et al. Anal. Chem. 2000: 72: 552). MALDI-TOF-TOF instruments may be used to fragment small and modest-sized intact proteins (> 5 kDa) (see e.g., Lin M, et al. Rapid Comm. Mass Spectrom. 2003; 17: 1809). Thus, a MALDI-TOF-TOF instrument may provide a "fingerprint" of a bacterial microorganism in MS mode, and also sequence- specific information of protein biomarkers by MS/MS (see e.g., Demirev, P.A., et al. (2005)
Anal. Chem. 2005; 77: 7455).
[0013] Because the amino acid sequence of a protein is often unique to a microbial strain, identification of a single protein biomarker is often sufficient for identification of the microorganism. In addition, whereas multiple microorganisms may complicate MALDI-
TOF-MS analysis, MS/MS of specific protein biomarkers allows identification of unique protein biomarkers that are specific to a particular microorganism and thus facilitates thr identification of a microorganizm in a mixed sample.
[0014] The potential of tandem mass spectrometry techniques such as e.g., MALDI-TOF-
TOF, for the rapid and accurate identification of proteins and their source organisms is only beginning to be realized. Indeed, given the proliferation of biological threats from diseases, pests, and bioterrorism, the increasing numbers of proteomes in public databases, (which continues to grow at an exponential rate) and the potential forensic applications (see e.g.,
Goldsmith, J. (1990) A crime lab for animals - National Fish and Wildlife Forensics
Laboratory, Ashaland, Oregon - Special Issue: Environmental Restoration Whole Earth
Review, Spring, 1990) one can rest assured that the value and importance of tandem mass spectrometry techniques for the identification of proteins will continue to grow.
[0015] Thus, what is needed in the art, are better matching algorithms and improved scoring schemes which facilitate ease of use and which will improve the accuracy, and rapidity of tandem mass spectrometry techniques thereby facilitating their utility.
[0016] Fortunately, as will be clear from the following disclosure, the present invention provides for these and other needs.
SUMMARY OF THE INVENTION
[0017] One embodiment of the present invention provides a method for identification of an unknown protein comprising: (i) comparing mass-to-charge (m/z) fragment ion peaks from an mass spectrum of the unknown protein to that of m/z fragment ion peaks from mass spectra of known protein sequences; and (ii) matching the m/z fragment ion peaks from the mass spectrum of the unknown protein to the m/z fragment ion peaks from the mass spectra of known protein sequences to provide mass spectrometry peak matches; (iii) scoring the mass spectrometry peak matches using aUSDA peak matching algorithm thereby providing a USDA peak matching score; and (iv) ranking the USDA peak matching score from highest to lowest; wherein the highest USDA peak matching score constitutes an identification of the unknown protein. [0018] In one exemplary embodiment the USDA peak matching algorithm is USDA peak matching algorithm α, which has the formula:
2 x (Number of peak matches)
USDAa Score = 100 x
(Number of peaks in the mass spectrum of the unknown protein + Number of peaks in the mass spectrum of known protein sequences).
[0019] In another exemplary embodiment the USDA peak matching algorithm is USDA peak matching algorithm β, which has the formula:
Number of peak matches USDA β Score = 100 x
(Number of MS/MS fragment ion peaks).
[0020] In one exemplary embodiment, the difference between the highest USDA peak matching score and the second highest USDA peak matching score is equal to or greater than 2.
[0021] In another exemplary embodiment, the mass spectra are members selected from the group consisting of MS spectra and MS/MS spectra.
[0022] In one exemplary embodiment, the mass spectrum of the unknown protein is an MS spectrum and the mass spectra of known protein sequences are MS spectra of known proteins.
[0023] In another exemplary embodiment, the mass spectrum of the unknown protein is an MS/MS spectrum and the mass spectra of known protein sequences are members of the group consisting of in silico MS/MS spectra generated from a genomically-derived database of protein sequences and MS/MS spectra of known proteins.
[0024] In one exemplary embodiment, the mass spectra of known protein sequences are in silico MS/MS spectra generated from a genomically-derived database of protein sequences.
[0025] In one exemplary embodiment, the method further comprises: (v) confirming that the highest USDA peak matching score constitutes an identification of the unknown protein. The confirming comprises: plotting the difference in m/z (Am/z) between an MS/MS fragment ion of the unknown protein and its matched fragment ion from the in silico MS/MS spectra generated from a genomically-derived database of protein sequences as a function of MS/MS fragment ion m/z, thereby providing a plot of Am/z vs MS/MS fragment ion m/z, wherein a correct protein identification is indicated when the plot of Am/z vs MS/MS fragment ion m/z reveals a characteristic systematic error related to the inherent calibration error of the mass analyzer, and wherein an incorrect protein identification is indicated when the plot of Am/z vs MS/MS fragment ion m/z reveals statistically random error. [0026] In another exemplary embodiment, the method further comprises: (v) confirming that the highest USDA peak matching score constitutes an identification of the unknown protein. In one exemplary embodiment, the confirming comprises: performing steps (i) - (iv), wherein the in silico MS/MS spectra generated from a genomically-derived database of protein sequences are limited to spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, glutamate (E) residue or proline (P) residue, and (vi) observing that the difference between the highest USDA peak matching score and the second highest USDA peak matching score is equal to or greater than the difference between the highest USDA peak matching score and the second highest USDA peak matching score obtained when steps (i) - (iv) are performed using in silico MS/MS spectra generated from a genomically-derived database of protein sequences that are not limited spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, glutamate (E) residue or proline (P) residue, thereby confirming that the highest USDA peak matching score constitutes an identification of the unknown protein. [0027] In another exemplary embodiment, the confirming comprises: performing steps (i) - (iv), wherein the in silico MS/MS spectra generated from a genomically-derived database of protein sequences are limited to spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, and (vi) observing that the difference between the highest USDA peak matching score and the second highest USDA peak matching score is equal to or greater than the difference between the highest USDA peak matching score and the second highest USDA peak matching score obtained when steps (i) - (iv) are performed using in silico MS/MS spectra generated from a genomically-derived database of protein sequences that are not limited spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, thereby confirming that the highest USDA peak matching score constitutes an identification of the unknown protein.
[0028] In one exemplary embodiment, the unknown protein is a protein toxin. [0029] In another exemplary embodiment, identification of the unknown protein is used to identify the source organism from which the unknown protein derived. In one exemplary embodiment, the source organism is a member selected from the group consisting of: viruses, microorganisms, insects, plants, and animals. In another exemplary embodiment, the source organism is a microorganism selected from the group consisting of: bacteria and fungi. In another exemplary embodiment, the source organism is a bacterium that is a member selected from the group consisting of Campylobacter, Escherichia coli, Listeria and Salmonella.
[0030] Another embodiment of the invention provides a computer readable storage medium storing instructions that, when executed by a computer, causes the computer to perform a method for identification of an unknown protein comprising: (i) comparing mass- to-charge (m/z) fragment ion peaks from an mass spectrum of the unknown protein to that of m/z fragment ion peaks from mass spectra of known protein sequences; and (ii) matching the m/z fragment ion peaks from the mass spectrum of the unknown protein to the m/z fragment ion peaks from the mass spectra of known protein sequences to provide mass spectrometry peak matches; (iii) scoring the mass spectrometry peak matches using a USDA peak matching algorithm thereby providing a USDA peak matching score; and (iv) ranking the USDA peak matching score from highest to lowest; wherein the highest USDA peak matching score constitutes an identification of the unknown protein.
[0031] In one exemplary embodiment the USDA peak matching algorithm is USDA peak matching algorithm α, which has the formula:
2 x (Number of peak matches)
USDAa Score = 100 x
(Number of peaks in the mass spectrum of the unknown protein + Number of peaks in the mass spectrum of known protein sequences).
[0032] In another exemplary embodiment the USDA peak matching algorithm is USDA peak matching algorithm β, which has the formula:
Number of peak matches
USDA β Score = 100 x
(Number of MS/MS fragment ion peaks).
[0033] In one exemplary embodiment, the difference between the highest USDA peak matching score and the second highest USDA peak matching score is equal to or greater than
2.
[0034] In another exemplary embodiment, the mass spectra are members selected from the group consisting of MS spectra and MS/MS spectra. [0035] In one exemplary embodiment, the mass spectrum of the unknown protein is an MS spectrum and wherein the mass spectra of known protein sequences are MS spectra of known proteins.
[0036] In one exemplary embodiment, the mass spectrum of the unknown protein is an MS/MS spectrum and the mass spectra of known protein sequences are members of the group consisting of in silico MS/MS spectra generated from a genomically-derived database of protein sequences and MS/MS spectra of known proteins. In another exemplary embodiment, the mass spectra of known protein sequences are in silico MS/MS spectra generated from a genomically-derived database of protein sequences.
[0037] In another exemplary embodiment, the method further comprises :(v) confirming that the highest USDA peak matching score constitutes an identification of the unknown protein, wherein the confirming comprises: plotting the difference in m/z (Am/z ) between an MS/MS fragment ion of the unknown protein and its matched fragment ion from the in silico MS/MS spectra generated from a genomically-derived database of protein sequences as a function of MS/MS fragment ion m/z, thereby providing a plot of Am/z vs MS/MS fragment ion m/z, wherein a correct protein identification is indicated when the plot of Am/z vs MS/MS fragment ion m/z reveals a characteristic systematic error related to the inherent calibration error of the mass analyzer, and wherein an incorrect protein identification is indicated when the plot of Am/z vs MS/MS fragment ion m/z reveals statistically random error. [0038] In another exemplary embodiment, the method further comprises: (v) confirming that the highest USDA peak matching score constitutes an identification of the unknown protein, wherein the confirming comprises: performing steps (i) - (iv) , wherein the in silico MS/MS spectra generated from a genomically-derived database of protein sequences are limited to spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, glutamate (E) residue or proline (P) residue, and (vi) observing that the difference between the highest USDA peak matching score and the second highest USDA peak matching score is equal to or greater than the difference between the highest USDA peak matching score and the second highest USDA peak matching score obtained when steps (i) - (iv) are performed using in silico MS/MS spectra generated from a genomically-derived database of protein sequences that are not limited spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, glutamate (E) residue or proline (P) residue, thereby that the highest USDA peak matching score constitutes an identification of the unknown protein. [0039] In another exemplary embodiment, the confirming comprises: performing steps (i) - (iv), wherein the in silico MS/MS spectra generated from a genomically-derived database of protein sequences are limited to spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, and (vi) observing that the difference between the highest USDA peak matching score and the second highest USDA peak matching score is equal to or greater than the difference between the highest USDA peak matching score and the second highest USDA peak matching score obtained when steps (i) - (iv) are performed using in silico MS/MS spectra generated from a genomically-derived database of protein sequences that are not limited spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, thereby confirming that the highest USDA peak matching score constitutes an identification of the unknown protein. [0040] In one exemplary embodiment, the unknown protein is a protein toxin. [0041] In another exemplary embodiment, identification of the unknown protein is used to identify the source organism from which the unknown protein derived. In another exemplary embodiment, source organism is a member selected from the group consisting of: viruses, microorganisms, insects, plants, and animals. In another exemplary embodiment, the source organism is a microorganism selected from the group consisting of: bacteria and fungi. In another exemplary embodiment, the source organism is a bacterium that is a member selected from the group consisting of Campylobacter, Escherichia coli, Listeria and Salmonella.
[0042] Other features, objects and advantages of the invention will be apparent from the detailed description which follows.
BRIEF DESCRIPTION OF THE DRAWINGS
[0043] FIG. 1 provides a general overview of the framework for the USDA mass spectrometry comparison software.
[0044] FIG. 2 shows the database model describing how the data is stored.
[0045] FIG. 3 describes the USDA mass spectrometry comparison software process used to compare each dataset.
[0046] FIG. 4 shows an MS spectrum (as displayed in the MALDI-TOF-TOF instrument software) of the extracted cell lysate of Campylobacter upsaliensis (strain RM3195) analyzed by MALDI-TOF-MS using sinapinic acid as the MALDI matrix.
[0047] FIG. 5 shows the MS/MS spectrum (as displayed in the MALDI-TOF-TOF instrument software) of the protein biomarker ion of Campylobacter upsaliensis (strain RM3195) at m/z 11138.9 analyzed on a MALDI-TOF-TOF-MS using sinapinic acid as the MALDI matrix.
[0048] FIG. 6 shows an ASCII MS/MS spectrum (m/z vs. relative intensity as displayed in the USDA software window) of thioredoxin from Campylobacter upsaliensis (strain RM3195) previously displayed in FIG. 5. The MS/MS data in FIG. 5 was centroided (i.e. converted to ASCII format: m/z vs. absolute intensity), exported from the MALDI-TOF-TOF instrument software and imported to the MS/MS databases of the USDA software. The m/z and absolute intensity of MS/MS fragment ions are shown in the sidebar. [0049] FIG. 7 shows the "MS/MS To In Silico Comparison" search parameter table as displayed in the USDA software window.
[0050] FIG. 8 shows the in silico MS/MS spectrum (as displayed in the USDA software window) of the protein thioredoxin of Campylobacter upsaliensis (strain RM3195). [0051] FIG. 9 shows a plot of fragment ion error (as displayed in the USDA software) as a function of the MS/MS fragment ion mass-to-charge (m/z) of the protein biomarker thioredoxin (from Campylobacter upsaliensis strain RM3195) and its "match" to the in silico fragment ions of thioredoxin of Campylobacter upsaliensis strain RM3195 (the highest scoring identification and the correct identification). Fragment ion error (Am/z) is the difference between m/z of an MS/MS fragment ion and the m/z of its putative in silico fragment ion "match". A red square represents a "match" whose in silico fragment ion was generated from a protein backbone cleavage site that is adjacent to a D, E or P residue. A black square represents a "match" whose in silico fragment ion was generated from a protein backbone cleavage site that is adjacent to only non-D,E,P residues.
[0052] FIG. 10 shows a plot of fragment ion error (as displayed in the USDA software) as a function of the MS/MS fragment ion mass-to-charge (m/z) of the protein biomarker thioredoxin (from Campylobacter upsaliensis strain RM3195) and its "match" to the in silico fragment ions of carbon dioxide concentrating mechanism protein of Cyanothece strain ATCC 51142 (the second highest scoring identification and an incorrect identification). Fragment ion error (Am/z) is defined here as the difference between m/z of an MS/MS fragment ion and the m/z of its putative in silico fragment ion "match". A red square represents a "match" whose in silico fragment ion was generated from a protein backbone cleavage site that is adjacent to a D, E or P residue. A black square represents a "match" whose in silico fragment ion was generated from a protein backbone cleavage site that is adjacent to only non-D,E,P residues. [0053] FIG. 11 An MS spectrum of the extracted cell lysate of E. coli O157:H7 strain EDL-933 analyzed on the MALDI-TOF-TOF-MS instrument (in linear mode) using HCCA matrix. Data acquisition: 1000 laser shots.
[0054] FIG. 12 An MS/MS spectrum of the protein biomarker ion [M + H]+ at m/z 7705.6 (FIG 11) from E. coli O157:H7 strain EDL-933 analyzed on the MALDI-TOF-TOF- MS instrument using HCCA matrix. Data acquisition: 32,000 laser shots. Fragmentation by post-source dissociation (PSD). Prominent fragment ions are identified by their m/z and ion type/number and amino acid residues adjacent to the site of polypeptide backbone cleavage for the amino acid sequence of the top identification: putative uncharacterized protein yahO from E. coli O157:H7 strain EDL-933 (Table 4). Many of the fragment ions are the result of a polypeptide cleavage site adjacent to an aspartic acid (D) or glutamic acid (E) residues. The MS/MS data was centroided, exported as an ASCII formatted file and uploaded to the USDA software for analysis.
[0055] FIG. 13 Primary amino acid sequence of the putative uncharacterized protein yahO of the pathogenic E. coli O157:H7 (EDL-933 strain)
MKIISKMLVGALAFAVTNVYAAELMTKAEFEKVESQYEKIGDISTSNEMSTADAKED LIKKADEKGADVLVLTSGQTDNKIHGTADIYKKK (SEQ ID NO: 1) and the UPF0379 protein yahO of the non-pathogenic E. coli (K- 12 strain)
MKIISKMLVGALALAVTNVYAAELMTKAEFEKVESQYEKIGDISTSNEMSTADAKED LIKKADEKGADVLVLTSGQTDNKIHGTANIYKKK (SEQ ID NO:2). Both proteins are post-translationally modified with a 21 residue signal peptide (boxed). Differences in amino acids between the two proteins are highlighted in bold. The D <-> N amino acid substitution results in a protein MW difference of 1 Da in the mature protein. Such slight differences in protein biomarker MW are nearly impossible to detect by MALDI-TOF-MS, however sequence-specific fragmentation by MS/MS allows these two proteins (and their source microorganisms) to be differentiated.
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0056] The expression "mass spectrum" as used herein, refers in general, to an intensity vs. m/z (mass-to-charge ratio) plot that represents the result of a chemical analysis. Hence, the mass spectrum of a sample is a pattern representing the distribution of charged molecules by mass-to-charge ratio in a sample. Thus, an "MS spectrum" as used herein, refers to a mass spectrum produced by mass spectrometer having a single mass analyser and single detector. In contrast, an "MS/MS spectrum" as used herein, refers to a mass spectrum produced by a tandem mass spectrometer.
[0057] The expression "matching the m/z fragment ion peaks from a mass spectrum of the unknown protein to the m/z fragment ion peaks from the mass spectra of known protein sequences" as used herein refers to a procedural step used by a person having ordinary skill in the art to make an identification of an unknown protein. Typically, "matching the m/z fragment ion peaks from a mass spectrum of the unknown protein to the m/z fragment ion peaks from the mass spectra of known protein sequences" refers to comparing the m/z of fragment ions that result from ionization and fragmentation of an intact unknown protein to the theoretical/calculated m/z oiin silico generated fragment ions of known protein sequences. The theoretical/calculated in silico molecular masses are based on the known atomic masses of the atoms which make up the known amino acid sequence, and as such, the calculated masses are considered to be "exact". The measured m/z of fragment ions from the ionized and fragmented unknown protein is not "exact" but, rather, is subject to the mass accuracy of a given mass analyzer. The mass accuracy of the mass analyzer may be determined and used to compare measured m/z values to those calculated "exact" masses. If the measured m/z value is within the analyzer's known uncertainty (mass accuracy and precision), then the comparison is considered to be a match (i.e. a "peak match"). If the measured m/z value differs from the calculated in silico m/z value by more than the instruments precision, then the comparison results in no match being found. [0058] Thus, "identification of an unknown protein" occurs when the m/z fragment ion peaks from a mass spectrum of the unknown protein "match" the m/z fragment ion peaks from the mass spectra of a known protein sequence.
[0059] The expression "USDA peak matching score" as used herein, refers to the number of measured m/z values which match calculated "exact" m/z values (within the instrument's measurement precision). In an exemplary embodiment, a "USDA peak matching score" is obtained by applying a "USDA peak matching algorithm". In an exemplary embodiment "USDA peak matching algorithm" is the "USDA peak matching algorithm alpha (α)", which has the following formula:
2 x (Number of peak matches)
USDAa Score = 100 x
(Number of peaks in the mass spectrum of the unknown protein + Number of peaks in the mass spectrum of known protein sequences) [0060] In another exemplary embodiment, the "USDA peak matching algorithm" is the "USDA peak matching algorithm beta (β)" which has the following formula:
Number of peak matches USDA β Score = 100 x
(Number of MS/MS fragment ion peaks)
[0061] Thus, unless specifically referred to otherwise, the expression "USDA peak matching score" refers inclusively to USDA peak matching scores obtained using the "USDA peak matching algorithm alpha (α)" and/or the "USDA peak matching algorithm beta (β)". [0062] The expression "ranking the USDA peak matching score from highest to lowest" as used herein, refers to ordering of scores from highest to lowest where the highest reflects the greatest number of matches between measured m/z values and calculated masses from a known sequence.
[0063] The expression "difference between highest USDA peak matching score and second highest USDA peak matching score" as used herein, refers to the result obtained by subtracting the second highest USDA peak matching score from the highest USDA peak matching score.
[0064] The term "in silico" as used herein refers generally, to processes taking place via computer calculations. In recent years, the DNA sequences of hundreds of organisms have been decoded and stored in databases. Indeed, the amount of information stored in "in silico databases" continues to grow exponentially as more genomes are sequenced and more proteomes are characterized. Thus, a large body of "in silico" genomic information has been obtained and stored and the amount continues to grow. The information stored in an "in silico database" may be analyzed to determine inter alia genes that encode polypeptides and/or the sequence of the polypeptides encoded by the genes. Such protein sequences are referred to herein as "genomically-derived". Thus, in an exemplary embodiment, "in silico" protein sequences comprise a "genomically-derived" protein sequence deduced by computer calculations based on a known DNA sequence. Alternatively, an "in silico" protein sequence may comprise the actual protein sequence as determined by a physical protein sequencing method e.g., Edman degradation, de novo sequencing by mass spectrometry, etc. [0065] The expression "in silico MS/MS spectrum" as used herein refers to a theoretical or hypothetical tandem mass spectrum generated by a computer based on known protein sequences. The term "in silico" fragment ion as used herein, takes on the meaning as typically used in the art and thus, refers to theoretical protein fragments generated by fragmentation performed in silico on known protein sequences. In some exemplary embodiments an in silico MS/MS spectrum shows theoretical fragment ions generated at every residue. In other exemplary embodiments, an in silico MS/MS spectrum shows theoretical fragment ions generated at selected residues.
[0066] The expression "mass spectra of known protein sequences" as used herein, refers to theoretical mass spectra generated in silico by calculated fragmentation of genomically- derived protein sequences and/or to mass spectra that are physically generated from known proteins.
[0067] The expression "mass spectrum of an unknown protein" as used herein, refers to the experimentally obtained mass spectrum of a protein whose identity has not been determined with certainty. Typically, an experimentally acquired MS/MS spectrum of a protein rarely shows fragment ions at every residue because the fragmentation efficiency at every residue is not the same.
[0068] The expression "source organism" as used herein, refers to an organism that has provided or that is used to provide a sample and hence proteins for analysis by laser desorption ionization mass spectrometry (e.g., Matrix-Assisted Laser Desorption/Ionization MALDI) as disclosed herein. In an exemplary embodiment a source organism is a microorganism. In another exemplary embodiment a source organism is a bacterium. In still other exemplary embodiments a source organism is a protein toxin, a plant, an animal, an insect, a virus or a human.
[0069] The expression "providing a plot of Am/z vs fragment ion m/z" as used herein, refers to plotting of the difference between the measured m/z and the calculated exact m/z of an analyte (e.g., a protein) as a function of analyte ion m/z. Instrument calibration involves comparing the observed masses of a mixture of known standards (e.g., protein standards) to their calculated exact masses. Any discrepancy between a standard's measured m/z and its known m/z is considered error. The m/z error (Am/z, i.e. the difference between the measured m/z and the actual m/z) is plotted as a function of analyte ion m/z.
[0070] The expression "characteristic systematic error related to the inherent calibration of the instrument" as used herein, refers to systematic error as revealed by a linear regression analysis fit of the relevant data (e.g., Am/z vs fragment ion m/z). Similarly, the expression "statistically random error" as used herein, refers to statistically random error as defined by a linear regression analysis fit of data. Regression analysis is well known in the art (see e.g., Draper, N.R. and Smith, H. Applied Regression Analysis, Wiley Series in Probability and Statistics (1998); Richard A. Berk, Regression Analysis: A Constructive Critique, Sage Publications (2004); David A. Freedman, Statistical Models: Theory and Practice, Cambridge University Press (2005))
[0071] The terms "polypeptide," and "protein" are used interchangeably herein to refer to a functional polymer of amino acid residues. Typically a functional protein folds cooperatively and comprises multiple secondary structural elements e.g., α-helices or β- pleated sheets, that interact in the final structure. The smallest known protein is TRP-Cage, a functional protein of only 20 amino acids (see e.g., Jonathan W. Neidigh et al. (2002) Nature Structural Biology 9:425 - 430). However, as used herein, the term "protein" typically refers to a polymer of amino acid residues that is above about 5 kDa molecular weight. A polymer of amino acid residues that is below about 5 kDa molecular weight is typically referred to as a "peptide". Thus, as used herein, a "peptide" is not a "protein", and a "peptide" is not a "polypeptide".
[0072] The term "amino acid" as used herein, refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, γ-carboxyglutamate, and O-phosphoserine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid. Amino acids are referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission.
[0073] The term "microorganism" is used herein, refers to is an organism that is microscopic. In its broadest sense the term "microorganism" refers to a diverse array of organisms including, but not limited to bacteria, fungi, archaea, and protists, as well as some microscopic plants and animals e.g., plankton.
[0074] The term "virus" as used herein, refers to sub-microscopic infectious agents that are typically unable to grow or reproduce outside a host cell. Typically a viral particle, or virion, comprises genetic material e.g., DNA or RNA, within a protective protein coat called a capsid. Viruses infect all cellular life forms and are grouped into animal, plant and bacterial types, according to the type of host infected.
[0075] The term "protein toxin" as used herein, refers to refers to any polypeptide that is deleterious to humans or other mammals when it is injected, ingested, inhaled or when contacted with the skin.
I. Introduction:
[0076] Rapid, accurate identification of proteins and the source organisms from which they are derived is increasingly valuable as threats to biosecurity of the environment, public health, food production and safety, transportation and national defense all continue to increase. Rapid, accurate identification of proteins also facilitates the work of forensic scientists concerned with the protection of endangered species and/or with solving of personal crime.
[0077] Since the identity of proteins connects directly to the genetic identity of the source organism (e.g., a pathogenic organism; protein toxin e.g., prion; blood sample; etc). Identification of a protein may be used to successfully identify the source organism (e.g., a bacterium, an endangered species, etc) from which it is derived. Fortunately, variations in protein biomarker amino acid composition due to non-synonymous mutations of the biomarker gene result in variations in protein molecular weight (MW) across genus, species and strains. The ability to tap into this information on a precise level is thus invaluable for the accurate identification of source organisms.
[0078] Improvements in the science of protein identification are always needed and welcome. Thus, an exemplary embodiment of the invention provides a method for rapid and accurate identification of proteins using laser desorption ionization mass spectrometry methods e.g., MALDI. In one exemplary embodiment, identification of the protein permits identification of the source organism from which the identified protein is derived. In another exemplary embodiment, the method comprises a peak-matching/scoring mathematical algorithm (the USDA peak matching algorithm) for comparison of MS/MS spectra of protein biomarkers and in silico MS/MS spectra of protein sequences contained in a database. [0079] In one exemplary embodiment, a USDA peak matching algorithm is the USDA α peak matching algorithm and has the formula: 2 x (Number of peak matches) USDAa Score = 100 x
(Number of peaks in the mass spectrum of the unknown protein + Number of peaks in the mass spectrum of known protein sequences)
[0080] In another exemplary embobiment, a USDA peak matching algorithm is the USDA β peak matching algorithm and has the formula:
Number of peak matches USDA β Score = 100 x
(Number of MS/MS fragment ion peaks)
[0081] In one exemplary embodiment, the USDA peak matching algorithm (either or α or β) is incorporated into a computer software program such that a MS/MS spectrum can be compared to thousands of in silico MS/MS spectra in seconds thereby allowing rapid identification of a protein and its source organism.
[0082] In another exemplary embodiment, the method further comprises steps for confirming the correctness of the protein identification, thereby ensuring accuracy. In one exemplary embodiment, confirming the correctness of the protein identification is achieved through error analysis. In this embodiment, the error analysis comprises analyzing the difference in mass-to-charge (m/z) between the MS/MS fragment ions and their putative in silico fragment ion "matches". Correct identifications are characterized in that the error is typically limited to systematic error caused by the inherent calibration error of the mass analyzer. In contrast, incorrect identifications are characterized by random error caused by false "matches".
[0083] In another exemplary embodiment, confirming the correctness of the protein identification is achieved by performing an identification of an unknown protein by comparing the MS/MS spectrum of the unknown protein to a full array of MS/MS in silico spectra of protein sequences contained in a database, and then performing the identification by comparing the MS/MS spectrum of the unknown protein to a set of MS/MS in silico spectra of protein sequences contained in the same database which are limited to those spectra which arise when the fragmentation occurs only at aspartic acid (D) glutamic acid (E) and proline (P) residues; and observing that the difference between the highest and the second highest USDA peak matching scores is the same or greater than the difference between the highest and the second highest USDA peak matching scores obtained in the identification using the full array of MS/MS in silico spectra of protein sequences contained in the database.
[0084] In still another exemplary embodiment, confirming the correctness of the protein identification is achieved by performing an identification of an unknown protein by comparing the MS/MS spectrum of the unknown protein to a full array of MS/MS in silico spectra of protein sequences contained in a database, and then performing the identification by comparing the MS/MS spectrum of the unknown protein to a set of MS/MS in silico spectra of protein sequences contained in the same database which are limited to those spectra which arise when the fragmentation occurs only at aspartic acid (D) residues; and observing that the difference between the highest and the second highest USDA peak matching scores is the same or greater than the difference between the highest and the second highest USDA peak matching scores obtained in the identification using the full array of MS/MS in silico spectra of protein sequences contained in the database. [0085] Enzymatic digestion of a protein is not required for analysis and identification of proteins using the disclosed methods. Thus, in one exemplary embodiment, proteins are analyzed without prior enzymatic digestion. However, in another exemplary embodiment, proteins are analyzed following enzymatic digestion.
[0086] In one embodiment of the invention, the methods and algorithms disclosed herein are contained in a computer readable storage medium thereby providing instructions that when executed by a computer, causes the computer to perform a method for identification of an unknown protein.
II. Identification of Proteins Using Laser Desorption Ionization Mass Spectrometry.
A. General Laser Desorption Ionization Mass Spectrometry Methods
[0087] Mass spectrometry is a sensitive and specific analytical technique that is increasingly being developed for detection, identification and characterization of proteins. Thus, mass spectrometry is also becoming a powerful tool for the identification of pathogenic bacterial microorganisms, viruses, and protein toxins and also finds use in proteomics and forensic science.
[0088] The methods disclosed herein utilize routine techniques in the field of mass spectrometry. Basic texts disclosing general mass spectrometry methods include e.g., Mass Spectrometry: A Textbook, by Jurgen H. Gross, (2002, 2004, 2006) Springer, and Mass Spectrometry: Principles and Applications by Edmond de Hoffmann, and Vincent Stroobant, (2002) John Wiley and Sons Ltd, (each of which is incorporated herein by reference). Laser Desorption/Ionization is disclosed e.g., in Laser Desorption Ionization Mass Spectrometry of Bioorganic Molecules by: Michael Karas, and Ute Bahr (1993) Methods in Molecular Biology Vol.17 pages 215-228 Springer.
[0089] Laser desorption/ionization mass spectrometry methods which produce singly, or occasionally doubly charge ions are suitable for use in the protein identification methods disclosed herein. In addition to MALDI, any method that is capable of mass isolating and fragmenting singly charged protein ions in the gas phase is suitable for use in the protein identification methods disclosed herein.
[0090] Laser desorption/ionization methods known in the art which have the ability to produce singly charged and sometimes doubly charged ions include, but are not limited to SELDI (see e.g. Surface-enhanced laser desorption/ionization (SELDI), Ning Tang, et al. (2004) Mass Spectrometry Reviews, 23:34-44); Infrared laser desorption/ionization on silicon (see e.g., Bhattacharya SH et al. (2002) Anal Chem. May 1;74(9):2228-31); Laser desorption/ionization mass spectrometry on porous silicon (see e.g., Seetharaman Vaidyanathan, et al. (2007) Rapid Communications in Mass Spectrometry 21(13): 2157- 2166); MALDI (see e.g., Tanaka, K., et al. (1987) supra and Karas, M., et al. (1987) supra) etc.
[0091] The methods disclosed herein for identification of an unknown protein are not suitable for use with ionization methods that produce multiply charged ions. Such methods include, but are not limited to e.g., electrospray ionization (ESI) (see e.g., Fenn, J. B., et al. (\9%9) Science, 246, 64-11).
B. Matrix-Assisted Laser Desorption/ionization (MALDI)
[0092] In an exemplary embodiment, the laser desorption/ionization mass spectrometry method is matrix-assisted laser desorption/ionization (MALDI). MALDI is a soft ionization technique, that is useful for, inter alia the analysis of biomolecules (see e.g., Cain, T.C., et al. (1994) supra; Krishnamurthy, T., et al. (1996) supra; Krishnamurthy, T., and Ross PL. (1996) 10:1992 supra; Karas, M. & Hillenkamp, F. (1988) Analytical Chemistry, 60, 2299- 2301; Karas, M, et al. (1987). Int. J. Mass Spectrom. Ion Proc. 78:53-68; Lancaster, K. S., et al. (2006) Anal Chem., 78, 4990-4997) and large organic molecules generally (see e.g., Karas, M.; Bahr, U. (1990). "Laser Desorption Ionization Mass Spectrometry of Large Biomolecules". Trends Anal. Chem. 9: 321-5). [0093] MALDI involves embedding analyte molecules in a matrix of a weak organic acid that are solids at room temperature (e.g. α-cyano-4-hydroxycinnamic acid). MALDI matrices typically absorb strongly in the ultraviolet electromagnetic spectrum (e.g. 337 nm or 355 nm, etc.). Typically, a pulsed nitrogen (at 337 nm) or pulsed solid state YAG laser (at 355 nm) is used to irradiate a dried spot of organic acid matrix that is embedded with analyte. These lasers have repetition rates from 2-100 Hz with a pulse width of 10 nanoseconds. The strong absorption of the matrix at the laser wavelength results in an explosive desorption from the target plate of matrix and analyte molecules into the gas phase.
[0094] In a process that is still not well understood, analyte molecules are protonated (or deprotonated). The MALDI ionization process typically results in singly charged protonated analytes (in positive ion mode). Higher charge states are possible but these typically have less signal intensity. In the case of peptides and proteins, protonation typically occurs at the side-chains of basic residues (e.g., arginine, lysine, histidine).
[0095] Because relatively low charge states are produced by MALDI the mass-to-charge (m/z) ratio of proteins is typically beyond the mass range of most mass analyzers. Thus, the type of a mass spectrometer most widely used with MALDI is the TOF (time-of-flight mass spectrometer) since this mass analyzer has a theoretically unlimited mass range. [0096] MALDI has been used for the identification of proteins isolated through gel electrophoresis or other purification methods (see e.g., Demirev, P.A., et al. Anal. Chem. 1999; 71 : 2732; Peneda, F.J., et al. Anal. Chem. 2000; 72: 3739; Demirev, P.A., et al. Anal. Chem. 2001; 73: 4566; Yao Z-P, et al. Anal. Chem. 2002; 74: 2529; Peneda, F.J., et al. Anal. Chem. 2003; 75: 3817). MALDI is also used for peptide mass fingerprinting by methods known in the art (see e.g., Pappin DJ, et al. (1993). Curr. Biol. 3 (6): 327-32; Henzel WJ, et al. (1993). Proc. Natl. Acad. Sci. U.S.A. 90 (11): 5011-5; Mann M, et al. (1993). Biol. Mass Spectrom. 22 (6): 338-45; James P, et al. (1993). Biochem. Biophys. Res. Commun. 195 (1): 58-64; Yates JR, et al. (1993) Anal. Biochem. 214 (2): 397^08). [0097] Tandem MALDI e.g., MALDI-TOF-TOF instruments have been used to fragment small to medium-sized proteins (see e.g., Lin M, et al. (2003) supra). MALDI has also been used for identification of Bacillus spores by fragmenting their protein biomarkers using a tandem MALDI mass spectrometer and analyzing the sequence-specific fragment ions generated by comparison to in silico fragment ions derived from protein amino acid sequences from open reading frames of genomic databases (see e.g., Demerev et al. (2005) Anal Chem 77:7455). Identifications were tested for significance by a p-value calculation, which provides a probability that an identification occurred randomly (see e.g., Demerev et al. (2005) supra).
[0098] At one time, mass spectrometry was only practiced by relatively small number of highly trained specialists. However, a revolution in mass spectrometry was triggered by the development of two ionization techniques developed in the late 1980s and early 1990s: matrix-assisted laser desorption/ionization or MALDI (Tanaka, Ido, Akita, Yoshida & Yoshida, 1987), (Karas, Bachmann, Bahr & Hillenkamp, 1987), (Karas & Hillenkamp, 1988), and electrospray ionization or ESI (Fenn, Mann, Meng, Wong, & Whitehouse, 1989). The impact that these two inventions dramatically extended the development of mass spectrometry and its application to the analysis of large biomolecules including peptides, proteins, nucleic acids and complex carbohydrates.
[0099] With the rapid development of genomic sequencing (i.e. "next-generation"), the speed of genomic sequencing, and the ability to acquire longer DNA sequence "reads", will allow almost any strain of microorganism to be completely sequenced in a relatively short period of time. This capability means that the number of strains of a genus, species, subspecies, sub-type of microorganism that will be genomically sequenced will increase signficantly beyond what is currently possible. With this ever increasing amount of genomic data being made available in public and private databases, the number of unique protein amino acid sequences (open reading frames or ORFs of genomic data) is expected to increase together with the genomic sequencing efforts. In consequence, it is critical that, as the volume of genomic and proteomic data increases, the mathematical algorithms used to analyze and exploit such data be as computationally efficient as possible. [0100] Fortunately, the USDA peak matching algorithms disclosed herein are demonstrably faster in computation speed than other method currently used in the art e.g., p- value calculation (see e.g., Demirev et al. (2005) Anal. Chem. 77:7455). Fortunately, in using the faster USDA peak matching algorithms, accuracy is not sacrificed for speed. Indeed, the USDA peak matching algorithms are faster and give comparable results in scoring/ranking of protein/organism identifications as that obtained by other methods more complicated scoring algorithms known in the art e.g., p-value calculation (see e.g., Tables IA, 2A, 3A). [0101] The difference in algorithm computation speeds is further enhanced (in favor of the USDA peak matching algorithms) when only residue-specific in silico fragment ions (e.g. D,E,P-specific fragment ions) are used for comparison to MS/MS fragment ions (see e.g., Tables IB, 2B, 3B). Under these circumstances, the USDA algorithm computation speed is cut by at least about half whereas the p-value computation speed is reduced by only about ~20% at best. The increased speed and accuracy of protein identification provided by residue-specific analysis has not heretofore been appreciated by others (see e.g., Demirev et al. (2005) Anal. Chem. 77:7455). Indeed, in the past it has typically been assumed, that fragment ions could be generated, theoretically, at every residue of a protein. [0102] In some exemplary embodiments, the USDA mass spectrometry comparison software uses plots and "fits" fragment ion m/z error as a function of fragment ion m/z to confirm the correctness of the USDA peak matching algorithm identification. Such a confirmatory analysis has heretofore not been utilized or demonstrated. Thus, the methods disclosed herein are simpler, faster, more accurate and more complete than than other currently available methods.
1. Sample Preparation for MALDI
[0103] Samples may be prepared for MALDI ionization by any method known in the art
(see e.g., Onnerfjord, P., Ekstrδm, S., Bergquist, J., Nilsson, J., Laurell, T., Marko-Varga, G.
(1999) Rapid Commun Mass Spectrom., 13, 315-322).
[0104] Typically, a purified sample of the analyte compound (e.g. peptide, protein, small molecule) is dissolved in an aqueous solution at a concentration of picomole (10~12 mole) per μL (10"6 L) or lower.
[0105] The MALDI matrix of choice (see below) is dissolved in a separate aqueous solution (e.g. 2: 1 water/acetonitrile) to make a saturated (or sub-saturated) solution of matrix.
Typically, this solution is acidified with an acid such as e.g., 0.1% of trifluoroacetic acid
(TFA) however, any suitable acidifier can be used in an effective concentration. As is known in the art, acidification facilitates protonation of analyte molecules during the desorption/ionization process.
[0106] In one exemplary embodiment, roughly equal aliquots of matrix solution and analyte solution are mixed together and then spotted onto a stainless steel MALDI target.
The spot is allowed to dry and the target is inserted into the ionization source of the mass spectrometer.
[0107] In another exemplary embodiment, a one μL aliquot of the matrix is spotted onto the stainless steel MALDI target and allowed to dry before a one μL aliquot of the sample is overlayed on top of the spot of dried matrix. The re-dissolved spot is allowed to dry before inserting the target into the mass spectrometer.
[0108] In still another exemplary embodiment, the sample is spotted the on the stainless steel target, and allowed to dry and then spotting the matrix on top of the dried spot of sample (see e.g., Onnerfjord, Ekstrδm, Bergquist, Nilsson, Laurell, Marko-Varga, 1999). [0109] MALDI works best when contaminants (e.g. salts, small molecules, etc.) are removed from the sample before MALDI preparation. Salts, in particular, interfere with ionization by MALDI. Sample clean-up using high performance liquid chromatography (HPLC) or dialysis helps to reduce salts and small molecule contaminants that may interfere with MALDI ionization of the analyte of interest.
2. Protein Extraction
[0110] Protein extraction may be accomplished using any suitable technique known in the art. Typically the technique chosen depends on the nature of the protein one wishes to extract. The skilled artisan will appreciate those factors that influence extraction of their protein of interest and will choose their extraction techniques accordingly. For example, proteins may be hydrophilic or hydrophobic or have regions that display both properties. Cytosolic proteins (because they reside in the aqueous cytosol of the cell) are often the easiest proteins to extract because they are hydrophilic and thus dissolve easily in aqueous solutions. Cytosolic proteins are also often high copy proteins so their relative abundance in the cellular proteome is high. In consequence, protein biomarkers of bacterial cells are often high copy cytosolic proteins. Extraction of cytosolic proteins typically involves nothing more difficult than rupturing the cellular membrane (or cell wall) to release the cytosolic proteins into the surrounding protein extraction medium (e.g. water/acetonitrile).
[0111] Cell membrane or cell wall disruption is accomplished by any technique known in the art, e.g. bead-beating (see e.g., Mandrell, R. E., Harden, L. A., Bates, A., Miller, W. G., Haddon, W. F., & Fagerquist, C. K. (2005). Appl Environ Microbiol, 71, 6292-6307; high pressure disruption (see e.g., Smejkal, G.B., Robinson, M.H., Lawrence, N.P., Tao, F., Saravi,s C.A., Schumacher, R.T. (2006) J. Biomol. Tech., 17, 173-175; or sonication (see e.g., Balasundaram, B., Pandit, A.B. (2001) Biotechnol Bioeng. ;75 , 607-614).
3. MALDI Matrices
[0112] In general, the identity of suitable matrix compounds is determined to some extent by trial and error. However, some considerations are helpful in guiding the skilled practitioner (see e.g., K. Strupat, et al. (1991) International Journal of Mass Spectrometry and Ion Processes Vol. 111, 1991, Pages 89-102; Beavis RC, and Chait BT (1989). Rapid Commun. Mass Spectrom. 3 (12): 432-5; Karas, M. et al. (1987). IntJ Mass Spectrom Ion Proc 78: 53-68.).
[0113] In general, exemplary MALDI matrices are low molecular weight (e.g., 100-200 Da) weak organic acids which are solid at room temperature but absorb strongly at ultraviolet light at wavelengths, e.g. 337 nm (nitrogen laser) or 355 nm (3rd-harmonic of a solid state YAG laser).
[0114] Exemplary MALDI matrices are also typically are functionalized with polar groups, allowing their use in aqueous solutions. The most popular MALDI matrices for ionizing peptides and proteins are α-cyano-4-hydroxycinnamic acid (abbreviated CHCA or CCA), 2,5-dihydroxybenzoic acid (abbreviated DHB), trans-4-hydroxy-3-methoxy-cinnamic acid (common name: ferulic acid) and 3,5 dimethoxy-4-hydroxy-cinnamic acid (common name: sinapinic acid). CHCA is considered a "hot" matrix because during laser vaporization/desorption this matrix appears deposit significant amounts of energy into the peptide or protein which can result in dissociation of the peptide or protein ion after it exits the ionization chamber. CHCA also generates doubly and triply protonated (charged) analytes in addition to singly protonated (charged) analytes, thus, it should be used with care in order to be suitable for use with the method disclosed herein for identification of an unknown protein. At the other end of the MALDI matrix spectrum is sinapinic acid which is considered to be a "cold" matrix. Use of sinapinic acid as a MALDI matrix tends to generate only singly protonated ions as well as high molecular weight proteins. In consequence, sinapinic acid is particularly suited to ionization of higher molecular weight proteins, e.g., above about 10 kDa.
C. Mass Spectrometry
[0115] Mass spectrometry is the science of "weighing" (or measuring the mass) of atoms and molecules. As is known in the art, the applications of mass spectrometry are numerous, ranging from measuring very precisely the abundances of atomic isotopes of elements found in the periodic table, to measuring with high resolution and mass accuracy the mass of large biomolecules, e.g. proteins (see e.g., Grayson, M.A. (2002) Measuring Mass , Chemical Heritage Foundation).
1. Tandem Mass Spectrometry
[0116] In an exemplary embodiment, the methods disclosed herein utilize tandem MALDI mass spectrometry. As is well known in the art, tandem mass spectrometry (or MS/MS) involves coupling two (or more) mass analyzers in tandem in order to selectively interrogate individual analyte ions observed in MS analysis. [0117] A popular tandem mass spectrometer is the triple quadrupole (see e.g., Yost, R.A., Enke, CG. (1978) J. Amer. Chem. Soc, 100:2274-2275). When used in MS/MS mode, the first quadrupole of a triple quadrupole instrument is operated so as to allow only ions of a particular m/z to transit into the second quadrupole mass analyzer. This is called mass isolation or mass selection. The mass-selected ions are fragmented in a second quadrupole typically by collision-activated dissociation (CAD). The fragment ions generated are then analyzed and detected by the third quadrupole mass analyzer. Because of mass- selection/isolation, the fragment ions generated in the second quadrupole are linked to the analyte precursor ions selected by the first quadrupole.
[0118] The principles of MS/MS have been extended to a number of instrument platforms e.g., time of flight (TOF). TOF/TOF mass spectrometry is known in the art (see e.g., U.S. Pat. No. 6,300,627).
[0119] In an exemplary embodiment, a method of identifying an unknown protein employs MALDI TOF/TOF mass spectrometry. Briefly, MS/MS using a MALDI-TOF-TOF instruments involves using the first TOF mass analyzer to separate ions in space and time. Because ions are separated on TOF instruments on the basis of their relative velocities and this is related to an ion's m/z, a timed ion "gate" is used to mass-select/isolate ions of a specific m/z. Only ions of a specific m/z (with a specific velocity and thus arrival time at the "gate") are allowed to pass from the first TOF mass analyzer to a collision cell. All other ions arriving either "too early" or "too late" are deflected from entering the collision cell. Thus, mass-selection/isolation is attained.
[0120] The mass selected/isolated ions are dissociated in the collision cell by high energy collision-activated dissociation (CAD) or by post-source dissociation (PSD) or by laser- induced dissociation (LID). On TOF-TOF instruments, collision energies of 1-2 keV are possible. PSD involves the dissociation of ions as a result of the energy deposited into the analyte ion at the ionization source. After precursor ion fragmentation, fragment ions are analyzed by the second TOF mass analyzer (see e.g., Medzihradszky, K.F., et al. (2000). Anal. Chem., 72, 552-558).
a. Error Analysis
[0121] In an exemplary embodiment, the method comprises confirming that the highest USDA peak matching score constitutes an identification of the unknown protein. In this embodiment the correctness of the identification is confirmed by plotting the difference in m/z (Am/z) between an MS/MS fragment ion of the unknown protein and its matched fragment ion from the in silico MS/MS spectra generated from a genomically-derived database of protein sequences as a function of MS/MS fragment ion m/z. The resulting plot of Am/z vs MS/MS fragment ion m/z is subjected to a linear regression analysis fit of the data. Linear regression analysis is known in the art (see e.g., Skoog, D.A. & West, D. M. (1986). Analytical Chemistry, 4th edition.)
[0122] Briefly, linear regression analysis is the process by which a "best" fit straight line is fitted to data plotted in two dimensions (e.g. x-dimension and y-dimension). In an exemplary embodiment, such an analysis is used in creating a calibration curve for a mass spectrometer. The simplest linear regression is the method of least squares. The method of least squares is a regression analysis that minimizes the square of the vertical displacement (residuals) of the data points from the line that is being fitted to the data. This process generates the "best" fit of the line to the data points (Skoog & West, 1986, supra). [0123] A correct protein identification is indicated when the plot of Am/z vs MS/MS fragment ion m/z reveals a characteristic systematic error related to the inherent calibration error of the mass analyzer.
[0124] An incorrect protein identification is indicated when the plot of Am/z vs MS/MS fragment ion m/z reveals statistically random error.
[0125] In an exemplary embodiment, prior to running a sample, the mass spectrometer is tuned to maximize sensitivity, resolution and mass accuracy. Typically, this involves either manually or automatically adjusting the instrument's ion optics using a known standard. This process ensures that the ionization source, mass analyzer and detector are all functioning properly. As part of this process, the mass analyzer is also calibrated. [0126] Calibrating the mass analyzer ensures that mass measurement is within the operating specifications of the instrument. As the skilled artisan will appreciate, instrument calibration in MS mode involves comparing the observed masses of a mixture of known standards to their actual masses. Any discrepancy between a standard's measured m/z and its known m/z is considered error. The m/z error or Am/z (i.e. difference between the measured m/z and the actual m/z) is plotted as a function of analyte ion m/z. A linear regression analysis (e.g., higher order curve fitting) is used to generate a calibration curve that is then applied to the mass assignment of any subsequent data collected to correct for inaccuracies in the mass analyzer's performance.
[0127] As the skilled artisan also appreciates, it is not unusual, even after calibration, for a mass analyzer to experience "drift", i.e. the instrument calibration is no longer correcting for a mass analyzer's slight inaccuracies in mass measurement. In an exemplary embodiment, mass analyzer "drift" is due to changes in the temperature of the room in which the instrument is housed, however other causes could be in play. TOF, TOF-TOF and hybrid quadrupole-TOF or ion trap-TOF instruments, are particularly susceptible to calibration "drift" due to changes in room temperature. In consequence, the instrument may require re- calibration daily (or more often) if there is a significant change in room temperature. [0128] In an exemplary embodiment, the "drift" in calibration of TOF-based mass spectrometry instrumentation is exploited with respect to peptide and protein identification that involves comparison of an MS/MS spectrum to in silico MS/MS spectra. [0129] It has been shown that a tryptic peptide (with a known amino acid sequence) analyzed using a hybrid quadrupole-TOF mass spectrometer in MS/MS mode generates an MS/MS spectrum that, when "matched" to its correctly identified in silico MS/MS peptide spectrum, results in a linear correlation (using linear regression analysis) between the fragment ion m/z error as a function of fragment ion m/z, and that this linear correlation was not observed when the MS/MS spectrum was "matched" to an incorrect in silico MS/MS peptide spectrum.
[0130] However, since it was concluded experimentally that the "drift" in the instrument calibration of the TOF mass analyzer of the quadrupole-TOF instrument was caused by changes in the temperature of the instrumentation room (see e.g., Taylor, J.A. & Johnson, R.S (2001) Analytical Chemistry, 73, 2594-2604), this linear correlation for the correct in silico peptide identification was simply incorporated into de novo peptide sequencing software (as an internal standard, i.e. trypsin autolysis peptides) to correct for the calibration "drift" of the TOF mass analyzer on the quadrupole-TOF instrument due to room temperature changes. [0131] Thus, although a linear "fit" of the fragment ion m/z error has been used to correct for calibration error of a TOF mass analyzer, it has not been appreciated before the instant disclosure that a linear "fit" of the fragment ion m/z error could be used to "identify" or "confirm the identity" of a protein and/or peptide sequence to that of an in silico sequence in a database.
[0132] Thus an exemplary embodiment of the invention provides a comparison of fragment ions generated from MS/MS of mature, intact proteins from cell lysates analyzed using a tandem TOF instrument to in silico fragment ions from protein amino acid sequence in a database. The difference in m/z between the MS/MS fragment ions and their putative in silico fragment ion "matches" are plotted as a function of the MS/MS fragment ion m/z. A linear or least-squares fit of such data is used to confirm the correctness of the USDA peak matching algorithm identification. In an exemplary embodiment, a correct identification displays evidence of a linear correlation between m/z error vs. fragment ion m/z whereas an incorrect identification will display poor correlation (i.e. random error) between m/z error vs. fragment ion m/z.
b. Residue Specific Analysis
[0133] In an exemplary embodiment, the method comprises confirming that the highest USDA peak matching score constitutes an identification of the unknown protein. In this embodiment the correctness of the identification is confirmed by performing the method while limiting the in silico MS/MS spectra generated from a genomically-derived database of protein sequences to spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, glutamate (E) residue, or proline (P) residue. If the difference between the highest USDA peak matching score and the second highest USDA peak matching score is equal to or greater than the difference between the highest USDA peak matching score and the second highest USDA peak matching score obtained when the method is performed without the limitation to D, E, and/or P residues this confirms the identification of the unknown protein.
[0134] As discussed more extensively below, in an exemplary embodiment, the method for identifying an unknown protein is contained within computer readable storage medium storing instructions that, when executed by a computer, causes the computer to perform a method for identification of an unknown protein.
[0135] In one exemplary embodiment, the software allows an "MS/MS to In Silico Comparison" to compare MS/MS fragment ions to all possible in silico MS/MS fragment ions or to only residue-specific in silico MS/MS fragment ions.
[0136] In another exemplary embodiment, the software allows an "MS/MS to In Silico Comparison" to compare MS/MS fragment ions to a subset of all possible in silico MS/MS comprising certain selected residue-specific in silico MS/MS fragment ions. In one exemplary embodiment, the comparison is executed by the software that compares the subset of in silico MS/MS residue-specific in silico MS/MS fragment ions comprising D,E,P- specific in silico MS/MS fragment ions to the MS/MS fragment ions. In another exemplary embodiment, the comparison is executed by the software that compares the subset of in silico MS/MS residue-specific in silico MS/MS fragment ions comprising D-specific in silico MS/MS fragment ions to the MS/MS fragment ions. [0137] Although it has been shown experimentally that singly protonated proteins are more likely to fragment at the polypeptide backbone at sites that are adjacent to an aspartic acid (D), glutamic acid (E) or proline (P) (see e.g., Lin, M., et al. (2003) Rapid Commun. Mass Spectrom. 77:1809-1814.), until the discovery by the present inventors, it was not heretofore appreciated that this experimental observation could be exploited into a method or software algorithm to specifically identify a protein (and its source organism) on the basis of a comparison of MS/MS fragment ions to residue-specific in silico MS/MS fragment ions. [0138] Incorporating residue specific analysis into the methods for identifying an unknown protein, as disclosed herein, significantly increases the ability to correctly and accurately identify an unknown protein as reflected in a USDA peak matching score (i.e., USDAα Score and/or USDAβ Score). Indeed, the absolute value of the USDA peak matching score is increased as well as the relative value of the highest USDA peak matching score relative to the second highest USDA peak matching score(s) and the USDA peak matching scores of other incorrect identifications.
[0139] Without being bound by theory, it is believed that the reason for this increase is that, if it is known experimentally that a particular protein (or proteins) will preferentially fragment at particular sites along the polypeptide backbone due to specific residues adjacent to such cleavage sites, then the software can be directed to include only those residue-specific in silico MS/MS fragment ions for comparison to the experimentally measured MS/MS fragment ions, i.e. they are fewer in silico MS/MS fragment ions that are involved in the comparison to MS/MS fragment ions, thus increasing the numerical value of the "USDA Score". Such selectivity not only increases the identification score of the correct identification, but also reduces the computation time of the analysis because fewer in silico MS/MS fragment ions are being compared.
D. Databases
1. In Silico Databases
Constructing an In Silico MS/MS Database
[0140] In an exemplary embodiment, an in silico MS/MS database is constructed to retrieve the amino acid sequences of all bacterial proteins having a protein molecular weight the same as the protein biomarker molecular weight within a specified mass tolerance (e.g. 10,000 ± 5 Da). Bacterial protein amino acid sequences can be downloaded from public web-based database servers (e.g. ExPASY proteomics server, available through Swiss Institute of Bioinformatics). In an exemplary embodiment, the Tagldent software tool at the Expasy website allows the retrieval of proteins on the basis of taxonomic identification of the source organism as well as protein p/, protein molecular weight and any sequence tag information (e.g., a short sequence of adjacent amino acid residues in the protein) if it available. Tagldent searches the public databases of UniProtKB/Swiss-Prot and/or UniProtKB/TrEMBL for all proteins which correspond to the specified search parameters. [0141] In an exemplary embodiment, all of the proteins that fit the specified search criteria are compiled into a single large FASTA file. This multi-protein sequence FASTA file is then imported into a mass spectrometry-based proteomics software (e.g. the a commercially available GPMAW, ©Lighthouse Data). Mass spectrometry-based proteomics software e.g., GPMAW, converts each protein amino acid sequence contained in the FASTA file into a series of in silico MS/MS fragment ions. The fragment ions are identified by their m/z, ion type/number (e.g. bs2, V44, a27, y32-17, b92-18, etc.) and the two amino acid residues immediately adjacent to the polypeptide cleavage site that generated the fragment ion. [0142] Each protein sequence (and its associated in silico MS/MS fragment ion information) is exported by the mass spectrometry-based proteomics software e.g., GPMAW, software as a separate datafile. Thus, a single multi-protein sequence FASTA file containing 700 protein sequences will result in 700 in silico MS/MS datafiles when processed by GPMAW. These in silico MS/MS datafiles are then imported into the in silico MS/MS database of the USDA mass spectrometry comparison software using Java client ("InSilicoUpload.jar", i.e. a binary file [jar file] that is interpreted by the Java Runtime Environment or JRE) which was created to import/upload automatically multiple in silico MS/MS data files to the MySQL database of the USDA mass spectrometry comparison software. This software program is operated independently of the Tomcat Apache (TA)/Java Server Pages (JSP) of the USDA mass spectrometry comparison software. Once the in silico files are imported into the In silico MS/MS Database of the USDA mass spectrometry comparison software, the data can be displayed or compared against MS/MS acquired experimentally.
[0143] Display of an in silico MS/MS spectrum looks very much like a "barcode" because each in silico MS/MS fragment ion has a 100% relative intensity as shown in FIG. 8. In contrast, an experimentally acquired MS/MS spectrum will have fragment ions whose intensity can vary from 0 to 100% as that shown in FIG. 6.
2. Mass Spectra of Known Proteins
[0144] In an exemplary embodiment, the amino acid sequence of a protein is determined by genetic or genomic sequencing of the gene whose product is protein. In another exemplary embodiment, the genomically-derived amino acid sequence of protein is determined and/or confirmed by proteomic techniques such as Edman sequencing or "bottom-up" or "top-down" mass spectrometry-based proteomic techniques. [0145] An MS and/or MS/MS spectrum of a protein whose identity was previously determined based on genomic sequencing of the protein's gene or Edman sequencing of the protein's N-terminal sequence, is an exemplary mass spectrum of a known protein.
3. Temporary Databases
[0146] A "temporary database" is simply tabulated data that is stored temporarily in random access memory (RAM). Processing such tabulated data when it is stored in RAM is significantly faster than processing the same data when it is stored on a hard drive.
E. Computer Software
1. Overview
[0147] In an exemplary embodiment, the invention provides a computer readable storage medium storing instructions that, when executed by a computer, causes the computer to perform a method for identification of an unknown protein. The method for identifying the unknown protein comprises: (i) comparing mass-to-charge (m/z) fragment ion peaks from an mass spectrum of the unknown protein to that of m/z fragment ion peaks from mass spectra of known protein sequences; and (ii) matching the m/z fragment ion peaks from the mass spectrometry spectrum of the unknown protein to the m/z fragment ion peaks from the mass spectrometry spectra of known protein sequences to provide mass spectrometry peak matches; (iii) scoring the mass spectrometry peak matches using the formula:
2 x (Number of peak matches)
USDAa Score = 100 x
(Number of peaks in the mass spectrum of the unknown protein + Number of peaks in the mass spectrum of known protein sequences) thereby providing a USDAα peak matching score; and (iv) ranking the USDAα peak matching score from highest to lowest; wherein the highest USDAα peak matching score constitutes an identification of the unknown protein.
[0148] In another exemplary embodiment, the invention provides a computer readable storage medium storing instructions that, when executed by a computer, causes the computer to perform a method for identification of an unknown protein. The method for identifying the unknown protein comprises: (i) comparing mass-to-charge (m/z) fragment ion peaks from an mass spectrum of the unknown protein to that of m/z fragment ion peaks from mass spectra of known protein sequences; and (ii) matching the m/z fragment ion peaks from the mass spectrometry spectrum of the unknown protein to the m/z fragment ion peaks from the mass spectrometry spectra of known protein sequences to provide mass spectrometry peak matches; (iii) scoring the mass spectrometry peak matches using the formula:
Number of peak matches USDA β Score = 100 x
(Number of MS/MS fragment ion peaks) thereby providing a USDAβ peak matching score; and (iv) ranking the USDAβ peak matching score from highest to lowest; wherein the highest USDAβ peak matching score constitutes an identification of the unknown protein.
[0149] In one exemplary embodiment, the instructions on the computer readable storage medium comprise a computer software program for the identification of proteins by analysis of fragment ions generated from gas phase fragmentation of singly charged protein ions generated by matrix-assisted laser desorption/ionization (MALDI) and analyzed by tandem time-of- flight (TOF) mass spectrometry (MS/MS). Prior enzymatic digestion of the proteins is not required. The software also provides instructions for performing a pair-wise comparison of an unknown MALDI-TOF-MS spectrum to that of known MALDI-TOF-MS spectra and rank spectra according to spectral similarity thereby enabling a user to identify an unknown spectrum.
[0150] In one exemplary embodiment, the USDA mass spectrometry comparison software (which in exemplary embodiments may utilize either the USDAα or the USDAβ peak matching algorithms) is written in JAVA and JSP computer language. However, in other exemplary embodiments the software is written in C, C++, PHP, Assembly or any other web-based software languages known in the art. To ensure that the web based/cross platform component is available a web server based language is utilized e.g., ASP, JSP, PHP, etc. [0151] The code for software embodiments is disclosed herein in the computer program listing appendix. The USDA mass spectrometry comparison software (which in exemplary embodiments may utilize either the USDAα or the USDAβ peak matching algorithms) comprises the following features, functionalities and attributes: [0152] A web browser interface and associated databases that utilize MySQL for database management.
[0153] The USDA mass spectrometry comparison software enables efficient entry, deletion, retrieval and searching of organism (e.g., microorganism) isolate information, e.g. in the case of a microorganism taxonomy, origin, source, etc.
[0154] The USDA mass spectrometry comparison software enables the entry of ASCII formatted m/z and intensity MS and MS/MS data files to databases for subsequent searching, retrieval or deletion.
[0155] The USDA mass spectrometry comparison software enables the entry of single data files (or multiple data files) of ASCII formatted m/z MS/MS in silico data files to a database for subsequent searching, retrieval or deletion.
[0156] The USDA peak matching algorithms enable comparison of the mass-to-charge
(m/z) of fragment ion peaks from a MS/MS spectrum to the m/z of fragment ions of an in silico MS/MS spectra of proteins. The software compares fragment ions of in silico MS/MS spectra to fragment ions of an MS/MS spectrum of an unknown protein when the mass of the protein falls within a pre-specified mass tolerance (e.g. ± 1.0 Th; ± 2.0 Th; ± 3.0 Th; ± 4.0
Th; ± 5.0 Th; wherein Th is Thomson the unit of m/z) of the precursor protein ion. When the difference between the m/z of a fragment ion in a MS/MS spectrum of an unknown protein and the m/z of a fragment ion in an in silico MS/MS spectrum fall within the set pre-specified mass tolerance (e.g. ± 2.5 Th) it is a "match". The USDAα peak matching algorithm has the formula:
2 x (Number of peak matches)
USDAa Score = 100 x
(Number of peaks in the mass spectrum of the unknown protein + Number of peaks in the mass spectrum of known protein sequences)
The USDAβ peak matching algorithm has the formula:
Number of peak matches
USDAβ Score = 100 x
(Number of MS/MS fragment ion peaks)
[0157] The highest scoring protein/microorganism identification obtained using either the USDAα or USDAβ peak matching algoritms, that is significantly higher than the second highest scoring protein/microorganism identification constitutes a presumptive correct identification. In an exemplary embodiment, significantly higher is a difference in score between the highest scoring identification and the second highest scoring identification that is equal to or greater than 2. In another exemplary embodiment, significantly higher is a difference in score between the highest scoring identification and the second highest scoring identification that is equal to or greater than 3. In another exemplary embodiment, significantly higher is a difference in score between the highest scoring identification and the second highest scoring identification that is equal to or greater than 4 or more. [0158] For convenience, in an exemplary embodiment, a probability-based significance testing algorithm (e.g., p-value calculation see Demirev et al. (2005) supra) is incorporated into the USDA mass spectrometry comparison software. The USDA peak matching score and the p-value calculation are completely independent. In this embodiment, the results of each calculation are displayed side-by-side in the identification results window. In this embodiment, the USDA mass spectrometry comparison software enables a user to rank the protein/microorganism identifications according to either the USDA peak matching score or the probability -based significance testing algorithm.
[0159] Thus, the USDA mass spectrometry comparison software enables a user to enter and retrieve data, and search or delete a database containing ASCII formatted m/z and intensity MALDI-TOF-MS data. In an exemplary embodiment, the USDA mass spectrometry comparison software performs a pair-wise comparison of a MALDI-TOF-MS spectrum from an unknown protein to that of MALDI-TOF-MS spectra from samples of known proteins and to rank the spectra according to spectral similarity thereby providing a taxonomic classification of the unknown protein and hence of the source organism from which the unknown protein is derived. The algorithms used for such a pairwise comparison are disclosed above. In another exemplary embodiment, the USDA mass spectrometry comparison software assigns the identity of m/z peaks in a MALDI-TOF-MS spectrum by comparison to another database of theoretical protein molecular weights derived from genomic data (e.g., open-reading frames or ORFs).
[0160] In one exemplary embodiment, for each unknown protein "identification", the USDA mass spectrometry comparison software displays a side-by-side comparison of the measured fragment ion m/z and the m/z of an in silico fragment ions to which it matches. When the identification is correct, a plot of the m/z error (Am/z), i.e. the difference in m/z between the measured fragment ions and their in silico fragment ion matches, reveals a characteristic systematic error caused by the inherent calibration error of the instrument. Incorrect protein identifications, in contrast, are seen to display only statistically random error caused by false "matches". The confirmation of the correctness of the unknown protein identification by systematic error is independent of the mathematical algorithm used for unknown protein identification.
2. Software/database Structure and Functionality [0161] FIG. 1 provides a general overview of the framework for the USDA mass spectrometry comparison software. The software stored on a computer readable storage medium provides instructions that when executed by a computer, causes the computer to perform a method for identification of an unknown protein. The instructions comprising the USDA mass spectrometry comparison software utilizing either the USDAα or USDA& peak matching algorithms are provided herein in the computer program listing appendix. [0162] FIG. 2 shows the database model describing how the data is stored. A MySQL Database Management System (MySQL DBMS) is used as the back-end (i.e. software that indirectly provides support for a client) for the archival/retrieval/analysis software developed for protein/microorganism identification by mass spectrometry (MS) and tandem mass spectrometry (MS/MS). A Tomcat Apache (TA) web server delivers the user/operator interface to any computer platform (e.g. PCs, Macintosh, Unix). The front-end (i.e. the software with which the user/operator interacts) was created using Java Server Pages (JSP). A second front-end is a Java client (i.e. a binary file [jar file] that is interpreted by the Java Runtime Environment or JRE) which was created to upload automatically multiple in silico MS/MS data files to the MySQL DB and is operated independently of the TA/JSP server. The web client allows the user/operator to search, archive, retrieve and edit microorganism strain information as well as perform spectral similarity analysis of MS and MS/MS data of microorganism proteins or toxin proteins, e.g. comparison of MSa <-> MSb or MS/MSa <-> MS/MSb or MS/MS <-> In Silico MS/MS. The web client also allows a user/operator to display plots of archived MS, MS/MS and in silico MS/MS data. The web client also facilitates visual comparison of putative "matched" data by displaying stacked or mirrored plots of MS <-> MS, MS/MS <-> MS/MS or MS/MS <-> In Silico MS/MS data.
3. Spectral Similarity Analysis
[0163] FIG. 3 describes the USDA mass spectrometry comparison software process used to compare each dataset. Spectral similarity analysis of MS or MS/MS data involves multiple steps. First, the user/operator selects the parameters under which the data analysis is to be conducted. Exemplary parameters include, but are not limited to: 1. the specific microorganisms MS/MS data as determined by a primary key (i.e. an integer that uniquely identifies a dataset); 2. the mass range to be compared; 3. the minimum relative intensity threshold of MS peaks to be compared; 4. the tolerance of the mass-to-charge (Am/z) when comparing the m/z of two fragment ion peaks; 5. the scoring algorithm to be used in the analysis; 6. the sorting the identifications by their scores. The user/operator may also choose search parameters that affect the list of reference data sets, for example, 1. taxonomical identification of the microorganism; 2. identification number; 3. protein name; 4. text notes of the references.
[0164] Second, the primary keys (an integer that uniquely identifies a dataset) of the datasets are stored in random access memory (RAM) and looped through and their respective data to be individually compared against the user/operator selected dataset iteratively. Both datasets, the one chosen by the user/operator to run for a comparison and the current iteration for comparison against the whole database, are "filtered" by the parameters selected by the user/operator as described above. This is then placed into two separate memory tables to be compared against one another. Memory table is a term being used to describe a MySQL DB table that utilizes the memory based storage engine (e.g. RAM). This increases the speed of the comparison.
4. USDAa Peak Matching Algorithm
[0165] The USDA peak matching algorithm counts the total number of in silico fragment ions and adds this number to the total number of MS/MS fragment ions whose intensity is equal to or greater than the minimum intensity threshold. [0166] The algorithm then counts the total number of in silico fragment ions that are within Am/z of MS/MS fragment ions, i.e. the number of "matches" between two datasets. The number of counted "matches" is multiplied by two and divided by the previously mentioned summation of in silico MS/MS and MS/MS fragment ions. This number is then multiplied by 100% to give the USDA peak matching score. The USDA peak matching score has a theoretical range from 0 to 100% with 0% meaning no matches were identified and 100% meaning every single peak was matched between the two datasets. A non-zero Am/z means that it is possible for an MS/MS fragment ion peak to "match" to two (or more) in silico fragment ion peaks (or vice versa). Such "multiple" matches are counted only once by the USDA peak matching algorithm, otherwise a USDA peak matching score greater than 100% may occur. This counting/matching/scoring process is identical to the method used for comparing two MS spectra of MALDI-TOF MS data.
5. USDAβ Peak Matching Algorithm
[0167] The peak matching algorithm involves counting the number of MS/MS fragment ions whose intensity is equal to or greater than a relative intensity threshold (e.g. 2%). The algorithm then counts the number of in silico fragment ions whose m/z falls within a specified m/z tolerance (e.g. ± 2.5 Th) to that of the m/z of MS/MS fragment ions, i.e. counting the number of "peak matches" between MS/MS fragment ions and in silico fragment ions of the two datasets. The number of " peak matches " is then divided by the total number of MS/MS fragment ions above the specified intensity threshold. This number is then multiplied by 100% to give the peak matching score shown below:
Number of peak matches
USDAβ Score = 100 x
(Number of MS/MS fragment ion peaks)
[0168] The USDAβ peak matching score has a theoretical range from 0 to 100%. Zero percent indicates no peak matches were identified and 100% indicates every single MS/MS fragment ion was matched to an in silico fragment ion of an identification. A non-zero fragment ion m/z tolerance indicates that it is possible for an MS/MS fragment ion m/z to "match" to the m/z of two (or more) in silico fragment ions (or vice versa). Such multiple matches are counted only once by the algorithm, otherwise a score greater than 100% may result. The highest scoring protein/microorganism identification that is significantly higher than the second highest scoring protein/microorganism identification constitutes a presumptive correct identification. "Significantly" as used herein refers a relative difference in score between the top identification and the second highest scoring identification, typically of about 15-20% (or greater).
[0169] Software functionality allows selective operation of one or the other algorithms (or both). Algorithm computation time is provided by the software. In addition, the protein/microorganism identifications can be "ranked" by either the peak matching scores or p-values.
6. Computation speed of USDA algorithms
[0170] The USDA peak matching algorithms are less computationally complex than other protein identification algoritms known in the art e.g., a p-value calculation (see e.g., Demirev et al. (2005) supra). Thus, the computation time of the USDA peak matching algorithms are rapid as well as accurate. Indeed, in an exemplary embodiment, computation time is as much as 50% faster than the same p-value calculation. As the number of in silico bacterial proteins increase due to the increasing number of bacterial genomes, algorithm computation time plays an increasingly important factor in rapid and efficient protein/microorganism identification. [0171] The following examples are offered to illustrate, but not to limit the invention.
EXAMPLES
Example 1
[0172] The following example illustrates an exemplary microorganism identification protocol for the identification of a microorganism using matrix assisted laser desorption ionization (MALDI) mass spectrometry to identify an unknown protein and it corresponding source organism.
Flow Chart of Protein/Microorganism Identification
[0173] A 1 μL loop of bacterial cells suspended in 0.5 mL of solution (33% CH3CN, 67% H2O and 0.1% TFA). Bead-beating 60 seconds, centrifugation 5 minutes @ 10,000 rpm.
[0174] A 0.5 μL aliquot of supernatant is deposited onto stainless steel target pre-spotted with MALDI matrix.
I
[0175] Collect MS and MS/MS data of bacterial strain using MALDI tandem mass spectrometer (e.g. MALDI-TOF-TOF).
I
[0176] Raw MS and MS/MS data is processed and converted to ASCII formatted mass- to-charge (m/z) vs. intensity data. The ASCII formatted MS and MS/MS data are uploaded to their respective MySQL MS database (DB) and MySQL MS/MS DB of the USDA software.
I
[0177] From the ExPASy Tagldent web server, a search/retrieve/download was conducted of all bacterial proteins with a molecular weight (MW) equivalent in mass to the protein precursor ion m/z (PPI m/z) after removal of its proton (-1 Th) and within a pre-set mass tolerance, e.g. MW = (PPI m/z - X) ± 5 Da.
I
[0178] From the ExPASy Tagldent web server, a search/retrieve/download was conducted of all bacterial proteins with a MW equivalent in mass to the PPI m/z after removal of its proton (-1 Th) and addition of the mass of a methionine residue (+131 Da) and within a preset mass tolerance, e.g. MW = [(PPI m/z - 1) + 131] ± 5 Da. I
[0179] The MW = (PPI m/z - 1) ± 5 Da and the MW = [(PPI m/z - 1) + 131] ± 5 Da searches generate two large Fasta files each containing ~ 600-700 bacterial protein sequences.
I
[0180] The MW = [(PPI m/z - 1) + 131] ± 5 Da FASTA file is edited to remove N- terminal methionine from all protein amino acid sequences. The protein identification is also modified to highlight this in silico post-translational modification (PTM).
I
[0181] Each multi-sequence Fasta file is processed using a beta-version of the commercial software GPMAW. The beta-version (8.0 Ia5) has enhanced features developed by ©Lighthouse Data at USDA's request.
I
[0182] Each processed FASTA file generates ~ 600-700 text files. Each text file contains the taxonomic identification of the microorganism, the protein identification and its MW (average) and its in silico fragment ions as identified by their m/z (average), their ion type (a, b, b-18, y, y-17, y-18) and the two amino acid residues immediately adjacent to the site of polypeptide backbone cleavage which generated the specific fragment ion.
I
[0183] The MW = (PPI m/z - 1) ± 5 Da text files are sorted by file size in order to identify any proteins having a putative signal peptide (SP). These SP-associated text files are excluded from upload to the MySQL In Silico DB. Instead the SP-identified proteins are individually downloaded from the ExPASy web server as single sequence FASTA files. These single sequence FASTA files are edited to remove the SP, and the protein identification is modified to highlight this in silico post-translational modification (PTM). These new sequences are compiled into a single FASTA file and processed by GPMAW. The text files generated are then ready for upload to the MySQL In Silico DB.
I
[0184] The MW = [(PPI m/z - 1) + 131] ± 5 Da text files are sorted by file size in order to identify a small number of proteins having a putative SP. These SP-associated text files are excluded from upload to the MySQL In Silico DB. The non-SP-associated text files are ready for upload to the MySQL In Silico DB.
I
[0185] In silico text files are batch uploaded to the MySQL In Silico DB using a Java client (i.e. a binary file [jar file] that is interpreted by the Java Runtime Environment or JRE) that is part of, but separate from, the USDA software.
[0186] A "MS/MS To In Silico Comparison" functionality of the USDA software compares the MS/MS spectrum against all in silico MS/MS spectra whose calculated protein MW falls within the pre-specified protein MW tolerance of the PPI m/z, e.g. MW = (PPI m/z -
1) ± 5 Da.
X [0187] Protein/bacteria IDs are sorted and displayed on the basis of their USDA score (α or β) and/or p-value.
I
[0188] Protein/bacteria IDs are also confirmed by plots of fragment ion error analysis: systematic error (i.e. instrument calibration error) versus random error.
I
[0189] Protein/bacteria IDs are also confirmed by residue-specific fragment ions, e.g. the number and percentage of D,E,P-specific fragment ions.
Example 2;
[0190] The following example illustrates an exemplary method for bacterial protein extraction for MALDI-TOF/TOF analysis.
[0191] Bacterial proteins were extracted from Campylobacter cells using a technique that has been previously reported (see e.g., Mandrell RE, et al. Applied Environ. Microbio. 2005; 71: 6292; Fagerquist CK, et al. Anal. Chem. 2005; 77: 4897; Fagerquist CK, et al. J. Proteome Research. 2006; 5: 2527. Briefly, C. jejuni (strain RM1221), C. coli (strain RM2228), C. upsaliensis (strain RM3195) and C. lari (strain RM2100) were each cultured on non-selective growth media for 24-48 hours. One μL of cells were transferred to a microcentrifuge tube containing 0.5 mL of extraction solvents (67% water, 33 % acetonitrile and 0.1 % TFA) and 40 mg of 0.1 mm zirconia/silica beads (BioSpec Products Inc., Bartlesville, OK). The tube was capped and agitated for 60 seconds with a bead-beater. The tube was then centrifuged at 10,000 rpm for 4-5 minutes. An equal volume of sample supernatant was combined with an equal volume of either α-cyano-4-hydroxycinnamic acid (CCA) or sinapinic acid, mixed and spotted onto a 384-spot stainless steel plate. Samples were allowed to air-dry prior to analysis. Example 3;
[0192] The following example illustrates an exemplary mass analysis using high energy collision-induced dissociation as well as post-source dissociation on a MALDI tandem-TOF mass spectrometer to generate MS/MS spectra in reflectron-mode in positive ion mode. [0193] Samples were analyzed using an Applied Biosystems 4800 TOF-TOF™ Analyzer mass spectrometer (Foster City, CA). Spectra were analyzed in both MS linear-mode and MS/MS in reflectron-mode in positive ion mode. Source acceleration in the first source in linear-mode was 20.00 kV. In MS/MS reflectron-mode, ions were initially accelerated at 8.00 kV in the first source, mass-selected with a timed ion selector, the mass-selected ions were then decelerated to 1.70 kV, fragmented with the target gas (air) in the floating collision cell at 2 kV and the fragment ions formed were re-accelerated to 15 kV in the second source. Data was collected with the metastable (precursor ion) suppressor, located after the 2nd source, in both "on" and "off mode. A two-stage reflectron mirror assembly was operated at 10.910 kV (mirror 1) at 18.750 kV (mirror 2). Both linear and reflectron detectors were operated at 2.190 kV. Linear data were externally calibrated using insulin (MW = 5734.59 Da), thioredoxin (MW = 111674.48 Da) and apomyoglobin (MW = 16,952.56 Da). Reflectron-TOF MS/MS spectra were calibrated using updated instrument default calibration. [0194] MS and MS/MS data were analyzed using the commercially available instrument software (Data Explorer Software®, Version 4.9). MS data were processed using a noise filter (correlation factor = 0.7). MS/MS data were processed first with an advanced baseline correction (peak width = 32, flexibility = 0.5, degree = 0.1), then with noise removal (standard deviations = 2) and finally with a Gaussian smooth (filter width = 31).
Example 4;
[0195] The intact protein biomarker, thioredoxin from Campylobacter upsaliensis strain RM3195 was mass-selected and fragmented in the gas phase using a MALDI-TOF-TOF mass spectrometer by methods known in the art (see e.g., Example 3 above). The protein was identified previously by "bottom-up" proteomics techniques (see e.g., Fagerquist, CK. J. Proteome Research. 2007; 6: 2539-2549). Since the identity of the proteins had been determined previously, it served as a control protein for confirmation of the accuracy and rapidity of identification achievable by the method for identification of an unknown protein disclosed herein. [0196] The sequence-specific fragment ions generated were used to identify the protein (and thus the microorganism) by comparison against a database containing in silico fragment ions derived from protein sequences from bacterial genomic databases.
[0197] The USDA peak-matching algorithm alpha (α) which has the formula:
2 x (Number of peak matches)
USDAa Score = 100 x
(Number of peaks in the mass spectrum of the unknown protein + Number of peaks in the mass spectrum of known protein sequences)
was incorporated into the data analysis software as disclosed herein and was used to score/rank protein/microorganism identifications. The algorithm correctly identified the thioredoxin protein biomarker from nearly ~ 1400 possible bacterial proteins. The algorithm also gave comparable rankings in protein identifications as that obtained with a much more complicated p-value calculation (see e.g., Demirev et al. (2005) Anal Chem 77:7455). [0198] Protein identifications made using the USDA peak-matching mathematical algorithm were confirmed by error analysis as disclosed herein and also by residue specific analysis. As is illustrated below, the correctly identified protein exhibits only systematic error that is due to the inherent calibration error of the mass analyzer, whereas incorrect identifications exhibit random error caused by false "matches". Furthermore, correct identification is confirmed by residue specific analysis. Correct identifications as confirmed by residue specific analysis reveal an increase in the absolute value of the highest USDA peak matching score, as well as an increase in the difference between the highest USDA peak matching score and the second highest USDA peak matching score.
Example 5;
[0199] The following example illustrates that a correct protein identification made using the peak-matching mathematical algorithm disclosed herein is confirmed by analysis of the difference in m/z between the MS/MS fragment ions of the protein and their putative "matches" from a MS/MS in silico spectra. For a correct identification, of thioredoxin protein, a linear regression analysis fit of the data reveals only systematic error which is due to the inherent calibration error of the mass analyzer (see e.g., FIG. 9). In contrast, a linear regression analysis fit of the data for an incorrect identification of the protein thioredoxin exhibits random error caused by false "matches" (see e.g., FIG. 10).
[0200] FIG. 4 shows an MS spectrum (as displayed in the MALDI-TOF-TOF instrument software) of the extracted cell lysate of Campylobacter upsaliensis (strain RM3195) analyzed by MALDI-TOF-MS using sinapinic acid as the MALDI matrix. The protein biomarker ion at m/z 11138.9 was analyzed by tandem mass spectrometry. The MS/MS spectrum of protein biomarker ion at m/z 11138.9 is shown in FIG. 5.
[0201] FIG. 5 shows the MS/MS spectrum (as displayed in the MALDI-TOF-TOF instrument software) of the protein biomarker ion of Campylobacter upsaliensis (strain RM3195) at m/z 11138.9 analyzed on a MALDI-TOF-TOF-MS using sinapinic acid as the MALDI matrix. Prominent fragment ions are identified by their m/z, ion type and number and amino acid residues immediately adjacent to the site of polypeptide backbone cleavage giving rise to the fragment ion. As can be seen, most (if not all) of the fragment ions are the result of polypeptide backbone cleavage immediately adjacent to a D (aspartic acid) or E (glutamic acid) residues. This MS/MS data is then centroided (i.e. converted to ASCII format: m/z vs. absolute intensity) and exported for uploading to the USDA software. [0202] FIG. 6 shows an ASCII MS/MS spectrum (m/z vs. relative intensity as displayed in the USDA software window) of thioredoxin from Campylobacter upsaliensis (strain RM3195) previously displayed in FIG. 5. The MS/MS data in FIG. 5 was centroided (i.e. converted to ASCII format: m/z vs. absolute intensity), exported from the MALDI-TOF-TOF instrument software and imported to the MS/MS databases of the USDA software. The m/z and absolute intensity of MS/MS fragment ions are shown in the sidebar. [0203] FIG. 7 shows The "MS/MS To In Silico Comparison" search parameter table as displayed in the USDA mass spectrometry comparison software window. The user/operator defines the m/z range to be compared, the number of results to be displayed, the average molecular weight of the protein to be searched (with an associated molecular weight tolerance, e.g. ± 10 Da), the fragment ion m/z tolerance (in Th) and restrictions (if any) on residue-specific fragment ions, i.e. fragment ions generated from polypeptide cleavage immediately adjacent to specific amino acid residues. The absence of an entry in the "Residues" field indicates that all fragment ions generated from the polypeptide (protein) are to be included in the search. The user/operator can also select which scoring algorithm to use for analysis, i.e. USDA peak matching algorithm or the p-value algorithm (or both). The scores/identifications can also be ranked/sorted.
[0204] FIG. 8 shows the in silico MS/MS spectrum (as displayed in the USDA software window) of the protein thioredoxin of Campylobacter upsaliensis (strain RM3195). The in silico sequence was post-translationally modified (PTM) to remove the N-terminal methionine. In silico fragment ions m/z are shown in the sidebar. [0205] Table IA (below) displays the top five identifications of a protein biomarker of Campylobacter upsaliensis (strain RM3195) at m/z 11138.9 (as shown in FIG. 4) and analyzed by MS/MS using MALDI-TOF-TOF mass spectrometry (as shown in FIG. 5 and FIG. 6) and compared to all in silico MS/MS fragment ions of bacterial protein sequences having the same molecular weight as the biomarker (within ± 5 Da. This corresponded to 1409 in silico protein sequences). Table IA compares peak matching scores obtained using the USDAα peak matching algorithm to the p-value calculation known in the art. The protein biomarker had been identified previously by "bottom-up" proteomics techniques as thioredoxin (Fagerquist, C. K., 2007, J. Proteome Res., 6, 2539-2549). The top identification correctly identifies the protein biomarker and its source microorganism.
Figure imgf000045_0001
[0206] Table IB (below) displays the top five identifications of the same protein biomarker of Campylobacter upsaliensis (strain RM3195) at m/z 11138.9 (as shown in FIG. 4) and analyzed by MS/MS using MALDI-TOF-TOF mass spectrometry (as shown in FIG. 5 and FIG. 6) and compared to all 1409 in silico MS/MS fragment ions of bacterial protein sequences having the same molecular weight as the biomarker (within ± 5 Da). Table IB compares peak matching scores obtained using the USDAβ peak matching algorithm to the p-value calculation known in the art.
Figure imgf000046_0001
[0207] FIG. 9 shows a plot of fragment ion error (as displayed in the USDA software) as a function of the MS/MS fragment ion mass-to-charge (m/z) of the protein biomarker thioredoxin (from Campylobacter upsaliensis strain RM3195) and its "match" to the in silico fragment ions of thioredoxin of Campylobacter upsaliensis strain RM3195 (the highest scoring identification and the correct identification). Fragment ion error (Am/z) is defined here as the difference between m/z of an MS/MS fragment ion and the m/z of its putative in silico fragment ion "match". A red square represents a "match" whose in silico fragment ion was generated from a protein backbone cleavage site that is adjacent to a D, E or P residue. A black square represents a "match" whose in silico fragment ion was generated from a protein backbone cleavage site that is adjacent to only non-D,E,P residues. Note the high number (27) and percentage (87.1%) of "matches" that are associated with D,E,P residues supporting the correctness of the identification. A linear regression fit of the data indicates a correlation (R = 0.6438) between Am/z and MS/MS fragment ion m/z due to systematic error caused by calibration error of the mass analyzer. This systematic error confirms that this is a correct identification. [0208] FIG. 10 shows plot of fragment ion error (as displayed in the USDA software) as a function of the MS/MS fragment ion mass-to-charge (m/z) of the protein biomarker thioredoxin (from Campylobacter upsaliensis strain RM3195) and its "match" to the in silico fragment ions of carbon dioxide concentrating mechanism protein of Cyanothece strain ATCC 51142 (the second highest scoring identification and an incorrect identification). Fragment ion error (Am/z) is defined here as the difference between m/z of an MS/MS fragment ion and the m/z of its putative in silico fragment ion "match". A red square represents a "match" whose in silico fragment ion was generated from a protein backbone cleavage site that is adjacent to a D, E or P residue. A black square represents a "match" whose in silico fragment ion was generated from a protein backbone cleavage site that is adjacent to only non-D,E,P residues. Note the low number (5) and percentage (26.3%) of "matches" that are D,E,P-associated supporting that this is not the correct identification. A linear regression fit of the data indicates a very poor correlation (R = 0.0206) between Am/z and MS/MS fragment ion m/z, i.e. random statistical error. This random error supports that this is an incorrect identification.
[0209] Table 1C (below) displays the top five identifications of a protein biomarker of Campylobacter upsaliensis (strain RM3195) at m/z 11138.9 (as shown in FIG. 4) and analyzed by MS/MS using MALDI-TOF-TOF mass spectrometry (as shown in FIG. 5 and FIG. 6) compared to D,E,P-specific in silico MS/MS fragment ions of bacterial protein sequences having the same molecular weight as the biomarker (within ± 5 Da). This corresponded to 1409 in silico protein sequences. The protein biomarker had been identified previously by "bottom-up" proteomics techniques as thioredoxin (Fagerquist, C. K., 2007, J. Proteome Res., 6, 2539-2549). The top identification correctly identifies the protein biomarker and its source microorganism. Table 1 C compares peak matching scores obtained using the USDAα peak matching algorithm to the p-value calculation known in the art.
Figure imgf000048_0001
[0210] Table ID (below) displays the top five identifications of the same protein biomarker as in Table 1C of Campylobacter upsaliensis (strain RM3195) at m/z 11138.9 (as shown in FIG. 4) and analyzed by MS/MS using MALDI-TOF-TOF mass spectrometry (as shown in FIG. 5 and FIG. 6) compared to D,E,P-specific in silico MS/MS fragment ions of bacterial protein sequences having the same molecular weight as the biomarker (within ± 5 Da). This corresponded to 1409 in silico protein sequences. The protein biomarker had been identified previously by "bottom-up" proteomics techniques as thioredoxin (Fagerquist, C. K., 2007, J. Proteome Res., 6, 2539-2549). The top identification correctly identifies the protein biomarker and its source microorganism. Table ID compares peak matching scores obtained using the USDAβ peak matching algorithm to the p-value calculation known in the art.
Figure imgf000049_0001
[0211] Table 2A (below) displays the top five identifications of a protein biomarker of Campylobacter upsaliensis (strain RM3195) at m/z 12855.3 (as shown in FIG. 4) and analyzed by MS/MS using MALDI-TOF-TOF mass spectrometry and compared to ALL in silico MS/MS fragment ions of bacterial protein sequences having the same molecular weight as the biomarker (within ± 5 Da). This corresponded to 1315 in silico protein sequences. The protein biomarker had been identified previously by "bottom-up" proteomics techniques as ribosomal protein 50S L7/L12 (Fagerquist, C. K., 2007, J. Proteome Res., 6, 2539-2549). The top identification correctly identifies the protein biomarker and its source microorganism.
Figure imgf000050_0001
[0212] Table 2B (below) displays the top five identifications of a protein biomarker of Campylobacter upsaliensis (strain RM3195) at m/z 12855.3 (as shown in FIG. 4) and analyzed by MS/MS using MALDI-TOF-TOF mass spectrometry and compared to D,E,P- specific in silico MS/MS fragment ions of bacterial protein sequences having the same molecular weight as the biomarker (within ± 5 Da). This corresponded to 1315 in silico protein sequences. The protein biomarker had been identified previously by "bottom-up" proteomics techniques as ribosomal protein 50S L7/L12 (Fagerquist, C. K., 2007, J. Proteome Res., 6, 2539-2549). The top identification correctly identifies the protein biomarker and its source microorganism.
Figure imgf000051_0001
[0213] Table 3A (below) displays the top five identifications of a protein biomarker of Campylobacter upsaliensis (strain RM3195) at m/z 9298.3 (as shown in FIG. 4) and analyzed by MS/MS using MALDI-TOF-TOF mass spectrometry and compared to all in silico MS/MS fragment ions of bacterial protein sequences having the same molecular weight as the biomarker (within ± 5 Da). This corresponded to 1404 in silico protein sequences. The protein biomarker had been identified previously by "bottom-up" proteomics techniques as 10 kD chaperonin (Fagerquist, C. K., 2007, J. Proteome Res., 6, 2539-2549). The top identification correctly identifies the protein biomarker and its source microorganism.
Figure imgf000052_0001
[0214] Table 3B (below) displays the top five identifications of a protein biomarker of Campylobacter upsaliensis (strain RM3195) at m/z 9298.3 (as shown in FIG. 4) and analyzed by MS/MS using MALDI-TOF-TOF mass spectrometry and compared to D,E,P-specific in silico MS/MS fragment ions of bacterial protein sequences having the same molecular weight as the biomarker (within ± 5 Da). This corresponded to 1404 in silico protein sequences. The protein biomarker had been identified previously by "bottom-up" proteomics techniques as 10 kD chaperonin (Fagerquist, C. K., 2007, J. Proteome Res., 6, 2539-2549). The top identification correctly identifies the protein biomarker and its source microorganism.
Figure imgf000053_0001
Example 6
[0215] The following Example illustrates a "top-down" proteomic approach for protein/microorganism identification of foodborne pathogens. In particular the Example illustrates the identification of a protein biomarker (putative uncharacterized protein yahO) whose amino acid sequence is unique to E. coli O157:H7 strains and thus can be used to distinguish O157:H7 strains from non-O157:H7 strains. Further, the Example illustrates that if multiple microorganisms are present in a culture, it is possible to identify multiple microorganisms on the basis of identification of at least one unique protein biomarker from each microorganism. Indeed, even though a non-genomically sequenced bacterial strain may have extensive protein sequence homology to a closely-related genomically sequenced bacterial strain the bacterial strains may nonetheless have slight differences in protein amino acid sequence. These amino acid variations can change the overall MW of the protein as well as affect the m/z of fragment ions generated from protein fragmentation. Materials and Methods Origin and cultivation of E. coli strains
[0216] E. coli strains were preserved at -80 0C in Microbank™ Microbial Preservation System beads (Pro-Lab Diagnostics, Richmond Hill, Ontario, Canada). The strains were propagated using a bead and streaking for isolation on LB agar (Becton Dickinson, Sparks MD). The inoculated agar plates were incubated overnight at 37 0C in normal atmosphere. Three E. coli strains were used in this study: two O157:H7 strains (EDL-933 and a Salinas strain) and one non-0157:H7, non-pathogenic E. coli strain. The genomically sequenced strain E. coli O157:H7 strain EDL-933 (designated RM1272 in our strain collection) was originally isolated from raw hamburger associated with hemorrhagic colitis outbreak and binds to anti-0157 and anti-H7 MAbs. The EDL-933 strain was generously provided by Jim Keen, Clay Center, Nebraska. The other O157:H7 strain (designated RM5603 in our strain collection) was isolated from a water sample taken from the Salinas River (Salinas, CA) in 2006.
[0217] RM5603 is a negative for shiga toxin 1, positive for shiga toxin 2, positive for the intimin gene (eae) and highly positive by PCR. In addition, RM5603 was analyzed by multi- locus variable-number tandem repeat analysis (MLVA). The non-pathogenic E. coli strain RM3061 was isolated from Romaine lettuce as part of a USDA microbiological survey of produce conducted in 2002. This sample was analyzed by Biolog microbial ID (Hayward, CA) and identified as a non-pathogenic E. coli.
Protein biomarker extraction and analysis
[0218] Bacterial cells were harvested and their proteins extracted as described in detail previously. Briefly, a 1 μL loop of bacterial cells were bead-beat for 1 minute in 0.5 mL of extraction solution (67% water, 33 % acetonitrile and 0.1 % TFA) with 40 mg of 0.1 mm zirconia/silica beads (BioSpec Products Inc., Bartlesville, OK). After bead-beating, the sample was centrifuged at 10,000 rpm for 5 minutes.
MALDI-TOF-TOF-MS analysis
[0219] Cell lysate/protein extract samples were analyzed using a 4800 TOF-TOF™ proteomics analyzer (Applied Biosystems, Foster City, CA) as described in detail in a previous report. Briefly, equal aliquot volumes of sample extraction supernatant and a saturated solution of MALDI matrix were mixed. A 0.5 μL aliquot of this mixture was deposited onto a stainless steel target having 384 target spots. Two MALDI matrices were utilized for this study: 3,5-dimethoxy-4-hydroxycinnamic acid (sinapinic acid, Mr = 224.21 Da) and α-cyano^-hydroxycinnamic acid (HCCA, Mr = 189.17 Da ). The mass spectrometer is equipped with a pulsed solid-state YAG laser (repetition rate: 200 Hz, λ = 355 nm, pulse width: 5 nsec). Samples were analyzed in both linear (MS analysis) and reflectron-modes (MS/MS analysis). The instrument was operated for detection of only positively charged ions. The instrument was externally calibrated in linear mode using bovine insulin (MW = 5733.58 Da), E. coli thioredoxin (MW = 11673.47 Da) and horse heart apomyoglobin (MW = 16,951.55 Da). The instrument was externally calibrated in reflectron- mode using the y-type fragment ions of ghV-fibrino-peptide B (MW = 1570.60) at m/z 175.120 and 1441.635.
[0220] For MS analysis, laser desorbed ions were accelerated from the source at 20 kV after delayed ion extraction for improved ion focussing. Ions were separated over an effective field free length of 1.5 m before striking a multichannel plate detector operated at 2.190 kV. For MS/MS analysis, ions were accelerated from the source at 8.0 kV after delayed extraction. Ions were separated in a field free region between the source and the collision cell. A timed ion selector (TIS) before the collision cell deflects (mass-selects) ions on the basis of arrival time so that only ions with a pre-selected m/z (i.e. arrival time) pass through the TIS. The TIS window was typically operated at ± 100 Da for MS/MS analysis. Ions passing through the TIS were decelerated to 1.70 kV prior to entry into a floating collision cell at 2.0 kV. Ions were fragmented by post-source dissociation (PSD) at higher than normal laser fluence. Ions exiting the collision cell were re-accelerated to 15 kV. An ion gate, after the second acceleration region, was used to suppress the un-fragmented protein ion signal. A two-stage reflectron mirror assembly (mirror 1 : 10.910 kV, mirror 2: 18.750 kV) separates and deflects the fragment ions toward the reflectron multichannel plate detector also operated at 2.190 kV.
[0221] MS data was collected and summed from 1000-2000 laser shots which provided excellent signal-to-noise (S/N). For MS/MS data, because of low the fragmentation efficiency of singly charged protein ions, 30,000 to 40,000 laser shots were collected and summed in order to improve S/N. At 200 Hz laser repetition rate this required 2-3 minutes data acquisition from a single spot. The ultrafast MALDI target rastering allowed higher than normal laser fluence, required for protein ion fragmentation by PSD, without exhausting the sample spot. [0222] Raw MS and MS/MS data were processed using the instrument software (Data Explorer® Software, Version 4.9). MS data were subjected to noise filtering (correlation factor = 0.7). Raw MS/MS data were subjected to an advanced baseline correction (peak width = 32, flexibility = 0.5, degree = 0.1) followed by noise removal (std. dev. = 2) followed by a Gaussian smooth (filter width = 31 points). Processed MS and MS/MS spectra were centroided and exported as an ASCII file (m/z vs. absolute intensity). MS and MS/MS ASCII files were uploaded to their respective databases in the USDA software.
Results
E. coli O157:H7 strain EDL-933
[0223] FIG. 11 shows the spectrum from MALDI-TOF-TOF-MS analysis of the extracted cell lysate of E. coli O157:H7 strain EDL-933 (genomically sequenced by Perna and coworkers in 2001, Perna, N.T. et al. (2001) Nature. 409(6819):529-533). The MS data was collected in linear mode with HCCA MALDI matrix.
[0224] FIG. 12 shows the MS/MS spectrum, as viewed in the instrument software, of the protein biomarker ion a m/z 7705.6 shown in FIG. 11. Prominent fragment ions are identified by their m/z and ion type/number and amino acid residues adjacent to the site of polypeptide backbone cleavage for the protein amino acid sequence of the top identification shown in Table 4: putative uncharacterized protein yahO of the pathogenic E. coli O157:H7 strain EDL-933. As can be seen, many of the fragment ions are the result of polypeptide cleavage adjacent to aspartic (D) and/or glutamic acid (E) residues. The MS/MS data in FIG. 12 was centroided, exported from the instrument software as an ASCII formatted file (m/z vs. absolute intensity) and uploaded to the USDA software for analysis.
[0225] Table 4 (below) shows the top five identifications of the protein biomarker of E. coli O157:H7 strain EDL-933 at m/z 7705.6 (shown in FIG. 11) and analyzed by MS/MS using MALDI-TOF-TOF mass spectrometry and compared to all in silico fragment ions of bacterial protein sequences having the same MW as the biomarker within a tolerance of ± 5 Da. The top identification of both the USDA peak matching algorithm β and the p-value calculation correctly identified the source microorganism. The protein biomarker was identified as the putative uncharacterized protein yahO. The scores of the 1st and 2nd identification are significantly different compared to the other runner-up identifications. This is reflective of the very high quality of this MS/MS spectrum. In addition, it was possible to distinguish between the pathogenic E. coli O157:H7 strain EDL-933 and the nonpathogenic E. coli strain K- 12 with this protein biomarker. As can be seen, the USDA peak matching algorithm β was approximately three times faster than the p-value calculation in terms of computation speed.
Figure imgf000057_0001
[0226] FIG. 13 shows the primary amino acid sequence of the putative uncharacterized protein yahO of the pathogenic E.coli O157:H7 strain EDL-933 strain (SEQ ID NO: l)and the UPF0379 protein yahO of the non-pathogenic E. coli strain K-12 strain (SEQ ID NO:2). Both proteins have a 21 residue N-terminal signal peptide (boxed). The two proteins are different by two amino acid substitutions. A F o L substitution at residue in the signal peptide and a D o N substitution that results in a protein MW difference of 1 Da in the mature protein. Such slight differences in protein biomarker MW are difficult to detect by MALDI-TOF-MS, however sequence-specific fragmentation by MS/MS allows these two proteins (and their source microorganisms) to be differentiated.
[0227] Identification of the putative uncharacterized protein yahO of is. coli O157:H7 strain EDL-933 was facilitated due to the high sequence homology to UPF0379 protein yahO of E. coli strain K-12. The putative uncharacterized protein yahO of E. coli O157:H7 strain EDL-933 currently in Expasy databases (>tr|Q8X699|Q8X699_ECO57) is displayed as the unprocessed protein sequence with no indication that this protein might possess a signal peptide. In consequence, this protein was not retrieved during the initial Tagldent protein MW search. However, the search did retrieve UPF0379 protein yahO of E. coli K-12 (>sp|P75694|YAHO_ECOLI) which possessed a 21-residue N-terminal signal peptide. The signal peptide-containing yahO sequence of E. coli K-12 (and other signal-peptide containing proteins) was identified from its larger file size. The signal peptides were removed from the in silico sequences, processed and uploaded by methods known in the art. Initially, the top identification of MS/MS of the m/z 7705.6 biomarker ion (FIG. 12) oϊE. coli O157:H7 strain EDL-933 was UPF0379 protein yahO oϊE. coli strain K-12 with a 21-residue N-terminal signal peptide and no other "runner up" identifications of E. coli among the top 5 identifications. Working on the assumption that the Expasy database may not indicate that yahO protein of is. coli O157:H7 strain EDL-933 possessed a signal peptide, a targeted search was conducted for the yahO protein and E. coli O157:H7 strain EDL-933 which resulted in the identification of an unprocessed sequence of putative uncharacterized protein yahO E. coli O157:H7 strain EDL-933. This sequence was processed to remove twenty-one residues from the N-terminus. The FastA file was then processed by methods known in the art and uploaded to the USDA software that in this instance utilized the USDA peak matching algorithm β. The MS/MS data was re-analyzed and the results are displayed in Table 4. Further inspection of Expasy database revealed nine other strains of E. coli O157:H7 whose yahO unprocessed sequence is identical to the yahO sequence of strain EDL-933. They are: EC4196, EC4113, EC4076, EC4401, EC4486, EC4501, EC869, EC508 and EC4115/EHEC. Thus, it would not be possible to distinguish between different strains of is. coli O157:H7 using only the yahO protein biomarker.
[0228] Although there is only a one residue difference (N <-> D) between the amino acid sequences of the mature yahO protein of E. coli strain K-12 and E. coli O157:H7 strain EDL- 933 (SEQ ID NO: 1) (FIG. 13), this difference involves an aspartic acid residue substitution. Aspartic acid residues facilitate fragmentation of singly protonated protein ions. Without being bound by theory it is believed that fragmentation is facilitated because the short acidic side chain allows transfer of its acidic proton to the polypeptide backbone thereby increasing the fragmentation efficiency of the polypeptide backbone. The other consequence of the N <-> D substitution is that the difference in mass of the mature yahO proteins is only 1 Da. Such slight differences in protein biomarker MW are nearly impossible to detect by MALDI- TOF-MS, however sequence-specific fragmentation by MS/MS allows these two yahO proteins (and their source microorganisms) to be differentiated.
[0229] It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims.
Computer Program Listing Appendix
<?xml version="1.0" encoding="UTF-8" ?>
<Form version="l.3" type="org. netbeans.modules.form.forminfo. J Frame Fo rmlnfo"> <Properties>
<Property name="defaultCloseOperation" type="int" value="3"/>
<Property name="title" type="java.lang. String" value="lnsilico Data Uploader"/> </Properties> <Syntheti cProperti es>
<SyntheticProperty name="formSizePolicy" type="int" value="l"/> </Syntheti cProperti es> <AuxVal ues>
<AuxValue name="FormSettings_generateMnemonicsCode" type="java.lang. Boolean" value="false"/>
<AuxValue name="FormSettings_layoutCodeTarget" type=" Java. lang. Integer" value="l"/>
<AuxValue name="FormSettings_listenerGenerationStyle" type=" Java. lang. Integer" value="0"/>
<AuxValue name="FormSettings_variablesLocal " type=" Java. lang. Boolean" value="false"/>
<AuxVal ue name="FormSetti ngs_vari abl esModi f i er" type="java.1 ang . Integer" value="2"/> </AuxVal ues>
Figure imgf000060_0001
Component i d="j Scrol l Panel" pref="251" max="32767" attri butes="O"/> <EmptySpace max="-2 " attri butes="O"/> </Group> </Group>
</DimensionLayout> </Layout> <SubComponents>
<Component class="javax. swing. JLabel " name="j Label 1"> <Properties>
<Property name="text" type="Java. lang. String" value="Enter a Di rectory: "/> </Properties> </Component>
<Component class="javax. swing. JTextField" name="txt_Di r"> <Properties>
<Property name="text" type="java. lang. String" value="C:\"/> </Properties> </Component>
<Contai ner class="javax. swi ng. JScroll Pane" name="jScroll Panel"> <AuxVal ues>
<AuxValue name="autoScroll Pane" type="java. lang. Boolean" value="true"/> </AuxValues>
<Layout class="org. netbeans.modules.form.compat2.layouts. support. JScroll PaneSupportl_ayout"/> <SubComponents>
<Component cl ass="javax. swi ng. JTextArea" name="txt_Status"> <Properties>
<Property name="columns" type="int" value="20"/> <Property name="rows" type="int" value="5"/> </Properties> </Component> </SubComponents> </Container>
<Component class="javax. swing. JButton" name="btn_Upload"> <Properties>
<Property name="text" type="java. lang. String" value="Upload Files"/> </Properties> <Events>
<EventHandler event="mouseClicked" Ii stener="Java. awt . event .MouseLi stener" parameters="Java. awt . event . MouseEvent" handl er="btn_UploadMouseCl i cked"/>
</Events> </Component>
<Component class="javax. swi ng.3 ProgressBar" name="pb_upload"> </Component> </SubComponents> </Form>
* InSilicoUpload. Java
*
* Created on June 10, 2008, 7:37 AM
Vc / /VcVc
* ©author Brandon Garbus */ import com. sun. jmx.snmp. tasks. Task; import javax. swing.*; import com.mysql . jdbc. Statement; import Java. sql . *; import java.io. File; import java.io. BufferedReader ; import java.io. FileReader ; import Java. util . *; public class InSilicoUpload extends javax. swing.3 Frame { public Connection myConn; public Java. sql .Statement stmt; private Task runCompare;
/** Creates new form InSilicoUpload */ public InSilicoUpload O { initComponentsO ;
/** This method is called from within the constructor to
* initialize the form.
* WARNING: Do NOT modify this code. The content of this method is
* always regenerated by the Form Editor.
*/
// <edi tor-fold defaultstate="col lapsed" desc=" Generated Code ">//GEN-BEGIN : i ni tComponents private void initComponentsO { j Label 1 = new javax. swing. J Label Q ; txt_Di r = new javax. swing. JTextFi eld (); jScrollPanel = new javax. swing. JScroll Pane() ; txt_Status = new javax. swing. JTextArea() ; btn_Upload = new javax. swing. J Button (); pb_upload = new javax. swing. JProgressBarO ; setDef aul tCl oseOpe rati on ( j avax . swi ng . Wi ndowConstants . EXIT_ON_CLOSE) ; setTitleC'lnsilico Data Uploader"); jLabell. setText("Enter a Directory:"); txt_Di r . setText ("C : \\") ; txt_Status . setCol umns (20) ; txt_Status . setRows (5) ; jScrollPanel. setviewportview(txt_Status) ; btn_upload.setτext("Upload Files"); btn_Upload . addMouseLi stener (new Java. awt . event . MouseAdapter () { public void moused i eked (Java. awt. event. MouseEvent evt) { btn_uploadMouseClicked(evt) ;
}); javax. swing. GroupLayout layout = new javax. swing.GroupLayout(getContentPaneQ) ; getContentPaneO . setLayout (layout) ; Tayout.setHorizontalGroupC
1 ayout . createParal 1 el Group (javax . swi ng . GroupLayout .Al i gnment . LEADING) . addGroupO ayout . createSequenti al GroupO . addContai nerGapO
. addGroupO ayout . createParal 1 el Group (javax . swi ng . GroupLayout .Al i gnment . LEADING)
. addComponent(jScroH Panel, javax. swi ng. GroupLayout .Alignment .TRAILING, javax. swi ng. GroupLayout . DEFAULT_SIZE, 518, Short.MAX_VALUE)
.addGroupOayout.createSequential GroupO . addComponentCjLabel 1)
. addPreferredGap (javax. swi ng. LayoutStyle. ComponentPlacement. RELATED)
. addComponent (txt_Di r , javax. swing. GroupLayout. DEFAULT_SIZE, 428, Short. MAX_VALUE))
. addGroup (javax. swi ng. GroupLayout .Alignment .TRAILING, layout.createSequentialGroupO
. addComponent (pb_upi oad, javax. swing. GroupLayout. DEFAULT_SIZE, 421, Short. MAX_VALUE)
. addPreferredGap (javax. swi ng. LayoutStyle. ComponentPlacement. RELATED)
. addComponent(btn_Upload))) . addContai nerGapO)
1 ayout . setverti cal Group (
1 ayout . createParal 1 el Group (javax . swi ng . GroupLayout .Al i gnment . LEADING) .addGroup (layout.createSequentialGroupO . addContai nerGapO
. addGroupO ayout . createParal 1 el Group (javax . swi ng . GroupLayout .Al i gnment . BASELINE)
. addComponent(jLabel 1)
. addComponent (txt_Di r , javax. swing. GroupLayout. PREFERRED_SIZE, javax. swing. GroupLayout. DEFAULT_SIZE, javax. swing. GroupLayout. PREFERRED_SIZE))
. addPreferredGap (javax. swi ng. LayoutStyle. ComponentPlacement. RELATED)
. addGroupO ayout . createParal 1 el Group (javax . swi ng . GroupLayout .Al i gnment . LEADING , false)
. addComponent (pb_upi oad, j avax . swi ng .GroupLayout . DEFAULT_SIZE , j avax . swi ng .GroupLayout . DEFAULT_SIZE , Short. MAX_VALUE)
. addComponent (btn_Upl oad, javax. swi ng. GroupLayout . DEFAULT_SIZE, javax. swi ng. GroupLayout . DEFAULT_SIZE, Short. MAX_VALUE))
.addGap(12, 12, 12)
. addComponent (j Sc roll Panel, javax. swing. GroupLayout. DEFAULT_SIZE, 251, Short. MAX_VALUE)
. addContai nerGapO) packQ; }// </edi tor-fol d>//GEN-END : i ni tComponents private void btn_uploadMouseCli eked (java.awt. event. MouseEvent evt) {//GEN-FIRST :event_btn_uploadMouseCli eked btn_upl oad. setEnabled (false) ; runCompare = new Task() ; runCompare . executeO ; }//GEN-LAST: event_btn_upl oadMouseCl i cked
* @param args the command line arguments public static void main (String args[]) {
Java, awt . EventQueue. i nvokel_ater(new RunnableO { public void run() { new lnSilicoUploadO . setvisible(true) ;
});
// Variables declaration - do not modi fy//GEN-BEGIN: variables private javax. swing. J Button btn_Upload; private javax. swing. J Label j Label 1; private javax. swing. JSc roll Pane jScroll Panel; private javax. swing. JProgressBar pb_upload; private javax. swing. JTextFi eld txt_Dir; private javax. swing. JTextArea txt_Status;
// End of variables declaration//GEN-END: variables class Task extends Swingworker<void, void> {
©Override public Void dolnBackgroundO {
//First get the list of files
File mfile = new File(txt_Di r.getτext() . toLowerCaseO) ;
File[] mfiles; mfiles = mfile.listFilesO ; if (mfiles. length == 0) { txt_Status. setτext("τhere are no files in this directory. Please choose a valid directory."); return null ;
}
//Connect to the database dbConnectO ; pb_upload. setst ring Pain ted (true) ; pb_upload. setMaximum(mfiles . length) ; pb_upload. setMinimum(O) ; pb_upload. setvalue(O) ; txt_Status.setτext(txt_Status.getτext() + "\nuploading Files:"); for(int i = 0; i < mfiles. length; i++) { try { txt_Status.setτext(txt_Status.getτext() + "\n" + mfiles[i] . toStringO) ;
//Now we want to open the file
BufferedReader in = new BufferedReader( new FileReader(mfiles[i])) ;
String In; double mw;
String aa;
//Read the first line
In = i n . readLi ne() ; aa = in. readLi neO .trim () ; mw = Double. valueOf(in. readLi ne()) ;
//Parse out the first line with ACCSSlON Number, Protein, Strain, Notes
String [] idat = ln.split(" ") ; //Parse the strain data
//idat[l] contains the strain. This removes the sp. Identifier from the strain.
//It means species and is redundant and annoying that people put that in the FASTA files idat[l] = idat[l].replaceAll("sp.", "");
//Parse the strain data. Seperate everythign by a space. Nothing too complicated
String [] strain = idat[l] . split(" ") ;
//Seperate the protein and accession number idat = idat[O] .split(" ") ;
String prot = ""; for (int k = 1; k < idat. length; k++) { prot += idat[k] + " "; } prot = prot. trim() ;
//Array to store the mass list from the file ArrayList mass = new ArrayListO; int si en = strain. length;
//if the strain is too long add extra stuff to subtype/other if (si en > 4) { for (int z = 4; z < strain. length; z++) { strain [3] = strain [3] + " " + strain[z] ; slen = 4; }
String genus = "", species = "", subspecies = "", subtype = ""; switch (si en) { case 4: subtype = strain [3]; case 3: subspecies = strain[2]; case 2: species = strain[l]; case 1: genus = strain [0] ;
int i genus, i species, i subspecies, i subtype;
//Check and see if a strain exists igenus = insertNewGenus(genus) ; i species = insertNewSpecies (species) ; isubspecies = insertNewSubspecies(subspecies) ; i subtype = insertNewSubtype(subtype) ;
String slctStr = "SELECT strain_id FROM strain WHERE genus_id="
+ igenus + " AND species_id=" + i species + " AND subspecies_id=" + isubspecies + " AND subtype_id=" + i subtype; int strainid, msmsid;
ResultSet myRS = getRS(slctStr) ; if (myRS. next ()) { strainid = myRS.getInt("strain_id") ; } else { //the strain does not exist, make a new one and use the new id myRS. close () ;
//Insert the strain ID, now get it the same way as above
String insrtStrain; insrtStrain = "INSERT INTO strain (genus_id, species_id, subspecies_id, subtype_id) VALUES(" + i genus + "," + i species + "," + i subspecies + "," + i subtype +")"; stmt . executeUpdate(i nsrtStrai n) ; stmt.closeO ; myRS = getRS(slctStr); myRS. next() ; strainid = myRS.getInt("strain_id") ; myRS.closeO ;
String insStr = "INSERT INTO in_silico(date, identification, strain_id, average_mw, protein, notes, aa_seq) VALUES(CURDATEO , 1 " + idat[0] + '" ," + strainid + "," + mw + ", '" + prot + '" , ' Filename: "+ mfilesfi] .getNameO + "' '" + aa + ")"; stmt . executeUpdate (i nsSt r , j ava . sql . Statement . RETURN_GENERATED_KEYS) ; myRS = stmt.getGeneratedKeysO ; myRS. next() ; msmsid = myRS.getlnt(l) ; myRS.closeO ; while ((In = in. readLineO) != null) {
//Splits the line using comma deli mi tor. First is m to z, second is ion type, third is residue
String [] mzln = In. split(" , ") ;
String tempi InStr = "INSERT INTO in_silico_data (in_silico_id, mass, intensity, iontype, residue) VAl_UES("; templlnStr += msmsid + "," + mzln[0] + ",100, "' + mzln[l] .trim() + "V" + mzln[2] + '")"; stmt. executeUpdate (templlnStr) ;
}
//Update Progress Bar pb_upload. setvalue( i + 1 );
} catch (SQLExcepti on sqle) { txt_Status. setτext(txt_Status.getτext() + "\nAn Error Occurred! !"); txt_Status.setτext(txt_Status.getτext() + sqle. toStringO) ; return null ; } catch (Exception e) { txt_Status.setτext(txt_Status.getτext() + "\nAn Error Occurred! !"); txt_Status. setτext(txt_Status.getτext() + e. toStringO) ; return null ;
} return null ; }
©Override public void done O { dbCloseO; btn_upload. setEnabled(true) ; }
} public void dbConnectO { try { txt_Status.setText ("Connecting...");
String url = "jdbc:mysql : //10.200.38.109: 3306/psm" ;
//String url = "jdbc:mysql I : //local host/psm";
Class.forNameC'com.mysql . jdbc. Driver") ;
Drive rManager . setLogi nτimeout(120) ; myConn = DriverManager .getConnection(url , "maldiuser" , "*!tOF2"); txt_Status. setτext(txt_Status.getτext() + "\nConnected Successfully!");
} catch (SQLException e) { return; } catch (Exception e) { return; } public Java. sql . ResultSet getRS(String myStmt) {
//Handles all necessarry code for creating a record set
Java. sql . ResultSet myRS; myRS = null ;
//Exit out if there is no connection if (myConn == null) {return null ;} try { stmt = myConn. createStatement(ResultSet. FETCH_FORWARD, Resul tSet . CONCUR_UPDATABLE) ; myRS = stmt.executeQuery(myStmt) ;
}catch (SQLException e) { e. printStackTraceO ; }catch (Exception e) { e. printStackTraceO ; }finally { if (myRS!=null) { return myRS;
}else { return null ;
}
} public int dbCloseO { txt_Status.setτext(txt_Status.getτext() + "\nConnection Closed."); if (myConn != null) { try {myConn. closeO ;} catch(Exception e) {e. printStackTraceO ;} return 0;
} public int insertNewGenus(String genusname) { try { //Fi rst check to see i f the name i s al ready i n the db
Resul tSet myRS = getRS("SELECT * FROM genus WHERE name = ' " + genusname
+ );
//if it is return the id if (myRS. next ()) { i nt i d = myRS . getlnt("genus_i d") ; myRS . cl oseO ; stmt . cl oseO ; return i d ;
} myRS.closeO ; stmt.closeO ;
String instStmt; instStmt = "INSERT INTO genus (name) VALUESC" + genusname + '")"; stmt = myConn.createStatementO; stmt.executeupdate(inststmt) ;
ResultSet myrRS = stmt.getGeneratedκeys() ; myrRS. next() ; int id = myrRS. getlnt(l) ; myrRS. closeO ; stmt.closeO ; return id;
} catch (SQLException e) { return -1; } catch (Exception e) { return -1; } public int insertNewSpecies (String speciesname) { try {
//First check to see if the name is already in the db ResultSet myRS = getRS("SEl_ECT * FROM species WHERE name = '" + speciesname + " ' ") ;
//if it is return the id if (myRS. next ()) { int id = myRS.getlnt("species_id") ; myRS.closeO ; stmt.closeO ; return id;
} myRS.closeO ; stmt.closeO ;
String instStmt; instStmt = "INSERT INTO species (name) VALUESC" + speciesname + '")"; stmt = myConn.createStatementO; stmt.executeupdate(inststmt) ;
ResultSet myrRS = stmt.getGeneratedκeys() ; myrRS. next() ; int id = myrRS. getlnt(l) ; myrRS. closeO ; stmt.closeO ; return id; } catch (SQLException e) { return -1; } catch (Exception e) { return -1; } } public int insertNewSubspecies (String subspeciesname) { try {
//First check to see if the name is already in the db ResultSet myRS = getRS("SEl_ECT * FROM subspecies WHERE name = '" + subspeciesname + "'");
//if it is return the id if (myRS. next ()) { int id = myRS.getlnt("subspecies_id") ; myRS.closeO ; stmt.closeO ; return id;
} myRS.closeO ; stmt.closeO ;
String instStmt; inststmt = "INSERT INTO subspecies (name) VALUESC" + subspeciesname +
J J stmt = myConn.createStatementO; stmt.executeupdate(inststmt) ;
ResultSet myrRS = stmt.getGeneratedκeys() ; myrRS. next() ; int id = myrRS. getlnt(l) ; myrRS. closeO ; stmt.closeO ; return id; } catch (SQLException e) { return -1; } catch (Exception e) { return -1; } public int insertNewSubtype(String othername) { try {
//First check to see if the name is already in the db ResultSet myRS = getRS("SEl_ECT * FROM subtype WHERE name = '" + othername + );
//if it is return the id if (myRS. next O) { int id = myRS.getlnt("subtype_id") ; myRS.closeO ; stmt.closeO ; return id;
} myRS.closeO ; stmt.closeO ;
String instStmt; instStmt = "INSERT INTO subtype (name) VALUESC" + othername + "')"; stmt = myConn.createStatementO; stmt.executeupdate(inststmt) ;
ResultSet myrRS = stmt.getGeneratedκeys() ; myrRS. next() ; int id = myrRS. getlnt(l) ; myrRS. closeO ; stmt.closeO ; return id; } catch (SQLException e) { return -1; } catch (Exception e) { return -1;
} <?xml version="1.0" encoding="UTF-8"?>
<!-- You may freely edit this file. See commented blocks below for -->
<!-- some examples of how to customize the build. -->
<!-- (if you delete it and reopen the project it will be recreated.) -->
<project name="lnsilicoupload" default="default" basedir=".">
<description>Builds, tests, and runs the project lnSilicoUpload.</description>
<import file="nbproject/build-impl .xml "/>
<! --
There exist several targets which are by default empty and which can be used for execution of your tasks. These targets are usually executed before and after some main targets. They are:
-pre-init: called before initialization of project properties -post-init: called after initialization of project properties -pre-compile: called before javac compilation -post-compile: called after javac compilation -pre-compi 1 e-si ngl e : called before javac compilation of single file -post-compi 1 e-si ngl e : called after javac compilation of single file -pre-compi 1 e-test : called before javac compilation of JUnit tests -post-compi 1 e-test : called after javac compilation of JUnit tests -pre-compi 1 e-test-si ngl e : called before javac compilation of single JUnit test
-post-compile-test-single: called after javac compilation of single JUunit test
-pre-jar : called before JAR building
-post-jar: called after JAR building
-post-clean: called after cleaning build products
(Targets beginning with '-' are not intended to be called on their own.) Example of inserting an obfuscator after compilation could look like this:
<target name="-post-compile">
<obfuscate>
<fileset di r="${build. classes. di r}"/>
</obfuscate> </target>
For list of available properties check the imported nbproject/build-impl .xml file.
Another way to customize the build is by overriding existing main targets. The targets of interest are:
-1 nii t-macrodef-javac : defines macro for javac compilation -i,n,,iit-macrodef-junit: defines macro for junit execution -i ni t-macrodef-debug : defines macro for class debugging -i ni t-macrodef-Java: defines macro for class execution -do-jar-wi th-mani fest : JAR building (if you are using a manifest) -do-jar-wi thout-mani fest : JAR building (if you are not using a manifest) run. execution of project
-javadoc-build: Javadoc generation test-report: JUnit report generation
An example of overriding the target for project execution could look like this:
<target name="run" depends="lnSilicoUpload-impl . jar">
<exec dir="bin" executable="launcher .exe"> <arg file="${dist. jar}"/>
</exec> </target>
Notice that the overridden target depends on the jar target and not only on the compile target as the regular run target does. Again, for a list of avai 1 abl e properties which you can use, check the target you are overriding in the nbproject/build-impl .xml file.
-->
</project>
<%@page contentType="text/html "%>
<%@page pageEncodi ng="UTF-8"%>
<%--
The taglib directive below imports the JSTL library, if you uncomment it, you must also add the JSTL library to the project. The Add Library... action on Libraries node in Projects view can be used to add the JSTL 1.1 library.
<%@taglib uri="http://java. sun.com/jsp/jstl/core" prefix="c"%>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
<head>
<meta http-equiv="Content-Type" content="text/html ; charset=UTF-8"> <title>JSP Page</title> </head> <body>
<jsp: useBean id="nln" class="psm.gene. nucelotideinsert" scope="session"/> <jsp:useBean id="dbBean" class="psm.db.dbAccess" scope ="session"/> <% dbBean . dbConnect ("genel i st") ; if (nln.insertNucleotide(request, request. getParameter("filetype") , dbBean) 0) { out.writeC'lnsert successfull ! ") ; } else { out.writeC'lnsert failed, please check and make sure the file extension matches what you selected. <br>You may also want to make sure that the locus has already been inserted into the database.") dbBean. dbCloseO ;
%>
</body> </html>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
<head>
<meta http-equiv="Content-Type" content="text/html ; charset=UTF-8">
<title>JSP Page</title> </head> <body>
<hl>JSP Page</hl>
<form method=post action="insernucleotidedataconfi rm. jsp" enctype="MULTIPART/FORM-DATA">
<table> <tr>
<td>
<input type=file name="aantfile"> </td> </tr> <tr>
<td>
<i nput type=" radi o" name="fi l etype" val ue="AA">AA <i nput type=" radi o" name="fi l etype" val ue="NT">NT </td> </tr> <tr>
<td>
<input type="submit" value="Send"> </td> </tr> </table> </form>
</body> </html>
<%@page contentType="text/html "%>
<%@page pageEncodi ng="UTF-8"%>
<%--
The taglib directive below imports the JSTL library, if you uncomment it, you must also add the JSTL library to the project. The Add Library... action on Libraries node in Projects view can be used to add the JSTL 1.1 library.
<%@taglib uri="http://Java. sun.com/jsp/jstl/core" prefix="c"%>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
<head>
<meta http-equiv="Content-Type" content="text/html ; charset=UTF-8">
<title>JSP Page</title> </head> <body>
<form> <table> <tr>
<td>
Locus:
</td>
<td>
<input type="text" name="locus">
</td> </tr> <tr>
<td>
Strain:
</td>
<td>
<input type="text" name="strain">
</td> </tr> <tr>
<td>
Genus:
</td>
<td>
<input type="text" name="genus">
</td> </tr> <tr>
<td>
Species:
</td>
<td>
<i nput type="text" name="speci es">
</td> </tr> <tr>
<td>
Location:
</td>
<td>
<i nput type="text" name="l ocati on">
</td> </tr> <tr>
<td> Location 2:
</td>
<td>
<i nput type="text" name="l ocati on2 ">
</td> </tr> <tr>
<td>
Product:
</td>
<td>
<input type="text" name="product">
</td> </tr> <tr>
<td>
Notes:
</td>
<td>
<input type="text" name="notes">
</td> </tr> </table> </form>
</body> </html>
Gothic}
;"
p;</td> g
Figure imgf000076_0001
<td align="left" valign="top"x/td> </tr> <tr>
<td style="vertical -align: top; text-align: left; width: 80px; ">&nbsp; </td> <td style="color: rgb(255, 102, 0); font-weight: bold;" colspan="l" rowspan="2" align="left" valign="top"xbigxbigxfont si ze="+l"xbi gxbi g>&nbsp ; &nbsp ; $τiτi_E$</bi gx/bi gx/f ontx/bi gx/bi gx/td>
<td align="left" valign="top"x/td> </tr> <tr>
<td align="left" valign="top">&nbsp; </td>
<td align="left" valign="top"x/td> </tr> </tbody> </table> </td> </tr> </tbody> </table> <br> </td>
<td style="vertical -align: top;">
<table style="text-align: left; width: 100%;" border="0" eel 1 paddi ng="3" eel 1 spaci ng="3"> <tbody> <tr>
<td style="vertical -align: top; text-align: left;"xspan style="font-family: Arial Black; "x/spanximg style="width: 385px; height: 27px;" alt="Produce Safety and Microbiology" src="images/psm.gif"x/td> </tr> <tr>
<td style="vertical -align: top; text-align: left; ">&nbsp;</td> </tr> <tr align="center">
<td style="vertical -align: top ; "xbi gxbi g>wel come&nbsp ; $USERNAME$ ! </bi gx/bi gx/td> </tr> <tr align="center">
<td style="vertical -align: top;">The strain file was last updated $l_ASTDATE$</td>
</tr> </tbody> </table> </td> </tr> <tr>
<td colspan="2" rowspan="l" align="undefined" val i gn="undef i ned">
<table style="text-align: left; width: 100%;" border="0" eel 1 paddi ng="0" eel 1 spaci ng="0"> <tbody> <tr>
<td style="vertical -align: top; text-align: left; width: 210px;" backg round="i mages/1 eftborder . jpg">
<table style="text-align: left; width: 100%;" border="0" cell paddi ng="0" cell spaci ng="0"> <tbody> <tr>
<td style="vertical -align: top; text-align: left;"x/td> </tr> <tr>
<td style="vertical -align: top; text-align: left;"ximg style="width: 210px; height: 43px;" alt= Strain Database" s rc="i mages/Li nkHeader . j pg"x/td> </tr> <tr>
<td align="center" valign="top"> <table style="width : 90%; text-align: left; margin-left: auto; margin-right: Opx;" border="0" cellpadding="O" cellspacing="O">
<tbody>
<tr style="font-family: Century Gothic; font-weight: bold;" align="left">
<td style="vertical -align: top;" class="nav"xa href="home. jsp">Search&nbsp;Strains</ax/td>
</tr> <tr style="font-family: Century Gothic; font-weight: bold;" align="left">
<td sty] e="vertical -align: top;" class="nav"xa href="searchi nsilico. isp">Search
<span style="font-style: italic; ">ln Silico</span> Data</ax/td>
</tr> <tr style="font-family: Century Gothic; font-weight: bold;" align="left">
<td style="vertical -align: top;" class="nav"xa href="uploadfilecompare. jsp">Compare MALDI File</ax/td>
</tr> <! --adminonly{-->
<tr style="font-family: Century Gothic; font-weight: bold;" align="left">
<td style="vertical -align: top;" class="nav"xa href="deletesampleconfi rmrange. jsp">Delete Sample Data</ax/td> </tr>
<tr style="font-family: Century Gothic; font-weight: bold;" align="left">
<td style="vertical -align: top;" class="nav"xa href="fi ndand replace. jsp">Fi nd&nbsp; &amp;&nbsp; Repl ace</ax/td>
</tr> <tr style="font-family: Century Gothic; font-weight: bold;" align="left">
<td style="vertical -align: top;" class="nav"xa href="insertstrain. jsp">Insert&nbsp; Strain</ax/td>
</tr> <tr style="font-family: Century Gothic; font-weight: bold;" align="left">
<td style="vertical -align: top;" class="nav"xa href="newgenus. jsp">Insert Genus</ax/td>
</tr> <tr style="font-family: Century Gothic; font-weight: bold;" align="left">
<td style="vertical -align: top;" cl ass="nav"xa href="newspeci es . j sp">Insert Speci es</ax/td>
</tr> <tr style="font-family: Century Gothic; font-weight: bold;" align="left">
<td style="vertical -align: top;" cl ass="nav"xa href="newsubspeci es . j sp">lnsert Subspeci es</ax/td>
</tr> <tr style="font-family: Century Gothic; font-weight: bold;" align="left">
<td style="vertical -align: top;" class="nav"xa href="newsubtype. jsp">Insert Subtype</ax/td>
</tr> <tr style="font-family: Century Gothic; font-weight: bold;" align="left">
<td style="vertical -align: top;" class="nav"xa href="insertmaldidatatab. jsp">Insert MALDI Data</ax/td>
</tr> <tr style="font-family: Century Gothic; font-weight: bold;" align="left">
<td style="vertical -align: top;" class="nav"xa href="insilicoadd. jsp">Insert <span style="font-style: italic; "> In Silico</span> Data</ax/td>
</tr> <tr style="font-family: Century Gothic; font-weight: bold;" align="left">
<td style="vertical -align: top;" class="nav"xa href="msmsadd. jsp">Insert MS/MS Data</ax/td>
</tr> <tr style="font-family: Century Gothic; font-weight: bold;" align="left">
<td style="vertical -align: top;" class="nav"xa href="importcsv. jsp">Import New Strains</ax/td>
</tr> <tr style="font-family: Century Gothic; font-weight: bold;" align="left">
<td style="vertical -align: top;" class="nav"xa href="importnotestabdel . jsp">Import Notes</ax/td>
</tr> <tr style="font-family: Century Gothic; font-weight: bold;" align="left">
<td style="vertical -align: top;" class="nav"xa h ref=" downloads trainfile. jsp?rmonly=yes">Download Strains</ax/td>
</tr> <! --}admi nonly-->
</tbody> </table> </td> </tr> <tr style="font-family: Century Gothic; ">
<td class="nav" aliqn="center" valign="top"xa href="newsubtype. jsp ><br>
</ax/td> </tr> <tr>
<td align="left" valign="top"ximg style="width: 210px; height: 43px;" alt="Gene Database" s rc="i mages/Li nkHeaderGene . j pg"x/td> </tr> <tr>
<td align="center" valign="top"> <table style="width: 90%; text-align: left; margin-left: auto; margin-right: Opx;" border="0" cellpadding="O" cellspacing="O">
<tbody>
<! --admi nonly{--xtr style="font-weight: bold; font-family: Century Gothic;" align="left">
<td style="vertical -align: top;" cl ass="nav"xa href="i mporttabgenel i st . j sp">Insert Genel i st</ax/td>
</tr>
<! --}adminonly--xtr style="font-weight: bold; font-family: Century Gothic;" align="left">
<td style="vertical -align: top;" class="nav"xa href="searchgenelist. jsp">Search Loci</ax/td>
</tr>
<! --admi nonly{--xtr style="font-weight: bold; font-family: Century Gothic;" align="left">
<td style="vertical -align: top;" class="nav"xa href="i nsertnucleotidedata. jsp">Insert AA/NT</ax/td>
</tr> <! --}adminonly-->
</tbody> </table> </td> </tr>
<! --admi nonly{--> <tr style="font-family: Century Gothic; font-weight: bold;">
<td style="text-align: center;" valign="top"xa href="i nsertnucleotidedata. jsp"xspan style="color: rgb(204, 255, 255) ; "x/spanxbr>
</ax/td> </tr> <! --}adminonly-->
</tbody> </table> </td>
<td style="text-align: center; vertical-align: top;"> <table style="background-color: rgb(255, 255, 255); width: 90%; text-align: left; margin-left: auto; margin-right: auto;" bordercolorlight="#000000" bordercolordark="#000000" border="2" bordercolor="#000000" cellpadding="O" cellspacing="0">
<tbody> <tr>
<td style="vertical -align: top; text-align: left; ">&nbsp; $MIDDLE$ </td>
</tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr>
<td colspan="2" rowspan="l" style="vertical -align: top; text-align: left; width: 100px;"> <table style="text-align: left; width: 100%;" border="0" eel 1 paddi ng="0" eel 1 spaci ng="0"> <tbody> <tr>
<td style="vertical -align: top; text-align: left; width: 200px; "ximg style="width: 209px; height: 44px;" alt="" src="images/BottomBorder. jpg"></td>
<td style="text-align: center; vertical -align: middle; "></td> </tr> </tbody> </table> </td> </tr> <tr>
<td colspan="2" rowspan="l" style="vertical -align: top; text-align: left; width: 100px;"x/td>
</tr> </tbody> </table> <br> </body> </html>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/> <jsp:useBean id="dbBean" class="psm.db.dbAccess" scope ="session" /> <% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getllsernameO , "Change Password" , "ChangePassword" , application. getReal Path("/") , dbBean); out. write (pageSource. getPageHeader ()) ; String cpwd = dbBean. getPassword() ; String newpwd = request. getParameter("newpwd") ; if (cpwd.compareTo(request.getParameter("oldpwd")) == 0) { if (newpwd. compareTo(request.getParameter("retype"))==0) { if (dbBean. changePassowrd(request.getParameter("newpwd"))) { out . pri nt (" Password Change Successful l ! ") ; } el se { out. print ("A Database error occurred, your password may not have been changed, if you experience trouble contact the system administrator.");
} else { out. print("Your passwords do not match, press back on your browser and try agai n . ") ;
} else{ out. print("Your old password is incorrect, press back on your browser to try agai n . ") ; dbBean. dbCloseO ; out. write (pageSource. getPageFooter ()) ;
%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="pageSource" class="psm.web. pageCode"/>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope ="session" />
<% dbBean . dbConnectO ; pageSource. sp"litTemplatePage(dbBean.getUsername() , "Change Password", "Change Password", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeaderO) ;
%>
<centerxhl>Change Password</hlx/centerxbr>
<form action="changeconfi rmation . jsp">
<table border="0" cellpadding="O" cellspacing="2" align=center>
<tr>
<td>Old Password: </tdxtdxinput type=password name="oldpwd"x/td> </tr> <tr>
<td>New Password: </tdxtdxinput type=password name="newpwd"x/td> </tr> <tr>
<td>Retype New Password :</tdxtd> <input type=password name="retype"> </td> </tr> <tr>
<td colspan=2 align=rightxinput type=submit value="0K" </td> </tr> </table> </form> <% out. write (pageSource. get Page Footer ()) ; dbBean. dbCloseO ; %>
%@page contentType="text/html "%>
i co</i >
Figure imgf000084_0001
<td colspan="2">
<center>Please check and make sure the data from the file was pased correcti y<br>and make any changes you wish before hitting submi t . <brxbrx/center>
</td> </tr> <tr>
<td>
Identification Number :&nbsp </td> <td>
<input type=text name="ident" val ue="<%=frlnsi 1 i co . getNumber()%>">
</td> </tr> <tr>
<td>
Mol ecul ar Wei ght : &nbsp </td>
<td col span=2> <i nput type="text" name="mw" val ue="<%=Doubl e . toStri ng(f rlnsi 1 i co . getMW())%>">
</td> </tr> <tr>
<td> Genus: </td> <td>
<input type="text" name="genus" val ue="<%=frlnsi Ii co. getGenus ()%>">
</td> </tr> <tr> <td>
Species: </td> <td>
<input type="text" name="species" val ue="<%=frlnsi 1 i co . getSpeci es ()%>">
</td> </tr> <tr> <td>
Subspecies: </td> <td>
<input type="text" name="subspecies" val ue="<%=frlnsi 1 i co . getSubspeci es ()%>">
</td> </tr> <tr> <td>
Subtype: </td> <td>
<input type="text" name="subtype" val ue="<%=frlnsi 1 i co . getSubtype ()%>">
</td> </tr> <tr>
<td>Protein: </td>
<tdxinput type=text name="protein" value="<%if (f rlnsilico.getProteinO != null) {out.write((f rlnsilico.getProtein())) ; }%>"
</td> </tr> <tr>
<td> Notes: </td> <td>
<input type="text" name="notes" val ue="<%=frlnsi 1 i co . getNotes ()%>">
</td> </tr> <tr>
<td>
Mass to Charge: </td> <td heignt=100px >
<textarea readonly><%
ArrayList mz = frlnsilico.getMaldiMZO ; for (int i= 0; i < mz.sizeO; i++) { out.write(mz.get(i) + "\n" );
%></textarea> </td> </tr> <tr>
<td colspan="3" align=center> <br>
<input type="submit"> </td> </tr> </table> </form> <% dbBean.dbCloseO ; out.writeCpageSource. getPageFooter ()) ; %> <%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%> <%@page import="java. util . *" %>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<jsp: useBean id="frMaldi" class="psm.mformat.formatMALDl" scope="session"/> <jsp:useBean id="dbBean" class="psm.db.dbAccess" scope ="session" /> <% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Insert MALDI Data", "insertMALDITitle", application.getReal Path("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; frMaldi . formatMALDIFile(request) ; %>
<form action="maldiconfi rmation. jsp"> <table align="center"> <tr>
<td colspan="2">
<center>Please check and make sure the data from the file was pased cor recti y<br>and make any changes you wish before hitting submi t . <brxbrx/center>
</td> </tr> <tr>
<td>
Identification Number :&nbsp </td> <td>
<input type=text name="ident" size=33 value="<%=f rMaldi . getNumber ()%>">
</td> </tr> <tr>
<td> Date: </td> <td>
<input type=text name="date" size=33 value="<%if
(frMaldi .getMdateO != null) {out. write((f rMaldi .getMdate() .getYear() + 1900) + "-" + (integer. toStringCfrMaldi .getMdateO .getMonthO + I)) + "-" + frMaldi .getMdateO .getDateO) ;}%>">
</td> </tr> <tr>
<td>
Target Spot Number:&nbsp </td>
<td colspan=2>
<input type="text" name="target" size=33 val ue="<%=f rMal di . getTargetNum()%>">
</td> </tr> <tr>
<td> Notes: </td> <td>
<input type="text" name="notes" size=33 val ue="<%=f rMal di . getNotes ()%>">
</td> </tr> <tr>
<td>
Mass to Charge/Intensity: </td> <td heignt=100px> <textarea readonly name="mz" cols=25><% ArrayList mz = f rMaldi .getMaldiMZ() ; ArrayList intensity = f rMal di . getMal di lntensi ty() ; for (int i= 0; i < mz.sizeO; i++) { out.write(mz.get(i) + "\t\t"
+intensity.get(i) + "\n" );
%></textarea> </td> </tr> <tr>
<td colspan="3" align=center> <br>
<input type="submit"> </td> </tr> </table> </form> <% dbBean.dbCloseO ; out.writeCpageSource. getPageFooter ()) ; %>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%> <%@page import="java. util . *" %>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<jsp: useBean id="frMSMS" class="psm.mformat.formatMSMSData" scope="session"/> <jsp:useBean id="dbBean" class="psm.db.dbAccess" scope ="session" /> <% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Insert MS/MS Data", "insertMALDITitle", application.getReal Path("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; frMSMS.formatMALDIFi Ie (request); %>
<form action="msmsconfi rmation . jsp"> <table align="center"> <tr>
<td colspan="2">
<center>Please check and make sure the data from the file was pased cor recti y<br>and make any changes you wish before hitting submi t . <brxbrx/center>
</td> </tr> <tr>
<td>
Identification Number :&nbsp </td> <td>
<input type=text name="ident" size="46" value="<%=frMSMS.getNumber()%>">
</td> </tr> <tr>
<td> Date: </td> <td> if
(fr " + (in frM
val
val
Figure imgf000088_0001
Notes: </td> <td>
<input type="text" name="notes" size="46" val ue="<%=frMSMS . getNotes ()%>"> </td> </tr> <tr>
<td>
Mass to Charge/Intensity: </td>
<td heignt=100px > <textarea readonly cols="35"><% ArrayList mz = frMSMS.qetMaldiMZO ; ArrayList intensity = frMSMS.getMaidilntensityO ; for (int i= 0; i < mz.sizeO; i++) { out.write(mz.get(i) + "\t\t" +intensity.get(i) + "\n" );
%></textarea> </td> </tr> <tr>
<td colspan="3" align=center> <br>
<input type="submit"> </td> </tr> </table> </form> <% dbBean.dbCloseO ; out.writeCpageSource. getPageFooter ()) ; %>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
<head>
<meta http-equiv="Content-Type" content="text/html ; charset=UTF-8"> <title>MALDI-TOF Graph</title> </head> <body>
<center>lf the graph does not appear to resemble the proper data, click refresh or submit. <br>Your browser may have cached the previous image. <brxbrx/center> <form action="comparefilegraphs . jsp"> <% int rangeA, rangeB, topnum; if (request. getParameterC'rangeA") != "" & request. getParameter("rangeA") != null) { rangeA = Integer . parselnt(request. getParameterC'rangeA")) ; } else { rangeA = 4000; if (request. getParameter("rangeB") != "" & request. getParameterC'rangeB") != null) { rangeB = Integer . parselnt(request. getParameterC'rangeB")) ; } else { rangeB = 14000; if (request. getParameterC'topnum") != "" & request. getParameterC'topnum") != null) { topnum = Integer . parselnt(request. getParameterC'topnum")) ; } else { topnum = 5; }
%>
<tabl e border="0" cel l paddi ng = "0" cel l spaci ng = "0" al i gn=center > <tr> <td col span="3">
<i mg s rc="mal di graphsmal 1 temp . j sp?mal di i d=<%=request . getParameter ("i dl")%>&rangeA=<%=rang eA%>&rangeB=<%=rangeB%>&topnum=<%=topnum%>&ti tl e=<%=request . getParameter ( ti tl e")%>
</td>
</tr>
<tr>
<td colspan="3">
&nbsp
</td>
</tr>
<tr>
<td C9lspan="3">
<img src="mal di graphsmal 1. j sp?mal di i d=<%=request . getParameter ("i d2")%>&rangeA=<%=rangeA%> &rangeB=<%=rangeB%>&topnum=<%=topnum%>">
</td>
</tr>
<tr>
<td>
Low Value :&nbsp<input type="text" name=" rangeA" value="<%=rangeA%>"> </td> <td>
Hi gh Val ue : &nbsp<i nput type="text" name=" rangeB" val ue="<%=rangeB%>"> </td> <td>
Number of Values Labeled: <input type="text" name="topnum" val ue="<%=topnum%>">
</td> </tr> <tr> name="idl" value=
name="id2" value=
name="ti tl e"
Figure imgf000091_0001
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
<head>
<meta http-equiv="Content-Type" content="text/html ; charset=UTF-8"> <title>MALDI-TOF Graph</title> </head> <body>
<center>lf the graph does not appear to resemble the proper data, click refresh or submit. <br>Your browser may have cached the previous image. <brxbrx/center> <form action="comparegraphs . jsp"> <% int rangeA, rangeB, topnum; if (request. getParameterC'rangeA") != "" && request. getParameter("rangeA") != null) { rangeA = Integer . parselnt(request. getParameterC'rangeA")) ; } else { rangeA = 4000; if (request. getParameterC'rangeB") != "" && request. getParameterC'rangeB") != null) { rangeB = Integer . parselnt(request. getParameterC'rangeB")) ; } else { rangeB = 14000; if (request. getParameterC'topnum") != "" && request. getParameterC'topnum") != null) { topnum = Integer . parselnt(request. getParameterC'topnum")) ; } else { topnum = 5; }
%>
<tabl e border="0" cel l paddi ng = "0" cel l spaci ng = "0" al i gn=center > <tr> <td col span="3">
<i mg src="mal di graphsmal 1. j sp?mal di i d=<%=request . getParameter ("i dl")%>&rangeA=<%=rangeA%> &rangeB=<%=rangeB%>&topnum=<%=topnum%>"> </td> </tr> <tr>
<td colspan="3"> &nbsp </td> </tr>
. getParameter ("i d2")%>&rangeA=<%=rangeA%>
Figure imgf000092_0001
<td>
Low Value :&nbsp<input type="text" name=" rangeA" value="<%=rangeA%>"> </td> <td>
High VaI ue:&nbsp<i nput type="text" name="rangeB" val ue="<%=rangeB%> > </td>
Figure imgf000093_0001
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope ="session" /> <jsp:useBean id="pageSource" class="psm.web. pageCode"/> <% dbBean . dbConnectO ; pageSource. splitTempl atePage (dbBean. getllsernameO , "MALDI Comparison" , "MaI di Compari sonTi tl e" , appl i cati on . getReal Path ("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; %>
<form method=post action="comparemaldifilesetup. jsp" enctype="MULTIPART/FORM-DATA"> <table align = center> <tr>
<td col span = 2>
<centerxhl>Upload MALDI-TOF MS Data<br>for Database compari son</hl></center>
This accepts a Bruker type MALDl-TOF data file for comparison of data. </td> </tr> <tr>
<td>
Fi nd Fi 1 e : </td> <td>
<i nput type="fi l e" name="mal di fi l e"> </td> </tr> <tr> <tdx/td>
<td col span="l" al i gn=l eft>
<input type="submit" value="Send"> </td> </tr> </table> </form> <% dbBean. dbCloseO ; out. write (pageSource. getPageFooter ()) ; %>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%> <%@page import="java. util . *" %>
<jsp: useBean id="pageSource" class="psm.web. pageCode"/> <jsp:useBean id="dbBean" class="psm.db.dbAccess" scope ="session" /> <% dbBean . dbConnectO ; pageSource. s pi itTempl ate Page (dbBean. getllser name () , "MALDI Comparison" , "MaI di Compari sonTi tl e" , appl i cati on . getReal Path ("/") , dbBean) ; out. write (pageSource. get PageHeader ()) ; %>
<jsp:useBean id="frMaldi" class="psm.mformat.formatMALDl" scope="session"/>
<% f rMaldi .formatMALDIFile(request) ;
%>
<form action="maldifilecompareresul ts . jsp"> <table align="center"> <tr>
<td colspan="2">
<center>Please check and make sure the data from the file was pased correcti y<br>and make any changes you wish before hitting submi t . <brxbrx/center>
</td> </tr> <tr>
<td> Ti tl e : </td> <td>
<input type="text" value="<%=f rMaldi .getFileName()%>" name="title">
</td> </tr> <tr>
<td>
Mass to Charge - Intensity:
</td
<td heignt=100px>
<textarea readonly><%
ArrayList mz = f rMaldi .getMaldiMZ() ;
ArrayList intensity = f rMaldi .getMaldilntensityO ; for (int i= 0; i < mz.sizeO; i++) { out.write(mz.get(i) + "\t\t" +intensity.get(i) + "\n" );
%></textarea>
</tr>
<tr>
<td>
Error Threshold (ppm) :
</td>
<td>
<input type="text" name="ppm" value="500">
</td> </tr> <tr>
<td> intensity Threshold (%) :
</td>
<td>
<input type="text" name="intensity" value=10>
</td> </tr> <tr>
<td>
Lower Mass/Charge Bound: </td> <td>
<input type="text" name="lMass" value="4000"> </td> </tr> <tr>
<td>
Upper Mass/Charge Bound: </td> <td>
<input type=text name="hMass" value="14000"> </td> </tr> <tr>
<td>
Maximum Number of Results: </td> <td>
<input type="text" name="maxresults" value="25"> </td> </tr>
<tr>
<td colspan=2>&nbsp; </td> </tr> <tr>
<td col span=2 al i gn = center>
Compare Agai nst Onl y Those That Meet Thi s Search Cri teri a<br>(l_eave Bl ank for ful l search)<br>
<input type="radio" name="andor" value="and" checked>AND <input type="radio" name="andor" value="0r">0R </td> </tr> <tr>
<td>
Search by Identification Number (e.g. RM12O3 or 1203): </td> <td>
<i nput type=text name="i denti fi er"> </td> </tr> <tr>
<td>
Within Range (e.g. 1203 To: 1403) </td> <td>
<input type="text" name="lowRM" size="5">&nbsp To: &nbsp<input type="text" name="highRM" size="5">
</td> </tr> <tr>
<td>
Search by Genus (e.g. Campylobacter): </td> <td>
<input type=text name="genus"> </td> </tr> <tr>
<td>
Search by Species (e.g. CoIi): </td> <td>
<input type=text name="species"> </td> </tr> <tr>
<td>
Search by Subspecies (e.g. Fetus): </td> <td>
<input type=text name="subspecies"> </td> </tr> <tr>
<td>
Search by Other Subtype: </td> <td>
<input type=text name="other"> </td> </tr> <tr>
<td>
Search inside Notes: </td> <td>
<input type=text name="notes"> </td> </tr> <tr>
<td>
Search inside History: </td> <td>
<input type=text name="history"> </td> </tr> <tr>
<td colspan=2>&nbsp; </td> </tr>
<tr>
<td colspan=2>&nbsp; </td> </tr> <tr>
<td>
<i nput type=" radi o" name="searchtype" val ue="i ntensi ty" checked>lntensi ty Compari son </td> <td>
<i nput type=" radi o" name="searchtype" val ue="mass">Mass onl y Compari son
</td> </tr> <tr>
<td col span=2 al i gn=centerxbr>
<input type=reset>&nbsp&nbsp&nbsp<input type="submit"> </td> </tr>
<td colspan=2>
<center><br>Usi ng the default mass range searches will be much faster .<br>Edi ting, or changing the range from 4000 to 14000 requires re-normalization of the data<br>and can cause search times in excess of 2 mi nutes .<br>Please be patient. </center>
</td> </table> </form> <% dbBean.dbCloseO ; out.writeCpageSource. getPageFooter()) ; %>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%> <%@page import="iava. sql . *" %> <%@page import="java. util . *" %> <%@page import="java. text. *" %> <%@page import="psm.db.box. *" %>
<style> table. notes
{ font-size: 100%; posi ti on : absol ute ; visibility: hidden; background : whi te ;
</style>
<script language="JavaScript"> f uncti on sel ectAl 1 (c) { for(i=l; i < c. length; i++) c[i] .checked=c[O] .checked;
</script>
<script type="text/javascript"> function showmenu(elmnt)
{ document. getElementByld(elmnt) . style. vi sibili ty="vi sible" function hidemenu(elmnt)
{ document. getElementByld(elmnt) . style. vi sibili ty=" hidden" function switchmnu(elmnt) { if (document. getElementByld(elmnt) . style. vi sibili ty==" hidden") { document. getElementByld(elmnt) . style. vi sibili ty="vi sible"
} else { document . getEl ementByld (el mnt) . styl e . vi si bi 1 i ty="hi dden"
} </script>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/> <% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getUsernameO , "MALDI Comparison" , "MaI di Compari sonTi tl e" , appl i cati on . getReal Path ("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ; %>
<form name="myForm">
<table align=center cellpadding="O" cellspacing="0" styl e="horizontal -align : center; text-align:center"> <trxtd colspan=9>
<table align=center cellpadding="O" cellspacing="0" styl e="horizontal -align : center; text-align:center">
<tr>
<td colspan=9>
<a href="comparemaldisampletextonly. jsp? rm=<%= request. get Parameter ("rm")%>&id=<%=reques t . getParameterC'i d")%>&ppm=<%=request . getParameter("ppm")%>&i ntensi ty=<%=request . get Parameter ("intensity")%>&lMass=<%=request. get Parameter ("1 Mass ")%>&hMass=<%=request.g etParameter("hMass")%>&maxresults=<%=request.getParameter("maxresults")%>&date=<%=re quest . getParameter("date")%>&andor=<%=request . getParameter("andor")%>&i denti fi er=<%= request . getParameter("i denti fi er")%>&l owRM=<%=request . getParameter("l owRM")%>&hi ghRM =<%=request. getParameter("hi ghRM")%>&genus=<%=request. getParameter("genus")%>&specie s=<%=request. getParameter("species")%>&subspecies=<%=request. getParameter("subspecie s")%>&other=<%=request, getParameter("other")%>&notes=<%=request, getParameter("notes" )%>&hi story=<%=request . getParameter("hi story")%>">Downloadabl e Text Format</a>
</td> </tr>
<trxtd col span=9>&nbsp ; </tdx/tr> <tr>
<td>Low Value:&nbsp</td> <td>
<input type="text" name="rangeA" value="<%=request.getParameter("lMass") %>" size="5">
</td>
<td>High Value:&nbsp</td> <td>
<input type="text" name="rangeB" value="<%=request. getParameter("hMass")%>" size="5">
</td>
<td>Label ed val ues : &nbsp</td> <td col span=2 al i gn=l eft>
<input type="text" name="topnum" value="5" size="2"> </td> </tr>
Figure imgf000100_0001
document . myForm . submi tO ; "> </td> </tr>
</tabl ex/tdx/tr> <tr>
<td colspan=9>&nbsp;</td> </tr>
<% int intensity, lmass, hmass, ppm, maxresults; if (request. getParameter("intensity") !="") { intensity = integer. parselnt( request. getParameter ("intensity")) ; } else { intensity = 10;
if (request. getParameterC'lMass") != "") { lmass = Integer. parselnt(request. getParameterC'lMass")) ;
} else { lmass = 4000;
if (request. getParameterC'hMass") != "") { hmass = Integer. parselnt(request. getParameterC'hMass")) ;
} else { hmass = 14000;
} if (request. getParameterC'ppm") != "") { ppm = Integer. parselnt(request. getParameterC'ppm")) ;
} else { ppm=500;
if (request. getParameterC'maxresults") != "") { maxresults =
Integer. parselnt( request. getParameter ("maxresults")) ; } else { maxresults = 10; }
//Get the sql statement String sql SeI = ""; sql Set = dbBean . bui 1 dCompareStri ngForTempMassOnl y(i ntensi ty , lmass, hmass, ppm);
//Get the array maldi ID list
ArrayList mID = dbBean. getAll MaI diDataID( request. getParameter ("andor") , request. getParameter ("identif ier") , request. getParameter ("lowRM") , request. getParameter (" hi ghRM") , request. getParameter ("genus") , request. getParameter ("s pecies") , request. getParameter ("subspecies") , request. getParameter ("other") , request. ge tParameter ("notes ) , request. getParameter ("hi story") , request. getParameter ("date")) ;
ArrayList rslts = new ArrayListO;
//connect to the database dbBean . dbConnectO ;
//To make the search faster we are going to dump all the data into the maldi temp table
//this table is stored in memory which makes it a lot faster and it also normalizes teh data int maldi Templd = dbBean. dumpMALDIDataToTemp (Integer, parselnt( request. getParameter ("id")) , intensity, lmass, hmass, "malditemp") ; dbBean. dbCloseO ; dbBean . dbConnectO ; //This deletes any temporary data that is two days old in the database dbBean . executeStri ng("DELETE maldi_tof, maldi_tof_data, maldiratl FROM maldiratl , maldi_tof, sample, identifier, maldi_tof_data where ident = 'Temporary' AND sample. identifier_id = identifier .identifier_id AND maldi_tof . sample_id = sample. sample_id AND maldi_tof .DATE < DATE_SUB(Current_timestamp, INTERVAL 1 day) AND maldi_tof .maldi_tof_id = maldi_tof_data.maldi_tof_id AND maldi ratl .maldi_tof_id = maldi_tof .maldi_tof_id") ;
//Loop through each ID and compare it sqlSel = sqlSel . replace("$cmpr$" , Integer . toString(maldiTempld)) ;
//if the mass range does not fall within 4 to 14 thousand then we need to normalize the data before comparing it
//if it does fall within this mass range then the data is already normalized and we can use that instead double nstar = (hmass - lmass) /
((Double. parseDouble(request.getParameter("ppm"))/ Math.pow(H), 6)) * hmass * 2); if (lmass != 4000 | hmass != 14000) { for (int i = 0; i < mlD.sizeO; i++) { String 1 = ""; 1 += mlD.get(i) ;
//if (1.compareTo(request.getParameter("id")) == 0 ) { continue; } int cmprTold; cmprTold = dbBean. dumpMALDIDataToTemp(lnteger . parselnt(l) , intensity, lmass, hmass, "malditemp2") ;
String tmp = sqlSel . replace("$cmprTo$" , Integer . toString(cmprTold) );
ResultSet myRS = dbBean. getRS(tmp) ; myRS. next() ; rslts.add(new scorecontainer(l , myRS.getStringC'score") , myRS.getInt("lc_k"), myRS.getInt("uc_k") , myRS.getInt("n") , nstar)); myRS.closeO ; dbBean . del eteMal diTempData(cmprTold , "mal di temp2") ;
} else { for (int i = 0; i < mlD.sizeO; i++) { String 1 = ""; 1 += mlD.get(i) ;
//if (1.compareTo(request.getParameter("id")) == 0 ) { continue; }
String tmp = sqlSel . replace("$cmprTo$" , 1);
ResultSet myRS = dbBean. getRS(tmp) ; myRS. next() ; rslts.add(new scorecontainer(l , myRS.getStringC'score"), myRS.getInt("lc_k"), myRS.getInt("uc_k") , myRS.getInt("n") , nstar)); myRS.closeO ;
}
//now delete the maldiTemp data to free up the memory dbBean . del eteMal di TempData(mal di Templd , "mal di temp") ; mID = null ;
//Sort the array, this is a simple bubble sort algorithm for (int i = 0 ; i< rslts. size Q ; i++) { for (int j=0; j < (rslts. size() - 1 - i) ; j++) { scorecontai ner x,y; x = (scorecontai ner) rslts. get(j + 1); y = (scorecontai ner) rslts. get(j) ; if (x.getScoreQ == null | y.getScoreQ == null) { //This was a bad score, if it is null move it to the bottom //A null value for a score means no data set was returned //This is probably because the intenisty threshold was higher than //What is present in the DB, this problem should go away once the data
//is normalized. if (x.getScoreQ == null) { rslts.setCj, y) ; rslts. set(j+l, x) ; } else { rslts.setCj, x) ; rslts.set(j+l, y) ;
} else { int mlntl = Integer . parselnt(x.getScoreO) ; int mlnt2 = Integer . parselnt(y.getScoreO) ; if ( mlntl > mlnt2 ) { rslts.setCj, x) ; rslts.set(j+l, y) ;
}
}
//Now we want to determine the best guess case for identification //This works by Taking all Results that scored above 60% and finding the most occuring strain in the set
//First lets convert all the MALDIIDS with a score above 60 to a strain ID and store them in an arraylist
ArrayList strains = new ArrayListO;
//Since rslsts is already sorted from bottom to top (item 0 being the highest score) we can do a while loop until the score is below 60 int dex=0;
String strainSQL = "SELECT s.strain_id FROM sample s, maldi_tof m, identifier WHERE m.sample_id = s.sample_id AND (";
//This loop will develop a sql statement to grab a list of all the strain ids scorecontainer b = (scorecontainer) rslts.get(O) ; int sc = integer . parselnt(b.getScoreO) ; while ( sc >= 60) { strainSQL += "m.maldi_tof_id = " + b.getMidO + " OR "; dex++; b = (scorecontainer) rslts.get(dex) ; sc = integer . parselnt(b.getScoreO) ;
//Format the string, get rid of the last OR and add a ) strainSQL = strainSQL. substring(O, strainSQL. lengthQ - 3) + ") AND identifier . identifier_id = s.identifier_id AND CONCAT_WS(' ' , identifier .i dent, s. number) != '" + request. getParameter("rm") + "'";
//now we want to use the SQL statement and make a list of the count of each strain
ResultSet strainRS = dbBean.getRS(strainSQL) ; if (strainRS != null) { while (strainRS. next()) {
//loop through the arraylist to find the strain boolean found = false; int indx = 0; for (int i = 0; i < strains. size() ; i ++) { box z = (box) strains. get(i) ; if (strainRS. getString(l) .compareτo(z.getθlθ) == 0 ) { found = true; indx = i ; i = strains. size() ; } if (found) { box z = (box) strains. get(indx) ; z. setO2(lnteger . toString(lnteger . parselnt(z.getO2()) + 1
} else { strains. add(new box(strainRS.getString(l) , "1"));
} strainRS.closeO ;
//Now we want to loop through this list, get the largest score, and display this is the identified strain box ab; if (strains. si ze() == 0) {
//nothing above a score of 60 out.write("<trxtd colspan = 9 style=' text-align:center ; background-color : rgb(45, 190, 230) ; font-weight: bold; '>No identification made</tdx/tr> );
} else { ab = (box) strains. get(O) ; String topid = ab.getol(); String score = ab.getO2(); for (int i =0; i < strains. si ze() ; i ++) { ab = (box) strains. get(i) ; if (Integer . parselnt(ab.getO2()) > Integer . parselnt(score)) { topid = ab.getol(); score = ab.getO2() ;
}
//Now lets get the strain strainRS = dbBean.getRS("SELECT CONCAT_WS(' ', g.name, s. name, sp.name, st.name) FROM strain sn, genus g, species s, subspecies sp, subtype st WHERE g.genus_id = sn.genus_id AND s.species_τd = sn. species_id AND sp. subspecies_id = sn. subspecies_id AND st. subtype_id = sn. subtype_id AND sn.strain_id = " + topid); strainRS. next() ; out.write("<trxtd colspan = 9 style=' text-align:center ;background-color : rgb(45, 190, 230) ; font-weight: bold; ">ldentified as:<br>" + strainRS. getStπ ng(l) + "</tdx/tr>") ; strainRS.closeO ;
} else {
//nothing above a score of 60 out.write("<trxtd colspan = 8 style=' text-align:center ;background-color : rgb(45, 190, 230) ; font-weight: bold; '>No identification made</tdx/tr>") ; }
%>
<tr>
<td colspan=8>&nbsp;</td>
</tr>
<tr>
<td>
<input type=checkbox name="checkid" onclick="selectAll (this.form.checkid) ; ">
</td> <td>
<span style="font-weight: bold; ">&nbsp;MALDl lD&nbsp;</span>
</td>
<td>
<span style="font-weight: bold; ">&nbsp;Date:&nbsp;</span>
</td>
<td>
<span style="font-weight: bold;" >&nbsp;Sample:&nbsp;</span>
</td>
<td>
<span style="font-weight: bold; ">&nbsp; Sample Name:&nbsp;</span>
</td>
<td>
<span style="font-weight: bold; ">&nbsp;Notes:&nbsp;</span>
</td>
<td>
<span style="font-weight: bold; ">&nbsp;Score&nbsp;</span>
</td>
<td>
<span style="font-weight: bol d ; ">&nbsp ; <i >P</i > : &nbsp ; </span>
</td>
<td>
<span style="font-weight: bold; ">&nbsp;Compare&nbsp;</span>
</td> </tr> <tr>
<td colspan=9>&nbsp; </td> </tr> <%
Decimal Format df = new Decimal Format("0.θEθ") ; for (int i = 0; i < maxresults & i < rslts.sizeO ; i++) { scorecontainer x = (scorecontainer) rslts.get(i) ; ResultSet rsltData = dbBean.getMaldiAndSamplelnfo(x.getMidO) ; rsltData. next() ; if (rsltData. getString(l) . compareTo( request. getParameter ("rm")) == 0) {
String notes = rsltData. getString("notes") ; String notesfull = notes; if (notes == null) { notes= ""; } else { notes = "&nbsp;" + notes. substring(O, 10) ;
String popuptbl ; popupt 1bDll == ""<<ttaabb'llee cceel Il lssppaaccii nngg==''O' cellpadding='O' border='l' class=' note ess 'r ' id=' " + x.getMidO + '" width='4 "00 '"xtrxtd>" + notesfull +
"</tdx/trx/table>";
String popuptbl2 = "<table bordercolor=black cellspacing='O' cellpadding='O' border='l' class=' notes ' id='" + x.getMidO + "b1 width=l25O'xtrxtd style=\"vertical -align: top; text-align: Left; background-color: rgb(36, 147, 184) ;\"xi>P</i> Value: " + x.getPvalue() + <br>K: " + x.getUc_k() + "<br>k: " + x.getLc_k() + "<br>n: " + x.getN() + "<br>n*: " + x.getNstar() + "<br>s: " + x.getsO + "</tdx/trx/table>"; out.write("<trxtd style='background-C9lor : rgb(251,
175, 55); 'xinput type=' checkbox1 name='checkid' value='" + x.getMidO + 'x/tdxtd style='background-color : rgb(251, 175, 55); 'xa href='maldidatawithgraph. jsp?maldiid=" + x.getMidO + '">" + x.getMidO + "</ax/tdxtd style='background-color : rgb(251, 175, 55); 'xa href='maldidatawi thgraph . jsp?maldiid=" + x.getMidO + '">" + rsltData. getString(2) + "</ax/tdxtd style='background-color : rgb(251, 175, 55); 'xa href=' strainDetail . jsp?sampleid=" + rsltData. getString(5) +'">" + rsltData. getString(l) + "</ax/tdxtd style='background-color : rgb(251, 175, 55); 'xa href=' strainDetail . jsp?sampleid=" + rsltData.getString(5) +'">" + rsltData.getString(4) + "</ax/tdxtd style=' background-color: rgb(251, 175, 55); ' onmouseout=\"hidemenu(' " + x.getMid() + "')\"><a href='iavascript:voidCO) ; ' onclick=\"showmenu('" + x.getMid() + '")\">" + notes + </a>" + popuptbl + "</tdxtd align=center style=' background-color: rgb(251, 175, 55); '>" + x.getScoreO + "</tdxtd align=left style='background-color : rgb(251, 175, 55);rxa href=' javascript:void(0) ; ' onclick=\"switchmnu(' " + x.getMidC) + "b')\">" + df .format (x.getPvalue O) + "</a>" + popuptbl 2 + "</tdxtd style='background-color : rgb(251, 175, 55); 'xa href='comparegraphs. jsp?idl=" + request. getParameter("id") + "&id2=" + x.getMidC) + "&rangeA=" + tmass + "&rangeB=" + hmass + " '>Graphs</a>" + "</tdx/tr>");
Figure imgf000106_0001
} rsltData.closeO ; dbBean.dbCloseO ;
%>
</table> </form> <%out.writeCpageSource.getPageFooterO) ; %>
Figure imgf000107_0001
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/> <jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% int intensity, lmass, hmass, ppm, maxresults; boolean massSearch = false; if (request. getParameter("searchtype") .compareTo("mass") == 0) { massSearch = true; if (request. getParameter("intensity") !="") { intensity = integer. parselnt( request. getParameter ("intensity")) ; } else { intensity = 10; i f (request . getParameterC'l Mass") ! = "") { l mass = Integer . parselnt(request . getParameterC'l Mass")) ; } el se { l mass = 4000 ; } i f (request . getParameterC'hMass") ! = "") { hmass = Integer . parselnt(request . getParameterC'hMass")) ; } el se { hmass = 14000 ; } i f (request . getParameterC'ppm") ! = "") { ppm = Integer . parselnt(request . getParameterC'ppm")) ; } el se { ppm=500 ; if (request. getParameterC'maxresults") != "") { maxresults = Integer. parselnt( request. getParameter ("maxresults")) ; } else { maxresults = 10; }
//Get the sql statement
String sql SeI = ""; if (massSearch) { sqlSel = dbBean.buildCompareStringForTempMassOnly(intensity, lmass, hmass, ppm); } else { sqlSel = dbBean.buildCompareStringForTemp(intensity, lmass, hmass, ppm);
//Get the array maldi ID list
ArrayList mID = dbBean.getMALDILISTWithSQLSel (request. getParameter ("date") , request. getParameter ("sql one")) ; ArrayList rslts = new ArrayListO; //connect to the database dbBean . dbConnectO ;
//To make the search faster we are going to dump all the data into the maldi temp table
//this table is stored in memory which makes it a lot faster and it also normalizes teh data i nt mal di Templd = dbBean. dumpMALDIDataToTemp (Integer, parselnt( request. getParameter ("id")) , intensity, lmass, hmass, "maldi temp") ; dbBean.dbCloseO ; dbBean . dbConnectO ;
//Loop through each ID and compare it
Figure imgf000108_0001
lmass, hmass, "malditemp2") ;
String tmp = sqlSel . replace("$cmprTo$" , Integer. toString(cmprTold) ); ResultSet myRS = dbBean. getRS(tmp) ; myRS. next() ;
;
) { continue;}
Figure imgf000108_0002
ResultSet myRS = dbBean. getRS(tmp) ; myRS. next() ; rslts.add(new box(l , myRS.getStringC'score"))) ; myRS.closeO ;
} dbBean.dbCloseO ;
//Now we need to take our results, and count the occurrances of scores 0-100 int[] scoreCount = new int [101]; for (int a=0;a < rslts.sizeO; a++) { box b = (box) rslts.get(a) ; scoreCount [Integer . parselnt(b.getO2 ())]++;
//now we want to find the most frequent occurring score. int maxCount=0; for (int i=l;i<=100;i++) { if (scoreCount [i] > maxCount) { maxCount = scoreCount [i ];
}
//Define vars for the size int height = 500, width = 600; //Start Drawing the graph response. setContentτype("i mage/j peg") ;
Bufferedlmage blmg = new Bufferedlmage (width, height, Bufferedlmage. TYPE_INT_RGB) ;
Graphics2D biContext = blmg.createGraphicsO ; biContext. setBackground(Color . WHITE) ; bi Context. clearRect (0,0, width, height) ;
//draw the x axis biContext. setCo]or(Color. BLACK) ; biContext. drawl_ine(50, height - 50, width - 50, height - 50);
//draw y axis biContext. drawl_ine(50, height - 50, 50, 50);
//Draw the iteration marks on the x axis and labels int xlteration = (width-100)/100; for (int i = 0; i <= 100; i++) { if (i % 10 == 0) { biContext. drawl_ine(50 + ((width - 100)/100) * i, height - 45, 50 + ((width - 100) /100) * i , height - 55); biContext. drawString(lnteger . toString(i) , 50 + ((width - 100)/100) * i -2, height - 30);
}
//Draw the y axis iteration marks and labels
//First we need to take maxCount and get a usable number this will give us a number slightly bigger than the maximum count number but divisible by ten int hiNum = ((maxCount / 10) + 1) * 10; float ylter = (float) (height - 100.0) / (float) hiNum; for (int i=0; i<=hiNum;i++) { if ( i % (hiNum/ 10) == 0) { float yd = (float) height - (float) 50.0 - (float) i * ylter; int y = Math. round(yd) ; biContext. drawl_ine(45, y, 55, y); biContext. drawString(lnteger .toString(i) , 15, y + 4) ;
}
//now draw the points on the screen biContext. setColor(Color . RED) ; for (int i=0;i<=100;i++) { if (scoreCount[i] != 0) { float yd = (float) height - (float) 50.0 - (float) scoreCount[i] * ylter; int y = Math. round(yd) ; biContext. drawOval (50 + i -Alteration, y , 2,2); biContext. fillOval (50 + i -Alteration, y , 2,2);
}
//Now Draw the second plots mID = dbBean . getMALDILISTWi thSQLSel (request . getParameter ("date") , request. getParameter ("sql two")) ; rslts = new Arrayl_ist() ;
//connect to the database dbBean . dbConnectO ;
//To make the search faster we are going to dump all the data into the malditemp table
//this table is stored in memory which makes it a lot faster and it also normalizes teh data dbBean.dbCloseO ; dbBean . dbConnectO ;
//Loop through each ID and compare it
Figure imgf000110_0001
lmass, hmass, "malditemp2") ;
String tmp = sqlSel . replace("$cmprTo$" , Integer. toString(cmprTold) ); ResultSet myRS = dbBean. getRS(tmp) ; myRS. next() ;
;
) { conti nue ; }
Figure imgf000110_0002
ResultSet myRS = dbBean. getRS(tmp) ; myRS. next() ; rslts.add(new box(l , myRS.getStringC'score"))); myRS.closeO ; }
//now delete the maldiTemp data to free up the memory dbBean . del eteMal diTempData(mal diTempld , "mal di temp") ; mID = null ; %><% dbBean.dbCloseO ;
//Now we need to take our results, and count the occurrances of scores 0-100 int[] scoreCount2 = new int [101]; for (int a=0;a < rslts. size() ; a++) { box b = (box) rslts. get(a) ; scoreCount2 [Integer. parselnt(b.getO2 ())]++;
//now we want to find the most frequent occurring score. maxCount=0; for (int i=l;i<=100;i++) { if (scoreCount2[i] > maxCount) { maxCount = scoreCount[i] ;
} bi Context . setCol or (Col or . BLUE) ; for (int i=0;i<=100;i++) { if (scoreCount2[i] != 0) { float yd = (float) height - (float) 50.0 - (float) scoreCount2 [i] * ylter; int y = Math. round (yd) ; bi Context. drawOval (50 + i -Alteration, y , 2,2); bi Context. fillOval (50 + i -Alteration, y , 2,2);
}
//Draw the labels bi Context . setCol or (Col or . BLACK) ; biContext.drawStringC'Percent Similarity (Score)", width/2 - 30, height-5);
FontMetrics fm = biContext.getFontMetrics() ; biContext.rotate(-Math.PI / 2, 2, 280 - (fm.getHeight()/2)) ; biContext.drawStringC'Number of Results", 2,280);
OutputStream output = response. getOutputStream() ; ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ; JPEGEncodeParam param = encoder .getDefaul t3 PEGEncodeParam(blmg) ; param. setQuality( (float) 1, false); encoder. setZIPEGEncodeParam(param) ; encoder .encode (blmg) ; output. closeO ; dbBean.dbCloseO ;
%>
<%@page contentType="text"%> <%@page import="java. sql . *" %> <%@page import="java. util . *" %> <%@page import="psm.db.box. *" %>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/> <% int intensity, lmass, hmass, ppm, maxresults; boolean massSearch = false; if (request. getParameter("searchtype") .compareTo("mass") == 0) { massSearch = true; } if (request. getParameter("intensity") !="") { intensity = integer. parselnt( request. getParameter ("intensity")) ; } else { intensity = 10;
if (request. getParameterC'lMass") != "") { lmass = Integer. parselnt(request. getParameterC'lMass")) ;
} else { lmass = 4000;
} if (request. getParameterC'hMass") != "") { hmass = Integer. parselnt(request. getParameterC'hMass")) ;
} else { hmass = 14000;
} if (request. getParameterC'ppm") != "") { ppm = Integer. parselnt(request. getParameterC'ppm")) ;
} else { ppm=500;
if (request. getParameterC'maxresults") != "") { maxresults =
Integer. parselnt( request. getParameter ("maxresults")) ; } else { maxresults = 10;
}
//Get the sql statement String sql SeI = ""; if (massSearch) { sql SeI = dbBean . bui 1 dCompareStri ngForTempMassOnl y(i ntensi ty , lmass, hmass, ppm);
} else { sql SeI = dbBean. bui 1 dCompareStri ngForTemp(intensity, lmass, hmass, ppm);
//Get the array maldi ID list
ArrayList mID = dbBean . getAl 1 MaI diDataID( request. getParameter("andor") , request. getParameter("identif ier") , request. getParameter ("lowRM") , request. getParameter (" hi ghRM") , request. getParameter ("genus") , request. getParameter ("s pecies") , request. getParameter ("subspecies") , request. getParameter ("other") , request. ge tParameter ("notes ) , request. getParameter ("hi story") , request. getParameter ("date")) ;
ArrayList rslts = new ArrayListO;
//connect to the database dbBean . dbConnectO ;
//To make the search faster we are going to dump all the data into the maldi temp table
//this table is stored in memory which makes it a lot faster and it also normalizes ten data int maldiTempld = dbBean. dumpMALDIDataToTemp (Integer. parselnt( request. getParameter ("id")) , intensity, lmass, hmass, "malditemp") ; dbBean. dbCloseO ; dbBean . dbConnectQ ;
//Loop through each ID and compare it sqlSel = sqlSel . replace("$cmpr$" , Integer. toString(maldiTempld)) ;
//if the mass range does not fall within 4 to 14 thousand then we need to normalize the data before comparing it
//if it does fall within this mass range then the data is already normalized and we can use that instead if (lmass != 4000 | hmass != 14000) { for (int i = 0; i < miD.sizeO; i++) { String 1 = ""; 1 += mlD.get(i) ;
//if (1.compareTo(request.getParameter("id")) == 0 ) { continue; } int cmprTold; cmprTold = dbBean. dumpMALDIDataToTemp(lnteger . parselnt(l) , intensity, lmass, hmass, "malditemp2") ;
String tmp = sqlSel . replace("$cmprTo$" , Integer . toString(cmprTold) );
ResultSet myRS = dbBean. getRS(tmp) ; myRS. next() ; rslts.add(new box(l , myRS.getStringC'score"))) ; myRS.closeO ; dbBean . del eteMal diTempData(cmprTold , "mal di temp2") ;
}
} else { for (int i = 0; i < miD.sizeO; i++) { String 1 = ""; 1 += mlD.get(i) ; //if (1.compareTo(request.getParameter("id")) == 0 ) { continue; }
String tmp = sqlSel . replace("$cmprTo$" , 1);
ResultSet myRS = dbBean. getRS(tmp) ; myRS. next() ; rslts.add(new box(l , myRS.getStringC'score"))); myRS.closeO ;
}
}
//now delete the maldiTemp data to free up the memory dbBean . del eteMal diTempData(mal diTempld , "mal di temp") ; mID = null ;
//Sort the array, this is a simple bubble sort algorithm for (int i = 0 ; i< rslts. size Q ; i++) { for (int j=0; j < (rslts. size() - 1 - i) ; j++) { box x,y; x = (box) rslts. get(j + 1); y = (box) rslts. get(j); if (x.getO2() == null | y.getO2() == null) {
//This was a bad score, if it is null move it to the bottom
//A null value for a score means no data set was returned //This is probably because the intenisty threshold was higher than
//What is present in the DB, this problem should go away once the data
//is normalized, if (x.getO2() == null) { rslts. set(j, y) ; rslts. set(j+l, x) ; } else { rslts.setCj, x) ; rslts. set(j+l, y) ;
} else { int mlntl = Integer . parselnt(x.getO2()) ; int mlnt2 = Integer . parselnt(y.getO2()) ; if ( mlntl > mlnt2 ) { rslts.setCj, x) ; rslts. set(j+l, y) ;
}
} for (int i = 0; i < maxresults & i < rslts. size O ; i++) { box x = (box) rslts. get(i) ; out.write(x.getOl() + "\t" + x.getO2() + "\n"); dbBean.dbCloseO ;
%>
<%@page contentType="text"%x%@page pageEncodi ng="UTF-8"%x%@page import=" Java. sql .*" %x%@page import="java. util . *" %x%@page import="java. text. *"
%x%@page import="psm.db.box. *" %><jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/x% int intensity, lmass, hmass, ppm, maxresults; if (request. getParameter("intensity") !="") { intensity = integer. parselnt( request. getParameter ("intensity")) ; } else { intensity = 10;
if (request. getParameterC'lMass") != "") { lmass = Integer. parselnt(request. getParameterC'lMass")) ;
} else { lmass = 4000;
if (request. getParameterC'hMass") != "") { hmass = Integer . parselnt(request. getParameterC'hMass")) ;
} else { hmass = 14000;
} if (request. getParameterC'ppm") != "") { ppm = Integer . parselnt(request. getParameterC'ppm")) ;
} else { ppm=500;
if (request. getParameterC'maxresults") != "") { maxresults = Integer. parselnt( request. getParameter ("maxresults")) ;
} else { maxresults = 10;
}
//Get the sql statement String sql SeI = ""; sql Set = dbBean . bui 1 dCompareStri ngForTempMassOnl y(i ntensi ty , lmass, hmass, ppm);
//Get the array maldi ID list
ArrayList mID = dbBean . getAl 1 MaI diDataID( request. getParameter("andor") , request. getParameter("identif ier") , request. getParameter ("lowRM") , request. getParameter (" hi ghRM") , request. getParameter ("genus") , request. getParameter ("s pecies") , request. getParameter ("subspecies") , request. getParameter ("other") , request. ge tParameter ("notes ) , request. getParameter ("hi story") , request. getParameter ("date")) ;
ArrayList rslts = new ArrayListO;
//connect to the database dbBean . dbConnectO ;
//To make the search faster we are going to dump all the data into the maldi temp table
//this table is stored in memory which makes it a lot faster and it also normalizes teh data int maldi Templd = dbBean. dumpMALDIDataToTemp (Integer, parselnt( request. getParameter ("id")) , intensity, lmass, hmass, "maldi temp") ; dbBean. dbCloseO ; dbBean . dbConnectO ;
//Loop through each ID and compare it sqlSel = sqlSel . replace("$cmpr$" , Integer . toString(maldiTempld)) ;
//if the mass range does not fall within 4 to 14 thousand then we jmparinq
//if it does fall within this mass range then the data is already normalized and we can use that instead double nstar = (hmass - lmass) /
((Double. parseDouble(request.getParameter("ppm"))/ Math.pow(H), 6)) * hmass * 2); if (lmass != 4000 | hmass != 14000) { for (int i = 0; i < mlD.sizeO; i++) { String 1 = ""; 1 += mlD.get(i) ;
//if (1.compareTo(request.getParameter("id")) == 0 ) { continue; } int cmprTold; cmprTold = dbBean. dumpMALDIDataToTemp(lnteger. parselnt(l) , intensity, lmass, hmass, "malditemp2") ;
String tmp = sqlSel . replace("$cmprTo$" , Integer. toString(cmprTold) );
ResultSet myRS = dbBean.getRS(tmp) ; myRS. next() ; rslts.add(new scorecontainer(l , myRS.getStringC'score") , myRS.getInt("lc_k"), myRS.getInt("uc_k") , myRS.getInt("n") , nstar)); myRS.closeO ; dbBean . del eteMal diTempData(cmprTold , "mal di temp2") ;
} else { for (int i = 0; i < mlD.sizeO; i++) { String 1 = ""; 1 += mlD.get(i) ;
//if (1.compareTo(request.getParameter("id")) == 0 ) { continue; }
String tmp = sqlSel . replace("$cmprTo$" , 1);
ResultSet myRS = dbBean. getRS(tmp) ; myRS. next() ; rslts.add(new scorecontainer(l , myRS.getStringC'score"), myRS.getInt("lc_k"), myRS.getInt("uc_k") , myRS.getInt("n") , nstar)); myRS.closeO ;
//now delete the maldiTemp data to free up the memory dbBean . del eteMal diTempData(mal diTempld , "mal di temp") ; mID = null ;
//Sort the array, this is a simple bubble sort algorithm for (int i = 0 ; i< rslts. size Q ; i++) { for (int j=0; j < (rslts. size() - 1 - i) ; j++) { scorecontainer x,y; x = (scorecontainer) rslts. get(j + 1); y = (scorecontainer) rslts. get(j) ; if (x.getScoreO == null | y.getScoreO == null) {
//This was a bad score, if it is null move it to the bottom
//A null value for a score means no data set was returned
//This is probably because the intenisty threshold was higher than
//What is present in the DB, this problem should go away once the data
//is normalized, if (x.getScoreO == null) { rslts. set(j, y) ; rslts. set(j+l, x) ; } else { rsits. set (j , x) ; rslts.set(j+l, y) ;
} else { int mlntl = Integer. parselnt(x.getScoreO) ; int mlnt2 = Integer . parselnt(y.getScoreO) ; if ( mlntl > mlnt2 ) { rslts.setCj, x) ; rslts.setCj+1, y) ;
}
//Now we want to determine the best guess case for identification //This works by Taking all Results that scored above 60% and finding the most occuring strain in the set
//First lets convert all the MALDIIDS with a score above 60 to a strain ID and store them in an arraylist
ArrayList strains = new ArrayListO;
//Since rslsts is already sorted from bottom to top (item 0 being the highest score) we can do a while loop until the score is below 60 int dex=0;
String strainSQL = "SELECT s.strain_id FROM sample s, maldi_tof m, identifier WHERE m.sample_id = s.sample_id AND (";
//This loop will develop a sql statement to grab a list of all the strain ids scorecontainer b = (scorecontainer) rslts.get(O) ; int sc = integer . parselnt(b.getScoreO) ; while ( sc >= 60) { strainSQL += "m.maldi_tof_id = " + b.getMidO + " OR "; dex++; b = (scorecontainer) rslts.get(dex) ; sc = integer . parselnt(b.getScoreO) ; out.writeC'Comparison of: " + request. getParameter("id") + "\tError (ppm) : " + request. getParameterC'ppm") + "\tMass Range: " + Integer . toString(lmass) + " - " + Integer . toString(hmass)) ; out.write("\n"); out. write ("MALDI ID\tDate\tSample\tSample Name\tNotes\tScore\tP val ue\tκ\tk\tn\tn*\ts") ; out.write("\n"); for (int i = 0; i < maxresults & i < rslts.size() ; i++) { scorecontainer x = (scorecontainer) rslts.get(i) ; ResultSet rsltData = dbBean.getMaldiAndSamplelnfo(x.getMidO) ; rsltData. next() ;
String notes = rsltData. getString("notes") ; out.write(x.getMid() + "\t" + rsltData. getString(2) + "\t" + rsltData. getString(l) + "\t" + rsltData. getString(4) + "\t\"" + notes + "\"\t" + x.getScoreO + "\t" + x.getPvalueO + "\t" + x.getuc_k() + "\t" + x.getLc_k() + "\t" + x.getNO + "\t" + x.getNstar() + "\t" + x.getsO); out.write("\n"); rsltData. closeO ; } dbBean.dbCloseO ; %> <%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
Figure imgf000118_0001
<td>
Low Value :&nbsp<input type="text" name=" rangeA" value="<%=rangeA%>"> </td> <td>
Hi gh Val ue : &nbsp<i nput type="text" name=" rangeB" val ue="<%=rangeB%>"> topnum"
Figure imgf000119_0001
href=i nsi 1 i coerrorgraphsal 1 matchandopt . j sp?i dl=<%=request . getParameter("i dl")%>&i d2= <%=request.getParameter("id2")%>&rangeA=<%=request.getParameter("rangeA")%>&rangeB=< %=request.getParameter("rangeB")%>&intensity=<%=request.getParameter("intensity")%>& masserror=<%=request. getParameter("masserror")%>&residue=<%=request. getParameter("re sidue")%> target="_top">Error Graphs All Matches</a>
</td> </tr> <tr>
<td colspan = "3" align = center>
<a href=i nsi 1 i coerrorgraphssi ngl ematchandopt . j sp?i dl=<%=request . getParameter("i dl")%>&i d2=<%=request. getParameter( id2")%>&rangeA=<%=request.getParameter("rangeA")%>&range B=<%=request . getParameter(" rangeB")%>&i ntensi ty=<%=request . getParameter("i ntensi ty") %>&masserror=<%=request. getParameter("masserror")%>&residue=<%=request. getParameter( "residue")%> target="_top">Error Graphs Single Matches</a>
</td> </tr> <tr>
<td colspan = "3" align = center>
<a href=comparemst9msAl 1 Matches . j sp?i dl=<%=request . getParameter("i dl")%>&i d2=<%=request . getParameter("id2")%>&rangeA=<%=request. getParameter("rangeA")%>&rangeB=<%=request. getParameter("rangeB")%>&intensity=<%=request.getParameter("intensity")%>&masserror= <%=request. getParameter("masserror")%>&residue=<%=request. getParameter("residue")%>& topnum=<%=request. getParameter("topnum")%> target="_top">MSMS All Matches</a>
</td> </tr> <tr> <td col span = "3" align = center>
Figure imgf000120_0001
<%@page contentType="text/html "%>
<%@page pageEncodi ng="UTF-8"%>
<%@page import="iava. sql . *" %>
<%@page import="java. util . *" %>
<%@page import="java. text. *" %>
<%@page import="psm.db.box. *" %>
<%@page import="java. util .Date" %>
<%@page import="java. text.DateFormat" %>
<%@page i mport="Java. text. Si mpleDateFormat"%>
<style> table. notes font-size: 100%; posi ti on : absol ute ; visibility: hidden; background: white;
</style>
<script type="text/javascript"> function showmenu(eimnt)
{ document . get El ementByld (el mnt) . styl e . vi si bi 1 i ty="vi si bl e" function hidemenu(elmnt)
{ document . get El ementByld (el mnt) . styl e . vi si bi 1 i ty="hi dden" function switchmnu(elmnt) { if (document. getEl ementByld (el mnt) . style.visibility=="hidden") { document . getEl ementByld (el mnt) . styl e . vi si bi 1 i ty="vi si bl e"
} else { document . getEl ementByld (el mnt) . styl e . vi si bi 1 i ty="hi dden"
} </script>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/> <% boolean calcp = false, calcsc = false, calcscb = false; if (request. getParameterC'calcpval ") != null && request. getParameterC'calcpval ") .compareTo("on") == 0) { calcp = true; if (request. getParameterC'calcscorea") != null && request. getParameterC'calcscorea") .compareTo("on") == 0) { calcsc = true; if (request. getParameterC'calcscoreb") != null && request. getParameterC'calcscoreb") .compareTo("on") == 0) { calcscb = true; if (calcp == false && calcsc == false && calcscb == false) { calcsc = true; long cstart = System. currentTimeMiHisO ; dbBean . dbConnectO ; pageSource. splitTemplatePaqe(dbBean.getUsername() , "MS/MS to <centerxi>In Silico</i> Comparison</center> , "MaldiComparisonTitle", appl i cati on . getReal Path ("/") , dbBean) ; out.write(pageSource.getPageHeaderO) ; dbBean.dbCloseO ;
%>
<table a]ign=center cellpadding="O" cellspacing="0" style="horizontal -align: center; text-align:center"><% int lmass = 4000, hmass = 14000, maxresults = 25, searchtype = 2, intensity=2 ;
String fierror = "2.5", masserror = "5", residue = "All";
/*if (request. getParameter("searchtype") .compareToC'insilico") == 0) searchtype = 0;
} else if (request. getParameter("searchtype") .compareTo("msms") == 0){ searchtype = 1;
}*/ if (request. getParameterC'residue") != "") { residue = request. getParameterC'residue") ; if (request. getParameterC'lMass") != "") { lmass = Integer. parselnt(request. getParameterC'lMass")) ;
if (request. getParameterC'hMass") != "") { hmass = Integer. parselnt(request. getParameterC'hMass")) ;
if (request. getParameterC'masserror") != "") { masserror = request. getParameterC'masserror") ;
if (request. getParameterC'maxresults") != "") { maxresults = Integer. parselnt( request. getParameter ("maxresults")) ;
if (request. getParameterC'intensity") != "") { intensity = integer. parselnt( request. getParameter ("intensity")) ;
if (request. getParameter("fierror") != "") { fierror = request. getParameter("fierror") ;
//Get the sql statement
//String sql SeI = "SELECT ROUND (((SELECT COUNT(*) FROM (select (a. mass + b.mass) / 2 mass from maldiTemp a, maldiτemp2 b where a. intensity > $minlntensity$ AND b. intensity > $minlntensity$ AND a. mass between (b.mass - $error$) and (b.mass + $error$) and a. mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$) m)) * 2 /((select COUNT(*)from maldiTemp a where a. intensity > $minlntensity$ AND a. mass between $lowMass$ and $highMass$ AND a.maldi_tof_id = $cmpr$) +(Select COUNT(*)from maldiτemp2 b where b. intensity > $mi nlntensi ty$ AND b.mass between $lowMass$ and $highMass$ AND b.maldi_tof_id = $cmprτo$)) * 100, 0) score";
String sql SeI = ""; if (calcsc && calcscb) { sql SeI = "SELECT lc_k, uc_k, n, Round (lc_k * 2 / (n + uc_k) * 100, 2) as score, Round(lc_k/ uc_k * 100, 2) as scorebeta FROM (SELECT (SELECT COUNT(*) FROM (select DISTINCT a.mass from maldiTemp a, maldiτemp2 b where a. intensity > $minlntensity$ AND b. intensity > $minlntensity$ AND a.mass between (b.mass - $error$) and (b.mass + $error$) and a.mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$) as m) as lc_k, (Select COUNT(*) as number_in_silico_ions FROM maldiτemp2 b where b.intensity > $minlntensity$ AND b . mass between $l owMass$ and $hi ghMass$ AND b . mal di _tof_i d = $cmprTo$) as n , (sel ect COUNT(*) FROM mal diTemp a where a. i ntensi ty > $mi nlntensi ty$ AND a. mass between $l owMass$ and $hi ghMass$ AND a. mal di_tof_i d = $cmpr$) as uc_k) as tbl " ;
} else if (calcsc) { sqlSel = "SELECT lc_k, uc_k, n, Round (lc_k * 2 / (n + uc_k) *
100, 2) as score FROM (SELECT (SELECT COUNT(*) FROM (select DISTINCT a.mass from maldiTemp a, maldiτemp2 b where a. intensity > $minlntensity$ AND b. intensity > $minlntensity$ AND a.mass between (b.mass - $error$) and (b.mass + $error$) and a.mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b. maldi _tof_id = $cmprTo$) as m) as lc_k, (Select COUNT(*) as number_i n_silico_ions FROM maldiτemp2 b where b. intensity > $minlntensity$ AND b.mass between $lowMass$ and $highMass$ AND b. maldi _tof_id = $cmprTo$) as n, (select COUNT(*) FROM maldiTemp a where a. intensity > $minlntensity$ AND a.mass between $lowMass$ and $highMass$ AND a.maldi_tof_id = $cmpr$) as uc_k) as tbl";
} else if(calcscb) { sqlSel = "SELECT lc_k, uc_k, n, Round (lc_k/ uc_k * 100, 2) as scorebeta FROM (SELECT (SELECT COUNT(*) FROM (select DISTINCT a.mass from maldiTemp a, maldiτemp2 b where a. intensity > $mi nlntensi ty$ AND b. intensity > $minlntensity$ AND a.mass between (b.mass - $error$) and (b.mass + $error$) and a.mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$) as m) as lc_k, (Select COUNT(*) as number_i n_silico_ions FROM maldiτemp2 b where b. intensity > $minlntensity$ AND b.mass between $lowMass$ and $highMass$ AND b. maldi _tof_id = $cmprTo$) as n, (select COUNT(*) FROM maldiTemp a where a. intensity > $minlntensity$ AND a.mass between $lowMass$ and $highMass$ AND a.maldi_tof_id = $cmpr$) as uc_k) as tbl";
} else if(calcp) {
SqlSel = "SELECT lc_k, UC_k, n FROM (SELECT (SELECT COUNT(*)
FROM (select DISTINCT a.mass from maldiTemp a, maldiτemp2 b where a. intensity > $mi nlntensi ty$ AND b. intensity > $minlntensity$ AND a.mass between (b.mass - $error$) and (b.mass + $error$) and a.mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b. maldi _tof_id = $cmprTo$) as m) as lc_k, (Select COUNT(*) as number_in_silico_ions FROM maldiτemp2 b where b. intensity > $mi nlntensi ty$ AND b.mass between $lowMass$ and $highMass$ AND b. maldi _tof_id = $cmprTo$) as n, (select COUNT(*) FROM maldiTemp a where a. intensity > $mi nlntensi ty$ AND a.mass between $lowMass$ and $highMass$ AND a.maldi_tof_id = $cmpr$) as uc_k) as tbl";
}
//Get the array maldi ID list sqlSel = sqlSel . replace("$minlntensity$", integer . toString(intensity)) ; sqlSel = sqlSel . replace("$error$" , fierror); sqlSel = sqlSel . replace("$lowMass$" , Integer . toString(lmass)) ; sqlSel = sqlSel . replace("$highMass$", Integer . toString(hmass)) ;
ArrayList mID = dbBean. getAll InSi licoDataID( request. getParameter ("andor") , request. getParameter ("i den tifier") , request. getParameter ("genus ) , request. getParameter ("species") , request. getPa rameter(" subspecies") , request. getParameter ("other") , request. getParameter ("protein") , request. getParameter ("notes") , request. getParameter ("mass") , request. getParameter ("masse rror")) ;
ArrayLi st rsl ts = new ArrayLi stO ;
//connect to the database dbBean . dbConnectO ;
//To make the search faster we are going to dump all the data into the maldi temp table
//this table is stored in memory which makes it a lot faster and it also normalizes teh data int maldi Templd = dbBean. dumpMSMSDataToTemp (Integer, parselnt( request. getParameter ("id")) , intensity, lmass, hmass, "maldi temp") ; dbBean. dbCloseO ; dbBean . dbConnectO ;
//Loop through each ID and compare it sqlSel = sqlSel . replace("$cmpr$" , Integer. toString(maldiTempld)) ;
//Used in the pvalue calculation double nstar = (Double. parseDouble(request.getParameter("mass")) - lmass) / (Double. parseDouble (request. getParameter ("fi error") )*2.0) ; int lstProteinSize = mlD.sizeO; for (int i = 0; i < lstProteinSize; i++) {
String 1 = "";
1 += mlD.get(i) ;
//if (1.compareTo(request.getParameter("id")) == 0 ) { continue; } int cmprTold; cmprTold = dbBean. dumpINSILICODataToTemp(lnteger . parselnt(l) , intensity, lmass, hmass, "malditemp2" , request. getParameter("residue")) ;
String tmp = sqlSel . replace("$cmprTo$" , Integer . toString(cmprTold) );
ResultSet myRS = dbBean. getRS(tmp) ; myRS. next() ;
String USDABeta = "0"; String USDAAl pha = "0"; if (calcsc) {
USDAAl pha = myRS.getStringC'score");
if(cal cscb) {
USDABeta = myRS.getStringC'scorebeta") ;
if(calcp) { rslts.add(new scorecontainer(l , USDAAlpha, USDABeta, myRS.getInt("lc_k"), myRS.getInt("uc_k") , myRS.getInt("n") , nstar));
} else { rslts.add(new scorecontainer(l , USDAAlpha, USDABeta)); myRS.closeO ; dbBean . del eteMaldiTempData (cmprTold, "maldi temp2") ;
//now delete the maldiTemp data to free up the memory dbBean . del eteMal diTempData(mal diTempld , "mal di temp") ; mID = null ;
//Sort the array, this is a simple bubble sort algorithm for (int i = 0 ; i< rslts. size Q ; i++) { for (int j=0; j < (rslts. size() - 1 - i) ; j++) { scorecontainer x,y; x = (scorecontainer) rslts. get(j + 1); y = (scorecontainer) rslts. get(j) ; double mlntl, mlnt2; if ((calcsc == false && calcscb == false) | | (calcp && request. getParameterC'sort") .compareToC'pval ") == O)) { mlnt2 = x.getPvalue() ; mlntl = y.getPvalueO ;
}else if ((calcsc == false && calcp == false) | | calcscb && request. getParameterC'sort") .compareToC'scoreb") == 0) { mlntl = Double. parseDouble(x.getScorebeta()) ; mlnt2 = Double. parseDouble(y.getScorebetaO) ; } else { mlntl = Double. parseDouble(x.getScoreO) ; mlnt2 = Double. parseDouble(y.getScoreO) ; if ( mlntl > mlnt2 ) { r sits. set (j , x) ; rslts.set(j+l, y) ;
} } long cfinish = System. cur rentTi meMilli s() ; long timeToExec = cfinish - cstart;
%>
href="comparemsm quest . getParameter("i =requ est. getParameter =<%=r equest . getParame =<%=r equest. getParame fi err or=<%=request. ge andor =<%=request. getP ier") %>&genus=<%=requ ecies ")%>&subspeci es= amete r("other")%>&pro arame ter("notes")%>">
Figure imgf000125_0001
ID&nbsp;</span>
</td>
<td>
<span style="font-weight: bold;" >&nbsp; identifier :&nbsp;</span>
</td>
<td>
<span style="font-weight: bold; ">&nbsp; Sample Name:&nbsp;</span>
</td>
<td>
<span styl e="font-wei ght : bol d ; ">&nbsp ; Protei n : &nbsp ; </span>
</td>
<td>
Figure imgf000126_0001
<%@page contentType="text"%x%@page pageEncodi ng="UTF-8"%x%@page i mport=" Java. sql . *" %x%@page i mport="java. uti l . *" %x%@page i mport="java. text . *"
%x%@page i mport="psm . db . box . *" %><j sp : useBean i d="dbBean" cl ass="psm . db . dbAccess" scope="sessi on"/x% i nt l mass = 4000 , hmass = 14000 , maxresul ts = 25 , searchtype = 2 , i ntensi ty=2 ;
Stri ng fi error = "2 . 5" , masserror = "5" ;
/*i f (request . getParameter("searchtype") . compareToC'i nsi l i co") == 0) searchtype = 0;
} el se i f (request . getParameter("searchtype") . compareTo("msms") == OM searchtype = 1; }*/ if (request. getParameter("lMass") != "") { lmass = Integer . parselnt(request.getParameter("lMass")) ;
if (request. getParameterC'hMass") != "") { hmass = Integer . parselnt(request. getParameterC'hMass")) ;
if (request. getParameterC'masserror") != "") { masserror = request. getParameterC'masserror") ;
if (request. getParameterC'maxresults") != "") { maxresults = Integer. parselnt( request. getParameter ("maxresults")) ;
if (request. getParameterC'intensity") != "") { intensity = integer. parselnt( request. getParameter ("intensity")) ;
i f (request . getParameterC'fi error") ! = "") { fi error = request . getParameterC'fi error") ;
//Get the sql statement
//String sql SeI = "SELECT ROUND (((SELECT COUNT(*) FROM (select (a. mass + b.mass) / 2 mass from maldiTemp a, maldiτemp2 b where a. intensity > $mi nlntensi ty$ AND b. intensity > $minlntensity$ AND a. mass between (b.mass - $error$) and (b.mass + $error$) and a. mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$) m)) * 2 /((select COUNT(*)from maldiTemp a where a. intensity > $minlntensity$ AND a. mass between $lowMass$ and $highMass$ AND a.maldi_tof_id = $cmpr$) +(Select COUNT(*)from maldiτemp2 b where b. intensity > $mi nlntensi ty$ AND b.mass between $lowMass$ and $highMass$ AND b.maldi_tof_id = $cmprτo$)) * 100, 0) score";
String sql SeI = "SELECT lc_k, uc_k, n, Round(lc_k * 2 / (n + uc_k) * 100, 0) as score FROM (SELECT (SELECT COUNTC*) FROM (select DISTINCT a.mass from maldiTemp a, maldiτemp2 b where a. intensity > $minlntensity$ AND b. intensity > $mi nlntensi ty$ AND a.mass between (b.mass - $error$) and (b.mass + $error$) and a.mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$) as m) as lc_k, (Select COUNT(*) as number_i n_silico_ions FROM maldiτemp2 b where b. intensity > $mi nlntensi ty$ AND b.mass between $lowMass$ and $highMass$ AND b.maldi_tof_id = $cmprTo$) as n, (select COUNT(*) FROM maldiTemp a where a. intensity > $mi nlntensi ty$ AND a.mass between $lowMass$ and $highMass$ AND a.maldi_tof_id = $cmpr$) as uc_k) as tbl";
//Get the array maldi ID list sqlSel = sqlSel . replace("$minlntensity$" , integer. toString(i intensity)) ; sqlSel = sqlSel . replace("$error$", fierror); sqlSel = sqlSel . replace("$lowMass$" , Integer. toString(lmass)) ; sqlSel = sqlSel . replace("$highMass$" , Integer. toString(hmass)) ;
ArrayList mID = dbBean . getAl 11nSilicoDataID( request. getParameter("andor") , request. getParameter("iden tifier") , request. getParameter ("genus ) , request. getParameter ("species") , request. getPa rameter(" subspecies") , request. getParameter ("other") , request. getParameter ("protein") , request. getParameter ("notes") , request. getParameter ("mass") , request. getParameter ("masse rror")) ;
ArrayList rslts = new Arrayl_ist() ;
//connect to the database dbBean . dbConnectO ;
//To make the search faster we are going to dump all the data into the malditemp table
//this table is stored in memory which makes it a lot faster and it also normalizes teh data int maldiTempld = dbBean. dumpMSMSDataToTemp (Integer. parselnt( request. getParameter ("id")) , intensity, lmass, hmass, "malditemp"); dbBean. dbCloseO ; dbBean . dbConnectO ;
//Loop through each ID and compare it sqlSel = sqlSel . replace("$cmpr$" , Integer . toString(maldiTempld)) ;
//Used in the pvalue calculation double nstar = (Double. parseDouble(request.getParameter("mass")) - lmass) / (Double. parseDouble (request. getParameter("fi error") )*2.0) ; for (int i = 0; i < mlD.sizeO; i++) {
String 1 = "";
1 += mlD.get(i) ;
//if (1.compareTo(request.getParameter("id")) == 0 ) { continue; } int cmprTold; cmprTold = dbBean. dumpINSILICODataToTemp(lnteger . parselnt(l) , intensity, lmass, hmass, "malditemp2") ;
String tmp = sqlSel . replace("$cmprTo$" , Integer . toString(cmprTold) );
ResultSet myRS = dbBean. getRS(tmp) ; myRS. next() ; rslts. add(new scorecontainer(l , myRS.getStringC'score") , myRS.getInt("lc_k"), myRS.getInt("uc_k") , myRS.getInt("n") , nstar)); myRS.closeO ; dbBean . del eteMal diTempData(cmprTold , "mal di temp2") ;
//now delete the maldiTemp data to free up the memory dbBean . del eteMal di TempData(mal di Templd , "mal di temp") ; mID = null ;
//Sort the array, this is a simple bubble sort algorithm for (int i = 0 ; i< rslts. size Q ; i++) { for (int j=0; j < (rslts. size() - 1 - i) ; j++) { scorecontainer x,y; x = (scorecontainer) rslts. get(j + 1); y = (scorecontainer) rslts. get(j) ; double mlntl, mlnt2; if (request. getParameterC'sort") .compareToC'pval ") == 0) { mlnt2 = x.getPvalueO ; mlntl = y.getPvalueO ; } else { mlntl = integer. parselnt(x.getScoreO) ; mlnt2 = integer. parselnt(y.getScoreO) ; if ( mlntl > mlnt2 ) { rslts. set(j, x) ; rslts.set(j+l, y) ;
out.writeC'Comparison of: " + request. getParameter("id") + "\tError (daltons): " + request. getParameter("masserror") + "\tMass Range: " + Integer .toString(lmass) + " - " + Integer. toString(hmass)) ; out.write("\n"); out.wri te("ln Silico ID\tldentifier\tSample Name\tProtein\tAverage MW\tScore\tP val ue\tκ\tk\tn\tn*\ts") ; out.write("\n"); for (int i = 0; i < maxresults & i < rslts. si ze() ; i++) { scorecontainer x = (scorecontainer) rslts. get(i) ; ResultSet rsltData = dbBean . getlnSilicoAndSamplelnfo(x. getMidO) ; rsltData. next O ; String notes = rsltData. getStringC'protein") ; out.write(x.getMid() + "\t" + rsltData. getString(l) + "\t" + rsltData. getString(3) + "\t" + notes + "\t" + rsltData. getString("average_mw") + "\t" + x.getScoreO + "\t" + x.getPvalueO + "\t" + x.getuc_k() + "\t" + x.getLc_k() + "\t" + x.getNO + "Yt" + x.getNstarO + "\t" + x.getSO); out.write("\n"); rsltData. closeC) ;
} dbBean. dbCloseO ;
%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
Figure imgf000130_0001
<td>
Low Value :&nbsp<input type="text" name=" rangeA" value="<%=rangeA%>"> </td> <td>
Hi gh Val ue :&nbsp<i nput type="text" name="rangeB" val ue="<%=rangeB%> > </td>
Figure imgf000131_0001
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%> <%@page import="iava. sql . *" %> <%@page import="java. util . *" %> <%@page import="java. text. *" %> <%@page import="psm.db.box. *" %>
<style> table. notes
{ font-size: 100%; posi ti on : absol ute ; visibility: hidden; background : whi te ;
</style>
<script language="JavaScript"> functi on setectAl 1 (c) { for(i=l; i < c. length; i++) c[i] .checked=c[O] .checked;
</script>
<script type="text/javascript"> function showmenu(elmnt)
{ document . get El ementByld (el mnt) . styl e . vi si bi 1 i ty="vi si bl e" function hidemenu(elmnt)
{ document . get El ementByld (el mnt) . styl e . vi si bi 1 i ty="hi dden" function switchmnu(elmnt) { if (document. get El ementByld (el mnt) . s tyl e. vi si bility==" hidden") { document . get El ementByld (el mnt) . styl e . vi si bi 1 i ty="vi si bl e"
} else { document. getEl ementByld(el mnt) . style. vi sibili ty="hidden"
} </script>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/> <% dbBean . dbConnectO ; pageSource. s pi itTempl ate Page (dbBean. getUsernameO , "MS/MS-MS/MS Comparison" , "MaI di Compari sonTi tl e" , appl i cati on . getReal Path ("/") , dbBean) ; out. write (pageSource. get PageHeader ()) ; dbBean. dbCloseO ; %>
<table align=center cellpadding="O" cellspacing="0" styl e="horizontal -align: center; text-align: center" width=100%> <form name="myForm"> <trxtd colspan=8>
<table align=center cellpadding="O" cellspacing="0" styl e="horizontal -align: center; text-align:center">
<tr>
<td>Low Value:&nbsp</td> <td>
<input type="text" name="rangeA" value="<%=request.getParameter("lMass") %>" size="5">
</td>
<td>High Value:&nbsp</td> <td> <input type="text" name="rangeB" value="<%=request.getParameter("hMass")%>" size="5">
</td>
<td>Label ed val ues : &nbsp</td> <td C9l span=2 al i gn=l eft>
<input type="text" name="topnum" value="5" size="2">
</td> </tr>
Figure imgf000133_0001
<td colspan=2>&nbsp;<input type="button" value="Subtraction" onclick="document .myForm. action=' subtractionmsmsgraph . jsp1 ; document .myForm. target='_
Figure imgf000133_0002
<td colspan=9>&nbsp;</td> </tr> </table> </tdx/tr> <% int lmass = 4000, hmass = 14000, maxresults = 25, searchtype = 2, intensity=2 ;
String fierror = "2.5", masserror = "5";
/*if (request. getParameter("searchtype") .compareToC'insilico") == 0) searchtype = 0; } el se i f (request . getParameter ("searchtype") . compareTo("msms") == OM searchtype = 1; }*/ if (request. getParameterC'lMass") != "") { lmass = Integer. parselnt(request. getParameterC'lMass")) ;
if (request. getParameterC'hMass") != "") { hmass = Integer. parselnt(request. getParameterC'hMass")) ;
if (request. getParameterC'masserror") != "") { masserror = request. getParameterC'masserror") ;
if (request. getParameterC'maxresults") != "") { maxresults = Integer. parselnt( request. getParameter ("maxresults")) ;
if (request. getParameterC'intensity") != "") { intensity = integer. parselnt( request. getParameter ("intensity")) ;
i f (request . getParameter ("fi error") ! = " ") { fi error = request . getParameter ("fi error") ;
//Get the sql statement
//String sql SeI = "SELECT ROUND (((SELECT COUNT(*) FROM (select (a. mass + b.mass) / 2 mass from maldiTemp a, maldiτemp2 b where a. intensity > $mi nlntensi ty$ AND b. intensity > $minlntensity$ AND a. mass between (b.mass - $error$) and (b.mass + $error$) and a. mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$) m)) * 2 /((select COUNT(*)from maldiTemp a where a. intensity > $minlntensity$ AND a. mass between $lowMass$ and $highMass$ AND a.maldi_tof_id = $cmpr$) +(Select COUNT(*)from maldiτemp2 b where b. intensity > $mi nlntensi ty$ AND b.mass between $lowMass$ and $highMass$ AND b.maldi_tof_id = $cmprτo$)) * 100, 0) score";
String sql SeI = "SELECT lc_k, uc_k, n, Round(lc_k * 2 / (n + uc_k) * 100, 0) as score FROM (SELECT (SELECT COUNT(*) FROM (select DISTINCT a.mass from maldiTemp a, maldiτemp2 b where a. intensity > $minlntensity$ AND b. intensity > $mi nlntensi ty$ AND a.mass between (b.mass - $error$) and (b.mass + $error$) and a.mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$) as m) as lc_k, (Select COUNT(*) as number_in_silico_ions FROM maldiτemp2 b where b. intensity > $mi nlntensi ty$ AND b.mass between $lowMass$ and $highMass$ AND b.maldi_tof_id = $cmprTo$) as n, (select COUNT(*) FROM maldiTemp a where a. intensity > $mi nlntensi ty$ AND a.mass between $lowMass$ and $highMass$ AND a.maldi_tof_id = $cmpr$) as uc_k) as tbl";
//Get the array maldi ID list sqlSel = sqlSel replace("$mi nlntensi ty$" , integer . toString(intensity)) ; sqlSel = sqlSel replace("$error$" , fierror); sqlSel = sqlSel replace("$lowMass$" , integer . toSt ring (lmass)) ; sqlSel = sqlSel replace("$highMass$" , Integer . toSt ring (hmass)) ;
ArrayList mID = dbBean . getAllMSMSDataID( request. getParameter("andor") , request. getParameter("identifi er") , request. getParameter ("genus") , request. getParameter ("species") , request. getParame ter(" subspecies") , request. getParameter ("other") , request. getParameter ("protei n") , requ est. getParameter ("notes") , request. getParameter ("mass") , request. getParameter ("masse rror")) ;
ArrayList rslts = new ArrayListO; //connect to the database dbBean . dbConnectO ;
//To make the search faster we are going to dump all the data into the malditemp table
//this table is stored in memory which makes it a lot faster and it also normalizes teh data int maldiTempld = dbBean. dumpMSMSDataToTemp (Integer, parselnt( request. getParameter ("id")) , intensity, lmass, hmass, "malditemp"); dbBean. dbCloseO ; dbBean . dbConnectO ;
//Loop through each ID and compare it sqlSel = sqlSel . replace("$cmpr$" , Integer . toString(maldiTempld)) ;
//Used in the pvalue calculation double nstar = (Double. parseDouble(request.getParameter("mass")) - lmass) / (Double. parseDouble (request. getParameter("fi error") )*2.0) ; for (int i = 0; i < mlD.sizeO; i++) {
String 1 = "";
1 += mlD.get(i) ;
//if (1.compareTo(request.getParameter("id")) == 0 ) { continue; } int cmprTold; cmprTold = dbBean. dumpMSMSDataToTemp(lnteger . parselnt(l) , intensity, lmass, hmass, "malditemp2") ;
String tmp = sqlSel . replace("$cmprTo$" , Integer . toString(cmprTold) );
ResultSet myRS = dbBean. getRS(tmp) ; myRS. next() ; rslts. add(new scorecontainer(l , myRS.getStringC'score") , myRS.getInt("lc_k"), myRS.getInt("uc_k") , myRS.getInt("n") , nstar)); myRS.closeO ; dbBean . del eteMaldiTempData (cmprTold, "maldi temp2") ;
//now delete the maldiTemp data to free up the memory dbBean . del eteMal diTempData(mal diTempld , "mal di temp") ; mID = null ;
//Sort the array, this is a simple bubble sort algorithm for (int i = 0 ; i< rslts. size Q ; i++) { for (int j=0; j < (rslts. size() - 1 - i) ; j++) { scorecontainer x,y; x = (scorecontainer) rslts. get(j + 1); y = (scorecontainer) rslts. get(j) ; double mlntl, mlnt2; if (request. getParameterC'sort") .compareToC'pval ") == 0) { mlnt2 = x.getPvalue() ; mlntl = y.getPvalueO ; } else { mlntl = integer . parselnt(x.getScoreO) ; mlnt2 = integer . parselnt(y.getScoreO) ; if ( mlntl > mlnt2 ) { rslts. set(j, x) ; rslts. set(j+l, y) ; %>
<trxtd colspan=9>
<a href="comparemsmstomsmssampletextonly. jsp?rm=<%=request. getParameter("rm")%>&id=<%=r equest. getParameter("id")%>&irιtensity=<%=request. getParameter("intensity")%>&lMass=< %=request. getParameter("1 Mass")%>&hMass=<%=request, getParameter("hMass")%>&maxresult s=<%=request.getParameter("maxresults")%>&date=<%=request.getParameter("date")%>&mas s=<%=request. getParameter("mass")%>&masserror=<%=request. getParameterC"masserror")%> &fierror=<%=request.getParameter("fi error")%>&sort=<%=request. getParameter("sort")%> &andor=<%=request.getParameter("andor")%>&identifier=<%=request.getParameter("identi fier")%>&genus=<%=request.getParameter("genus")%>&species=<%=request.getParameter("s pecies")%>&subspecies=<%=request.getParameter("subspecies")%>&other=<%=request.getPa rameter("other")%>&protein=<%=request.getParameter("protein")%>&notes=<%=request.get Parameter("notes")%>">Downloadable Text Format</a> </tdx/tr> <tr>
<td>
<input type=checkbox name="checkid" onclick="selectAll (thi s . form. checkid) ; ">
</td> <td>
<span style="font-weight: bold; ">&nbsp; MS/MS lD&nbsp;</span> </td> <td>
<span style="font-weight: bold;" >&nbsp; identifier :&nbsp;</span> </td> <td>
<span style="font-weight: bold; ">&nbsp; Sample Name:&nbsp;</span> </td> <td>
<span styl e="font-wei ght : bol d ; ">&nbsp ; Protei n : &nbsp ; </span> </td> <td>
<span styl e="font-wei ght: bold; ">&nbsp;Score:&nbsp;</span> </td> <td>
<span styl e="font-wei ght: bol d ; ">&nbsp ; <i >P</i > : &nbsp ; </span>
</td> <td>
<span styl e="font-wei ght: bold; ">&nbsp;Compare:&nbsp;</span> </td> </tr> <%
Decimal Format df = new Decimal Format("0.θEθ") ; for (int i = 0; i < maxresults & i < rslts.size() ; i++) { scorecontainer x = (scorecontainer) rslts.get(i) ;
ResultSet rsltData = dbBean.getMSMSAndSamplelnfo(x.getMidO) ; rsltData. next() ;
String notes = rsltData. getStringC'protein") + "<br>" + rsltData.getString("precursor_ion_mtoz") ;
String notesfull = notes;
String popuptbl ; popuptbl = "<table bordercolor=black CeIIsPaCiIIg=1O1 cellpadding='O' border='l' class=' notes ' id='" + x.getMid() + '" width=' 300'xtrxtd style=\"vertical-align: top; text-align: center; background-color: rgb(36, 147, 184);\">" + notesfull + "</tdx/trx/table>" ;
String popuptbl2 = "<table bordercolor=black cellspacing='O' cellpaddin^'O1 border='l' class=' notes ' id='" + x.getMid() + "b1 width='25O ><trxtd styl e=\"vertical -align: top; text-align: Left; background-color: rgb(36, 147, 184) ;\"><i>P</i> Value: " + x.getPvalueQ + "<br>K: " + x.getUc_k() + "<br>k: " + x.getLc_k() + "<br>n: " + x.getN() + "<br>n*: " + x.getNstarO + "<br>s: " + x.getsO + "</tdx/trx/table>"; if (notes == null | | notes. compareTo("") == 0) { notes= ""; }else { if (notes. lengthO > 8) { notes = "&nbsp;" + notes. substring(0,8) ; } else { notes = "&nbsp;" + notes;
}
String outstr = "<trxtd $color$xinput type=checkbox name='checkidl value='" + x.getMidO + "'x/tdxtd $color$xa href='msmsdatawi thgraph . jsp?msmsid=" + x.getMidO + '">" + x.getMid() + "</ax/tdxtd $color$>" + rsltData.getString(l) + "</tdxtd $color$>" + rsltData.getString(4) + "</tdxtd $color$ onmouseout=\"hidemenu(' " + x.getMidO + "')\"><a href=' iavascript:void(0) ; ' onmouse9ver=\"showmenu(' " + x.getMidO + '")\">" + notes + "</a> ' + popuptbl + "</tdxtd align=center $color$>" + x.getScoreO + "</tdxtd align=left $color$xa href=' javascript:void(0) ; ' onclick=\"switchmnu(' " + x.getMidO + b')\">" + df .format (x.getPvalue Q) + "</a>" + popuptbl2 + "</tdxtd $color$xa href=lcomparemsmstomsmsgraphs. jsp?idl=" + request. getParameter("id") + "&id2=" + x.getMidO + "&rangeA=" + lmass + "&rangeB=" + hmass + " '>Graphs</a>" + "</tdx/tr>"; if (request. getParameter("id") .compareTo (x.getMidO) == 0) { outstr = outstr. replaceC'ScolorS" , "style='background-color: rgb(251, 175, 55); 1 M);
} else { outstr = outstr. replaceC'ScolorS", ""); out.write(outstr) ; rsltData.closeO ; dbBean.dbCloseO ; %>
</table> </form> <%out.write(pageSource.getPageFooter()) ; %>
<%@page contentType="text"%x%@page pageEncodi ng="UTF-8"%x%@page i mport=" Java. sql . *" %x%@page i mport="java. uti l . *" %x%@page i mport="java. text . *"
%x%@page i mport="psm . db . box . *" %><j sp : useBean i d="dbBean" cl ass="psm . db . dbAccess" scope="sessi on"/x% i nt l mass = 4000 , hmass = 14000 , maxresul ts = 25 , searchtype = 2 , i ntensi ty=2 ;
Stri ng fi error = "2 . 5" , masserror = "5" ;
/*i f (request . getParameter("searchtype") . compareToC'i nsi l i co") == 0) searchtype = 0;
} el se i f (request . getParameter("searchtype") . compareTo("msms") == OM searchtype = 1; }*/ if (request. getParameter("lMass") != "") { lmass = Integer . parselnt(request.getParameter("lMass")) ;
if (request. getParameterC'hMass") != "") { hmass = Integer . parselnt(request. getParameterC'hMass")) ;
if (request. getParameterC'masserror") != "") { masserror = request. getParameterC'masserror") ;
if (request. getParameterC'maxresults") != "") { maxresults = Integer. parselnt( request. getParameter ("maxresults")) ;
if (request. getParameterC'intensity") != "") { intensity = integer. parselnt( request. getParameter ("intensity")) ;
i f (request . getParameterC'fi error") ! = "") { fi error = request . getParameterC'fi error") ;
//Get the sql statement
//String sql SeI = "SELECT ROUND (((SELECT COUNT(*) FROM (select (a. mass + b.mass) / 2 mass from maldiTemp a, maldiτemp2 b where a. intensity > $mi nlntensi ty$ AND b. intensity > $minlntensity$ AND a. mass between (b.mass - $error$) and (b.mass + $error$) and a. mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$) m)) * 2 /((select COUNT(*)from maldiTemp a where a. intensity > $minlntensity$ AND a. mass between $lowMass$ and $highMass$ AND a.maldi_tof_id = $cmpr$) +(Select COUNT(*)from maldiτemp2 b where b. intensity > $mi nlntensi ty$ AND b.mass between $lowMass$ and $highMass$ AND b.maldi_tof_id = $cmprτo$)) * 100, 0) score";
String sql SeI = "SELECT lc_k, uc_k, n, Round(lc_k * 2 / (n + uc_k) * 100, 0) as score FROM (SELECT (SELECT COUNTC*) FROM (select DISTINCT a.mass from maldiTemp a, maldiτemp2 b where a. intensity > $minlntensity$ AND b. intensity > $mi nlntensi ty$ AND a.mass between (b.mass - $error$) and (b.mass + $error$) and a.mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$) as m) as lc_k, (Select COUNT(*) as number_i n_silico_ions FROM maldiτemp2 b where b. intensity > $mi nlntensi ty$ AND b.mass between $lowMass$ and $highMass$ AND b.maldi_tof_id = $cmprTo$) as n, (select COUNT(*) FROM maldiTemp a where a. intensity > $mi nlntensi ty$ AND a.mass between $lowMass$ and $highMass$ AND a.maldi_tof_id = $cmpr$) as uc_k) as tbl";
//Get the array maldi ID list sqlSel = sqlSel . replace("$minlntensity$" , integer. toString(i intensity)) ; sqlSel = sqlSel . replace("$error$", fierror); sqlSel = sqlSel . replace("$lowMass$" , Integer. toString(lmass)) ; sqlSel = sqlSel . replace("$highMass$" , Integer. toString(hmass)) ;
ArrayList mID = dbBean . getAllMSMSDataID( request. getParameter("andor") , request. getParameter("identifi er") , request. getParameter ("genus ) , request. getParameter ("species") , request. getParame ter(" subspecies") , request. getParameter ("other") , request. getParameter ("protein") , requ est. getParameter ("notes") , request. getParameter ("mass") , request. getParameter ("masse rror")) ;
ArrayList rslts = new Arrayl_ist() ;
//connect to the database dbBean . dbConnectO ;
//To make the search faster we are going to dump all the data into the malditemp table
//this table is stored in memory which makes it a lot faster and it also normalizes teh data int maldiTempld = dbBean. dumpMSMSDataToTemp (Integer. parselnt( request. getParameter ("id")) , intensity, lmass, hmass, "malditemp"); dbBean. dbCloseO ; dbBean . dbConnectO ;
//Loop through each ID and compare it sqlSel = sqlSel . replace("$cmpr$" , Integer . toString(maldiTempld)) ;
//Used in the pvalue calculation double nstar = (Double. parseDouble(request.getParameter("mass")) - lmass) / (Double. parseDouble (request. getParameter("fi error") )*2.0) ; for (int i = 0; i < mlD.sizeO; i++) {
String 1 = "";
1 += mlD.get(i) ;
//if (1.compareTo(request.getParameter("id")) == 0 ) { continue; } int cmprTold; cmprTold = dbBean. dumpMSMSDataToTemp(lnteger . parselnt(l) , intensity, lmass, hmass, "malditemp2") ;
String tmp = sqlSel . replace("$cmprTo$" , Integer . toString(cmprTold) );
ResultSet myRS = dbBean. getRS(tmp) ; myRS. next() ; rslts. add(new scorecontainer(l , myRS.getStringC'score") , myRS.getInt("lc_k"), myRS.getInt("uc_k") , myRS.getInt("n") , nstar)); myRS.closeO ; dbBean . del eteMal diTempData(cmprTold , "mal di temp2") ;
//now delete the maldiTemp data to free up the memory dbBean . del eteMal di TempData(mal di Templd , "mal di temp") ; mID = null ;
//Sort the array, this is a simple bubble sort algorithm for (int i = 0 ; i< rslts. size Q ; i++) { for (int j=0; j < (rslts. size() - 1 - i) ; j++) { scorecontainer x,y; x = (scorecontainer) rslts. get(j + 1); y = (scorecontainer) rslts. get(j) ; double mlntl, mlnt2; if (request. getParameterC'sort") .compareToC'pval ") == 0) { mlnt2 = x.getPvalueO ; mlntl = y.getPvalueO ; } else { mlntl = integer. parselnt(x.getScoreO) ; mlnt2 = integer. parselnt(y.getScoreO) ; if ( mlntl > mlnt2 ) { rslts. set(j, x) ; rslts.set(j+l, y) ;
out.writeC'Comparison of: " + request. getParameter("id") + "\tError (daltons): " + request. getParameter("masserror") + "\tMass Range: " + Integer .toString(lmass) + " - " + Integer. toString(hmass)) ; out.write("\n"); out. write ("MS/MS ID\tldentifier\tSample Name\tProtei n\tAverage MW\tScore\tP val ue\tκ\tk\tn\tn*\ts") ; out.write("\n"); for (int i = 0; i < maxresults & i < rslts. si ze() ; i++) { scorecontainer x = (scorecontainer) rslts. get(i) ;
ResultSet rsltData = dbBean.getMSMSAndSamplelnfo(x.getMidO) ; rsltData. next() ;
String notes = rsltData. getStringC'protein") ; out.write(x.getMid() + "\t" + rsltData. getString(l) + "\t" + rsltData. getString(3) + "\t" + notes + "\t" + rsltData. getString("precursor_ion_mtoz") + "\t" + x.getScoreO + "\t" + x.getPvalueO + "\t" + x.getuc_k() + "\t" + x.getLc_k() + "\t" + x.getN() + "\t" + x.getNstarO + "\t" + x.getsO); out.write("\n"); rsltData. closeC) ;
} dbBean.dbCloseO ;
%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<%@page import="java. sql . *" %>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/> <jsp:useBean id="gBean" class="psm. graph. maldiGraph"/> <! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
Figure imgf000141_0001
} myRS. close () ; dbBean.dbCloseO ; %>
</td> </tr> <tr> <td C9lspan="3">
<img src="msmsgraphsmallAl 1 Matches . j sp?i dl=<%=request . getParameter ("i dl")%>&i d2=<%=reques t . getParameter("id2")%>&rangeA=<%=request . getParameter ("rangeA")%>&ranqeB=<%=request . getParameter ("rangeB")%>&intensity=<%=request. getParameter ("intensity )%>&masserror =<%=request. getParameter ("masse rror")%>&residue=<%=request. getParameter ("residue")%> &topnum=<%=request.getParameter("topnum")%>"> </td> </tr> <tr>
<td>
Low Value :&nbsp<input type="text" name="rangeA" value="<%=rangeA%>"> </td> <td>
High VaI ue:&nbsp<i nput type="text" name="rangeB" val ue="<%=rangeB%> > </td> <td>
Number of Values Labeled: <input type="text" name="topnum" val ue="<%=topnum%>">
</td> </tr> <tr>
<td>
Residue:&nbsp<input type="text" name="residue" value="<%=request.getParameter("residue")%>" readonly> </td> <td>
Mass ToI erance:<i nput type="text" name="masserror" val ue="<%=request. getParameter("masserror")%>" readonly> </td> <td> lntensity:<input type="text" name="intensity" val ue="<%=request . getParameter ("i ntensi ty")%>" readonl y>
</td> </tr> <tr>
<td col span ="1"> <br>
In Silico ID:&nbsp <input type="text" name="id2" value="<%=request.getParameter("id2")%>" readonl y> </td> <td colspan ="2">
MS/MS lD:&nbsp <input type="text" name="idl" value= <%=request.getParameter("idl")%> readonl y>
</td> </tr> <tr>
<td col span = 3 al i gn = ri ght> <i nput type=submi t val ue="Rel oad"> </tr>
</table> </form> </body> </html> <%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<%@page import="java. sql . *" %>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/> <jsp:useBean id="gBean" class="psm. graph. maldiGraph"/> <! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
Figure imgf000143_0001
} myRS. close () ; dbBean.dbCloseO ; %>
</td> </tr> <tr> <td C9lspan="3">
<img src="msmsgraphsmal 1 Si ngl eMatches . j sp?i dl=<%=request . getParameter ("i dl")%>&i d2=<%=req uest.getParameter("id2")%>&rangeA=<%=request.getParameter("rangeA")%>&rangeB=<%=requ est . getParameter (" rangeB")%>&i ntensi ty=<%=request . getParameter ("i ntensi ty )%>&masser ror=<%=request. getParameter ("masse rror")%>&residue=<%=request, getParameter ("residue" )%>&topnum=<%=request. getParameter ("topnum")%>"> </td> </tr> <tr>
<td>
Low Value :&nbsp<input type="text" name="rangeA" value="<%=rangeA%>"> </td> <td>
High VaI ue:&nbsp<i nput type="text" name="rangeB" val ue="<%=rangeB%> > </td> <td>
Number of Values Labeled: <input type="text" name="topnum" val ue="<%=topnum%>">
</td> </tr> <tr>
<td>
Residue:&nbsp<input type="text" name="residue" value="<%=request.getParameter("residue")%>" readonly> </td> <td>
Mass ToI erance:<i nput type="text" name="masserror" val ue="<%=request. getParameter("masserror")%>" readonly> </td> <td> lntensity:<input type="text" name="intensity" val ue="<%=request . getParameter ("i ntensi ty")%>" readonl y>
</td> </tr> <tr>
<td col span ="1"> <br>
In Silico ID:&nbsp <input type="text" name="id2" value="<%=request.getParameter("id2")%>" readonl y> </td> <td colspan ="2">
MS/MS lD:&nbsp <input type="text" name="idl" value= <%=request.getParameter("idl")%> readonl y>
</td> </tr> <tr>
<td col span = 3 al i gn = ri ght> <i nput type=submi t val ue="Rel oad"> </tr>
</table> </form> </body> </html> <%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%> <%@page import="java. util . *" %>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html> <head>
<meta http-equiv="content-type" content="text/html ; charset=ISO-8859-l">
<title>USDA: Produce Safety and Microbiology Strain Database</title> </head> <body alink="#000099" vlink="#990099" link="#000099" style="color: rgb(O, 0, 0); background-color: rgb(O, 0, 153) ;"> <table cellpadding="O" cellspacing="O" border="0" style="width: 800px; text-align: left; background-color: rgb(255, 255, 255); margin-left: auto; margin-right: auto;"> <tbody>
<tr align="left">
<td style="vertical -align: top; width: 70px;" rowspan="l" colspan="l">
<table cellpadding="O" cellspacing="O" border="l" style="width: 100%; text-align: left;"> <tbody> <tr>
<td style="vertical -align: top;"> <table cellpadding="O" cellspacing="O" border="0" style="width: 800px; text-align: left; background-color: rgb(255, 255, 255); margin-left: auto; margin-right: auto;"> <tbody>
<tr align="left">
<td style="vertical -align: top; width: 70px;"ximg src="http : //www. nal . usda.gov/speccol 1 /col 1 ect/hi story/usda3. gi f " alt="USDA Seal" style="width: 107px; height: 107px;"x/td>
<td style="vertical -align: middle; text-align: center ; "xbigxbigxbigxspan style="font-weight: bold; ">Produce Safety and Microbiology<br>
<smallxsmall>MALDI-T0F Strain Database</smallx/smallxbr> </spanx/bi gx/bi gx/bi g> </td> </tr> <tr>
<tr>
<td colspan=2 align=center>
<a href="home. jsp">New Search</a>
<a href="insertstrain. jsp">lnsert New Strain</a>
<a href=" ./changepassword. jsp" >Change Password</a>
<a href="i nsertmaldidata. jsp">Add New MALDI-TOF Data</a>
<a href="comparemaldifile. jsp">Compare MALDI File</a>
</td> </tr> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr>
<td style="vertical -align: top; background-color: rgb(O, 0, 153);" rowspan="l" colspan="l"xbr>
</td> </tr> <tr> <td style="vertical -align: top;" rowspan="l" colspan="l"> <table cellpadding="0" cellspacing="0" border="l" style="width: 100%; text-align: left;"> <tbody> <tr>
<td style="vertical -align: top;"> <jsp:useBean id="dbBean" class="psm.db.dbAccess" scope= "session"/>
<% int gtent, sptent, subtent, othertent; String cmpr = "1"; if (request. getParameterC'gtent") == null) { gtent = 0; } else { gtent = 1; if (request. getParameterC'sptent") == null) { sptent = 0; } else { sptent = 1; } if (request. getParameterC'subtent") == null) { subtent = 0; } else { subtent = 1; } if (request. getParameterC'othertent") == null) { othertent = 0; } else { othertent = 1;
} dbBean . dbConnectO ; for (int i =0; i < Integer. parselnt(request.getParameter("numberofentries")) ; i++) { int dbRtrn = dbBean. insertNewSt rain (Integer. parselnt ( request. getParameter ("i dent")) , (Integer, pars elnt(request.getParameter("number")) + i), request. getParameter ("date") , Integer. parselnt( request. getParameter ("genus")) , Integer . parselnt (request. getParameter ("species")) , Integer. parselnt (request. getParameter ("su bspecies")) , integer. parselnt (request. getParameter ("subtype")) , request. getParameter (" notes") , request. getParameter(" hi story") , gtent , sptent, subtent, othertent) ; %> <center> <% if ( dbRtrn ==0) { out.write(lnteger . toString(i + 1) + " strain(s) successfully inserted.") out.writeC'lnsert Successful! ! ") ; } else if ( dbRtrn == 3) { out.write(lnteger . toString(i + 1) + " strain(s) successfully inserted.") out. write ("This identifier and number combination already exists, please check your number again or use the update page to change this data."); } else{ out.write(lnteger . toString(i + 1) + " strain(s) successfully inserted.") out.writeC'lnsert Failed, please press back and make sure that your data is correct and that your login has not timed out. You may also not have permission to insert new data."); } dbBean. dbCloseO ; %>
</center> </td>
</tr> </tbody> </table> </td> </tr> </tbody> </table> <br> </body> </html>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%> <%@page import="java. util . *" %>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope= "session"/> <jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getllsernameO , "Update Strain" , "UpdateSt rai nTi tie", appl i cati on . getReal Path ("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<% int gtent, sptent, subtent, othertent; String cmpr = "1"; if (request. getParameterC'gtent") == null) { gtent = 0; } else { gtent = 1; if (request. getParameterC'sptent") == null) { sptent = 0; } else { sptent = 1; if (request. getParameterC'subtent") == null) { subtent = 0; } else { subtent = 1; if (request. getParameterC'othertent") == null) { othertent = 0; } else { othertent = 1; } dbBean . dbConnectO ; if ( dbBean. updateSt rain (Integer. parselnt( request. getParameter ("sampleid")) , Integer. parse Int (request. getParameter ("i dent")) , Integer. parselnt( request. getParameter ("number")) , request. getParameter ("date") , Integer. parselnt( request. getParameter ("genus")) , Integer . parselnt( request. getParameter ("species")) , Integer. parselnt( request. getParameter ("su bspecies")) , integer. parselnt( request. getParameter ("subtype")) , request. getParameter (" notes") , request. getParameterC'history") , gtent , sptent, subtent, othertent) ==0) { out.writeC'Update Successfull !");
} else{ out.writeC'Update Failed, please press back and make sure that your data is correct and that your login has not timed out."); dbBean. dbCloseO ; out. write (pageSource. getPageFooter ()) ;
%> <%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Remove In Silico Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<table align = center> <tr>
<td col span = 2>
<centerxhlxi>DELETE</i> In Silico Data</hlx/center> </td> </tr> <tr>
<td colspan=2> <% if (request. getParameter ("confi rmationnum") . compareTo(" 5105595691") == 0 && request . getParameter ("i nsi 1 i coi d") . compareTo(request . getParameter ("i nsi 1 i coconfi rm") ) == 0) { dbBean . dbConnectQ ; dbBean. executeString("DELETE FROM in_silico_data WHERE in_silico_id = " + request. getParameter ("i nsi Ii coi d")) ; dbBean. executeString("DELETE FROM in_silico WHERE in_silico_id = " + request . getParameter ("i nsi 1 i coi d")) ; out.write("Data Deleted"); } else { out.write("Either the confirmation number, or the msms id entered are incorrect. ") ; } dbBean. dbCloseO ; %>
</td> </tr> </table> <%out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Remove <i>In Silico</i> Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeaderO) ; dbBean. dbCloseO ;
%>
with the id:
val
Figure imgf000150_0001
<%out. write (pageSource. getPageFooter ()) ;%> <%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean . getllsernameO , "Remove MALDI-TOF Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<table align = center> <tr>
<td col span = 2>
<centerxhlxi>DELETE</i> MALDI-TOF- Data</hlx/center> </td> </tr> <tr>
<td colspan=2> <% if (request. get Parameter ("confi rmationnum") . compareTo(" 5105595691") == 0 && request . getParameter ("mal di id") . compareTo(request . getParameter ("mal di confi rm")) == 0) { dbBean . dbConnectQ ; dbBean. executeStringC'DELETE FROM maldi_tof_data WHERE maldi_tof_id = " + request. getParameter ("mal di id )); dbBean. executeStringC'DELETE FROM maldi_tof WHERE maldi_tof_id = " + request. get Parameter ("mal di id")) ; out.write("Data Deleted"); } else { out.write("Either the confirmation number, or the maldi id entered are incorrect. ") ; } dbBean. dbCloseO ; %>
</td> </tr> </table> <%out. write (pageSource. get Page Footer ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean . getllsernameO , "Remove MALDI-TOF Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<f orm acti on="del eternal di . j sp"> <tabl e al i gn = center> <tr>
<td col span = 2>
<centerxhlxi>DELETE</i> MALDI-TOF Data</hlx/center> </td> </tr> <tr>
<td colspan=2>
Are you sure you want to delete the MALDI-TOF data with the id: </td> </tr> <tr>
<td col span = 2 align=center>
<input align=center type=text name=maldiid val ue= ' <%=request . getParameter ("mal di i d")%> ' >
</td> </tr> <tr>
<td>
Enter Confirmation Number: </td> <td>
<input type="text" name="confi rmationnum"> </td> </tr> <tr>
<td>
Enter MALDI-TOF ID Number: </td> <td>
<i nput type="text" name="mal di confi rm"> </td> </tr> <tr>
<td col span="2 " al i gn=center>
<i nput type="submi t" val ue="YES ! DELETE Thi s Data"> </td> </tr> </tabl e> </form> <%out . wri te (pageSou rce . get Page Footer () ) ; %> <%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Remove MS/MS Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<table align = center> <tr>
<td col span = 2>
<centerxhlxi>DELETE</i> MS/MS Data</hlx/center> </td> </tr> <tr>
<td colspan=2> <% if (request. getParameter ("confi rmationnum") . compareTo(" 5105595691") == 0 && request. getParameter ("msmsid") . compareTo (request. getParameter ("msmsconfi rm")) == 0) dbBean . dbConnectQ ; dbBean. executeStringC'DELETE FROM ms_ms_data WHERE ms_ms_id = " + request. getParameter ("msmsid")) ; dbBean. executeStringC'DELETE FROM ms_ms WHERE ms_ms_id = " + request. getParameter ("msmsid")) ; out.write("Data Deleted"); } else { out.write("Either the confirmation number, or the msms id entered are incorrect. ") ; } dbBean. dbCloseO ; %>
</td> </tr> </table> <%out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Remove MS/MS Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
with the id:
val
Figure imgf000154_0001
<%out. write (pageSource. getPageFooter ()) ;%> <%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Remove Sample Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<table align = center> <tr>
<td col span = 2>
<centerxhlxi>DELETE</i> Strain Data</hlx/center> </td> </tr> <tr>
<td colspan=2> <% if
(request. getParameter("confi rmationnum") .compareTolgnoreCaseC'YES") == 0 && request. get Parameter ("sampleid") . compareTo (request. get Parameter ("sampleconfi rm")) == 0) { dbBean . dbConnectQ ; dbBean. executeStringC'DELETE FROM sample WHERE sample. sample_id = " + request. get Parameter ("sampleid")) ; dbBean. executeStringC'DELETE FROM maldi_tof, maldi_tof_data WHERE maldi_tof_data.maldi_tof_id = maldi_tof .maldi_tof_id AND maldi_tof . sample_id = " + request. get Parameter ("sampleid")) ; out.writeC'Data Deleted"); } else { out.wri te("Ei ther the confirmation, or the maldi id entered are incorrect. ") ;
} dbBean. dbCloseO ; %>
</td> </tr> </table> <%out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Remove Sample Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
wi th the i d :
val a:
Figure imgf000156_0001
<%out. write (pageSource. getPageFooter ()) ;%> <%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean . getllsernameO , "Remove MALDI-TOF Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<form acti on=" del etesampl e range . j sp"> <tabl e al i gn = center> <tr>
<td col span = 2>
<centerxhlxi>DELETE</i> Sample Data</hlx/center> </td> </tr> <tr>
<td colspan=2>
Select The Range of RM Numbers to Delete </td> </tr> <tr>
<td col span = 2 align=center>
<input align=right type=text name=lowrange val ue= ' ' >&nbsp ; To : &nbsp ;
<input align=left type=text name=highrange value=' '> </td> </tr> <tr>
<td>
Do you want to delete the above sample data? (Type yes in the box) :
</td> <td>
<input type="text" name="confi rmationnum"> </td> </tr> <tr>
<td colspan="2" align=center>
<input type="submit" value="YES! DELETE This Data"> </td> </tr> </table> </form> <%out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Remove Sample Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<table align = center> <tr>
<td col span = 2>
<centerxhlxi>DELETE</i> Strain Data</hlx/center> </td> </tr> <tr>
<td colspan=2> <% if
(request. getParameterC'confi rmationnum") .compareTolgnoreCaseC'YES") == 0) { dbBean . dbConnectO ; dbBean. executeStringC'DELETE FROM sample USING sample, identifier WHERE sample. identifier_id = identifier .identifier_id AND identifier . ident=' RM1 AND sample. number BETWEEN " + request. getParameter("lowrange") + " AND " + request. getParameterC'highrange")) ; out.write("Data Deleted"); } else { out.wri te("You did not enter Yes in the confirmation text box."); } dbBean. dbCloseO ; %>
</td> </tr> </table> <%out. write (pageSource. get Page Footer ()) ;%>
<%@page contentType="text"%x%@page import="java. sql . *" %><%@page import="java. util . *" %><jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<%int validlogin = dbBean.dbConnectO ; %>
<% if (validlogin ==0 & (dbBean.getUsernameO .compareTo("rmandreH ") == 0 | | dbBean.getUsernameO .compareTo("psmlogin") == 0) == true) { ResultSet myRS; boolean rmonly; if (request. getParameterC'rmonly") != null) { if (request. getParameterC'rmonly") .compareTo("yes") == 0) { rmonly = true; } else { rmonly = false;
} else { rmonly = false; if (rmonly) { myRS = dbBean. getRS("SELECT sample. sample_id, CONCAT(identifier .ident, sample. number) ident, sample. date, genus. name genus, species. name species, subspecies. name subspecies, subtype. name subtype, sample. notes, sample. history, sampl e . tentati ve_gen us , sampl e . tentati ve_speci es , samp] e . tentati ve_subspeci es , sample. tentati ve_subtype FROM identifier, sample, strain, genus, species, subspecies, subtype WHERE strain. genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND sample. strain_id = strain. strain_id AND identifier. identifier_id = sampl e.identifier_id and identifier .identifier_id = 1"); } else {
String strandor = request. getParameter("andor") ; int maldionly; if (request. getParameterC'maldionly") == null) { maldionly = 0; } else { maldionly = 1;
} if (strandor .compareTo("Or") == 0 ) { myRS = dbBean. runORSearch(request.getParameter("sampleid") , request. getParameter ("identifier") , request. getParameter ("genus") , request. getParameter ("species") , request. getParameter ("subspecies") , request. getParameter ("other") , request. getParameter ("notes") , request. getParameter ("hi story") , request. getParameter ("gtent") , request. getParameter ("sptent") , request. getParameter ("subtent") , request. getParameter ("othertent") , maldionly, request. getParameter ("lowRM") , request. getParameter (" hi ghRM")) ;
//Java. sql .Statement temps = myRS.getStatementO ;
//String s; } else { myRS = dbBean. runANDSearch(request.getParameter("sampleid") , request. getParameter ("identifier") , request. getParameter ("genus") , request. getParameter ("species") , request. getParameter ("subspecies") , request. getParameter ("other") , request. getParameter ("notes") , request. getParameter ("hi story") , request. getParameter ("gtent") , request. getParameter ("sptent") , request. getParameter ("subtent") , request. getParameter ("othertent") , maldionly, request. getParameter ("mass") , Integer. parselnt( request. getParameter ("masse rror")) , request. getParameter("mi m ntensity") , request. getParameter ("lowRM") , request. getParameter ("hi ghRM")) ;
}
//Write the header/column names out.writeC'Sample Number\tDate\tName\tNotes\tHistory\n") ; while (myRS. next ()) {
String notes = myRS.getStringC'notes") ;
String hist = myRRSS. getString("hi story") ; if (notes != nu ff? notes = notes. replace("\"", "\"\""); notes = notes.replaceATK"\r\n|\n|\t", "");
}else { notes=""; if (hist != null) { hist = hist.replaceCY"1, "\"\""); hist = hist.replaceAll("\r\n|\n", "");
} else { hist = "";
String qG = "", qS = "", qSS = "", qθ = ""; if (myRS.getlnt("tentative_genus") == 1) { qG = "?"; if (myRS.getlnt("tentative_species") == 1) { qS = V; if (myRS.getlnt("tentative_subspecies") == 1) { qSS = "?"; if (myRS.getlnt("tentative_subtype") == 1) { qθ = *?";
String lname = myRS.getStringC'genus") + qG + " " + myRS.getStringC'species") + qS + " " + myRS.getString("subspecies") + qSS + " " + myRS.getStringC'subtype") + qθ; lname = lname. replace("null ", ""); lname = lname. trim() ;
String line;
//RUMm number line = myRS.getStringC'ident") + "\t";
//date line += "\"" + myRS.getStringC'date") + "\"\t";
//name line += "\"" + lname + "\"\t"; line += "\"" + notes + "\"\t"; line += "\"" + hist + "\"\n"; out. write (line) ; } myRS.closeO ;
%>
%@page contentType="text/html "%>
ace",
Figure imgf000161_0001
<form action="fi ndand replace. jsp">
<% int genus = 0, species=0, subspecies=0,other=0;
String rdate = ""; if (request. getParameterC'genusr") != null) { genus = integer. parselnt(request.getParameter("genus")) ; if (request. getParameterC'spr") != null) { species = integer. parselnt( request. getParameter ("species")) ; if (request. getParameterC'subspr") != null) { subspecies = integer. parselnt( request. getParameter ("subspecies")) ; if (request. getParameterC'other") != null) { other = integer . parselnt(request.getParameter("subtype")) ; if (request. getParameterC'dater") != null) { rdate = request. getParameter("date") ; if (request. getParameterC'submit") != null) { boolean noerror = true; if (request. getParameter("l Range") == null) { out .wri teC'Please enter a low range value."); noerror = false; } if (request. getParameter("hRange") == null) { out .wri teC'Please enter a high range value."); noerror = false;
} if (request. getParameterC'replace") == null) { out.writeC'Please enter a search/replace value"); noerror = false;
} if (request. getParameterC'with") == null) { out.writeC'Please enter a replacement value."); noerror = false;
}
String mChar = ""; int mSInt = 0; if (noerror) { dbBean . dbConnectO ; if (request. getParameterC'inChar") != null && request. getParameterC'inChar") != "") { mChar = request. getParameterC'inChar") ; if (request. getParameterC'inStart") != null && request. getParameter("inStart") != "") { mSInt = Integer. parselnt(request.getParameter("inStart")) ; int num = dbBean. findAndRepl ace (Integer. parselnt( request, getParameter ("1 Range")) , Integer. parselnt( request. getParameterC'hRange")) , request. getParameter ("replace") , request. getParameter ("with") , Integer. parselnt( request. getParameter ("i dent")) , mChar , mSInt, genus, species, subspecies, other , rdate) ; out.write(num + " rows have been updated."); dbBean.dbCloseO ; }
} else if (request. getParameterC'Prepend") != null | request. getParameterC'Append") != null) { boolean noerror=true; if (request. getParameterC'with") == null) { out.writeC'Please enter a replacement value."); noerror = false; } if (request. getParameterC'lRange") == null) { out.writeC'Please enter a low range value."); noerror = false; } if (request. getParameterC'hRange") == null) { out.writeC'Please enter a high range value."); noerror = false;
} if (noerror) { dbBean . dbConnectO ;
String mChar = ""; int mSInt = 0; if (request. getParameterC'inChar") != null && request. getParameterC'inChar") != "") { mChar = request. getParameterC'inChar") ; if (request. getParameterC'inStart") != null && request. getParameterC'inStart") != "") { mSInt = Integer . parselnt(request. getParameterC'inStart")) ; if (request. getParameterC'Append") !=null) { int num = dbBean. findAndReplaceAppend (Integer. parselnt( request. getParameter ("lRanqe")) , Integer. parselnt( request. getParameterC'hRange")) , request. getParameter( with") , Integer . parselnt(request.getParameter("ident")) ,mChar, mSInt, 0, genus, species, subspecies, other, rdate); out.write(num + " rows have been updated."); } else { int num = dbBean. findAndReplaceAppend (Integer. parselnt( request. getParameterC'lRange")) , Integer. parselnt( request. getParameterC'hRange")) , request. getParameter ("with") , Integer . parselnt(request.getParameter("ident")) ,mChar, mSInt, 1, genus, species, subspecies, other, rdate); out.write(num + " rows have been updated."); dbBean.dbCloseO ; }
%>
<table align=center> <tr>
<td colspan=2> <centerxhl>Find and Replace</hlx/center> </td> </tr> <tr> <td> identifier (RM):&nbsp </td> <td>
<select name="ident"> <% dbBean . dbConnectO ;
ResultSet myRS = dbBean. getldentPrefixO ; if (myRS. next ()) { myRS. first O ; do { out.write("<option value=" + myRS.getlnt("identifier_id") + ">" + myRS.getStringC'ident")) ;
} while (myRS. next C)) ; } myRS.closeO ; %>
</select> </td> </tr>
<tr>
<td>
Range: </td> <td>
<input type="text" name="l Range" size=5>&nbsp To: &nbsp<input type="text" name="hRange" size= 5>
</td> </tr> <tr>
<td> Replace: </td> <td>
<input type="text" name="replace"> </td> </tr> <tr>
<td>
Genus: </td> <td>
<sel
Figure imgf000163_0001
(cmpr .compareTo(myRS.getString("genus_id")) == 0) { out.write("<option value='" + myRS.getlnt("genus_id") + '" selected>" + myRS.getStringC'name"));
} else { out.write("<option value='" + myRS.getInt("genus_id") + '">" + myRS.getStringC'name"));
} else { if (cmpr .compareTo("")==0) { out .wri te("<opti on val ue= ' " + myRS.getlnt("genus_id") + '" selected>No Genus");
} else { out.write("<option value='" + myRS.getlnt("genus_id") + '">No Genus");
} } while (myRS. next()) ; myRS. close () ; %>
</selectxinput type=' checkbox1 name=' genus r1 value='l' unchecked>Repl ace
</td> </tr> <tr> <td>
))
Figure imgf000164_0001
Subspecies: </td> <td>
<select name="subspecies"> es() ;
Figure imgf000164_0002
String cmpr = request. getParameter("subspecies") ; if (cmpr == null) { cmpr = "";} if (myRS.getStringC'name") !=null) { if (cmpr.compareTo(myRS.getString("subspecies_id")) == 0) { out.write("<option value='" + myRS.getlnt("subspecies_id") + "' selected>" + myRS.getStringC'name"));
} else { out.write("<option value='" + myRS.getlnt("subspecies_id") + '">" + myRS.getStringC'name"));
} else { if (cmpr.compareTo("")==0 ) { out.write("<option value='" + myRS.getlnt("subspecies_id") + "' selected>No Subspecies");
} else { out.write("<option value='" + myRS.getlnt("subspecies_id") + '">No Subspecies");
} } while (myRS. next()) ; myRS.closeO ; %>
</selectxi nput type=' checkbox1 name=' subspr1 value='l' unchecked>Repl ace </td> </tr> <tr>
<td>
Serovar/Subtype/Genotype : </td> <td>
<select name="subtype"> <% myRS = dbBean.getSubτype() ; if (myRS. next ()) { myRS. first O ; do {
String cmpr = request. getParameter("subtype") ; if (cmpr == null) { cmpr = "";} if (myRS.getStringC'name") !=null) { if (cmpr .compareTo(myRS.getString("subtype_id")) == 0) { out.write("<option value='" + myRS.getlnt("subtype_id") + '" selected>" + myRS.getStringC'name"));
} else { out.write("<option value='" + myRS.getInt("subtype_id") + '">" + myRS.getStringC'name"));
} else { if (cmpr.compareTo("")==0) { out.write("<option value='" + myRS.getlnt("subtype_id") + '" selected>No Subtype");
} else { out.write("<option value='" + myRS.getlnt("subtype_id") + '">No Subtype");
} } while (myRS. next ()) ; myRS.closeO ; %>
</selectxi nput type=' checkbox1 name=' other1 value='l' unchecked>Repl ace </td> </tr> <tr>
<td>
Date (2005-8-24):
</td>
<td>
<input type="text" name="date"xinput type=' checkbox1 name='dater' value='l' unchecked>Replace
</td> </tr> <tr>
<td>
With (comma delimted):
</td>
<td>
<input type="text" name="with">
</td> </tr> <tr>
<td>
Auto-Increment Character:
</td>
<td>
<input type="text" name="inChar" size=5>
Start:
<input type="text" name="inStart" size=5>
</td> </tr> <tr>
<td colspan="2" style="text-align: center; "><br>
<input type="submit" value="Prepend" name="Prepend">
<input type="submit" value="Append" name="Append">
<input type="submit" value="Replace" name="submit">
</td> </tr> </table> </form>
<% out.write(pageSource. getPageFooter ()) ; dbBean.dbCloseO ; %>
<%@page contentType="text/html "%>
<%@page pageEncodi ng="UTF-8"%>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope ="session"/>
<%@page import="java. sql . *" %>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<%
//Becuase of the nature of this search the majority of the code will be processed here instead of in a bean
String searchSQL = "SELECT locus_id"; if (request. getParameterC'locus") != null && request. getParameterC'locus") .compareTo("on") == 0) { searchSQL += ", locus, name 'Locus111; if (request. getParameterC'strain") != null && request. getParameterC'strain") .compareTo("on") == 0) { searchSQL += ", CONCAT(identifier . name, sample. number) 'Strain'"; if (request. getParameterC'genusspecies") != null && request. getParameterC'genusspecies") .compareτo("on") == 0) { searchSQL += ", CONCAT(genus. name, ' ', species. name) 'genus-species'"; if (request. getParameter("locationl") != null && request. getParameterC'locationl") .compareTo("on") == 0) { searchSQL += ", a. name ' Location].'" ; if (request. getParameter("location2") != null && request. getParameter("location2") .compareTo("on") == 0) { searchSQL += ", b.name ' Location2 '" ; if (request. getParameterC'start") != null && request. getParameterC'start") .compareTo("on") == 0) { searchSQL += ", locus. start 'Start'"; if (request. getParameterC'end") != null && request. getParameterC'end") .compareTo("on") == 0) { searchSQL += ", locus. end 'End'"; if (request. getParameterC'GBK") != null && request. getParameter("GBK") .compareTo("on") == 0) { searchSQL += ", CASE locus. FR WHEN 'F' THEN CONCAT(I ocus . start , ' .. ' , locus. end) WHEN 'R' THEN CONCATC complement (' , locus. start, ' .. ' , locus. end, ')') End 'GBK"1; } if (request. getParameterC'fr") != null && request. getParameterC'f r") .compareTo("on") == 0) { searchSQL += ", locus. FR"; } if (request. getParameterC'NT") != null && request. getParameter("NT") .compareTo("on") == 0) { searchSQL += ", locus. NT"; } if (request. getParameter ("AA") != null && request. getParameterC'AA") .compareTo("on") == 0) { searchSQL += ", locus. AA"; } if (request. getParameterC'MW") != null && request. getParameterC'MW") .compareTo("on") == 0) { searchSQL += ", locus. MW"; } if (request. getParameterC'iep") != null && request. getParameterC'iep") .compareτo("on") == 0) { searchSQL += ", locus. IEP"; if (request. getParameter("gene") != null && request. getParameter("gene") .compareTo("on") == 0) { searchSQL += ", locus. gene 'Gene111; if (request. getParameterC'code") != null && request. getParameter("code") .compareTo("on") == 0) { searchSQL += ", locus. code 'Code111; if (request. getParameterC'COG") != null && request. getParameter("COG") .compareTo("on") == 0) { searchSQL += ", locus. cog 1COG1"; if (request. getParameterC'ecl") != null && request. getParameterC'ecl") .compareTo("on") == 0) { searchSQL += ", locus. ECl Εc#r"; if (request. getParameter("ec2") != null && request. getParameter("ec2") .compareTo("on") == 0) { searchSQL += ", locus. EC2 ' EC#2 ' " ; if (request. getParameterC'product") != null && request. getParameterC'product") .compareTo("on") == 0) { searchSQL += ", locus. product 1PrOdUCt1"; if (request. getParameterC'notes") != null && request. getParameterC'notes") .compareTo("on") == 0) { searchSQL += ", locus. notes 'Notes1 ";
//Add the default WHERE clause necessarry to retrieve the real data not just the
IDS searchSQL += " FROM locus, location a, location b, sample, identifier, strain, genus, species WHERE locus. location_id = a.location_id AND locus. Iocation2_id = b.location_id AND locus. sample_id = sample. sample_id AND sample. identifier_id = identifier .identifier_id AND sample. strain_id = strain. strain_id AND strain. genus_id = genus. genus_id AND strain. species_id = species. species_id" ;
//Now add to the where clause the search criteria if (request. getParameterC'locusstr") != null && request. getParameter("locusstr")
!= "") { searchSQL += " AND locus. name LIKE '%" + request. getParameterC'locusstr") +
} if' (request. getParameterC'strainstr") != null && request. getParameterC'strainstr") != "") { searchSQL += " AND CONCAT(identifier . name, sample. number) LIKE '%" + request. getParameterC'strainstr") + "%'"; if (request. getParameterC'genusstr") != null && request. getParameter("genusstr")
!= "") { searchSQL += " AND genus. name LIKE '%" + request. getParameterC'genusstr") +
if (request. getParameterC'speciesstr") != null && request. getParameterC'speciesstr") != "") { searchSQL += " AND species. name LIKE '%" + request. getParameterC'speciesstr") + "%"; } if (request. getParameterC'locationstr") != null && request. getParameterC'locationstr") != "") { searchSQL += " AND a. name LIKE '%" + request. getParameterC'locationstr") +
"O/ I " . /O , if (request. getParameter("location2str") != null && request. getParameter("location2str") != "") { searchSQL += " AND b.name LIKE '%" + request. getParameter(""location2str") +
if (request. getParameterC'productstr") != null && request. getParameterC'productstr") != "") { searchSQL += " AND locus. Product LIKE '%" + request. getParameterC'productstr") + "%'"; if (request. getParameter("notesstr") != null && request. getParameter("notesstr")
!= "") { searchSQL += " AND locus. Notes LIKE '%" + request. getParameter("notestr") +
if (request . getParameterC'mw") != null && request. getParameter("mw") != "") { searchSQL += " AND locus. MW between " + request. getParameterC'mw") + " - (" + request. getParameterC'mw") + " * " + request. getParameter("ppm") + " / 1000000.0) AND " + request. getParameterC'mw") + " + (" + request. getParameterC'mw") + " * " + request. getParameterC'ppm") + " / 1000000.0)"; if (request. getParameterC'genestr") != null && request. getParameter("genestr") != searchSQL += " AND locus. gene LIKE '%" + request. getParameterC'genestr") + "%' " ; dbBean . dbConnect("genel i st") ;
ResultSet myRS = dbBean. getRS(searchSQL) ;
ResultSetMetaData myMD = myRS.getMetaData() ;
%>
<html>
<head>
<meta http-equiv="Content-Type" content="text/html ; charset=UTF-8"> <title>USDA Produce Safety and Microbiology Database</title> </head>
<body style="background-color : rgb(54, 171, 54) ; "> <table cellspacing=0 cellpadding=O align=center> <tr> <% for (int i=l; i <= myMD.getColumnCountO -1; i++) { out.write("<th bgcolor = #008700><span style='color : rgb(231,229, 38);'>" + myMD. getCol umnName(i + 1) + "</thx/span>") ;
%> <%
String mColor; int count = 0; while (myRS. next ()) { out.write("<tr>"); if ( count % 2 == 0) { mColor= "#ffdθae"; }else { mColor = "#ecac7d"; } for (int i=l; i <= myMD.getColumnCountO -1; i++) { if (myRS.getString(i+l) != null) { if (myMD.getColumnName(i+l) .compareToC'Locus") == 0) { out.write("<td style='vertical-align: top; background-color: " + mColor + '"><span style=' color: rgb(O,O,O) ; font-weight: bold; '>&nbsp;<a href='locusdetails. jsp?locusid=" + myRS.getString(l) + '>" + myRS.getString(i+ 1) + "</a>&nbsp;</tdx/span>") ;
} else if (myMD.getColumnName(i+l) .compareTo("Strain") == 0) { out.write("<td style='vertical-align: top; background-color: " + mColor + "'xspan style=' color: rgb(O,O,O) ; font-weight: bold; '>&nbsp;<a href= ' search resul ts . j sp?andor=Or&l owRM=&hi ghRM=&genus=&speci es=&subspeci es=&other=&n otes=" + myRS.getStringO' + 1) +
"&hi story=&gtent=Any&sptent=Any&subtent=Any&othertent=Any&sampl ei d=&mass=&i denti f i er =" + myRS.getStringCi + 1) + '">" + myRS.getString(i+ 1) + "</a>&nbsp;</tdx/span>") ;
} else{ out.write("<td style='vertical-align: top; background-color: " + mColor + "'xspan style=' color: rgb(O,O,O) ; font-weight: bold; '>&nbsp; " + myRS.getString(i+ 1) + "&nbsp;</tdx/span>") ;
} else { out.write("<td style='vertical-align: top; background-color: " + mColor + "'xspan style=' color: rgb(O,O,O) ; font-weight: bold; lx/tdx/span>") ;
} count++; if (count == 2000) {myRS = null;} out.write("</tr>"); }
%>
</table> </body> </html>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getllsernameO , "Insert Genus" , "insertGenusTitle", application. getReal Path("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%> <% dbBean . dbConnectO ; int rtrn; rtrn = dbBean. insertNewGenus(request. getParameter("name")) ; if (rtrn > 0) { out . wri te C'lnsert successful l ! ") ;
} el se i f (rtrn == -1) { out.write("An error occurred while processing this request, please try again, if this continues contact support."); dbBean. dbCloseO ; %>
<brxcenterxa href="insertstrain. jsp">Insert New Strain</ax/center> <%out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/> <jsp: setProperty name="dbBean" property="*"/> <jsp:useBean id="pageSource" class="psm.web. pageCode"/> <%int validlogin = dbBean.dbConnectO ; %>
<% if (validlogin ==0) { pageSource.splitTemplatePage(dbBean.getllsernameO , "Search Strain Data", "Strai nSearchTi tl e" , appl i cati on . getReal Path ("/") , dbBean) ; out.write(pageSource.getPageHeaderO) ; if (validlogin != 0) {%>
<center>The username/password combination you have entered does not exist or is no longer valid. Please press back on your browser and try agai n .</center>
<%} else { dbBean. dbCloseO; %>
<table border="0" cellpadding=O cellspacing=0> <tr>
<form acti on=" search results. j sp"> <br>
<table align=center> <tr>
<td colspan="2">
<centerxb>Enter the parameters for your search : </bx/centerxbr>
</td> </tr> <tr>
<td colspan=2 align = center>
<input type="radio" name="andor" value="and" checked>AND <input type="radio" name="andor" value="0r">0R </td> </tr> <tr>
<td>
Search by Identification Number (e.g. RM12O3 or 1203): </td> <td>
<input type=text name="identifier"> </td> </tr> <tr>
<td>
Within Range (e.g. 1203 To: 1403) </td> <td>
<input type="text" name="lowRM" size="5">&nbsp To: &nbsp<input type="text" name="highRM" size="5">
</td> </tr> <tr>
<td>
Search by Genus (e.g. Campylobacter): </td> <td>
<input type=text name="genus"> </td> </tr> <tr>
<td> Search by Species (e.g. CoIi): </td> <td>
<input type=text name="species"> </td> </tr> <tr>
<td>
Search by Subspecies (e.g. Fetus): </td> <td>
<input type=text name="subspecies"> </td> </tr> <tr>
<td>
Search by Other Subtype: </td> <td>
<input type=text name="other"> </td> </tr> <tr>
<td>
Search inside Notes: </td> <td>
<input type=text name="notes"> </td> </tr> <tr>
<td>
Search inside History: </td> <td>
<input type=text name="history"> </td> </tr> <tr>
<td>
Search Genus Tentativity: </td> <td>
<input type=radio name="gtent" value="Any" checked> <input type=radio name="gtent" value="true">True <input type=radio name="gtent" value="false">False </td> </tr> <tr>
<td>
Search Species Tentativity: </td> <td>
<input type=radio name="sptent" value="Any" checked> <input type=radio name="sptent" value="true">True <input type=radio name="sptent" value="false">False </td> </tr> <tr>
<td>
Search Subspecies Tentativity: </td> <td>
<input type=radio name="subtent" value="Any" checked> <input type=radio name="subtent" value="true">True <input type=radio name="subtent" value="false">False
</td> </tr>
<tr>
<td>
Search Serovar/Subtype/Genotype Tentativity:
</td>
<td>
<input type=radio name="othertent" value="Any" checked> <input type=radio name="othertent" value="true">True <input type=radio name="othertent" value="false">False
</td> </tr> <tr>
<td>
Search by Sample ID (e.g. 321):
</td>
<td>
<input type=text name="sampleid">
</td> </tr> <tr>
<td colspan=2 align=center>
<span style="Font-Weight: Bold;">For AND seach only:</span>
</td> <tr> <tr>
<td>
Search by mass:
</td>
<td>
<input type=text" name="mass">
</td> </tr> <tr>
<td>
Mass Error (ppm) :
</td>
<td>
<input type=text" name="masserror" value="500">
</td> </tr> <tr>
<td>
Minimum Intensity:
</td>
<td>
<input type=text" name="minintensity" value="10">
</td> </tr> <tr>
<td>
Only Display Results With MALDl-TOF Data:<br>(This Will Lengthen Search Time, Please Be Patient)
</td>
<td>
<input type=checkbox name="maldionly" value="l">Yes
</td> </tr> <tr>
<td col span = "2" align=right>
<i nput type="reset">&nbsp&nbsp&nbsp&nbsp&nbsp&nbsp<i nput type=submit>
</td> </tr> <tr> </tr>
<t rxtd>&nbs p</tdx/t r> </table> <br> </form> <% } if (validlogin ==0) { ou t.writeCpageSource. get Page Footer ()) ;
%> <%-- Close out the else statement --%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getllsernameO , "Insert Identifier" , "insertldentifierTitle", application. getReal Path("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%> <% dbBean . dbConnectO ; int rtrn; rtrn = dbBean. insertNewldentifier (request. getParameter("name") , request. getParameter ("notes")) ; if (rtrn == 3) { out.write("τhis identifier is already present in the database.");
} else if (rtrn !=0) { out.write("An error occurred while processing this request, please try again, if this continues contact support.");
} else if (rtrn ==0 ) { out.writeC'lnsert successfull ! ") ;
} dbBean. dbCloseO ; %> <brxcenterxa href="insertstrain. jsp">Insert New Strain</ax/center>
<%out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp: useBean id="pageSource" class="psm.web. pageCode"/>
<jsp: useBean id="importCSV" class="psm.mformat.importStrain"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getUsernameO , "insert Subtype" , "insertSubtypeTitle", application. getRealPath("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; if (importCSV. parseandlmportStrain(request, dbBean) == 0) { out.writeC'Update Successfull !"); } else { out.write("An error occurred please try again.");
%> <% dbBean. dbCloseO ; out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp: useBean id="pageSource" class="psm.web. pageCode"/>
<jsp: useBean id="importCSV" class="psm.mformat.importStrain"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getUsernameO , "insert Subtype" , "insertSubtypeTitle", application. getRealPath("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; if (importCSV. parseandlmportNoteData(request, dbBean) == 0) { out.writeC'Update Successfull !"); } else { out.write("An error occurred please try again.");
%> <% dbBean. dbCloseO ; out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getlisernameO , "insert Subtype" , "insertSubtypeTitle", application. getReal Path("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ; %>
<centerxhl>lmport Comma Delimited File</hlx/center>
<form method=post action="importconfi rm. jsp" enctype="MULTIPART/FORM-DATA"> <table align=center> <tr>
<td colspan=2>
<center>You can upload a tab delimted file with the following format :<br>
StrainNumber Date Genus Species Subspecies Subtype Notes History<br>
Make sure to strip out any header information, the easiest way to make a tab delimited file is to use excel and save as text tab delimited fi 1 e . </centerxbr>
</td> </tr> <tr>
<td colspan=2>
<center>Choose which fields you want changed/updated from this file</center>
</td> </tr> <tr>
<td>
<input type=checkbox name="date"> </td> <td> Date </td> </tr> <tr>
<td>
<input type=checkbox name="Genus"> </td> <td> Genus </td> </tr> <tr>
<td>
<input type=checkbox name="Species"> </td> <td> Species </td> </tr> <tr>
<td>
<input type=checkbox name="Subspecies"> </td> <td>
Subspecies </td> </tr> <tr> <td>
<input type=checkbox name="Subtype">
</td>
<td>
Subtype
</td> </tr> <tr>
<td>
<input type=checkbox name="notes" checked>
</td>
<td>
Notes
</td> </tr> <tr>
<td>
<input type=checkbox name="Hi story" checked>
</td>
<td>
History
</td> </tr>
<tr>
<td>
<input type=checkbox name="append" checked>
</td>
<td>
Append notes and history Data to existing data<br>(Note otherwise all fields will be replaced)
</td> </tr> <tr>
<td colspan=2>
&nbsp;
</td> </tr> <tr>
<td>
Fi 1 e :
</td>
<td>
<input type="file" name="csvfile">
</td> </tr> <tr>
<td colspan="2" align="right">
<input type="submit" value="Upload File">
</td> </tr> </table> </form>
<%out.write(pageSource. getPageFooter()) ;%> <%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage(dbBean. getlisernameO , "insert Subtype" , "insertSubtypeTitle", application. getReal Path("/") , dbBean) ; out.write(pageSource. getPageHeader()) ; dbBean. dbCloseO ; %>
<centerxhl>lmport Tab Delimited File</hlx/center>
<form method=post action="importconfi rmnotes. jsp" enctype="MULTIPART/FORM-DATA"> <table align=center> <tr>
<td colspan=2>
<center>Import notes data with RM Number first and Notes in the second column seperated by a tab.<br>τhis will append notes to existing notes. </center>
</td> </tr>
<tr>
<td colspan=2>
&nbsp;
</td> </tr> <tr>
<td>
Fi 1 e :
</td>
<td>
<i nput type="fi l e" name="csvfi l e">
</td> </tr> <tr>
<td col span="2 " al i gn=" ri ght">
<i nput type="submi t" val ue="Upl oad Fi l e">
</td> </tr> </table> </form>
<%out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getlisernameO , "insert Subtype" , "insertSubtypeTitle", application. getReal Path("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ; %>
<centerxhl>lmport Comma Delimited File</hlx/center>
<form method=post action="locusimportconfi rm. jsp" enctype="MULTIPART/FORM-DATA"> <table align=center> <tr>
<td colspan=2>
<center>You can upload a tab delimted file with the following format :<br>
Locus Genus Species Subspecies Subtype Strain Location
Location2 (LOCUS) START END GBK F/R NT AA MW IEP GENE CODE COG EC#1 EC#2 Product
Notes<br>
Make sure to strip out any header information, the easiest way to make a tab delimited file is to use excel and save as text tab delimited fi 1 e . </centerxbr>
</td> </tr> <tr>
<td colspan=2> &nbsp; </td> </tr> <tr>
<td> Fi 1 e : </td> <td>
<input type="file" name="csvfile"> </td> </tr> <tr>
<td col span="2 " al i gn=" ri ght"> <i nput type="submi t" val ue="Upl oad Fi l e"> </td> </tr> </tabl e> </form>
<%out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN"
"http://www.w3.org/TR/html4/loose.dtd"> <% response. setHeaderC'Cache-Control ", "no-cache, post-check=0, pre-check=O") ; response. setHeader("Pragma" , "no-cache") ; response. setHeader("Expi res", "Thu, 01 Dec 1994 16:00:00 GMT"); %> <html>
<head>
<meta http-equiv="Content-Type" content="text/html ; charset=UTF-8"> <title>PSM Strain Database</title> </head>
<body style="background-color: rgb(54, 171, 54) ; "> <br>
<centerxspan style="color: rgb(231, 229, 38) ; font-weight: bold; "><h3>Wel come to the Produce Safety and Microbiology Databases<br>Please login below</h3x/spanx/center> <br>
<table border=0 align=center>
<tr> <td>
<table align=left cellspacing=5 cellpadding=O > <form method="post" action="home. jsp"> <tr border=0>
<tdxspan style="color: rgb(253, 161, 17) ; font-weight: bol d ; "xb>Username :&nbsp</bx/spanx/td>
<tdxinput type="text" name = "username" size=25x/td> </tr> <tr>
<tdxspan style="color: rgb(253, 161, 17) ; font-weight: bol d ; "xb>Password :&nbsp</bx/spanx/td>
<tdxinput type = "password" name = "password" size=25x/td> </tr>
<tr border=0> <tdx/td>
<td align=rightxinput type=submit value="Login" styl e="font-wei ght : bol d ; "></td>
</tr> </form> </table> </td> </tr> </table>
</body> </html>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp:useBean id="nln" class="psm.gene. nucelotideinsert" scope="session"/>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope ="session"/> <jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getllsernameO , "Insert AA/NT" , "insertAANTTitle", application.getReal Path("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<% dbBean . dbConnect ("genel i st") ; if (nln.insertNucleotide(request, dbBean) == 0) { out.writeC'lnsert successfull ! ") ;
} else { out.writeC'lnsert failed, please check and make sure the file extension matches what you selected. <br>You may also want to make sure that the locus has already been inserted into the database."); dbBean. dbCloseO ; out. write (pageSource. getPageFooter ()) ;
%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Insert MALDI Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<form method=post acti on="checkmaldi parse. jsp" enctype="MULTlPART/FORM-DATA"> <table align = center> <tr>
<td col span = 2>
<centerxhl>Upload MALDI-TOF MS Data</hlx/center> </td> </tr> <tr>
<td>
Fi nd Fi 1 e : </td> <td>
<i nput type="fi l e" name="mal di fi l e"> </td> </tr> <tr> <tdx/td>
<td col span="l" al i gn=l eft>
<input type="submit" value="Send"> </td> </tr> </table> </form> <%out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/> <jsp:useBean id="pageSource" class="psm.web. pageCode"/> <% dbBean . dbConnectO ; pageSource. s pi itTempl ate Page (dbBean. getllsernameO , "Insert AA/NT" , "insertAANTTitle", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. get PageHeader ()) ; dbBean. dbCloseO ; %>
<centerxhl>Insert AA/NT</hlx/center>
<form method=post action="insernucleotidedataconfi rm. jsp" enctype="MULTIPART/FORM-DATA"> <table align=center> <tr>
<td>
<input type=file name="aantfile"> </td> </tr> <tr>
<td style="text-align: right ;">
<input type="submit" value="Send" > </td> </tr> </table> </form>
<% out. write (pageSource. getPageFooter ()) ;
%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<%@page import="iava. sql . *" %> <%@page import="java. util . *" %>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/> <jsp:useBean id="pageSource" class="psm.web. pageCode"/> <% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getllsernameO , "Insert Strain" , "insertStrainTitle", application. getReal Path("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ; %>
<%dbBean . dbConnectO ;%>
<% int gtent, sptent, subtent, othertent; //String cmpr = "1"; if (request. getParameterC'gtent") == null) { gtent = 0; } else { gtent = 1; if (request. getParameterC'sptent") == null) { sptent = 0; } else { sptent = 1; } if (request. getParameterC'subtent") == null) { subtent = 0; } else { subtent = 1; } if (request. getParameterC'othertent") == null) { othertent = 0; } else { othertent = 1;
%>
<%
//Test and see if this page loaded from the submit, or submit and increment button, or from neither, if (request. getParameterC'submit") != null) { int success = 0; for (int i =0; i <
Integer. parselnt( request. getParameter ("numberofentries")) ; i++) { //Page Reloaded from submit int dbRtrn = dbBean. insertNewSt rain (Integer. parselnt( request. getParameter ("i dent")) , Integer. parse Int(request.getParameter("number")) + i, request. getParameter ("date") , Integer. parselnt( request. getParameter ("genus")) , Integer . parselnt( request. getParameter ("species")) , Integer. parselnt( request. getParameter( su bspecies")) , integer. parselnt( request. getParameter ("subtype")) , request. getParameter (" notes") , request. getParameter(" hi story ) , gtent , sptent, subtent, othertent) ; if ( dbRtrn ==0) { success++; if(i == (Integer. parselnt( request. getParameter ("numberofentries")) -D) { out . wri te (lnteger . toStri ng (i +l) + " strai n (s) successful l y i nserted . <br>") ; } } else if ( dbRtrn == 3) { out. write ("This identifier and number combination already exists, please check your number again or use the update page to change this data.<br>"); } else{ out.writeC'lnsert Failed, please press back and make sure that your data is correct and that your login has not timed out.<br>"); dbRtrn = 0;
}
} else { int success = 0; if (request. getParameter("increment") != null) { for (int i =0; i <
Integer. parselnt( request. getParameter ("numberofentries")) ; i++) { //Page Reloaded from submit int dbRtrn = dbBean.insertNewSt rain (Integer. parselnt( request. getParameter ("i dent")) , Integer, parse Int(request.getParameter("number"))+ i , request. getParameter ("date") , Integer. parselnt( request. getParameter ("genus")) , Integer . parselnt( request. getParameter ("species")) , Integer. parselnt( request. getParameter ("su bspecies")) , integer. parselnt( request. getParameter ("subtype")) , request. getParameter (" notes") , request. getParameter(" hi story") ,gtent , sptent, subtent, othertent) ; if ( dbRtrn ==0) { success++; if(i == (Integer. parselnt( request. getParameter ("numberofentries")) -I)) { out.write(lnteger . toString(i+l) + " strain(s) successfully inserted. <br>") ;
} } else if ( dbRtrn == 3) { out. write ("This identifier and number combination already exists, please check your number again or use the update page to change this data.<br>");
} else{ out.writeC'lnsert Failed, please press back and make sure that your data is correct and that your login has not timed out.<br>"); dbRtrn = 0;
%>
<form action="insertstrai n . jsp">
<table border="0" cell padding = "0" cellspacing = "1" align="center"> <tr>
<td col span = "3">
<centerxhl>Insert New Strain</hlx/center> </td> </tr> <tr>
<td colspan="3">
<center>All fields are nullable.</center> <td> </tr> <tr>
<td> identifier (RM):&nbsp </td> <td>
<select name="ident"> <%
ResultSet myRS = dbBean.getldentPrefix() ; if (myRS. next ()) { myRS.fi rst() ; do { if (request. getParameterC'ident") !=nul] && request. getParameterC'ident") .compareTo(myRS.getString("identifier_id")) == 0) { out.write("<option value=" + myRS.getlnt("identifier_id") + " selected>" + myRS.getStringC'ident")) ;
} else { out.write("<option value=" + myRS.getlnt("identifier_id") + ">" + myRS.getStringC'ident"));
} while (myRS. next()) ; myRS. close () ; %>
</sel ect>&nbsp<a h ref="newi denti fi er . j sp">New ldenti fi er</a>&nbsp </td> </tr> <tr>
<td>
Number (1222):&nbsp </td> <td>
<input type=text name="number" value ="<% if (request. getParameterC'number") != null) { int mint = Integer. parselnt( request. getParameterC'number")) ; mint = mint + integer. parselnt( request. getParameter ("numberofentries")) ; out. write (Integer. toSt ring (mint)) ; } else { out. write (integer . tost ring (dbBean. getLastUsedStrainNumber 0+1)) ;
%>"> </td> </tr>
if
Figure imgf000189_0001
Genus: </td> <td>
<sel
Figure imgf000189_0002
out.write("<option value='" + myRS.getlnt("genus_id") + '" selected>" + myRS.getStringC'name"));
} else { out.write("<option value='" + myRS.getInt("genus_id") + '">" + myRS.getStringC'name")) ;
} else { if (cmpr.compareTo("")==0) { out.write("<option value='" + myRS.getlnt("genus_id") + '" selected>No Genus");
} else { out.write("<option value='" + myRS.getlnt("genus_id") + '">No Genus");
} } while (myRS. next()) ; myRS. close () ; %>
</select> </td> <td> <% if (request. getParameterC'gtent") == null | | Integer . parselnt(request.getParameter("gtent")) == 0) { out.write("<input type=' checkbox1 name='gtent ' val ue=' l'>Tentative") ; }else { out.write("<input type=' checkbox1 name='gtent ' value='l' checked>τentative") ; }
%>
</td> </tr> <tr>
<td>
Species: </td> <td>
<select name="species"> <% myRS = dbBean.getSpeciesO ; if (myRS. next ()) { myRS. first O ; do {
String cmpr = request. getParameter("species") ; if (cmpr == null) { cmpr = "";} if (myRS.getStringC'name") !=null) { if (cmpr.compareTo(myRS.getString("species_id")) 0) { out.write("<option value='" + myRS.getlnt("species_id") + "' selected>" + myRS.getStringC'name"));
} else { out.write("<option value='" + myRS.getInt("species_id") + '">" + myRS.getStringC'name"));
} else { if (cmpr .compareTo("")==0) { out.write("<option value='" + myRS.getlnt("species_id") + "' selected>No Species");
} else { out.write("<option value='" + myRS.getlnt("species_id") + '">No Species");
} } while (myRS. next ()) ; myRS.closeO ;
%> </select> </td> <td> <% if (request. getParameterC'sptent") == null | | Integer . parselnt(request.getParameter("sptent")) == 0) { out.write("<input type=' checkbox1 name=' sptent ' value='l'>τentative") ; }else { out.write("<input type=' checkbox1 name=' sptent ' value='l' checked>τentative") ;
%>
</td> </tr> <tr>
<td>
id"))
Figure imgf000191_0001
<tr>
<td>
Serovar/Subtype/Genotype : </td> <td>
<select name="subtype"> <% myRS = dbBean.getSubType() ; if (myRS. next ()) { myRS. first O ; do {
String cmpr = request. getParameter("subtype") ; if (cmpr == null) { cmpr = "";} if (myRS.getStringC'name") !=null) { if (cmpr .compareTo(myRS.getString("subtype_id")) 0) { out.write("<option value='" + myRS.getlnt("subtype_id") + '" selected>" + myRS.getStringC'name"));
} else { out.write("<option value='" + myRS.getInt("subtype_id") + '">" + myRS.getStringC'name"));
} else { if (cmpr . compareTo("")==0) { out.write("<option value='" + myRS.getlnt("subtype_id") + '" selected>No Subtype");
} else { out.write("<option value='" + myRS.getlnt("subtype_id") + '">No Subtype");
} } while (myRS. next ()) ; myRS.closeO ; %>
</select> </td> <td> <% if (request. getParameterC'othertent") == null | | Integer . parselnt(request.getParameter("othertent")) == 0) { out.write("<input type=' checkbox1 name='othertent ' value='l'>τentative") ; }else { out.write("<input type=' checkbox1 name='othertent ' value='l' checked>τentative") ; }
%>
</td> </tr> <tr>
<td style="vertical -align: top">
Notes: </td> <td colspan="2">
<textarea name="notes" cols="60" rows="10" ><%if (request. getParameterC'notes") != null) {out.write(request.getParameter("notes")) ; }%></textarea>
</td> <tr> <tr>
<td style="vertical -align: top">
History: </td> <td colspan="2"> <textarea name="hi story" cols="60" rows="5"x%if (request. getParameter("hi story") != null) {out. write (request. getParameter ("hi story")) ; }%></textarea>
</td> <tr> <tr>
<td>
Number of entries to insert: </td> <td>
<input name="numberofentries" type="text" value="l" size="5"xbr>*Press Submit New Strain for this to be applicable, not Submit and Increment
</td> </tr> <tr>
<td C9lspan="3" align="right">
<input type="submit" name="increment" value="Submit and
Increment">&nbsp&nbsp&nbsp&nbsp&nbsp<input type="submit" value="Submit New Strain" name="submi t">
</td> </tr> </table> </form>
<%}dbBean . dbCloseO ;%> <%out.write(pageSource. get Page Footer ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Insert <i>In Silico</i> Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeaderO) ; dbBean. dbCloseO ;
%>
<form method=post action="checkinsilicoparse. jsp" enctype="MUl_TlPART/FORM-DATA"> <table align = center> <tr>
<td col span = 2>
<centerxhl>Upload <i>In Silico</i> Data</hlx/center> </td> </tr> <tr>
<td>
Fi nd Fi 1 e : </td> <td>
<input type="file" name="maldifile"> </td> </tr> <tr> <tdx/td>
<td colspan="l" align=left>
<input type="submit" value="Send"> </td> </tr> </table> </form> <%out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<j sp : useBean i d="frlnsi 1 i co" cl ass="psm . mformat . formati nsi 1 i co" scope="session"/>
<jsp: useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Insert <i>In Silico</i> Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeaderQ) ; dbBean. dbCloseO ;
%> <% dbBean . dbConnectO ; int rtrn; int genus = dbBean. insertNewGenus(request. getParameter("genus")) ; int species = dbBean. insertNewSpecies(request. getParameter("species")) ; int subspecies = dbBean. insertNewSubspecies(request. getParameter("subspecies")) ; int subtype = dbBean. insertNewSubtype( request. getParameter("subtype")) ; rtrn = dbBean. insertINSILICO( request. get Parameter ("i dent") , Integer. toSt ring (genus) , integer. tost ring (species) , integer. tost ring (subspecies) , integer. tost ring (subtype) , request. get Parameter ("mw") , request. get Parameter ("protein") , request, get Parameter ("notes") , f rlnsilico.getMaldiMZO) ; if (rtrn == 1) { out.write("τhis identifier does not exist, please press back and choose an identifier already in the database."); } else if (rtrn !=0) { out.write("An error occurred while processing this request, please try again, if this continues contact support."); } else if (rtrn ==0 ) { out.writeC'lnsert successfull ! ") ; dbBean. dbCloseO ; %> <%out.write(pageSource.getPageFooter()) ; %>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%> <%@page import="java. sql . *" %>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
<head>
<meta http-equiv="Content-Type" content="text/html ; charset=UTF-8">
<title>ln Si Ii co Data</title> </head> <body>
<hlxi>In Silico</i> Data</hl>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope = "session" />
<bxi>ln Silico</i> lD:</b> <%=request.getParameter("insilicoid")%xbr>
<% dbBean . dbConnectO ;
ResultSet myRS; ico, es_id =
Figure imgf000196_0001
<% do {
%>
<tr>
<td>
<%=myRS.getString("mass")%> </td>
<%} while (myRS. next ()); } else {%>
There is no MS/MS data for this sample. <%} myRS.closeO ; dbBean. dbCloseO ; %>
</table> <br>
<a href=" ./deletei nsilicoconfi rm. jsp?i n si 1 i coi d=<%= request. getParameter("i nsilicoid")%> " target="_top">DELETE Data</axbr>
</body>
</body> </html>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
<ti tl e>MALDl-TOF DATA and Sti ck Graph</ti tl e>
<frameset cols="75%,25%">
<frame src="i nsi 1 i cographandopti ons . j sp?i nsi 1 i coi d=<%=request . getParameter("i nsi 1 i coi d")%>& rangeA=0&rangeB=14000&topnum=l">
<frame src="i nsi 1 i codata. jsp?i nsi 1 i coi d=<%=request . getParameter("i nsi 1 i coi d")%>">
</frameset>
</html>
<%@ page language="java" %>
<%@ page import ="java. util . *" %>
<%@ page import ="java. text.NumberFormat" %>
<%@ page import ="java. text. Decimal Format" %>
<%@ page import="java.io.OutputStream" %>
<%@ page import="java. awt. image. Bufferedlmage" %>
<%@ page import=" Java. awt. *" %>
<%@ page import="com. sun. image. codec. j peg. *" %>
<%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/> <jsp:useBean id="gBean" class="psm. graph. maldiGraph"/>
<% int idl, id2, intA = 0, intB = 14000, intensity=2, ybound; String masserror = "2.5"; idl = integer. parselnt(request.getParameter("idl")) ; id2 = Integer. parselnt(request.getParameter("id2")) ; if (request. getParameterC'rangeA") != "") { intA = Integer. parselnt(request. getParameterC'rangeA")) ;
if (request. getParameterC'rangeB") != "") { intB = Integer. parselnt(request. getParameterC'rangeB")) ;
if (request. getParameterC'masserror") != "") { masserror = request. getParameterC'masserror") ;
if (request. getParameterC'intensity") != "") { intensity = integer. parselnt( request. getParameter ("intensity")) ;
ybound = (int) (Double. parseDouble(masserror) + 0.5); ybound = ybound * -1;
Font font = new Font("ARIAL" , Font. BOLD , 12); response. setContentτype("image/jpeg") ;
Bufferedlmage blmg = new Bufferedlmage(850, 580, Bufferedlmage. TYPE_INT_RGB) ;
Graphics2D biContext = blmg.createGraphicsO ; biContext. setBackground(Color. WHITE) ; bi Context. cl earRect (0,0, 850, 580);
bi Context . setCol or (Col or . BLACK) ;
//vertical Line
//left biContext. drawLine(60, 40, 60, 540) ;
//right bi Context . drawLi ne (810 , 40 , 810 , 540) ;
//Horizontal Line
//top bi Context . drawLi ne (60 , 40 , 810 , 40) ;
//bottom biContext. drawLine(60, 540,810, 540) ; biContext. setFont(font) ;
//Horizontal Line
//middle bi Context .drawLi ne (60 , 290 , 810 , 290) ; //Draws the Y Numbers
//bi Con text. drawSt ring (Integer. toSt ring (ybound) , 35, 545) ; //biContext.drawl_ine(53, 540, 60, 540); double interval = 500.0 / (ybound*-2) ; for (int j = 0; j <= (ybound * -2); j++) { int increment = (int) ((double) j -'interval + .5); biContext.drawString(lnteger . toString(ybound + j), 30, 545 -increment); biContext.drawLine(53, 540-increment, 60, 540-increment) ;
} int div = (intB - intA) / 5; int 1 ;
String num; num = ""; num = num + intA; biContext.drawString(num, 60 , 315);
//Draws the X numbers for (1=1; 1 <=5; 1++) { int i = 0; i = i ntA + div*l ; num = ""; num = num + i ; int centerint = num.length() / 2 * 7; if (num.length()%2 !=0) { centerint+= 3; } biContext.drawString(num, (60 + 150*(l) - centerint) , 315); bi Context. drawLine (60+150*1 , 280, 60+150*1, 300); } dbBean . dbConnectO ;
ResultSet myRS = dbBean. getlnSilicoErrorData(Integer. parselnt( request. getParameter ("idl")) ,
Integer. parselnt( request. getParameter ("id2")) , Integer .toSt ring (intensity) , masserror, Integer .toString(i ntA) , Integer . toString(intB) , request. getParameter ("residue")) ;
ArrayList x, y, r; x = new ArrayListO; y = new ArrayListO; r = new ArrayListO; int n = 0; double xavg = 0; double yavg = 0; double xmin = intB; double xmax = 0;
Double tempx; Double tempy; String tempr;
//Grab the data from the database and calculate the average of x and y //also determine maximum and minimum value for y while (myRS. next()) { x. add (new Double (myRS. getDouble("x"))) ; y. add (new Doubl e (myRS. getDouble(" Error"))) ; r. add (new St ri ng (myRS. getSt ring ("residue"))) ; tempx = (Double)x.get(n) ; xavg += tempx. doubl evalue () ; tempy = (Double)y.get(n) ; yavg += tempy. doubl eVal ue() ; if (xmi n > tempx. doubl eValueO) { xmin = tempx. doubl evalue O ; if(xmax < tempx. doubl eValueO) { xmax = tempx. doubl eVal ue() ; n++; } xavg = xavg / (n) ; yavg = yavg / (n) ; double Sxx = 0.0; double Syy = 0.0; double Sxy = 0.0; int countDEP = 0; double xinterval = 750.0 / (intB - intA); int radius = 5; for (int t = 0; t < x.sizeO; t++) { tempx = (Double)x.get(t) ; tempy = (Double)y.get(t) ; tempr = (String)r .get(t) ;
//Calculate Sxx and Syy and Sxy
Sxx += Math. pow( (tempx. doubl evalue () - xavg), 2);
Syy += Math. pow( (tempy. doubl evalue () - yavg), 2);
Sxy += (tempx. doubl evalue () - xavg)* (tempy. doubl evalue () - yavg);
//Choose which color to plot the point as. DEP residues are labeled red //all others are black if(tempr.contains("D") | | tempr .contains("E") | | tempr .contains("P")) { biContext. setColor(Color . red) ; countDEP++; } else { bi Context . setCol or (Col or . bl ack) ; }
//Plot the points double xl = (int) 60.5 + xinterval * (tempx. doubleValue() - intA); double yl = (int) 290.5 - interval*(tempy.doubleValue()) ;
biContext. drawRect((int) xl,(int) yl - (radius/2), radius, radius); biContext. fillRect((int) xl, (int) yl - (radius/2), radius, radius);
double ratioDEP = 100 * (double)countDEP / (double) x.sizeO; biContext. setColor(Color .black) ; //calculate the slope double m = Sxy/Sxx; //calculate the intercept double b = yavg - m*xavg; //calculate teh r2 value double r2 = Math. pow(Sxy,2) / (Sxx * Syy) ; xmi n -= xmi n * .15 ; xmax += xmax * .15 ; if (xmi n < intA) { xmi n = intA; if (xmax > intB) { xmax = intB; } int txl = (int) (((xmin - intA) * xinterval) + 60.5); int tx2 = (int) (((xmax - intA) * xinterval) + 60.5); int yxl = (int) (290.5 - ((xmin*m + b)) * interval); int yx2 = (int) (290.5 - ((xmax*m + b)) * interval); biContext. setstroke(new BasicStroke(2)) ; bi Con text. draw/Line (txl, yxl, tx2 ,yx2) ;
NumberFormat outnum = new Decimal Format("#0.0000") ; biContext. drawString("RΛ2 = " + outnum. format(r2) ,650, 55 ); biContext . drawStri ngC'y = " + outnum. format(m) + "x + " + outnum. format(b) , 650, 70); biContext. drawStringC'DEP Count: " + Integer. toString(countDEP) , 650, 85); biContext. drawStri ng("DEP Ratio: " + outnum. format(ratioDEP) + "%" , 650, 100); String residue = "All"; if (request. getParameterC'residue") != null) { residue = request. getParameterC'residue") ; biContext. drawStri ng("All Matches, " + Integer . toString(intensity) + "% Intensity Cutoff, " + masserror + " Da Mass Tolerance + ", Residue: " + residue, 275, 30);
Font font2 = new Font("ARIAL" , Font. ITALIC + Font. BOLD, 12); biContext. setFont(font2) ; biContext. drawStri ng("m/z" , 350, 560); biContext. setFont(font) ; biContext. drawStri ng(" of MS/MS Fragment Ions", 370, 560);
FontMetrics fm = biContext. getFontMetricsO ; biContext. rotate(-Math. PI / 2, 10, 325 - (fm.getHeight()/2)) ; biContext. drawStri ngC'Error", 25,325) ;
OutputStream output = response. getθutputstream() ;
ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ;
JPEGEncodeParam param = encoder .getDefaultJPEGEncodeParam(blmg) ; param. setQuality((float) 1, false); encoder. setZIPEGEncodeParam(param) ; encoder .encode (blmg) ; output. close O ; dbBean.dbCloseO ;
%> <%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
<head>
<meta http-equiv="Content-Type" content="text/html ; charset=UTF-8"> <title>Error Graphs</title> </head> <body>
<center>lf the graph does not appear to resemble the proper data, click refresh or submit. <br>Your browser may have cached the previous image. <brxbrx/center> <form action="i nsilicoerrorgraphsallmatchandopt . jsp"> <% int rangeA, rangeB, topnum; if (request. getParameterC'rangeA") != "" && request. getParameter("rangeA") != null) { rangeA = Integer . parselnt(request. getParameterC'rangeA")) ; } else { rangeA = 4000; if (request. getParameterC'rangeB") != "" && request. getParameterC'rangeB") != null) { rangeB = Integer . parselnt(request. getParameterC'rangeB")) ; } else { rangeB = 14000; if (request. getParameterC'topnum") != "" && request. getParameterC'topnum") != null) { topnum = Integer . parselnt(request. getParameterC'topnum")) ; } else { topnum = 5; }
%>
<tabl e border="0" cel l paddi ng = "0" cel l spaci ng = "0" al i gn=center > <tr> <td col span="3">
<i mg src="i nsi 1 i coerrorgraphsal 1 match . j sp?i dl=<%=request . getParameter ("i dl")%>&i d2=<%=req uest.getParameter( id2")%>&rangeA=<%=request.getParameter("rangeA")%>&rangeB=<%=requ est . getParameter (" rangeB")%>&i ntensi ty=<%=request . getParameter ("i ntensi ty")%>&masser ror=<%=request. getParameter ("masse rror")%>&residue=<%=request. getParameter ("residue" )%>">
</td> </tr>
<tr>
<td>
Low VaI ue:&nbsp<i nput type="text" name=" rangeA" value="<%=rangeA%>"> </td> <td>
Hi gh VaI ue : &nbsp<i nput type="text" name=" rangeB" val ue="<%=rangeB%>"> </td> <td>
Number of Val ues Label ed : <i nput type="text" name="topnum" val ue="<%=topnum%>">
</td> </tr> <tr>
<td>
Resi due : &nbsp<i nput type="text" name=" resi due" val ue="<%=request . getParameter (" resi due")%>" readonl y>
Figure imgf000204_0001
<%@ page language="java" %>
<%@ page import ="java. util . *" %>
<%@ page import ="java. text.NumberFormat" %>
<%@ page import ="java. text. Decimal Format" %>
<%@ page import="java.io.OutputStream" %>
<%@ page import="java. awt. image. Bufferedlmage" %>
<%@ page import=" Java. awt. *" %>
<%@ page import="com. sun. image. codec. j peg. *" %>
<%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/> <jsp:useBean id="gBean" class="psm. graph. maldiGraph"/>
<% int idl, id2, intA = 0, intB = 14000, intensity=2, ybound; String masserror = "2.5"; idl = integer. parselnt(request.getParameter("idl")) ; id2 = Integer. parselnt(request.getParameter("id2")) ; if (request. getParameterC'rangeA") != "") { intA = Integer. parselnt(request. getParameterC'rangeA")) ;
if (request. getParameterC'rangeB") != "") { intB = Integer. parselnt(request. getParameterC'rangeB")) ;
if (request. getParameterC'masserror") != "") { masserror = request. getParameterC'masserror") ;
if (request. getParameterC'intensity") != "") { intensity = integer. parselnt( request. getParameter ("intensity")) ;
ybound = (int) (Double. parseDouble(masserror) + 0.5); ybound = ybound * -1;
Font font = new Font("ARIAL" , Font. BOLD , 12); response. setContentτype("image/jpeg") ;
Bufferedlmage blmg = new Bufferedlmage(850, 580, Bufferedlmage. TYPE_INT_RGB) ;
Graphics2D biContext = blmg.createGraphicsO ; biContext. setBackground(Color. WHITE) ; bi Context. cl earRect (0,0, 850, 580);
bi Context . setCol or (Col or . BLACK) ;
//vertical Line
//left biContext. drawLine(60, 40, 60, 540) ;
//right bi Context . drawLi ne (810 , 40 , 810 , 540) ;
//Horizontal Line
//top bi Context . drawLi ne (60 , 40 , 810 , 40) ;
//bottom biContext. drawLine(60, 540,810, 540) ; biContext. setFont(font) ;
//Horizontal Line
//middle bi Context .drawLi ne (60 , 290 , 810 , 290) ; //Draws the Y Numbers
//bi Con text. drawSt ring (Integer. toSt ring (ybound) , 35, 545) ; //biContext.drawl_ine(53, 540, 60, 540); double interval = 500.0 / (ybound*-2) ; for (int j = 0; j <= (ybound * -2); j++) { int increment = (int) ((double) j -'interval + .5); biContext.drawString(lnteger . toString(ybound + j), 30, 545 -increment); biContext.drawLine(53, 540-increment, 60, 540-increment) ;
} int div = (intB - intA) / 5; int 1 ;
String num; num = ""; num = num + intA; biContext.drawString(num, 60 , 315);
//Draws the X numbers for (1=1; 1 <=5; 1++) { int i = 0; i = i ntA + div*l ; num = ""; num = num + i ; int centerint = num.length() / 2 * 7; if (num.length()%2 !=0) { centerint+= 3; } biContext.drawString(num, (60 + 150*(l) - centerint) , 315); bi Context. drawLine (60+150*1 , 280, 60+150*1, 300); } dbBean . dbConnectO ;
ResultSet myRS = dbBean. getlnSilicoErrorData(Integer. parselnt( request. getParameter ("idl")) ,
Integer. parselnt( request. getParameter ("id2")) , Integer .toSt ring (intensity) , masserror, Integer .toString(i ntA) , Integer . toString(intB) , request. getParameter ("residue")) ;
ArrayList x, y, z, r, tossx, tossy, tossi ; z = new ArrayListO; x = new ArrayLi st(); y = new ArrayListO; r = new ArrayListO; tossx = new ArrayListO; tossy = new ArrayListO; tossi = new ArrayListO; int n = 0; double xavg = 0; double yavg = 0; double xmin = intB; double xmax = 0;
Double tempx = new Double(O.O); Double ttempx = new Double(O.O); Double tempi = new Double(O.O); Double tempy = new Double(O.O); Double tempz = new Double(O.O); String tempr = new StringC"1);
//Grab the data from the database and calculate the average of x and y //also determine maximum and minimum value for y while(myRS. next Q) { double insilico = myRS.getDouble ("insilico") ; double nx = myRS.getDouble("x") ; double nerr = myRS.getDouble("Error") ; String nR = myRS.getStringC'residue") ; if (n > 0) { tempx = (Double)x.get(n-l) ; if (tossx.sizeO > 0) { ttempx = (Double)tossx.get(tossx. size()-l) ; if (tossi .size O > 0) { tempi = (Double)tossi .get(tossi . size()-l) ; tempy = (Double)y.get(n-l) ; tempz = (Double)z.get(n-l) ; tempr = (String)r .get(n-l) ; if ((tossi .sizeO > 0 && insilico == tempi .doubleValueO) | | (tossx.sizeO > 0 && nx == ttempx. doubleValueO)) {
//Dont follow through ignore this one } else if (tempx. doubleValueO == nx) { xavg -= tempx. doubleValueO ; yavg -= tempy. doubleValueO ; x. remove(n-l) ; y. remove(n-l) ; z. remove(n-l) ; r . remove(n-l) ; tossx.add(new Double(nx)); n— ; } else if(tempz. doubleValueO == insilico) { xavg -= tempx. doubleValueO ; yavg -= tempy. doubl eVal ue() ; x. remove(n-l) ; y. remove(n-l) ; z. remove(n-l) ; r . remove(n-l) ; tossi .add(new Double(nerr)) ; n— ; } else { x.add(new Double(nx)); y.add(new Double(nerr)) ; z. add (new Doubl e(i nsi 1 i co)) ; r.add(new String(nR)); tempx = (Double)x.get(n) ; tempy = (Double)y.get(n) ; xavg += tempx. doubl evalue () ; yavg += tempy. doubl eValue O ; n++;
} else { x.add(new Double(nx)); y.add(new Double(nerr)) ; z. add (new Doubl e(i nsi 1 i co)) ; r.add(new String(nR)); tempx = (Double)x.get(n) ; tempy = (Double)y.get(n) ; xavg += tempx. doubl evalue () ; yavg += tempy.doubleValue() ; n++;
} xavg = xavg / (n) ; yavg = yavg / (n) ; double Sxx = 0.0; double Syy = 0.0; double Sxy = 0.0; int countDEP = 0; double xinterval = 750.0 / (intB - intA); int radius = 5; for (int t = 0; t < x. size O; t++) { tempx = (Double)x.get(t) ; tempy = (Double)y.get(t) ; tempr = (String)r .get(t) ;
//Calculate Sxx and Syy and Sxy
Sxx += Math. pow( (tempx. doubleValueO - xavg), 2);
Syy += Math. pow( (tempy. doubleValueO - yavg), 2);
Sxy += (tempx. doubleValueO - xavg)* (tempy. doubleValueO - yavg);
//Choose color if(tempr.contains("D") | | tempr. contains("E") | | tempr. contains("P")) { biContext. setColor(Color. red) ; countDEP++; } else { bi Context . setCol or (Col or . bl ack) ; }
//Plot the points double xl = (int) 60.5 + xinterval * (tempx. doubleValueO - intA); double yl = (int) 290.5 - interval *(tempy. doubleValueO) ; biContext. drawRect((int) xl - (radius/2) , (int) yl - (radius/2), radius, radius); biContext. fillRect((int) xl - (radius/2), (int) yl - (radius/2), radius, radius) ; if (xmin > tempx. doubleValueO) { xmin = tempx. doubleValueO ; } if(xmax < tempx. doubleValueO) { xmax = tempx. doubl eval ue() ;
} biContext. setColor(Color .black) ; double ratioDEP = 100 * (double)countDEP / (double) x.sizeO;
//calculate the slope double m = Sxy/Sxx;
//calculate the intercept double b = yavg - m*xavg;
//calculate ten r2 value double r2 = Math. pow(Sxy,2) / (Sxx * Syy); xmi n -= xmi n * .15 ; xmax += xmax * .15 ;
if (xmin < intA) { xmin = intA; if (xmax > intB) { xmax = intB;
int txl = (int) (((xmin - intA) * xinterval) + 60.5); int tx2 = (int) (((xmax - intA) * xinterval) + 60.5); int yxl = (int) (290.5 - ((xmin*m + b)) * interval); int yx2 = (int) (290.5 - ((xmax*m + b)) * interval); biContext. setstroke(new BasicStroke(2)) ; bi Con text. draw/Line (txl, yxl, tx2 ,yx2) ;
NumberFormat outnum = new Decimal Format ("#0.0000") ; biContext. drawString("RΛ2 = " + outnum. format(r2) ,650, 55 ); biContext. drawStringC'y = " + outnum. format (m) + "x + " + outnum. format(b) , 650, 70); biContext. drawStringC'DEP Count: " + Integer . toString(countDEP) , 650, 85); biContext. drawStringC'DEP Ratio: " + outnum. format(ratioDEP) + "%" , 650, 100); String residue = "All"; if (request. getParameterC'residue") != null) { residue = request. getParameterC'residue") ; biContext. drawStringC'Single Matches, " + Integer . toString(intensity) + "% Intensity Cutoff, " + masserror + " Da Mass Tolerance" + ", Residue: " + residue, 275, 30);
Font font2 = new Font("ARIAL" , Font. ITALIC + Font. BOLD, 12); biContext. setFont(font2) ; biContext. drawString("m/z" , 350, 560); biContext. setFont(font) ; biContext. drawStringC" of MS/MS Fragment Ions", 370, 560);
FontMetrics fm = biContext. getFontMetricsO ; biContext. rotate(-Math. PI / 2, 10, 325 - (fm.getHeight()/2)) ; biContext. drawStringC'Error", 25,325) ;
OutputStream output = response. getθutputstream() ;
ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ;
JPEGEncodeParam param = encoder .getDefaultJPEGEncodeParam(blmg) ; param. setQuality((float) 1, false); encoder. setZIPEGEncodeParam(param) ; encoder .encode (blmg) ; output. close O ; dbBean.dbCloseO ;
%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
<head>
<meta http-equiv="Content-Type" content="text/html ; charset=UTF-8"> <title>Error Graphs</title> </head> <body>
<center>lf the graph does not appear to resemble the proper data, click refresh or submit. <br>Your browser may have cached the previous image. <brxbrx/center> <form action="i nsilicoerrorgraphssi nglematchandopt . jsp"> <% int rangeA, rangeB, topnum; if (request. getParameterC'rangeA") != "" && request. getParameter("rangeA") != null) { rangeA = Integer . parselnt(request. getParameterC'rangeA")) ; } else { rangeA = 4000; if (request. getParameterC'rangeB") != "" && request. getParameterC'rangeB") != null) { rangeB = Integer . parselnt(request. getParameterC'rangeB")) ; } else { rangeB = 14000; if (request. getParameterC'topnum") != "" && request. getParameterC'topnum") != null) { topnum = Integer . parselnt(request. getParameterC'topnum")) ; } else { topnum = 5; }
%>
<tabl e border="0" cel l paddi ng = "0" cel l spaci ng = "0" al i gn=center > <tr> <td col span="3">
<i mg src="i nsi 1 i coerrorgraphssi ngl ematch . j sp?i dl=<%=request . getParameter("i dl")%>&i d2=<%= request. getParameter("id2")%>&rangeA=<%=request . getParameter("rangeA")%>&rangeB=<%=r equest . getParameter(" rangeB")%>&i ntensi ty=<%=request . getParameter("i ntensi ty")%>&mas serror=<%=request. getParameter("masserror")%>&residue=<%=request. getParameter("resid ue")%>">
</td> </tr> </tr>
<tr>
<td> lue :&nbsp<input type="text" name=" rangeA" value="<%=rangeA%>"> aI ue:&nbsp<i nput type="text" name="rangeB"
Figure imgf000210_0001
Number of Values Labeled: <input type="text" name="topnum" val ue="<%=topnum%>">
</td> </tr> <tr>
<td>
Resi due : &nbsp<i nput type="text" name=" resi due" value="<%=request.getParameter("residue")%>" readonly> </td> <td>
Mass Tolerance:<input type="text" name="masserror" value="<%=request. getParameter("masserror")%>" readonly> </td> <td> intensity: <input type="text" name="intensity" val ue="<%=request . getParameter("i ntensi ty")%>" readonl y>
</td> </tr> <tr>
<td col span ="1"> <br>
In Silico ID:&nbsp <input type="text" name="id2" val ue="<%=request. getParameter("id2")%>" readonl y> </td> <td colspan ="2">
MS/MS lD:&nbsp <input type="text" name="idl" value= <%=request.getParameter("idl")%> readonl y>
</td> </tr> <tr>
<td col span = 3 al i gn = ri ght> <i nput type=submi t val ue="Rel oad"> </td> </tr> </tabl e> </form> </body> </html >
<%@ page language="java" %>
<%@ page import="java.io.OutputStream" %>
<%@ page import="java. awt. image. Bufferedlmage" %>
<%@ page import=" Java. awt. *" %>
<%@ page import="com. sun. image. codec. j peg. *" %>
<%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="gBean" class="psm. graph. maldiGraph"/>
<% int intA = Integer. parselnt(request. getParameter("rangeA")) ; int intB = Integer .parselnt(request.getParameter("rangeB")) ; int topnum = Integer. parselnt(request.getParameter("topnum")) ;
String id = request. getParameter("insilicoid") ; Font font = new Font("ARIAL" , Font. BOLD , 12); response. setContentτype("image/jpeg") ;
Bufferedlmage blmg = new Bufferedlmage(850, 620, Bufferedlmage. TYPE_INT_RGB) ;
Graphics2D biContext = blmg.createGraphicsO ; biContext. setBackground(Color . WHITE) ; bi Context. clearRect (0,0, 850, 620);
biContext. setCol or (Color. BLACK) ; biContext. drawLine(60, 40, 60, 540) ; bi Context . drawLi ne (60 , 540 , 810 , 540) ; biContext. setFont(font) ;
//Draws the Y Numbers int j =1; biContext . drawStri ng("0" , 35 , 545) ; biContext. drawLine(53, 540, 60, 540); for (j = 1; j<=100; j++) { if (j % 10 == 0) {
String num; num = ""; num = num + j ; biContext. drawString(num, 30, 545 - j*5); biContext. drawLine(53, 540-j*5, 60, 540-j*5); } else { biContext. drawLine(58 , 540 -j *5, 60, 540-j*5 );
} int div = (intB - intA) / 5; int 1 ;
String num; num = ""; num = num + intA; biContext. drawStri ng(num, 60 , 570);
//Draws the X numbers for (1=1; 1 <=5; 1++) { int i = 0; i = i ntA + div*l ; num = ""; num = num + i ; int centerint = num.lengthQ / 2 * 7; if (num.length()%2 !=0) { centerint+= 3;
} biContext. drawString(num, (60 + 150*(l) - centerint) , 570);
bi Context. drawLine(60+150*"l , 540, 60+150*1 , 555);
for (1=1; 1 <=10; 1++) { biContext.drawLine(60+(75*l), 540, 60+(75*l), 550);
for (1=1; 1 <= 20; 1++) { if (1 % 2 != 0 ) { double shift = 1 * 37.5; int lshift = (int) shift; biContext.drawl_ine(60+Ishift, 540, 60+Ishift, 545); } dbBean . dbConnectO ;
//draw the lines biContext = gBean.gDraw(biContext, dbBean. getINSILICOGraphData(id, intA, intB), intA, intB, topnum, 540, 5, 750); bi Context . setCol or (Col or . BLACK) ; biContext = gBean.gDrawMSMSTitleAA(bi Context, dbBean. getINSILICOAndSampl elnfo(i d) ,
870);
biContext. drawString("Mass to Charge (M/Z)", 365, 610); FontMetrics fm = biContext. getFontMetricsO ; biContext. rotate(-Math. PI / 2, 10, 325 - (fm.getHeight()/2)) ; biContext. drawString("% Intensity", 10,325);
OutputStream output = response. getOutputStream() ;
ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ;
JPEGEncodeParam param = encoder. getDefaultJ PEGEncodeParam(blmg) ; param. setQuality( (float) 1, false); encoder. setJPEGEncodeParam(param) ; encoder. encode (blmg) ; output. closeO ; dbBean. dbCloseO ;
%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
Figure imgf000214_0001
<td>
Low Value :&nbsp<input type="text" name="rangeA" value="<%=request.getParameter("rangeA")%>"> </td> <td>
High Value:&nbsp<input type="text" name="rangeB" value="<%=request.getParameter("rangeB")%>"> </td> <td>
Number of Values Labeled: <input type="text" name="topnum" value="<%=request.getParameter("topnum")%>">
</td> </tr> name="insilicoid" value=
Figure imgf000214_0002
<%@ page language="java" %>
<%@ page import="java.io.OutputStream" %>
<%@ page import="java. awt. image. Bufferedlmage" %>
<%@ page import=" Java. awt. *" %>
<%@ page import="com. sun. image. codec. j peg. *" %>
<%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="gBean" class="psm. graph. maldiGraph"/>
<% int intA = Integer. parselnt(request. getParameter("rangeA")) ; int intB = Integer .parselnt(request.getParameter("rangeB")) ; int topnum = Integer. parselnt(request.getParameter("topnum")) ;
String id = request. getParameter("insilicoid") ; Font font = new Font("ARIAL" , Font. BOLD , 12); response. setContentτype("image/jpeg") ;
Bufferedlmage blmg = new Bufferedlmage(850, 400, Bufferedlmage. TYPE_INT_RGB) ;
Graphics2D biContext = blmg.createGraphicsO ; biContext. setBackground(Color . WHITE) ; bi Context . cl earRect (0 ,0,850, 600) ; bi Context . setCol or (Col or . BLACK) ; bi Context . drawLi ne (60 , 40 , 60 , 340) ; bi Context . drawLi ne (60 , 340 , 810 , 340) ; biContext. setFont(font) ;
//Draws the Y Numbers int j =1; biContext . drawStri ng("0" , 35 , 345) ; biContext. drawLine(53, 340, 60, 340); for (j = 1; j<=100; j++) { if (j % 10 == 0) {
String num; num = ""; num = num + j ; biContext. drawString(num, 30, 345 - j*3); biContext. drawLine(53, 340-j*3, 60, 340-j*3); } else { biContext. drawLine(58 , 340 -j *3, 60, 340-j*3 );
} int div = (intB - intA) / 5; int 1 ;
String num; num = ""; num = num + intA; biContext. drawStri ng(num, 60 , 370);
//Draws the X numbers for (1=1; 1 <=5; 1++) { int i = 0; i = intA + div*l ; num = ""; num = num + i ; int centerint = num.lengthQ / 2 * 7; if (num.length()%2 !=0) { centerint+= 3; } biContext. drawString(num, (60 + 150*(l) - centerint) , 370);
biContext. drawl_ine(60+150*l, 340, 60+150*1, 355);
for (1=1; 1 <=10; 1++) { bi Context . drawLi ne(60+(75*l ) , 340, 60+(75*l), 350); } for (1=1; 1 <= 20; 1++) { if (1 % 2 != 0 ) { double shift = 1 * 37.5; int lshift = (int) shift; bi Context . drawLi ne(60+Ishi ft , 340, 60+Ishift, 345); } } dbBean . dbConnectO ;
//draw the lines biContext = gBean.gDraw(biContext, dbBean. getINSILICOGraphData(id, intA, intB, request. getParameterC'residue")) , intA, intB, topnum, 340, 3,750); bi Context . setCol or (Col or . BLACK) ; biContext = gBean.gDrawMSMSTitleAA(bi Context, dbBean. getINSILICOAndSampl elnfo(i d) ,
870);
biContext. drawString("Mass to Charge (M/Z)", 375, 390); FontMetrics fm = biContext. getFontMetricsO ; biContext. rotate(-Math. PI / 2, 10, 230 - (fm.getHeight()/2)) ; biContext. drawString("% Intensity", 10,230);
OutputStream output = response. getOutputStream() ;
ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ;
JPEGEncodeParam param = encoder. getDefault3 PEGEncodeParam(blmg) ; param. setQuality( (float) 1, false); encoder. setJPEGEncodeParam(param) ; encoder. encode (blmg) ; output. closeO ; dbBean. dbCloseO ;
%>
<%@page contentType="text/html "%>
<%@page pageEncodi ng="UTF-8"%>
<%@page import="iava. sql . *" %>
<jsp:useBean id= 'dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Strain" , "StrainSearchTitle" , application.getRealPath("/ ), dbBean); out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<%
//Connnect to the genelist db dbBean . dbConnect ("genel i st") ;
//grab the pertinent information for the locus
ResultSet myRS = dbBean. getRS("SEl_ECT locus. ]ocus_id, locus. name 'Locus' ,
CONCAT(identifier . name, sample. number) 'Strain' , CONCAT(genus. name, ' ' , species. name) 'Name' , a. name 'Location 1' , b.name 'Location 2' , locus. start 'Start' , locus. end 'End' , CASE 1OCUS. FR WHEN 1F1 THEN C0NCAT(1OCUS. start, ' .. ' , locus. end)
WHEN 'R' THEN C0NCAT( ' compl ement ( ' , locus. start, ' .. ' , locus. end, ') ') End 'GBK' , locus. FR, locus. NT, locus.AA, locus.MW, locus.lEP, locus.gene 'Gene' , locus. code
'Code' , locus. COG, locus. ECl Εc#l' , locus. EC2 ' EC#2 ' , locus. product 'Product' , locus. notes 'Notes' FROM locus, location a, location b, sample, identifier, strain, genus, species WHERE locus. location_id = a.location_id AND locus. Iocation2_id = b.location_id AND locus. sample_id = sample. sample_id AND sample. identifier_id = identifier .identifier_id AND sample. strain_id = strain. strain_id AND strain. genus_id
= genus. genus_id AND strain. species_id = species. species_id AND locus_id = " + request. getParameter ("locusid")) ;
ResultSetMetaData myMD = myRS.getMetaData() ; myRS. next() ;
%>
<table cellspacing=O cellpadding=O align=center> <% for (int i=l; i <= myMD.getColumnCountO -1; i++) { out.write("<tr>"); out.write("<td style=' font-weight: bold; '>&nbsp; " + myMD.getColumnName(i + 1) + "</td>"); out.write("<td>"); if (myRS.getString(i+l) != null) { out.write("&nbsp; " + myRS.getString(i + I)); } else { out.writeC1-"); } out.write("</td>"); out.write("</tr>"); } myRS.closeO ;
//Now we want the nucleotide data myRS = dbBean. getRS("SELECT nucleotide FROM nucleotide WHERE locus_id = " + request. getParameter ("locusid")) ; if (myRS.nextO) { %>
<tr>
<td style="vertical -align: top; font-weight: bold;"> &nbsp;NT Sequence:&nbsp; </td>
<td style="vertical -align: t9p;">
<smal 1 xsmal 1 ><%=myRS . getSt ri ng ("nucl eoti de")%x/smal 1 ></smal 1 > </td> </tr> <% %>
<% myRS.closeO; %>
<% myRS = dbBean.getRSC'SELECT sequence FROM nucleotidesequence WHERE locus_id = " + request. getParameter ("locusid")) ; if (myRS. next ()) {
%>
<tr>
<td colspan="2">&nbsp;</td>
<tr>
<tr>
<td style="vertical -align: top; font-weight: bold;"> &nbsp;AA Sequence: </td>
<td style="vertical -align: top;">
<smal 1 xsmal 1 ><%=myRS . getSt ri ng ("sequence ")%></smal 1 ></smal 1 > </td> </tr> <%
%> </table>
<% myRS.closeO ; dbBean.dbCloseO ;
%>
<% ou t.write(pageSource. get Page Footer ()) ;
%>
111 <%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp: useBean id="pageSource" class="psm.web. pageCode"/>
<jsp: useBean id="importCSV" class="psm.mformat.importGenelist"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getUsernameO , "insert Subtype" , "insertSubtypeTitle", application. getRealPath("/") , dbBean) ; dbBean. dbCloseO ; out. write (pageSource. getPageHeader ()) ; dbBean . dbConnect ("genel i st") ; i f (i mportCSV. upl oadGenel i st(request , dbBean) == 0) { out .wri teC'Update Successful l ! ") ; } el se { out.write("An error occurred please try again.");
%> <% dbBean. dbCloseO ; out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%>
<%@page pageEncodi ng="UTF-8"%>
<%@page import="iava. sql . *" %>
<jsp:useBean id= 'dbBean" class="psm.db.dbAccess" scope ="session" />
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage(dbBean. getllsername() , "MALDI Comparison" , "MaI di Compari sonTi tl e" , appl i cati on . getReal Path ("/") , dbBean) ; out.write(pageSource. getPageHeader()) ; dbBean. dbCloseO ; %>
<form acti on="comparemal di sampl e . j sp"> <table align="center"> <tr>
<td colspan=2>
<centerxhl>MALDI-TOF Compare</hlx/center> </td> </tr> <tr>
<td colspan=2> <center>
maldi_tof WHERE
sampl e . number)
Figure imgf000220_0001
identifier: </td> <td>
<input type=text name="rm" value="<%=smpl%>"> </td> </tr> <tr>
<td> MALDI-TOF ID:
</td>
<td>
<input type=text name="id" val ue="<%=request . getParameter("mal di i d")%>">
</td> </tr> <tr>
<td>
Error Threshold (ppm) :
</td> <td>
<input type="text" name="ppm" value="500">
</td> </tr> <tr>
<td> intensity Threshold (%) :
</td>
<td>
<i nput type="text" name="i ntensi ty" val ue=5>
</td> </tr> <tr>
<td>
Lower Mass/Charge Bound:
</td>
<td>
<input type="text" name="lMass" value="4000">
</td> </tr> <tr>
<td>
Upper Mass/Charge Bound:
</td>
<td>
<input type=text name="hMass" value="14000">
</td> </tr> <tr>
<td>
Maximum Number of Results:
</td>
<td>
<i nput type="text" name="maxresul ts" val ue="25">
</td> </tr> <tr>
<td>
Ran After (2005-8-15):
</td>
<td>
<input type="text" name="date">
</td> </tr> <tr>
<td colspan=2>&nbsp;
</td> </tr> <tr>
<td col span=2 al i gn = center>
Compare Agai nst Onl y Those That Meet Thi s Search Cri teri a<br>(l_eave Bl ank for ful l search)<br>
<input type="radio" name="andor" value="and" checked>AND <input type="radio" name="andor" value="0r">0R
</td> </tr> <tr>
<td>
Search by Identification Number (e.g. RM12O3 or 1203):
</td>
<td>
<i nput type=text name="i denti fi er">
</td> </tr> <tr> 1203 To: 1403)
name="lowRM" size="5">&nbsp To: &nbsp<input type="text"
Figure imgf000222_0001
Search by Genus (e.g. Campylobacter): </td> <td>
<input type=text name="genus"> </td> </tr> <tr>
<td>
Search by Species (e.g. CoIi): </td> <td>
<input type=text name="species"> </td> </tr> <tr>
<td>
Search by Subspecies (e.g. Fetus): </td> <td>
<input type=text name="subspecies"> </td> </tr> <tr>
<td>
Search by Other Subtype: </td> <td>
<input type=text name="other"> </td> </tr> <tr>
<td>
Search inside Notes: </td> <td>
<input type=text name="notes"> </td> </tr> <tr>
<td>
Search inside History: </td> <td>
<input type=text name="history"> </td> </tr> <tr>
<td colspan=2>&nbsp; </td> </tr> <tr>
<td col span=2 al i gn=centerxbr>
<input type=reset>&nbsp&nbsp&nbsp<input type="submit"> </td> </tr> <tr>
<td colspan=2>
<center><br>Usi ng the default mass range searches will be much faster. <br>Edi ting, or changing the range from 4000 to 14000 requires re-normalization of the data<br>and can cause search times in excess of 2 minutes.<br>Please be patient. </center>
</td> </tr> </table> </form>
<%dbBean . dbCl ose() ; ou t .wri te(pageSource . get Page Footer ()) ;
%>
111 <%@page contentType="text/html "%>
<%@page pageEncodi ng="UTF-8"%>
<%@page import="iava. sql . *" %>
<jsp:useBean id= 'dbBean" class="psm.db.dbAccess" scope ="session" />
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getllsername () , "MALDI Comparison" , "MaI di Compari sonTi tl e" , appl i cati on . getReal Path ("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ; %>
<form acti on="comparemal di sampl estatanal ysi s . j sp"> <table align="center"> <tr>
<td colspan=2>
<centerxhl>MALDI-TOF Compare</hlx/center> </td> </tr> <tr>
<td colspan=2> <center> <% dbBean . dbConnectO ;
ResultSet myRS = dbBean. getRS("SELECT sampl e_id FROM maldi_tof WHERE maldi_tof_id = " + request. getParameter( maldiid")); myRS. next () ;
String smpl = myRS.getString("sample_id") ; myRS.closeO ; myRS = dbBean . getRSC'SELECT concat(identifier .ident, sample. number) as 'ident1 FROM sample, identifier WHERE sampl e.identifier_id = identifier .identifier_id AND sample. sampl e_id = " + smpl ); myRS. next () ; smpl = myRS.getStringC'ident") ; myRS.closeO ; dbBean. dbCloseO ; %>
</center> </td> </tr> <tr>
<td colspan=2> &nbsp </td> <tr>
<td> identifier: </td> <td>
<input type=text name="rm" value="<%=smpl%>"> </td> </tr> <tr>
<td> MALDI-TOF ID:
</td>
<td>
<input type=text name="id" val ue="<%=request . getParameter ("mal di i d")%>">
</td> </tr> <tr>
<td>
Error Threshold (ppm) :
</td> <td>
<input type="text" name="ppm" value="500">
</td> </tr> <tr>
<td> intensity Threshold (X):
</td>
<td>
<i nput type="text" name="i ntensi ty" val ue=10>
</td> </tr> <tr>
<td>
Lower Mass/Charge Bound:
</td>
<td>
<input type="text" name="lMass" value="4000">
</td> </tr> <tr>
<td>
Upper Mass/Charge Bound:
</td>
<td>
<input type=text name="hMass" value="14000">
</td> </tr> <tr>
<td>
Maximum Number of Results:
</td>
<td>
<i nput type="text" name="maxresul ts" val ue="25">
</td> </tr> <tr>
<td>
Ran After (2005-8-15):
</td>
<td>
<input type="text" name="date">
</td> </tr> <tr>
<td colspan=2>&nbsp;
</td> </tr> <tr>
<td colspan=2 align = center>
Use the below text areas to write SQL statements that will be used what data to process.
</td> </tr> <tr>
<td colspan=2>
Select Statement 1:
</td> </tr> <tr>
<td colspan=2>
<textarea col s="60" name="sql one"x/textarea>
</td> </tr> <tr> <td colspan=2>
Select Statement 2:
</td> </tr> <tr>
<td colspan=2>
<textarea cols="60" name="sq"ltwo"x/textarea>
</td> </tr> <tr>
<td colspan=2 align = center>
<input type=" radio" name="searchtype" value="intensity" checked>lntensity Comparison
<input type="radio" name="searchtype" value="mass">Mass only Comparison
</td> </tr> <tr>
<td colspan=2 align=centerxbr>
<input type=reset>&nbsp&nbsp&nbsp<input type="submit">
</td> </tr> </table> </form>
<%dbBean.dbClose(); ou t.writeCpageSource. get Page Footer ()) ;
%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
Figure imgf000227_0001
<%out.write(pageSource.getPageFooter()) ; %>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
<ti tl e>MALDl-TOF DATA and Sti ck Graph</ti tl e>
<frameset cols="75%,25%">
<frame src="mal di graphandopti ons . j sp?mal di i d=<%=request . getParameter("mal di i d")%>&rangeA=40 00&rangeB=14000&topnum=5">
<frame src="mal di tofdata. j sp?mal di i d=<%=request . getParameter("mal di i d")%>">
</frameset>
</html>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%> <%@page import="iava. sql . *" %> <%@page import="java. util . *" %> <%@page import="psm.db.box. *" %>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="frMaldi" class="psm.mformat.formatMALDl" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean.dbConnectO ; pageSource. splitTemp]atePage(dbBean.getUsername() , "MALDI Comparison" , "MaI di Compari sonTi tl e" , appl i cati on . getReal Path ("/") , dbBean) ; out.write(pageSource. getPageHeader()) ; dbBean. dbCloseO ;
%>
<%
//SLightly different from the interna] database
//First insert the maldi file sample into a temporary table, which is terminated at the end of a session
//Then compare teh results
//connect to the database dbBean.dbConnectO ; int id; id = dbBean. i nsertTempMALDl (frMaldi .getMaldiMZO , frMaldi . getMal dimtensityO , Integer. parselnt(request. getParameter("1 Mass")) , Integer. parselnt(request. getParameter("hMass"))) ;
%>
<tabl e al i gn=center cel l paddi ng="l" cel l spaci ng="4" styl e="hori zontal -al i gn : center"> <tr>
<td col span="6" al i gn="center">
<%=request . getParameter ("ti tl e")%>
</td> </tr> <tr>
<td colspan="6" align=center> <a href="mal di fi 1 edatawi thgraph . j sp?mal di i d=<%=i d%>&ti tl e=<%=request . getParameter("ti tl e")%>">See Stick Graph of MALDl-TOF Data</a> </td> </tr> <tr>
<td>
&nbsp;
</td>
<td>
<span style="font-weight: bold; ">MALDI-TOF lD</span>
</td>
<td>
<span style="font-weight : bold; ">MALDI-T0F Date:</span>
</td>
<td>
<span style="font-weight: bold; ">Sample Identifier :</span>
</td>
<td>
<span style="font-weight: bold; ">Sample Name:</span>
</td>
<td>
<span style="font-weight: bold; ">Score</span>
</td> <td>
<span style="font-weight: bold; ">Compare</span> </td> </tr>
<%
//Analyze the parameters and make assignments appropriately, if they are blank redefault them int intensity, lmass, hmass, ppm, maxresults; boolean massSearch = false; if (request. getParameter("searchtype") .compareTo("mass") == 0) { massSearch = true; } if (request. getParameter("intensity") !="") { intensity = integer. parselnt( request. getParameter ("intensity")) ; } else { intensity = 10; } i f (request . getParameter C'l Mass") ! = " ") { l mass = Integer . parselnt (request . getParameter C'l Mass") ) ;
} el se { l mass = 4000 ;
} i f (request . getParameter C'hMass") ! = " ") { hmass = Integer . parselnt (request . getParameter C'hMass") ) ;
} el se { hmass = 14000 ;
} i f (request . getParameter C'ppm") ! = " ") { ppm = Integer . parselnt (request . getParameter C'ppm") ) ;
} el se { ppm=500 ;
if (request. getParameterC'maxresults") != "" & request. getParameterC'maxresults") != null) { maxresults =
Integer. parselnt( request. getParameter ("maxresults")) ; } else { maxresults = 10;
}
//Get the sql statement String sql SeI = ""; if (massSearch) { sql SeI = dbBean . bui 1 dCompareStri ngForTempMassOnl y(i ntensi ty , lmass, hmass, ppm);
} else { sql SeI = dbBean. bui 1 dCompareStri ngForTemp(intensity, lmass, hmass, ppm);
//Get the array maldi ID list
ArrayList mID = dbBean . getAl 1 MaI diDataID( request. getParameter("andor") , request. getParameter("identif ier") , request. getParameter ("lowRM") , request. getParameter (" hi ghRM") , request. getParameter ("genus") , request. getParameter ("s pecies") , request. getParameter ("subspecies") , request. getParameter ("other") , request. ge tParameterC'notes ), request. getParameter("history") , "");
ArrayList rslts = new ArrayListO; dbBean. dbCloseO ; dbBean . dbConnectQ ; //Loop through each ID and compare it sqlSel = sqlSel . replace("$cmpr$", Integer. toString(id)) ;
//if the mass range does not fall within 4 to 14 thousand then we need to normalize the data before comparing it
//if it does fall within this mass range then the data is already normalized and we can use that instead if (lmass != 4000 | hmass != 14000) { for (int i = 0; i < miD.sizeO; i++) {
String 1 = ""; 1 += mlD.get(i) ; int cmprTold; cmprTold = dbBean. dumpMALDIDataToTemp(lnteger . parselnt(l) , intensity, lmass, hmass, "malditemp2") ;
String tmp = sqlSel . replace("$cmprTo$" , Integer . toString(cmprTold) );
ResultSet myRS = dbBean.getRS(tmp) ; myRS. next() ; rslts.add(new box(l , myRS.getStringC'score"))) ; myRS.closeO ; dbBean . del eteMal diTempData(cmprTold , "mal di temp2") ;
} else { for (int i = 0; i < miD.sizeO; i++) {
String 1 = ""; 1 += mlD.get(i) ;
String tmp = sqlSel . replace("$cmprTo$" , 1);
ResultSet myRS = dbBean. getRS(tmp) ; myRS. nextQ ; rslts.add(new box(l , myRS.getStringC'score"))); myRS.closeO ;
} mID = null ;
//Sort the array, this is a simple bubble sort algorithm, it is fast enough for our purposes for (int i = 0 ; i< rslts. size Q ; i++) { for (int j=0; j < (rslts. size() - 1 - i) ; j++) { box x,y; x = (box) rslts. get(j + 1); y = (box) rslts. get(j); String a = x.getO2() ; String b = y.getO2(); if (integer . parselnt(x.getO2()) > integer . parselnt(y.getO2()) ) { rslts. set(j, x) ; rslts. set(j+l, y) ;
} } for (int i = 0; i < maxresults & i < rslts. si ze() ; i++) { box x = (box) rslts. get(i) ;
//Grab all the information pertaining to the result (id's dates, sample, etc.) ResultSet rsltData = dbBean.getMaldiAndSamplelnfo(x.getOl()) ; rsltData. next() ; if (massSearch) { out.write("<trxtdxinput type=' checkbox1 name='" + x.getOlO + "'x/tdxtdxa href='maldidatawithgraph. jsp?maldiid=" + x.getOl() + '">' + x.getOlO + "</ax/tdxtdxa href='maldidatawithgraph. jsp?maldiid=" + x.getOlO + '">" + rsltData. getString(2) + "</ax/tdxtdxa href=' strainDetail . jsp?sampleid=" + rsltData. getString(5) +"r>" + rsltData. getString(l) + "</ax/tdxtdxa href=' strainDetail . jsp?sampleid=" + rsltData. getString(5) +'">" + rsltData. getString(4) + "</ax/tdxtd align=πght>" + x.getO2() + "</tdxtdxa href=' comparefilegraphs . isp?idl=" + id + "&id2=" + x.getOlO + "&rangeA=" + lmass + "&rangeB=" + hmass + "StItIe=" + request. getParameter("ti tie") + " '>Graphs</a>" + "</tdx/tr>");
} else { out.write("<trxtdxinput type=' checkbox1 name='" + x.getOlO + "'x/tdxtdxa href='maldidatawithgraph. jsp?maldiid=" + x.getOlO + '">' + x.getOlO + "</ax/tdxtdxa href='maldidatawithgraph. jsp?maldiid=" + x.getOlO + '">" + rsltData. getString(2) + "</ax/tdxtdxa href=' strainDetail . jsp?sampleid=" + rsltData. getString(5) +'">" + rsltData. getString(l) + "</ax/tdxtdxa href=' strainDetail . jsp?sampleid=" + rsltData. getString(5) +'">" + rsltData. getString(4) + "</ax/tdxtd align=rightxa href='scorecomputationfile. jsp?idl=" + id + "&τd2=" + x.getOlO + "&ppm=" + request. getParameterC'ppm") + "&intensity=" + request. getParameter("intensity") + "&lMass= + request. getParameterC'lMass") + "&hMass=" + request. getParameterC'hMass") + '">" + x.qetO2() + "</ax/tdxtdxa href=' comparefilegraphs . jsp?idl=" + id + &id2=" + x.getOlO + "&rangeA=" + lmass + "&rangeB=" + hmass + "&title=" + request. getParameter ("title") + " '>Graphs</a>" + "</tdx/tr>");
} rsltData. close O ; } dbBean.dbCloseO ; %>
</table> <%out.write(pageSource. get Page Footer ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
Figure imgf000233_0001
τitle:&nbsp&nbsp<input type="text" name="title" value="<%=request.getParameter("title")%>">
</td> </tr> <tr>
<td col span = 3 align = right> <input type=submit> </td> </tr> </table> </form> </body> </html> <%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
<ti tl e>MALDl-TOF DATA and Sti ck Graph</ti tl e>
<frameset cols="75%,25%">
<frame src="mal di fi 1 egraphandopti ons . j sp?mal di i d=<%=request . getParameter("mal di i d")%>&range A=4000&rangeB=14000&topnum=5&ti tl e=<%=request . getParameter("ti tl e")%>">
<frame src="mal di tofdatatemp . j sp?mal di i d=<%=request . getParameter("mal di i d")%>">
</frameset>
</html>
<%@ page language="java" %>
<%@ page import="java.io.OutputStream" %>
<%@ page import="java. awt. image. Bufferedlmage" %>
<%@ page import=" Java. awt. *" %>
<%@ page import="com. sun. image. codec. j peg. *" %>
<%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="gBean" class="psm. graph. maldiGraph"/>
<% int intA = Integer. parselnt(request. getParameter("rangeA")) ; int intB = Integer .parselnt(request.getParameter("rangeB")) ; int topnum = Integer. parselnt(request.getParameter("topnum")) ;
String id = request. getParameter("maldiid") ; Font font = new Font("ARIAL" , Font. BOLD , 12); response. setContentτype("image/jpeg") ;
Bufferedlmage blmg = new Bufferedlmage(850, 620, Bufferedlmage. TYPE_INT_RGB) ;
Graphics2D biContext = blmg.createGraphicsO ; biContext. setBackground(Color . WHITE) ; bi Context. clearRect (0,0, 850, 620);
biContext. setCol or (Color. BLACK) ; biContext. drawLine(60, 40, 60, 540) ; bi Context . drawLi ne (60 , 540 , 810 , 540) ; biContext. setFont(font) ;
//Draws the Y Numbers int j =1; biContext . drawStri ng("0" , 35 , 545) ; biContext. drawLine(53, 540, 60, 540); for (j = 1; j<=100; j++) { if (j % 10 == 0) {
String num; num = ""; num = num + j ; biContext. drawString(num, 30, 545 - j*5); biContext. drawLine(53, 540-j*5, 60, 540-j*5); } else { biContext. drawLine(58 , 540 -j *5, 60, 540-j*5 );
} int div = (intB - intA) / 5; int 1 ;
String num; num = ""; num = num + intA; biContext. drawStri ng(num, 60 , 570);
//Draws the X numbers for (1=1; 1 <=5; 1++) { int i = 0; i = i ntA + div*l ; num = ""; num = num + i ; int centerint = num.lengthQ / 2 * 7; if (num.length()%2 !=0) { centerint+= 3;
} biContext. drawString(num, (60 + 150*(l) - centerint) , 570);
bi Context. drawLine(60+150*"l , 540, 60+150*1 , 555);
for (1=1; 1 <=10; 1++) { bi Context . drawLi ne (60+ (75*1 ) 540, 60+(75*l), 550);
} for (1=1; 1 <= 20; 1++) { if (1 % 2 != 0 ) { double shift = 1 * 37.5; int lshift = (int) shift; biContext.drawl_ine(60+Ishift, 540, 60+Ishift, 545); }
dbBean . dbConnectO ;
//draw the lines bi Context = gBean.gDraw(bi Context, dbBean. getMaldiGraphData(id, intA, intB), intA, intB, topnum, 540, 5, 750); bi Context . setCol or (Col or . BLACK) ; biContext = gBean.gDrawTitle(biContext, dbBean. getMal diAndSampl elnfo(i d) , 870);
biContext. drawString("Mass to Charge (M/Z)", 365, 610); FontMetrics fm = biContext. getFontMetricsO ; biContext. rotate(-Math. PI / 2, 10, 325 - (fm.getHeight()/2)) ; biContext. drawString("% Intensity", 10,325);
OutputStream output = response. getOutputStream() ;
ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ;
JPEGEncodeParam param = encoder. getDefault 3 PEGEncodeParam(blmg) ; param. setQuality( (float) 1, false); encoder. setZIPEGEncodeParam(param) ; encoder. encode (blmg) ; output. closeO ; dbBean. dbCloseO ;
%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html >
Figure imgf000237_0001
<td>
Low Value :&nbsp<input type="text" name="rangeA" value="<%=request.getParameter("rangeA")%>"> </td> <td>
Hi gh Val ue : &nbsp<i nput type="text" name=" rangeB" val ue="<%=request . getParameter (" rangeB")%>"> </td> <td>
Number of Values Labeled: <input type="text" name="topnum" value="<%=request.getParameter("topnum")%>">
</td> </tr> <tr> <td col span ="3"> <br>
Maldi ID:&nbsp <input type="text" name="maldiid" value= <%=request . getParameter ("mal di i d")%> readonl y> </td> </tr> <tr>
<td col span = 3 align = right> <input type=submit> </td> </tr> <tr>
<td colspan=3 align=center>
<a href="mal di comparesetup . j sp?mal di i d=<%=request . getParameter ("mal di i d")%>" target="_top">Run Database Comparison</a> </td> </tr> </table> </form> </body> </html> <%@ page language="java" %>
<%@ page import="java.io.OutputStream" %>
<%@ page import="java. awt. image. Bufferedlmage" %>
<%@ page import=" Java. awt. *" %>
<%@ page import="com. sun. image. codec. j peg. *" %>
<%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="gBean" class="psm. graph. maldiGraph"/>
<% int intA = Integer. parselnt(request. getParameter("rangeA")) ; int intB = Integer .parselnt(request.getParameter("rangeB")) ; int topnum = Integer. parselnt(request.getParameter("topnum")) ;
String id = request. getParameter("maldiid") ; Font font = new Font("ARIAL" , Font. BOLD , 12); response. setContentτype("image/jpeg") ;
Bufferedlmage blmg = new Bufferedlmage(850, 400, Bufferedlmage. TYPE_INT_RGB) ;
Graphics2D biContext = blmg.createGraphicsO ; biContext. setBackground(Color . WHITE) ; bi Context . cl earRect (0 ,0,850, 600) ; bi Context . setCol or (Col or . BLACK) ; bi Context . drawLi ne (60 , 40 , 60 , 340) ; bi Context . drawLi ne (60 , 340 , 810 , 340) ; biContext. setFont(font) ;
//Draws the Y Numbers int j =1; biContext . drawStri ng("0" , 35 , 345) ; biContext. drawLine(53, 340, 60, 340); for (j = 1; j<=100; j++) { if (j % 10 == 0) {
String num; num = ""; num = num + j ; biContext. drawString(num, 30, 345 - j*3); biContext. drawLine(53, 340-j*3, 60, 340-j*3); } else { biContext. drawLine(58 , 340 -j *3, 60, 340-j*3 );
} int div = (intB - intA) / 5; int 1 ;
String num; num = ""; num = num + intA; biContext. drawStri ng(num, 60 , 370);
//Draws the X numbers for (1=1; 1 <=5; 1++) { int i = 0; i = intA + div*l ; num = ""; num = num + i ; int centerint = num.lengthQ / 2 * 7; if (num.length()%2 !=0) { centerint+= 3; } biContext. drawString(num, (60 + 150*(l) - centerint) , 370);
biContext. drawl_ine(60+150*l , 340, 60+150*1 , 355);
for (1=1; 1 <=10; 1++) { biContext.drawLine(60+(75*l), 340, 60+(75*l), 350); } for (1=1; 1 <= 20; 1++) { if (1 % 2 != 0 ) { double shift = 1 * 37.5; int lshift = (int) shift; biContext.drawl_ine(60+Ishift, 340, 60+Ishift, 345); } } dbBean . dbConnectO ;
//draw the lines bi Context = gBean.gDraw(bi Context, dbBean. getMaldiGraphData(id, intA, intB), intA, intB, topnum, 340, 3,750); bi Context . setCol or (Col or . BLACK) ; biContext = gBean.gDrawTitle(biContext, dbBean. getMal diAndSampl elnfo(i d) , 870);
biContext. drawString("Mass to Charge (M/Z)", 375, 390); FontMetrics fm = biContext. getFontMetricsO ; biContext. rotate(-Math. PI / 2, 10, 230 - (fm.getHeight()/2)) ; biContext. drawString("% Intensity", 10,230);
OutputStream output = response. getOutputStream() ;
ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ;
JPEGEncodeParam param = encoder. getDefault J PEGEncodeParam(blmg) ; param. setQuality( (float) 1, false); encoder. setZIPEGEncodeParam(param) ; encoder. encode (blmg) ; output. closeO ; dbBean. dbCloseO ;
%>
<%@ page language="java" %>
<%@ page import="java.io.OutputStream" %>
<%@ page import="java. awt. image. Bufferedlmage" %>
<%@ page import=" Java. awt. *" %>
<%@ page import="com. sun. image. codec. j peg. *" %>
<%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="gBean" class="psm. graph. maldiGraph"/>
<% int intA = Integer. parselnt(request. getParameter("rangeA")) ; int intB = Integer .parselnt(request.getParameter("rangeB")) ; int topnum = Integer. parselnt(request.getParameter("topnum")) ;
String id = request. getParameter("maldiid") ; Font font = new Font("ARIAL" , Font. BOLD , 12); response. setContentτype("image/jpeg") ;
Bufferedlmage blmg = new Bufferedlmage(850, 415, Bufferedlmage. TYPE_INT_RGB) ;
Graphics2D biContext = blmg.createGraphicsO ; biContext. setBackground(Color . WHITE) ; bi Context. clearRect (0,0, 850, 620); bi Context . setCol or (Col or . BLACK) ; bi Context . drawLi ne (60 , 40 , 60 , 340) ; bi Context . drawLi ne (60 , 340 , 810 , 340) ; biContext. setFont(font) ;
//Draws the Y Numbers int j =1; biContext . drawStri ng("0" , 35 , 345) ; biContext. drawLine(53, 340, 60, 340); for (j = 1; j<=100; j++) { if (j % 10 == 0) {
String num; num = ""; num = num + j ; biContext. drawString(num, 30, 345 - j*3); biContext. drawLine(53, 340-j*3, 60, 340-j*3); } else { biContext. drawLine(58 , 340 -j *3, 60, 340-j*3 );
} int div = (intB - intA) / 5; int 1 ;
String num; num = ""; num = num + intA; biContext. drawStri ng(num, 60 , 370);
//Draws the X numbers for (1=1; 1 <=5; 1++) { int i = 0; i = intA + div*l ; num = ""; num = num + i ; int centerint = num.lengthQ / 2 * 7; if (num.length()%2 !=0) { centerint+= 3; } biContext. drawString(num, (60 + 150*(l) - centerint) , 370);
biContext. drawl_ine(60+150*l , 340, 60+150*1 , 355);
for (1=1; 1 <=10; 1++) { bi Context . drawLi ne(60+(75*l ) , 340, 60+(75*l), 350); } for (1=1; 1 <= 20; 1++) { if (1 % 2 != 0 ) { double shift = 1 * 37.5; int lshift = (int) shift; bi Context . drawLi ne(60+Ishi ft , 340, 60+Ishift, 345); } } dbBean . dbConnectO ;
//draw the lines biContext = gBean.gDraw(biContext, dbBean. getTempMaldiGraphData(id, intA, intB) intA, intB, topnum, 340, 3,750); bi Context . setCol or (Col or . BLACK) ;
String myTitle = request. getParameter("ti tl e") ; if (myTitle == null) { myTitle = "";} biContext. drawstring (myTitle, 435 - ((myTitle. length()/2)*6) 10) biContext. drawStringC'Mass to Charge (M/Z)", 365, 410);
FontMetrics fm = biContext. getFontMetricsO ; biContext. rotate(-Math. PI / 2, 10, 230 - (fm.getHeight()/2)) ; biContext. drawString("% Intensity", 10,230);
OutputStream output = response. getθutputstream() ;
ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ; encoder .encode (blmg) ; output. closeO ; dbBean. dbCloseO ;
%>
<%@ page language="java" %>
<%@ page import="java.io.OutputStream" %>
<%@ page import="java. awt. image. Bufferedlmage" %>
<%@ page import=" Java. awt. *" %>
<%@ page import="com. sun. image. codec. j peg. *" %>
<%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="gBean" class="psm. graph. maldiGraph"/>
<% int intA = Integer. parselnt(request. getParameter("rangeA")) ; int intB = Integer .parselnt(request.getParameter("rangeB")) ; int topnum = Integer. parselnt(request.getParameter("topnum")) ;
String id = request. getParameter("maldiid") ; Font font = new Font("ARIAL" , Font. BOLD , 12); response. setContentτype("image/jpeg") ;
Bufferedlmage blmg = new Bufferedlmage(850, 620, Bufferedlmage. TYPE_INT_RGB) ;
Graphics2D biContext = blmg.createGraphicsO ; biContext. setBackground(Color . WHITE) ; bi Context. clearRect (0,0, 850, 620);
biContext. setCol or (Color. BLACK) ; biContext. drawLine(60, 40, 60, 540) ; bi Context . drawLi ne (60 , 540 , 810 , 540) ; biContext. setFont(font) ;
//Draws the Y Numbers int j =1; biContext . drawStri ng("0" , 35 , 545) ; biContext. drawLine(53, 540, 60, 540); for (j = 1; j<=100; j++) { if (j % 10 == 0) {
String num; num = ""; num = num + j ; biContext. drawString(num, 30, 545 - j*5); biContext. drawLine(53, 540-j*5, 60, 540-j*5); } else { biContext. drawLine(58 , 540 -j *5, 60, 540-j*5 );
} int div = (intB - intA) / 5; int 1 ;
String num; num = ""; num = num + intA; biContext. drawStri ng(num, 60 , 570);
//Draws the X numbers for (1=1; 1 <=5; 1++) { int i = 0; i = i ntA + div*l ; num = ""; num = num + i ; int centerint = num.lengthQ / 2 * 7; if (num.length()%2 !=0) { centerint+= 3;
} biContext. drawString(num, (60 + 150*(l) - centerint) , 570);
bi Context. drawLi ne(60+150*"l , 540, 60+150*1 , 555);
for (1=1; 1 <=10; 1++) { bi Context . drawLi ne(60+(75*l ) , 540, 60+(75*l), 550);
for (1=1; 1 <= 20; 1++) { if (1 % 2 != 0 ) { double shift = 1 * 37.5; int lshift = (int) shift; bi Context . drawLi ne(60+Ishift , 540, 60+Ishift, 545); } dbBean . dbConnectO ;
//draw the lines biContext = gBean.gDraw(biContext, dbBean. getTempMaldiGraphData(id, intA, intB), intA, intB, topnum, 540, 5,750); bi Context . setCol or (Col or . BLACK) ;
String myTitle = request. getParameter("ti tl e") ; if (myTitle == null) { myTitle = "";} biContext. drawstring (myTitle, 435 - ((myTitle. length()/2)*6) , 10); biContext. drawStringC'Mass to Charge (M/Z)", 365, 610);
FontMetrics fm = biContext. getFontMetricsO ; biContext. rotate(-Math. PI / 2, 10, 325 - (fm.getHeight()/2)) ; biContext. drawString("% Intensity", 10,325);
OutputStream output = response. getθutputstream() ;
ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ;
JPEGEncodeParam param = encoder .getDefaultJPEGEncodeParam(blmg) ; param. setQuality((float) 1, false); encoder. setJPEGEncodeParam(param) ; encoder .encode (blmg) ; output. closeO ; dbBean. dbCloseO ;
%>
<%@ page language="java" %>
<%@ page import="java.io.OutputStream" %>
<%@ page import="java. awt. image. Bufferedlmage" %>
<%@ page import=" Java. awt. *" %>
<%@ page import="com. sun. image. codec. j peg. *" %>
<%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="gBean" class="psm. graph. maldiGraph"/>
<% int intA = Integer. parselnt(request. getParameter("rangeA")) ; int intB = Integer .parselnt(request.getParameter("rangeB")) ; int topnum = Integer. parselnt(request.getParameter("topnum")) ;
String id = request. getParameter("maldiid") ; Font font = new Font("ARIAL" , Font. BOLD ,10); response. setContentτype("image/jpeg") ;
Bufferedlmage blmg = new Bufferedlmage(450, 200, Bufferedlmage. TYPE_INT_RGB) ;
Graphics2D biContext = blmg.createGraphicsO ; biContext. setBackground(Color . WHITE) ; bi Context. clearRect (0,0, 450, 200); bi Context . setCol or (Col or . BLACK) ; bi Context . drawLi ne (60 , 40 , 60 , 140) ; bi Context . drawLi ne (60 , 140 , 410 , 140) ; biContext. setFont(font) ;
//Draws the Y Numbers int j =1; biContext . drawStri ng("0" , 35 , 145) ; biContext. drawLine(53, 140, 60, 140); for (j = 1; j<=100; j++) { if (j % 10 == 0) {
String num; num = ""; num = num + j ; biContext. drawString(num, 30, 145 - j); biContext. drawLine(53, 140- j , 60, 140-j); }/* else { biContext. drawLi ne (58 , 140 - j , 60, 140-j ); }*/ } int div = (intB - intA) / 5; int 1 ;
String num; num = ""; num = num + intA; biContext. drawStri ng(num, 60 , 170);
//Draws the X numbers for (1=1; 1 <=5; 1++) { int i = 0; i = intA + div*l ; num = ""; num = num + i ; int centerint = num.lengthQ / 2 * 7; if (num.length()%2 !=0) { centerint+= 3; } biContext. drawString(num, (60 + 70*O) - centerint) , 170); bi Context. drawLine(60+70*"l , 140, 60+70*1 , 155);
for (1=1; 1 <=10; 1++) { biContext.drawLine(60+(35*l), 140, 60+(35*l), 150);
} for (1=1; 1 <= 20; 1++) { if (1 % 2 != 0 ) { double shift = 1 * 17.5; int lshift = (int) shift; biContext.drawl_ine(60+Ishift, 140, 60+Ishift, 145);
} dbBean . dbConnectO ;
//draw the lines bi Context = gBean.gDraw(bi Context, dbBean. getMaldiGraphData(id, intA, intB), intA, intB, topnum, 140, 1, 350); biContext. setColor(Color. BLACK) ; biContext = gBean.gDrawTitle(biContext, dbBean. getMal diAndSampl elnfo(i d) , 550);
biContext. drawString("Mass to Charge (M/Z)", 180, 190); FontMetrics fm = biContext. getFontMetricsO ; biContext. rotate(-Math. PI / 2, 10, 230 - (fm.getHeight()/2)) ; biContext. drawString("% Intensity", 10,70);
OutputStream output = response. getOutputStream() ;
ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ;
JPEGEncodeParam param = encoder. getDefault3 PEGEncodeParam(blmg) ; param. setQuality( (float) 1, false); encoder. setJPEGEncodeParam(param) ; encoder. encode (blmg) ; output. closeO ; dbBean. dbCloseO ;
%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%> <%@page import="java. sql . *" %>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
<head>
<meta http-equiv="Content-Type" content="text/html ; charset=UTF-8">
<title>MALDl-TOF Data</title> </head> <body>
<hl>MALDI-TOF Data</hl>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope = "session" />
<b>Mal di ID : </b> <%=request . getParameter ("mal di i d")%xbr>
<% dbBean . dbConnectO ;
ResultSet myRS; myRS = dbBean. getMaldiData(request.getParameter("maldi id")) ; if (myRS. next ()) { myRS. first O ; %>
<table> <th>Mass</th> <th>Intensi ty</th>
<% do {
%>
<tr>
<td>
<a href="genesearch results. jsp?locusstr=&strainstr=&genusstr=&speciesstr=&locationstr=& location2str=&mw=<%=myRS.getString("mass")%>&ppm=500&productstr=&notesstr=&locus=on& st rai n=onSgenusspeci es=on&l ocati onl=on&l ocati on2=on&start=on&end=on&GBK=on&fr=on&NT= on&AA=on&MW=on&i 6P=OnSgBnB=OnScOdB=OnSCOG=OnSeCl=OnSeCZ=OnSPrOdUCt=OnSnOtBS=On" target="_top"><%=myRS.getString(''mass")%></a> </td>
<td styl6="t6xt-align: right ;"> <% doubl e d = (doubl e) myRS . getDoubl e ("i ntensi ty") ; ou t . wr i te (Doubl e . tost ri ng (d) ) ; %> </td>
<%} while (myRS. next ()); } else {%>
There is no MALDl-TOF data for this sample. <%} myRS.closeO ; dbBean. dbCloseO ; %>
</table>
</body>
<br>
<a href="del eternal di confi rm . j sp?mal di i d=<%=request . getParameter ("mal di i d")%>" target="_top">DELETE Data</a> </html>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%> <%@page import="java. sql . *" %>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
<head>
<meta http-equiv="Content-Type" content="text/html ; charset=UTF-8">
<title>MALDl-TOF Data</title> </head> <body>
<hl>MALDI-TOF Data</hl>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope = "session" />
<b>Your MALDI Data</b>
<% dbBean . dbConnectO ;
ResultSet myRS; myRS = dbBean . getTempMal di Data(request . getParameter ("mal di id")) ; if (myRS. next ()) { myRS. first O ; %>
<table> <th>Mass</th> <th>Intensi ty</th>
<% do {
%>
<tr>
<td>
<a href="genesearch results. jsp?locusstr=&strainstr=&genusstr=&speciesstr=&locationstr=& location2str=&mw=<%=myRS.getString("mass")%>&ppm=500&productstr=&notesstr=&locus=on& st rai n=on&genusspeci es=on&l ocati onl=on&l ocati on2=on&start=on&end=on&GBK=on&fr=on&NT= on&AA=on&MW=on&i 6P=OnSgBnB=OnScOdB=OnSCOG=OnSeCl=OnSeCZ=OnSPrOdUCt=OnSnOtBS=On" target="_top"><%=myRS.getString(''mass")%></a> </td> <td>
<%=myRS. gεtStri ng("i ntεnsi ty")%> </td>
<%} while (myRS. next ()); } else {%>
There i s no MALDl-TOF data for thi s sampl e . <%} myRS . cl oseO ; dbBean . dbCl oseO ; %>
</tabl e>
</body> </html > <%@ page language="java" %>
<%@ page import="java.io.OutputStream" %>
<%@ page import="java. awt. image. Bufferedlmage" %>
<%@ page import=" Java. awt. *" %>
<%@ page import="com. sun. image. codec. j peg. *" %>
<%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/> <jsp:useBean id="gBean" class="psm. graph. maldiGraph"/>
<%
String [] maldiids; maldiids = request. getParameterValues("checkid") ; if (maldiids != null ) { int x,y,l , m;
//x = Integer. parselnt(request.getParameter("x")) ;
//y = Integer. parselnt(request.getParameter("y")) ; x = 900; y = 690; if (maldiids[0].compareτo("on") == 0) {
1 = 1; m =2 ; } else { 1 =0; m = 1;
//initial Setup
Bufferedlmage blmg = new Bufferedlmage(x,y, Bufferedlmage. TYPE_INT_RGB) ; response. setContentType ("i mage/j peg") ;
Graphics2D biContext = gBean.mi rroredGraphs(blmg, dbBean, Integer. parselnt (request. getParameter ("rangeA")) ,
Integer. parselnt( request. getParameter ("rangeB")) , Integer. parselnt (maldiids [I]) , Integer. parselnt (maldiids[m]) ,10, x,y, 100) ;
//Wrap up
OutputStream output = response. getOutputStream() ;
ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ;
JPEGEncodeParam param = encoder .getDefaultJPEGEncodeParam(blmg) ; param. setQuality((float) 1, false); encoder. setJPEGEncodeParam(param) ; encoder .encode (blmg) ; output. closeO ; } else { out.writeC'Please select at least one strain to plot."); } %>
<%@ page language="java" %>
<%@ page import="java.io.OutputStream" %>
<%@ page import="java. awt. image. Bufferedlmage" %>
<%@ page import=" Java. awt. *" %>
<%@ page import="com. sun. image. codec. j peg. *" %>
<%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/> <jsp:useBean id="gBean" class="psm. graph. maldiGraph"/>
<%
String [] maldiids; maldiids = request. getParameterValues("checkid") ; if (maldiids != null ) { int x,y,l , m;
//x = Integer. parselnt(request.getParameter("x")) ;
//y = Integer. parselnt(request.getParameter("y")) ; x = 900; y = 690; if (maldiids[0].compareτo("on") == 0) {
1 = 1; m =2 ; } else { 1 =0; m = 1;
//initial Setup
Bufferedlmage blmg = new Bufferedlmage(x,y, Bufferedlmage. TYPE_INT_RGB) ; response. setContentType ("i mage/j peg") ;
Graphics2D biContext = gBean.mi rroredMSMSGraphs(blmg, dbBean, Integer. parselnt (request. getParameter ("rangeA")) ,
Integer. parselnt( request. getParameter ("rangeB")) , Integer. parselnt (maldiids [I]) , Integer. parselnt (maldiids[m]) ,10, x,y, 100) ; dbBean . dbConnectO ; biContext = gBean.gDrawMSMSTi tie (biContext, dbBean. getMSMSAndSamplelnfo(maldiids [I]) , 900, 70); biContext = gBean.gDrawMSMSTi tie (biContext, dbBean. getMSMSAndSampl elnfo(mal di i ds [m] ), 900, 630); dbBean. dbCloseO ;
//Wrap up
OutputStream output = response. getOutputStream() ; ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ; JPEGEncodeParam param = encoder .getDefaultJPEGEncodeParam(blmg) ; param. setQuality((float) 1, false); encoder. setJPEGEncodeParam(param) ; encoder .encode (blmg) ; output. closeO ; } else { out.writeC'Please select at least one strain to plot.");
%> <%@page contentType="text"%x%@page pageEncodi ng="UTF-8"%x%@page import="java. sql . *" %><jsp: useBean id= dbBean" class="psm.db.dbAccess" scope =
"session" />
In Si 1 i co<%out .wri te("\t") ;%>lon τype<%out.write("\t") ;%>Residue<%out.write("\t") ;%>MS/MS<%out.write("\t") ;%>lntensit y
<%out.write("\n"); int lmass = 4000, hmass = 14000, intensity=2; String masserror = "2.5"; if (request. getParameterC'rangeA") != "") { lmass = Integer . parselnt(request. getParameterC'rangeA")) ; if (request. getParameterC'rangeB") != "") { hmass = Integer . parselnt(request. getParameterC'rangeB")) ; if (request. getParameterC'masserror") != "") { masserror = request. getParameterC'masserror") ;
if (request. getParameterC'intensity") != "") { intensity = integer. parselnt(request. getParameter("intensity")) ;
ResultSet myRS;
String getcmprdata = "SELECT r.insilico, r.msms, r. intensity, y.iontype, y. residue FROM (SELECT b.mass as insilico, '' as msms, '' as intensity FROM ma]diτemp2 b WHERE b. intensity > $minlntensity$ and b.mass between $lowMass$ and $highMass$ and b.maldi_tof_id = $cmprTo$ AND b.mass not in (SELECT insilico FROM (select b.mass as insilico, a. mass as msms from maldiTemp a, maldiTemp2 b where a. intensity > $minlntensity$ AND b. intensity > $minlntensity$ AND a. mass between (b.mass - $error$) and (b.mass + $error$) and a. mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$) t) UNION select b.mass as insilico, a. mass as msms, a. intensity as intensity from maldiTemp a, maldiτemp2 b where a. intensity > $mi nlntensi ty$ AND b. intensity > $minlntensity$ AND a. mass between (b.mass - $error$) and (b.mass + $error$) and a. mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$ order by insilico) r, in_silico_data y WHERE r.insilico = y.mass AND y.in_silico_id = $id2$"; getcmprdata = getcmprdata. replace("$mi nlntensi ty$" , request. getParameter("intensity")) ; getcmprdata = getcmprdata. replace("$error$" , request. getParameterC'masserror")) ; getcmprdata = getcmprdata. replace("$lowMass$" , request. getParameterC'rangeA")) ; getcmprdata = getcmprdata. replace("$highMass$" , request. getParameterC'rangeB")) ; getcmprdata = getcmprdata. replace("$id2$" , request. getParameter("id2")) ;
Thread. currentThread() . sleep(700) ; dbBean . dbConnectO ; int maldiTempld = dbBean. dumpMSMSDataToTemp(Integer. parselnt(request. getParameter("idl")) , intensity, lmass, hmass, "malditemp") ; int cmprTold = dbBean. dumpINSILICODataToTemp(Integer. parselnt(request. getParameter("id2")) , intensity, lmass, hmass, "malditemp2" , request. getParameter("residue")) ; getcmprdata = getcmprdata. repl ace("$cmpr$" , Integer . toStri ng(mal diTempld)) ; getcmprdata = getcmprdata. repl ace("$cmprTo$" , Integer . toStπ ng(cmprTold)) ; myRS = dbBean.getRS(getcmprdata) ; if (myRS. next Q) { myRS. first () ; do { out.write(myRS.getString("insilico") + "\t" + myRS.getStringC'iontype") + "\t" + myRS.getStringC'residue") + "\t" + myRS.getStringC'msms") + \t" + myRS.getStringC'intensity") + "\n");
} while (myRS. next ()) ;
} else {%>
There is no MS/MS data for this sample.
<%} myRS.closeO ; dbBean.dbCloseO ;
%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
<title>MS/MS in Si Ii co Compare</title>
<frameset cols="75%,25%">
<frame src="comparemsi nsi 1 i cographs . j sp?i dl=<%=request . getParameter("i dl")%>&i d2=<%=request . getParameter("i d2")%>&rangeA=<%=request . getParameter("rangeA")%>&rangeB=<%=request . getParameter("rangeB")%>&topnum=l&intensity=<%=request.getParameter("i ntensity")%>&m asserror=<%=request. getParameter("masserror")%>&residue=<%=request. getParameter("res idue")%>">
<frame src="msi nsi 1 i codatacompare . j sp?i dl=<%=request . getParameter("i dl")%>&i d2=<%=request . g etParameter("id2")%>&rangeA=<%=request.getParameter("rangeA")%>&rangeB=<%=request.ge tParameter("rangeB")%>&i ntensi ty=<%=request . getParameter("i ntensity )%>&masserror=<% =request. getParameter("masserror")%>&residue=<%=request. getParameter("residue")%>">
</frameset>
</html>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Insert MS/MS Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<form method=post action="checkmsmsparse. jsp" enctype="MULTIPART/FORM-DATA"> <table align = center> <tr>
<td col span = 2>
<centerxhl>Upload MS/MS Data</hlx/center> </td> </tr> <tr>
<td>
Fi nd Fi 1 e : </td> <td>
<i nput type="fi l e" name="mal di fi l e"> </td> </tr> <tr> <tdx/td>
<td col span="l" al i gn=l eft>
<input type="submit" value="Send"> </td> </tr> </table> </form> <%out. write (pageSource. getPageFooter ()) ;%>
%@page contentType="text/html "%>
Figure imgf000255_0001
intensity Threshold (%) :
</td>
<td>
<input type=text name="intensity" value="2">
</td> </tr> <tr> <td>
Lower Mass/Charge Bound: </td> <td>
<input type="text" name="lMass" value="0"> </td> </tr> <tr>
<td>
Upper Mass/Charge Bound: </td> <td>
<input type=text name="hMass" value="14000"> </td> </tr> <tr>
<td>
Maximum Number of Results: </td> <td>
<input type="text" name="maxresults" value="25"> </td> </tr> <tr>
<td>
Ran After (2005-8-15):
</td>
<td>
<input type="text" name="date"> </td> </tr> <tr>
<td>
Search by Average Molecular weight:
</td>
<td>
<input type=text name="mass" value="<%=avgmass%>">
</td> </tr> <tr>
<td>
Protein AMW Tolerance (daltons):
</td>
<td>
<input type=text name="masserror" value="5">
</td> </tr> <tr>
<td>
Fragment Ion Tolerance (Th):
</td>
<td>
<input type="text" name="fi error" value="2.5">
</td> </tr> <tr>
<td>
Residues (e.g. DEP):
</td>
<td>
<input type = "text" name="residue">
</td> </tr> <tr>
<td col span=2 al i gn = center> <input type="radio" name="sort" value="scorea">Sort by USDA Score ALPHA
<input type="radio" name="sort" value="scoreb">Sort by USDA Score BETA
<input type="radio" name="sort" value="pval" checked>Sort By <i>P</i> Value
</td> </tr> <tr>
<td colspan=2 align=center>
<input type="checkbox" name="calcscorea" checked>Calculate USDA Score ALPHA
<input type="checkbox" name="calcscoreb" checked>Calculate USDA Score BETA
<i nput type="checkbox" name="cal cpval " checked>Cal cul ate <i >P</i > val ue
</td> </tr> <tr>
<td colspan=2>&nbsp; </td> </tr> <tr>
<td col span=2 al i gn = center>
Compare Agai nst Onl y Those That Meet Thi s Search Cri teri a<br>(Leave Bl ank for ful l search)<br>
<input type="radio" name="andor" value="and" checked>AND <input type="radio" name="andor" value="0r">0R </td> </tr> <tr>
<td>
Search by Identification (e.g. NCBI12O3 or 1203): </td> <td>
<input type=text name="identifier"> </td> </tr> <tr>
<td>
Search by Genus (e.g. Campylobacter): </td> <td>
<input type=text name="genus"> </td> </tr> <tr>
<td>
Search by Species (e.g. CoIi): </td> <td>
<input type=text name="species"> </td> </tr> <tr>
<td>
Search by Subspecies (e.g. Fetus): </td> <td>
<input type=text name="subspecies"> </td> </tr> <tr>
<td>
Search by Other Subtype: </td> <td>
<input type=text name="other"> </td> </tr> <tr>
<td>
Search Protein: </td> <td>
<input type=text name="protein"> </td> </tr> <tr>
<td>
Search inside Notes: </td> <td>
<input type=text name="notes"> </td> </tr> <tr>
<td colspan=2 align=centerxbr>
<input type=reset>&nbsp&nbsp&nbsp<input type="submit"> </td> </tr> </table> </form>
<%dbBean.dbClose(); ou t.writeCpageSource. get Page Footer ()) ;
%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
Figure imgf000259_0001
<%out.write(pageSource.getPageFooter()) ; %>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%> <%@page import="java. sql . *" %>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
<head>
<meta http-equiv="Content-Type" content="text/html ; charset=UTF-8">
<title>MS/MS Data</title> </head> <body>
<hl>MS/MS Data</hl>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope = "session" />
Figure imgf000260_0001
<% do {
%>
<tr>
<td>
<%=myRS.getString("mass")%> </td> <td style="text-align: right ;">
<% double d = (double) myRS.getDouble("intensity") ; ou t. wr i te (Doubl e. tost ring (d)) ;
%> </td>
<%} while (myRS. next ()); } else {%>
There is no MS/MS data for this sample. <%} myRS.closeO ; dbBean. dbCloseO ; %>
</table>
<br>
<a href=" . /del etemsmsconf i rm . j sp?msmsi d=<%= request . getParameter ("msmsi d")%>" target="_top">DELETE Data</axbr>
</body> </html >
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
<ti tl e>MALDl-TOF DATA and Sti ck Graph</ti tl e>
<frameset cols="75%,25%">
<frame src="msmsgraphandoptions . jsp?msmsid=<%=request. getParameter("msmsid")%>&rangeA=O&ran geB=14000&topnum=5">
<frame src="msmsdata. jsp?msmsid=<%=request. getParameter("msmsid")%>">
</frameset>
</html>
<%@ page language="java" %>
<%@ page import="java.io.OutputStream" %>
<%@ page import="java. awt. image. Bufferedlmage" %>
<%@ page import=" Java. awt. *" %>
<%@ page import="com. sun. image. codec. j peg. *" %>
<%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="gBean" class="psm. graph. maldiGraph"/>
<% int intA = Integer. parselnt(request. getParameter("rangeA")) ; int intB = Integer .parselnt(request.getParameter("rangeB")) ; int topnum = Integer. parselnt(request.getParameter("topnum")) ;
String id = request. getParameter("msmsid") ; Font font = new Font("ARIAL" , Font. BOLD , 12); response. setContentτype("image/jpeg") ;
Bufferedlmage blmg = new Bufferedlmage(850, 620, Bufferedlmage. TYPE_INT_RGB) ;
Graphics2D biContext = blmg.createGraphicsO ; biContext. setBackground(Color . WHITE) ; bi Context. clearRect (0,0, 850, 620);
biContext. setCol or (Color. BLACK) ; biContext. drawLine(60, 40, 60, 540) ; bi Context . drawLi ne (60 , 540 , 810 , 540) ; biContext. setFont(font) ;
//Draws the Y Numbers int j =1; biContext . drawStri ng("0" , 35 , 545) ; biContext. drawLine(53, 540, 60, 540); for (j = 1; j<=100; j++) { if (j % 10 == 0) {
String num; num = ""; num = num + j ; biContext. drawString(num, 30, 545 - j*5); biContext. drawLine(53, 540-j*5, 60, 540-j*5); } else { biContext. drawLine(58 , 540 -j *5, 60, 540-j*5 );
} int div = (intB - intA) / 5; int 1 ;
String num; num = ""; num = num + intA; biContext. drawStri ng(num, 60 , 570);
//Draws the X numbers for (1=1; 1 <=5; 1++) { int i = 0; i = i ntA + div*l ; num = ""; num = num + i ; int centerint = num.lengthQ / 2 * 7; i f (num . l ength ()%2 ! =0) { centeri nt+= 3 ;
} bi Context . drawStri ng(num , (60 + 150* (l ) - centeri nt) , 570) ;
bi Context . drawLi ne(60+150*"l , 540 , 60+150*1 , 555) ;
for (1=1; 1 <=10; 1++) { bi Context . drawLi ne (60+ (75*1 ) 540, 60+(75*l), 550);
} for (1=1; 1 <= 20; 1++) { if (1 % 2 != 0 ) { double shift = 1 * 37.5; int lshift = (int) shift; biContext.drawl_ine(60+Ishift, 540, 60+Ishift, 545); } dbBean . dbConnectO ;
//draw the lines biContext = gBean.gDraw(biContext, dbBean. getMSMSGraphData(id, intA, intB), intA, intB, topnum, 540, 5, 750); bi Context . setCol or (Col or . BLACK) ; biContext = gBean.gDrawMSMSTitle(biContext, dbBean. getMSMSAndSampl elnfo(i d) , 870);
biContext. drawString("Mass to Charge (M/Z)", 365, 610); FontMetrics fm = biContext. getFontMetricsO ; biContext. rotate(-Math. PI / 2, 10, 325 - (fm.getHeight()/2)) ; biContext. drawString("% Intensity", 10,325);
OutputStream output = response. getOutputStream() ;
ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ;
JPEGEncodeParam param = encoder. getDefault3 PEGEncodeParam(blmg) ; param. setQuality( (float) 1, false); encoder. setJPEGEncodeParam(param) ; encoder. encode (blmg) ; output. closeO ; dbBean. dbCloseO ;
%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
Figure imgf000265_0001
d")%>" "
Figure imgf000265_0002
<%@ page language="java" %>
<%@ page import="java.io.OutputStream" %>
<%@ page import="java. awt. image. Bufferedlmage" %>
<%@ page import=" Java. awt. *" %>
<%@ page import="com. sun. image. codec. j peg. *" %>
<%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="gBean" class="psm. graph. maldiGraph"/>
<% int intA = Integer. parselnt(request. getParameter("rangeA")) ; int intB = Integer .parselnt(request.getParameter("rangeB")) ; int topnum = Integer. parselnt(request.getParameter("topnum")) ;
String id = request. getParameter("msmsid") ; Font font = new Font("ARIAL" , Font. BOLD , 12); response. setContentτype("image/jpeg") ;
Bufferedlmage blmg = new Bufferedlmage(850, 400, Bufferedlmage. TYPE_INT_RGB) ;
Graphics2D biContext = blmg.createGraphicsO ; biContext. setBackground(Color . WHITE) ; bi Context . cl earRect (0 ,0,850, 600) ; bi Context . setCol or (Col or . BLACK) ; bi Context . drawLi ne (60 , 40 , 60 , 340) ; bi Context . drawLi ne (60 , 340 , 810 , 340) ; biContext. setFont(font) ;
//Draws the Y Numbers int j =1; biContext . drawStri ng("0" , 35 , 345) ; biContext. drawLine(53, 340, 60, 340); for (j = 1; j<=100; j++) { if (j % 10 == 0) {
String num; num = ""; num = num + j ; biContext. drawString(num, 30, 345 - j*3); biContext. drawLine(53, 340-j*3, 60, 340-j*3); } else { biContext. drawLine(58 , 340 -j *3, 60, 340-j*3 );
} int div = (intB - intA) / 5; int 1 ;
String num; num = ""; num = num + intA; biContext. drawStri ng(num, 60 , 370);
//Draws the X numbers for (1=1; 1 <=5; 1++) { int i = 0; i = intA + div*l ; num = ""; num = num + i ; int centerint = num.lengthQ / 2 * 7; if (num.length()%2 !=0) { centerint+= 3; } biContext. drawString(num, (60 + 150*(l) - centerint) , 370);
biContext. drawl_ine(60+150*l , 340, 60+150*1 , 355);
for (1=1; 1 <=10; 1++) { biContext.drawLine(60+(75*l), 340, 60+(75*l), 350); } for (1=1; 1 <= 20; 1++) { if (1 % 2 != 0 ) { double shift = 1 * 37.5; int lshift = (int) shift; biContext.drawl_ine(60+Ishift, 340, 60+Ishift, 345); } } dbBean . dbConnectO ;
//draw the lines biContext = gBean.gDraw(biContext, dbBean. getMSMSGraphData(id, intA, intB), intA, intB, topnum, 340, 3,750); bi Context . setCol or (Col or . BLACK) ; biContext = gBean.gDrawMSMSTitle(biContext, dbBean. getMSMSAndSampl elnfo(i d) , 870);
biContext. drawString("Mass to Charge (M/Z)", 375, 390); FontMetrics fm = biContext. getFontMetricsO ; biContext. rotate(-Math. PI / 2, 10, 230 - (fm.getHeight()/2)) ; biContext. drawString("% Intensity", 10,230);
OutputStream output = response. getOutputStream() ;
ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ;
JPEGEncodeParam param = encoder. getDefault J PEGEncodeParam(blmg) ; param. setQuality( (float) 1, false); encoder. setZIPEGEncodeParam(param) ; encoder. encode (blmg) ; output. closeO ; dbBean. dbCloseO ;
%>
<%@ page language="java" %>
<%@ page import="java.io.OutputStream" %>
<%@ page import="java. awt. image. Bufferedlmage" %>
<%@ page import=" Java. awt. *" %>
<%@ page import="com. sun. image. codec. j peg. *" %>
<%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="gBean" class="psm. graph. maldiGraph"/>
<% int intA = Integer. parselnt(request. getParameter("rangeA")) ; int intB = Integer .parselnt(request.getParameter("rangeB")) ; int topnum = Integer. parselnt(request.getParameter("topnum")) ;
Thread. sleep(200);
String id = request. getParameter("idl") ;
Font font = new Font("ARIAL" , Font. BOLD , 12); response. setContentτype("image/jpeg") ;
Bufferedlmage blmg = new Bufferedlmage(850, 400, Bufferedlmage. TYPE_INT_RGB) ;
Graphics2D biContext = blmg.createGraphicsO ; biContext. setBackground(Color. WHITE) ; bi Context . cl earRect (0 ,0,850, 600) ; bi Context . setCol or (Col or . BLACK) ; bi Context . drawLi ne (60 , 40 , 60 , 340) ; bi Context . drawLi ne (60 , 340 , 810 , 340) ; biContext. setFont(font) ;
//Draws the Y Numbers int j =1; biContext . drawStri ng("0" , 35 , 345) ; biContext. drawLine(53, 340, 60, 340); for (j = 1; j<=100; j++) { if (j % 10 == 0) {
String num; num = ""; num = num + j ; biContext. drawString(num, 30, 345 - j*3); biContext. drawLine(53, 340-j*3, 60, 340-j*3); } else { biContext. drawLine(58 , 340 -j *3, 60, 340-j*3 );
} int div = (intB - intA) / 5; int 1 ;
String num; num = ""; num = num + intA; biContext. drawStri ng(num, 60 , 370);
//Draws the X numbers for (1=1; 1 <=5; 1++) { int i = 0; i = intA + div*l ; num = ""; num = num + i ; int centerint = num.lengthQ / 2 * 7; i f (num . l ength ()%2 ! =0) { centeri nt+= 3 ; } bi Context . drawStri ng(num , (60 + 150* (l ) - centeri nt) , 370) ;
bi Context . drawl_i ne(60+150*l , 340 , 60+150*1 , 355) ;
for (1=1; 1 <=10; 1++) { biContext.drawLine(60+(75*l), 340, 60+(75*l), 350); } for (1=1; 1 <= 20; 1++) { if (1 % 2 != 0 ) { double shift = 1 * 37.5; int lshift = (int) shift; biContext.drawl_ine(60+Ishift, 340, 60+Ishift, 345); } } dbBean . dbConnectO ;
//draw the lines bi Context = gBean.gDrawPluslnSiliclnfo(bi Context, dbBean. getlnSilicoMSMSMatchedData(Integer. parselnt( request. getParameter ("idl")) ,
Integer. parselnt( request. getParameter( id2")) , request. getParameter ("intensity") , request. getParameter ("masse rror") , request. getParameter ("rangeA") , request. getParameterC'rangeB") , request. getParameter("residue")) , intA, intB, topnum, 340, 3,750); bi Context . setCol or (Col or . BLACK) ; biContext = gBean.gDrawMSMSTitle(biContext, dbBean. getMSMSAndSampl elnfo(i d) , 870);
biContext. drawString("Mass to Charge (M/Z)", 375, 390); FontMetrics fm = biContext. getFontMetricsO ; biContext. rotate(-Math. PI / 2, 10, 230 - (fm.getHeight()/2)) ; biContext. drawString("% Intensity", 10,230);
OutputStream output = response. getθutputstream() ;
ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ;
JPEGEncodeParam param = encoder .getDefaultJPEGEncodeParam(blmg) ; param. setQuality((float) 1, false); encoder. setZIPEGEncodeParam(param) ; encoder .encode (blmg) ; output. closeO ; dbBean. dbCloseO ;
%> <%@ page language="java" %>
<%@ page import="java.io.OutputStream" %>
<%@ page import="java. awt. image. Bufferedlmage" %>
<%@ page import=" Java. awt. *" %>
<%@ page import="com. sun. image. codec. j peg. *" %>
<%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="gBean" class="psm. graph. maldiGraph"/>
<% int intA = Integer. parselnt(request. getParameter("rangeA")) ; int intB = Integer .parselnt(request.getParameter("rangeB")) ; int topnum = Integer. parselnt(request.getParameter("topnum")) ;
Thread. sleep(200);
String id = request. getParameter("idl") ;
Font font = new Font("ARIAL" , Font. BOLD , 12); response. setContentτype("image/jpeg") ;
Bufferedlmage blmg = new Bufferedlmage(850, 400, Bufferedlmage. TYPE_INT_RGB) ;
Graphics2D biContext = blmg.createGraphicsO ; biContext. setBackground(Color. WHITE) ; bi Context . cl earRect (0 ,0,850, 600) ; bi Context . setCol or (Col or . BLACK) ; bi Context . drawLi ne (60 , 40 , 60 , 340) ; bi Context . drawLi ne (60 , 340 , 810 , 340) ; biContext. setFont(font) ;
//Draws the Y Numbers int j =1; biContext . drawStri ng("0" , 35 , 345) ; biContext. drawLine(53, 340, 60, 340); for (j = 1; j<=100; j++) { if (j % 10 == 0) {
String num; num = ""; num = num + j ; biContext. drawString(num, 30, 345 - j*3); biContext. drawLine(53, 340-j*3, 60, 340-j*3); } else { biContext. drawLine(58 , 340 -j *3, 60, 340-j*3 );
} int div = (intB - intA) / 5; int 1 ;
String num; num = ""; num = num + intA; biContext. drawStri ng(num, 60 , 370);
//Draws the X numbers for (1=1; 1 <=5; 1++) { int i = 0; i = intA + div*l ; num = ""; num = num + i ; int centerint = num.lengthQ / 2 * 7; if (num.length()%2 !=0) { centerint+= 3; } biContext. drawString(num, (60 + 150*(l) - centerint) , 370);
biContext. drawl_ine(60+150*l , 340, 60+150*1 , 355);
for (1=1; 1 <=10; 1++) { biContext.drawLine(60+(75*l), 340, 60+(75*l), 350); } for (1=1; 1 <= 20; 1++) { if (1 % 2 != 0 ) { double shift = 1 * 37.5; int lshift = (int) shift; biContext.drawl_ine(60+Ishift, 340, 60+Ishift, 345); } } dbBean . dbConnectO ;
//draw the lines biContext = gBean.gDrawPluslnSiliclnfoSingle(biContext, dbBean. getlnSilicoMSMSMatchedData(Integer. parselnt( request. getParameter ("idl")) ,
Integer. parselnt (request. getParameter ( id2")) , request. getParameter ("intensity") , request. getParameter ("masse rror") , request. getParameter ("rangeA") , request. getParameterC'rangeB") , request. getParameter("residue")) , intA, intB, topnum, 340, 3,750); bi Context . setCol or (Col or . BLACK) ; biContext = gBean.gDrawMSMSTitle(biContext, dbBean. getMSMSAndSampl elnfo(i d) , 870);
biContext. drawStringC'Mass to Charge (M/Z)", 375, 390); FontMetrics fm = biContext. getFontMetricsO ; biContext. rotate(-Math. PI / 2, 10, 230 - (fm.getHeight()/2)) ; biContext. drawString("% Intensity", 10,230);
OutputStream output = response. getθutputstream() ;
ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ;
JPEGEncodeParam param = encoder .getDefaultJPEGEncodeParam(blmg) ; param. setQuality((float) 1, false); encoder. setJPEGEncodeParam(param) ; encoder .encode (blmg) ; output. closeO ; dbBean. dbCloseO ;
%> <%@ page language="java" %>
<%@ page import="java.io.OutputStream" %>
<%@ page import="java. awt. image. Bufferedlmage" %>
<%@ page import=" Java. awt. *" %>
<%@ page import="com. sun. image. codec. j peg. *" %>
<%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="gBean" class="psm. graph. maldiGraph"/>
<% int intA = Integer. parselnt(request. getParameter("rangeA")) ; int intB = Integer .parselnt(request.getParameter("rangeB")) ; int topnum = Integer. parselnt(request.getParameter("topnum")) ;
String id = request. getParameter("msmsid") ; Font font = new Font("ARIAL" , Font. BOLD ,10); response. setContentτype("image/jpeg") ;
Bufferedlmage blmg = new Bufferedlmage(450, 200, Bufferedlmage. TYPE_INT_RGB) ;
Graphics2D biContext = blmg.createGraphicsO ; biContext. setBackground(Color . WHITE) ; bi Context. clearRect (0,0, 450, 200); bi Context . setCol or (Col or . BLACK) ; bi Context . drawLi ne (60 , 40 , 60 , 140) ; bi Context . drawLi ne (60 , 140 , 410 , 140) ; biContext. setFont(font) ;
//Draws the Y Numbers int j =1; biContext . drawStri ng("0" , 35 , 145) ; biContext. drawLine(53, 140, 60, 140); for (j = 1; j<=100; j++) { if (j % 10 == 0) {
String num; num = ""; num = num + j ; biContext. drawString(num, 30, 145 - j); biContext. drawLine(53, 140- j , 60, 140-j); }/* else { biContext. drawLi ne (58 , 140 - j , 60, 140-j ); }*/ } int div = (intB - intA) / 5; int 1 ;
String num; num = ""; num = num + intA; biContext. drawStri ng(num, 60 , 170);
//Draws the X numbers for (1=1; 1 <=5; 1++) { int i = 0; i = intA + div*l ; num = ""; num = num + i ; int centerint = num.lengthQ / 2 * 7; if (num.length()%2 !=0) { centerint+= 3; } biContext. drawString(num, (60 + 70*O) - centerint) , 170); bi Context. drawLine(60+70*"l , 140, 60+70*1 , 155);
for (1=1; 1 <=10; 1++) { biContext.drawLine(60+(35*l), 140, 60+(35*l), 150);
} for (1=1; 1 <= 20; 1++) { if (1 % 2 != 0 ) { double shift = 1 * 17.5; int lshift = (int) shift; biContext.drawl_ine(60+Ishift, 140, 60+Ishift, 145);
} dbBean . dbConnectO ;
//draw the lines biContext = gBean.gDraw(biContext, dbBean. getMSMSGraphData(id, intA, intB), intA, intB, topnum, 140, 1, 350); biContext. setColor(Color. BLACK) ; biContext = gBean.gDrawMSMSTitle(biContext, dbBean. getMSMSAndSampl elnfo(i d) , 550);
biContext. drawStringC'Mass to Charge (M/Z)", 180, 190); FontMetrics fm = biContext. getFontMetricsO ; biContext. rotate(-Math. PI / 2, 10, 230 - (fm.getHeight()/2)) ; biContext. drawString("% Intensity", 10,70);
OutputStream output = response. getOutputStream() ;
ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ;
JPEGEncodeParam param = encoder. getDefault3 PEGEncodeParam(blmg) ; param. setQuality( (float) 1, false); encoder. setJPEGEncodeParam(param) ; encoder. encode (blmg) ; output. closeO ; dbBean. dbCloseO ;
%>
111 <%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%> <%@page import="iava. sql . *" %>
<jsp:useBean id= 'dbBean" class="psm.db.dbAccess" scope ="session" /> <jsp:useBean id="pageSource" class="psm.web. pageCode"/> <% dbBean . dbConnectO ; pageSource. spi itTempl atePage(dbBean. getllsername() , "MS/MS-MS/MS Comparison" , "MaI di Compari sonTi tl e" , appl i cati on . getReal Path ("/") , dbBean) ; out.write(pageSource. getPageHeader()) ; dbBean. dbCloseO ; %>
<form action="comparemsmstomsmssample. jsp">
<table align="center">
<tr>
<td colspan=2> <center> <% dbBean . dbConnectO ;
ResultSet myRS = dbBean. getRS("SELECT sample_id FROM ms_ms WHERE ms_ms_id = " + request. getParameter("msmsi d")) ; myRS. next () ;
String smpl = myRS.getString("sample_id") ; myRS.closeO ; myRS = dbBean. qetRSC'SELECT concat(identifier .ident, sample. number) as 'ident1 FROM sample, identifier WHERE sample. identifier_id = identifier. identifier_id AND sample. sample_id = " + smpl ); myRS. next () ; smpl = myRS.getStringC'ident") ; myRS.closeO ; myRS = dbBean. getRS("SELECT * FROM ms_ms WHERE ms_ms_id = " + request. getParameter("msmsid")); myRS. next() ;
String avgmass = myRS.getString("precursor_ion_mtoz") ; myRS.closeO ; dbBean. dbCloseO ; %>
</center> </td> </tr> <td> identifier: </td> <td>
<input type=text name="rm" value="<%=smpl%>" readonly="true"> </td> </tr>
readonly="true">
Figure imgf000274_0001
intensity Threshold (%) :
</td>
<td>
<input type=text name="intensity" value="2">
</td> </tr> <tr> <td>
Lower Mass/Charge Bound: </td> <td>
<input type="text" name="lMass" value="0"> </td> </tr> <tr>
<td>
Upper Mass/Charge Bound: </td> <td>
<input type=text name="hMass" value="14000"> </td> </tr> <tr>
<td>
Maximum Number of Results: </td> <td>
<input type="text" name="maxresults" value="25"> </td> </tr> <tr>
<td>
Ran After (2005-8-15):
</td>
<td>
<input type="text" name="date"> </td> </tr>
<tr> <td>
Average Molecular weight: </td> <td>
<input type=text name="mass" value="<%=avgmass%>"> </td> </tr> <tr>
<td>
Protein AMW Error (daltons): </td> <td>
<input type=text name="masserror" value="5"> </td> </tr> <tr>
<td>
Fragment Ion Error (Th): </td> <td>
<input type="text" name="fi error" value="2.5"> </td> </tr> <tr>
<td C9l span=2 al i gn = center>
<i nput type=" radi o" name="sort" val ue="pval " checked>Sort Byue
<i nput type=" radi o" name="sort" val ue="score">Sort by USDA Score </td> </tr> <tr>
<td col span=2>&nbsp ; </td> </tr> <tr>
<td col span=2 al i gn = center>
Compare Agai nst Onl y Those That Meet Thi s Search Cri teri a<br>(l_eave Bl ank for ful l search)<br>
<input type="radio" name="andor" value="and" checked>AND <input type="radio" name="andor" value="Or">OR </td> </tr> <tr>
<td>
Search by Identification (e.g. NCBI12O3 or 1203): </td> <td>
<input type=text name="identifier"> </td> </tr> <tr>
<td>
Search by Genus (e.g. Campylobacter): </td> <td>
<input type=text name="genus"> </td> </tr> <tr>
<td>
Search by Species (e.g. CoIi): </td> <td>
<input type=text name="species"> </td> </tr> <tr>
<td>
Search by Subspecies (e.g. Fetus): </td> <td>
<input type=text name="subspecies"> </td> </tr> <tr>
<td>
Search by Other Subtype: </td> <td>
<input type=text name="other"> </td> </tr> <tr>
<td>
Search Protein: </td> <td>
<input type=text name="protein"> </td> </tr> <tr>
<td>
Search inside Notes: </td> <td>
<input type=text name="notes"> </td> </tr> <tr>
<td col span=2 al i gn=centerxbr>
<input type=reset>&nbsp&nbsp&nbsp<input type="submit">
</td>
</tr>
</table>
</form>
<%dbBean.dbClose(); out.writeCpageSource. getPageFooter ()) ;
%>
<%@page contentType="text/html "%>
<%@page pageEncodi ng="UTF-8"%>
<%@page import="iava. util . *" %>
<jsp:useBean id= 'dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<%
//this gets the settings
String topnum, rangeA, rangeB; if (request. getParameterC'rangeA") != null && request. getParameter("rangeA") !="") { rangeA = request. getParameterC'rangeA") ;} else { rangeA = "4000";} if (request. getParameterC'rangeB") != null && request. getParameter("rangeB") !="") { rangeB = request. getParameter("rangeB") ;} else { rangeB = "14000";} if (request. getParameterC'topnum") != null && request. getParameterC'topnum") !="") { topnum = request. getParameterC'topnum") ;} else { topnum = "5";}
%>
<form action="multiplegraphdisplay. jsp?" name="myform" >
<table align=center cellpadding=O cellspacing=0>
<tr>
<td colspan=3>
</td>
<%
//Display the graphs if (request. getParameterValuesC'checkid") != null){ String [] maldiids; maldiids = request. getParameterValuesC'checkid") ; int 1 ; if (maldiids[0] .compareToC'on") == 0) {
1=1;
} else { 1=0; for (int i=l ; i < maldiids. length; i++) { if ((i-1) % 3 == 0) { out.write("</tr>"); out.write("<tr>"); } out.write("<tdximg name='checkidl value='" + maldiids[i] + "' src='maldigraphtiny. jsp?maldiid=" + maldiids[i] + "&rangeA=" + rangeA + "&rangeB=" + rangeB + "&topnum=" + topnum + "'x/td>");
%>
<%
} else { out.write("<center>Please Use the Checkboxes to select which graphs you wish to display.</center>") ; }
%>
</tr> </table> </form> <%@page contentType="text/html "%>
<%@page pageEncodi ng="UTF-8"%>
<%@page import="iava. util . *" %>
<jsp:useBean id= 'dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<%
//this gets the settings
String topnum, rangeA, rangeB; if (request. getParameterC'rangeA") != null && request. getParameter("rangeA") !="") { rangeA = request. getParameterC'rangeA") ;} else { rangeA = "4000";} if (request. getParameterC'rangeB") != null && request. getParameter("rangeB") !="") { rangeB = request. getParameter("rangeB") ;} else { rangeB = "14000";} if (request. getParameterC'topnum") != null && request. getParameterC'topnum") !="") { topnum = request. getParameterC'topnum") ;} else { topnum = "5";}
%>
<form action="multiplemsmsgraphdisplay. jsp?" name="myform" >
<table align=center cellpadding=O cellspacing=0>
<tr>
<td colspan=3>
</td>
<%
//Display the graphs if (request. getParameterValuesC'checkid") != null){ String [] maldiids; maldiids = request. getParameterValuesC'checkid") ; int 1 ; if (maldiids[0] .compareToC'on") == 0) {
1=1;
} else { 1=0; for (int i=l ; i < maldiids. length; i++) { if ((i-1) % 3 == 0) { out.write("</tr>"); out.write("<tr>"); } out.write("<tdximg name='checkid' value='" + maldiids[i] + "' src='msmsgraphtiny. jsp?msmsid=" + maldiids[i] + "&rangeA=" + rangeA + "&rangeB=" + rangeB + "&topnum=" + topnum + '"></td>");
%>
<%
} else { out.write("<center>Please Use the Checkboxes to select which graphs you wish to display.</center>") ; }
%>
</tr> </table> </form> <%@page contentType="text/html "%>
<%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getllsernameO , "Insert Genus" , "insertGenusTitle", application. getReal Path("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ; %>
<centerxhl>Insert New Genus</hl></center> <form action="genusconfi rmation. jsp"> <table align=center> <tr>
<td>
Genus Name: </td> <td>
<input type="text" name="name"> </td> </tr> <tr>
<td colspan="2" align="right"> <input type="submit" value="Submit New Genus"> </td> </tr> </table> </form> <% out. write (pageSource. getPageFooter ()) ; %>
<%@page contentType="text/html "%>
<%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getllsernameO , "Insert Identifier" , "insertldentifierTitle", application. getReal Path("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ; %>
<centerxhl>lnsert Subtype</hlx/center> <form action="identifierconfi rmation. jsp"> <table align=center> <tr>
<td> identifier: </td> <td>
<input type="text" name="name"> </td> </tr> <tr>
<td>
Notes: </td> <td>
<input type=text name="notes"> </td> </tr> <tr>
<td col span="2 " al i gn=" ri ght"> <i nput type="submi t" val ue="Submi t ldenti fi er"> </td> </tr> </tabl e> </form> <%out . wri te (pageSource . get Page Footer () ) ; %>
<%@page contentType="text/html "%>
<%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getUsernameO , "insert Species" , "insertSpeciesTitle", application. getReal Path("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ; %>
<centerxhl>lnsert New Species</hl></center> <form action="speciesconfi rmation. jsp"> <table align=center> <tr>
<td>
Species Name: </td> <td>
<input type="text" name="name"> </td> </tr> <tr>
<td col span="2 " al i gn=" ri ght"> <i nput type="submi t" val ue="Submi t New Speci es"> </td> </tr> </tabl e> </form>
<%out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getlisernameO , "insert Subspecies" , "insertSubspeciesTitle" , application. getReal Path("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ; %>
<centerxhl>lnsert Subspeci es</hl></center> <form action="subspeciesconfi rmation. jsp"> <table align=center> <tr>
<td>
Subspecies Name: </td> <td>
<input type="text" name="name"> </td> </tr> <tr>
<td colspan="2" aliqn="right"> <input type="submit value="Submit Subspeci es"> </td> </tr> </table> </form>
<%out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getlisernameO , "insert Subtype" , "insertSubtypeTitle", application. getReal Path("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ; %>
<centerxhl>lnsert Subtype</hl></center> <form action="subtypeconfi rmation. jsp"> <table align=center> <tr>
<td>
Subtype Name: </td> <td>
<input type="text" name="name"> </td> </tr> <tr>
<td colspan="2" aliqn="right"> <input type="submit value="Submit Subtype"> </td> </tr> </table> </form>
<%out. write (pageSource. getPageFooter ()) ;%>
<%@ page language="java" %>
<%@ page import="java.io.OutputStream" %>
<%@ page import="java. awt. image. Bufferedlmage" %>
<%@ page import=" Java. awt. *" %>
<%@ page import="com. sun. image. codec. j peg. *" %>
<%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/> <jsp:useBean id="gScatter" class="psm. graph. scatterPlot"/>
<%
String [] maldiids; maldiids = request. getParameterValues("checkid") ; if (maldiids != null ) { int x,y; x = Integer. parselnt(request.getParameter("x")) ; y = Integer. parselnt(request.getParameter("y")) ;
//initial Setup
Bufferedlmage blmg = new Bufferedlmage(x,y, Bufferedlmage. TYPE_INT_RGB) ; response. setContentType ("i mage/j peg") ;
Graphics2D biContext = gScatter.maldiScatterCdbBean, blmg, maldiids, x, y,
Integer. parselnt (request. getParameter ("rangeA")) ,
Integer . parselnt(request.getParameter("rangeB")) , 12, 120,
Integer. parselnt( request. getParameter ("topnum")) ,
Integer. parselnt( request. getParameter ("ppm")) , integer. parselnt (request. getParameter ("intensity"))) ;
//Wrap up
OutputStream output = response. getθutputstream() ;
ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ;
JPEGEncodeParam param = encoder .getDefaultJPEGEncodeParam(blmg) ; param. setQuality((float) 1, false); encoder. setJPEGEncodeParam(param) ; encoder .encode (blmg) ; output. closeO ;
} else { out.writeC'Please select at least one strain to plot."); } %>
<%@ page language="java" %>
<%@ page import="java.io.OutputStream" %>
<%@ page import="java. awt. image. Bufferedlmage" %>
<%@ page import=" Java. awt. *" %>
<%@ page import="com. sun. image. codec. j peg. *" %>
<%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/> <jsp:useBean id="gScatter" class="psm. graph. scatterPlot"/>
<%
String [] maldiids; maldiids = request. getParameterValues("checkid") ; if (maldiids != null ) { int x,y; x = Integer. parselnt(request.getParameter("x")) ; y = Integer. parselnt(request.getParameter("y")) ;
//initial Setup
Bufferedlmage blmg = new Bufferedlmage(x,y, Bufferedlmage. TYPE_INT_RGB) ; response. setContentType ("i mage/j peg") ;
Graphics2D biContext = gScatter.MSMSScatterCdbBean, blmg, maldiids, x, y,
Integer. parselnt (request. getParameter ("rangeA")) ,
Integer . parselnt(request.getParameter("rangeB")) , 12, 120,
Integer. parselnt( request. getParameter ("topnum")) ,
Double. parseDouble (request. getParameter ("masse rror")) , integer. parselnt (request. getParameter ("intensity"))) ;
//Wrap up
OutputStream output = response. getθutputstream() ;
ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ;
JPEGEncodeParam param = encoder .getDefaultJPEGEncodeParam(blmg) ; param. setQuality((float) 1, false); encoder. setJPEGEncodeParam(param) ; encoder .encode (blmg) ; output. closeO ;
} else { out.writeC'Please select at least one strain to plot."); } %>
<%@page contentType="text/html "%>
<%@page pageEncodi ng="UTF-8"%>
<%@page import="iava. sql . *" %>
<jsp:useBean id= 'dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getUsernameO , "Score" , "ScoreTitle" , appl i cati on . getReal Path ("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<table align="center" cell padding = 2 cellspacing = 4> <tr>
<td align=center col span =5> <hl>Scori ng</hl>
The comparison program uses the following formula to compare two sets of MALDI-TOF-DATA:<br>
SUM((A+B) - (2* |A-B I)) / SUM(A+B) </td> </tr> <tr>
<td>
<smallxspan style="font-weight: bold; ">Ave rage Mass</spanx/small> </td> <td>
<small> <span style="font-weight: bold; ">lntensity A (<%=request . getParameter ("i dl")%>)</spanx/smal 1 > </td> <td>
<small> <span style="font-weight: bold; ">lntensity B (<%=request. getParamete r("id2")%>)</spanx/small> </td> <td>
<small> <span style="font-weight: bold; ">lntensity [A + B] </spanx/smal 1 >
</td> <td>
<smallxspan style="font-weight: bold; ">Intensity [(A + B) - (2 * | A - B I )]</spanx/small>
</td> </tr> <% dbBean. dbConnect () ;
//Dump maldi compare data to temp table for faster searches and to normalize the data int maldi Templd = dbBean. dumpMALDIDataToTemp (Integer. parselnt( request. getParameter("idl")) , Integer. parselnt( request. getParameter ("intensity")) ,
Integer. parselnt( request. getParameter ("1 Mass")) , Integer. parselnt( request. getParamete rC'hMass")), "malditemp") ;
Stri ng sel Str = dbBean. buildCompareStringWithoutTotalScore(lnteger. parselnt(request.getParameter("in tensity")) , integer .parselnt( request. getParamete r("l Mass")) , integer. parselnt( request, getParamete rC'hMass")) , Integer. parselnt( request. getParamete r("ppm"))) ; //Set up the selstr inserting the ID'S Appropriately int cmprTold = 0; if (request. getParameter("lMass") .compareTo("4000") == 0 & request. getParameter("hMass").compareTo("14000") == 0) { selStr = selStr . replace("$cmprTo$" , request. getParameter("id2") ); } else {
//if not then we have to put back the temporary data then delete it agai n
//this dumps it to the temp table and also normalizes it cmprTold = dbBean . dumpMALDIDataToTemp (Integer. parselnt (request. getParameter("id2")) , Integer. parselnt (request. getParameter ("intensity")) ,
Integer. parselnt (request. getParameter ("1 Mass")) , Integer. parselnt (request. getParamete rC'hMass")), "malditemp2") ; selStr = selStr. replace("$cmprTo$", Integer. toString(cmprTold)) ; selStr = selStr. replace("$cmpr$" , Integer. toString(maldiTempld)) ;
ResultSet myRS = dbBean. getRS(sel Str) ; while (myRS. next ()) { out.wri te("<trxtd align='center 'xsmall>" + myRS.getString(l) + "</smallx/tdxtd align=' center '><sma]t>" + myRS.getString(2) + "</small></td><td align=lcenterlxsmall>" + myRS.getString(3) + "</small></tdxtd align=' center 'xsmall>" + myRS.getString(4) + "</smallx/tdxtd align=lcenterlxsmall>" + myRS.getString(5) + "</smallx/tdx/tr>") ; myRS.closeO ;
//now delete the maldiTemp data to free up the memory dbBean . del eteMal di TempData(mal di Templd , "mal di temp") ; dbBean. dbCloseO ;
%>
</table>
<%out.write(pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%>
<%@page pageEncodi ng="UTF-8"%>
<%@page import="iava. sql . *" %>
<jsp:useBean id= 'dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getUsernameO , "Score" , "ScoreTitle" , appl i cati on . getReal Path ("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<table align="center" cell padding = 2 cellspacing = 4> <tr>
<td align=center col span =5> <hl>Scori ng</hl>
The comparison program uses the following formula to compare two sets of MALDI-TOF-DATA:<br>
SUM((A+B) - (2* |A-B I)) / SUM(A+B) </td> </tr> <tr>
<td>
<smallxspan style="font-weight: bold; ">Ave rage Mass</spanx/small> </td> <td>
<smallxspan style="font-weight: bold; ">lntensity A (<%= request . get Parameter ("i dl")%>)</spanx/smal 1 > </td> <td>
<smallxspan style="font-weight: bold; ">lntensity B (<%=request.getParameter("id2")%>)</spanx/small> </td> <td>
<smallxspan style="font-weight: bold; ">lntensity [A + B] </spanx/smal 1 >
</td> <td>
<smallxspan style="font-weight: bold; ">Intensity [(A + B) - (2 * | A - B I )]</spanx/small>
</td> </tr> <% dbBean. dbConnect () ; int cmprTold = 0; String selStr = dbBean . bui 1 dCompareStri ngForTempWi thoutTotal Score(lnteger . parselnt (request . getParame ter("intensity")) , Integer. parselnt (request. getParameter ("1 Mass")) , Integer. parselnt (r
'"' "' . ' . . sger . parselnt(request.getParameter("ppm"))) ; //if the mass range falls within the one given then we only need to replace teh parameters if (request. getParameter("lMass").compareTo("4000") == 0 & request. getParameter("hMass").compareTo("14000") == 0) { selStr = selStr. replace("$cmprTo$", request. getParameter("id2") ); } else {
//if not then we have to put back the temporary data then delete it agai n
//this dumps it to the temp table and also normalizes it cmprTold = dbBean. dumpMALDIDataToTemp (Integer. parselnt( request. getParameter("id2")) , Integer. parselnt (request. getParameter ("intensity")) ,
Integer. parselnt (request. getParameter ("1 Mass")) , Integer. parselnt( request. getParamete rC'hMass")), "malditemp2") ; selStr = selStr . replace("$cmprTo$" , Integer . toString(cmprTold)) ; selStr = se1Str.rep1ace("$cmpr$", request. getParameter("idl")) ;
ResultSet myRS = dbBean.getRS(selStr) ; while (myRS. next ()) { out.write("<trxtd align=' center '><smal]>" + myRS.getString(l) + "</smallx/tdxtd align=' center '><sma]t>" + myRS.getString(2) + "</small></td><td align=' center 'xsmall>" + myRS.getString(3) + "</small></tdxtd align=' center '><small>" + myRS.getString(4) + "</small></tdxtd align=' center 'xsmall>" + myRS.getString(5) + "</small></tdx/tr>") ; myRS. close () ; if (request. getParameter("lMass") -compareToCMOOO") == O & request. getParameter("hMass")-compareTo("14000") == O) { dbBean . del eteMal diTempData(cmprTold , "mal di temp2") ;
dbBean.dbCloseO ;
%>
</table>
<%out.write(pageSource. get Page Footer ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope ="session"/> <jsp: useBean id="pageSource" class="psm.web. pageCode"/> <% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Search Loci", "SearchLoci " , appl i cati on . getReal Path ("/") , αbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ; %>
<form action="genesearch results. jsp"> <table align=center> <tr>
<td colspan=2 styl e="text-align: center ;">
Please enter your search parameters
<td> <tr> <tr>
<td colspan=2>
&nbsp;
</td> </tr> <tr>
<td>
Locus:
</td>
<td>
<input type="text" name="locusstr">
</td> </tr> <tr>
<td>
Strain:
</td>
<td>
<i nput type="text" name="strai nstr">
</td> </tr> <tr>
<td>
Genus:
</td>
<td>
<input type="text" name="genusstr">
</td> </tr> <tr>
<td>
Species:
</td>
<td>
<i nput type="text" name="speci esstr">
</td> </tr> <tr>
<td>
Location:
</td>
<td>
<i nput type="text" name="l ocati onstr">
</td> </tr> <tr>
<td> Location 2:
</td>
<td>
<i nput type="text" name="l ocati on2str">
</td> </tr> <tr>
<td>
Gene:
</td>
<td>
<input type="text" name="genestr">
</td> </tr> <tr>
<td>
Molecular Weight:
</td>
<td>
<input type="text" name="mw">
</td> </tr> <tr>
<td>
Error Range (ppm) :
</td>
<td>
<i nput type="text" name="ppm" val ue=0>
</td> </tr> <tr>
<td>
Product:
</td>
<td>
<input type="text" name="productstr">
</td> </tr> <tr>
<td>
Notes:
</td>
<td>
<input type="text" name="notesstr">
</td> </tr>
<trxtd col span=2>&nbsp ; </tdx/td> <tr>
<td col span=2>
Sel ect the col umns you wi sh di spl ayed .
<td> </tr>
<trxtd col span=2>&nbsp ; </tdx/td> <tr>
<td C9lspan=2>
<input type="checkbox" name="locus" checked>Locus&nbsp;<input type="checkbox" name=" strain" checked>Strain&nbsp;<input type="checkbox" name="genusspecies" checked>Genus-Species&nbsp;<input type="checkbox" name="locationl" checked>Location l&nbsp;<input type="checkbox" name="location2" checked>Location 2&nbsp;
<td> </tr> <tr>
<td colspan=2>
<input type="checkbox" name="start" checked>start&nbsp;<input type="checkbox" name="end" checked>end&nbsp;<input type="checkbox" name="GBK' checked>GBK&nbsp;<input type="checkbox" name="fr" checked>FR&nbsp;<input type="checkbox" name="NT" checked>NT&nbsp;<input type="checkbox" name="AA" cchheecckkeedd>>AAAA&&nnbDsspp;;<<iinnppuutt ttyyppee=="cchheecckkbbooxx" nnaammee=="MW" checked>MW&nbsp;<input ttvyDpee==""cchheecckkbbooxx"" nnaammee==""iieeDp"" cchheecckkeedd>>IlEEPP&&nnbbssop:; </td>
</tr>
ct"
Figure imgf000293_0001
</table>
</form> <% out.writeCpageSource. getPageFooter ()) ;
%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/> <jsp: setProperty name="dbBean" property="*"/> <jsp:useBean id="pageSource" class="psm.web. pageCode"/> <%int validlogin = dbBean.dbConnectO ; %>
<% if (validlogin ==0) { pageSource.splitTemplatePage(dbBean.getllsernameO , "Search <i>In Silico</i> Data", "StrainSearchTitle", appl icati on. getReal Path ("/"), dbBean) ; out.write(pageSource.getPageHeaderO) ; if (validlogin != 0) {%>
<center>The username/password combination you have entered does not exist or is no longer valid. Please press back on your browser and try agai n .</center>
<%} else { dbBean. dbCloseO; %>
<table border="0" cellpadding=O cellspacing=0> <tr>
<form action=" search result sin si Ii co. jsp"> <br>
<table align=center> <tr>
<td colspan="2">
<centerxb>Enter the parameters for your search : </bx/centerxbr>
</td> </tr> <tr>
<td colspan=2 align = center>
<input type="radio" name="andor" value="and" checked>AND <input type="radio" name="andor" value="0r">0R </td> </tr> <tr>
<td>
Search by Identification (e.g. NCBI12O3 or 1203): </td> <td>
<input type=text name="identifier"> </td> </tr> <tr>
<td>
Search by Genus (e.g. Campylobacter): </td> <td>
<input type=text name="genus"> </td> </tr> <tr>
<td>
Search by Species (e.g. CoIi): </td> <td>
<input type=text name="species"> </td> </tr> <tr>
<td>
Search by Subspecies (e.g. Fetus): </td> <td>
<input type=text name="subspecies"> </td> </tr> <tr>
<td>
Search by Other Subtype: </td> <td>
<input type=text name="other"> </td> </tr> <tr>
<td>
Search Protein: </td> <td>
<input type=text name="protein"> </td> </tr> <tr>
<td>
Search inside Notes: </td> <td>
<input type=text name="notes"> </td> </tr> <tr>
<td>
Search by Average Molecular weight: </td> <td>
<input type=text" name="mass"> </td> </tr> <tr>
<td>
AMW Error (daltons): </td> <td>
<input type=text" name="masserror" value="5"> </td> </tr> <tr>
<td col span = "2" align=right>
<i nput type="reset">&nbsp&nbsp&nbsp&nbsp&nbsp&nbsp<i nput type=submit>
</td> </tr> <tr> </tr>
<trxtd>&nbsp</tdx/tr> </table> <br> </form> <% } if (validlogin ==0) { ou t.write(pageSource. get Page Footer ()) ;
%> <%-- Close out the else statement --%> <%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%> <%@page import="java. sql . *" %>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<! DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transi ti onal //EN" "http://www.w3.org/TR/html4/loose.dtd">
<html>
<head>
<meta http-equiv="Content-Type" content="text/html ; charset=UTF-8">
<title>PSM Strain Database Search Results</title> </head> <body style="background-color: rgb(54, 171, 54) ; ">
<centerxhl style="color: rgb(255, 255, 255) ; ">Database Search Results</hl>
<a href="./home.jsp" style="color: rgb(255, 255, 255);">New Search</a>&nbsp;&nbsp;
<% i f ((dbBean . getllsernameO . compareTo(" rmandrel l ") == 0 | | dbBean . getUsernameO . compareTo("psml ogi n") == 0) == true) { out .wri te("<a styl e=\"col or : rgb(255 , 255 , 255) ; \" href=\"downloadstrainfile. jsp?andor=" + request. getParameter("andor") + "&identifier=" + request. getParameter("identifier") + "&1OWRM=" + request . getParameter("lowRM") + "&highRM=" + request. getParameter("highRM") + "&genus= + request. getParameter("genus") + "&species=" + request. getParameter("species") + "&subspecies=" + request. getParameter("subspecies") + "&other=" + request. getParameter("other") + "&notes=" + request. getParameterC'notes") + "&history=" + request. getParameter ("hi story") + "&gtent=" + request. getParameter("gtent") + "&sptent=" + request. qetParameterC'sptent") + "&subtent=" + request. getParameterC subtent") + "&othertent=" + request. getParameter("othertent") + "&sampleid=" + request. getParameter("sampleid") + "&mass=" + request. getParameter ("mass") + "&masserror=" + request. getParameter("masserror") + "&minintensity=" + request. getParameter("minintensity") + "\">Download Tab Delimited File</a>"); }
%> <brxbrx/center>
<%int validlogin = dbBean. dbConnect (); %>
<% i f (val i dl ogi n ==0) {
ResultSet myRS;
String strandor = request. getParameter("andor") ; int maldionly; if (request. getParameterC'maldionly") == null) { maldionly = 0; } else { maldionly = 1; if (strandor. compareTo("Or") == 0 ) { myRS = dbBean. runORSearch(request.getParameter("sampleid") , request. getParameter ("identifier") , request. getParameter ("genus") , request. getParameter ("species") , request. getParameter ("subspecies") , request. getParameter ("other") , request. getParameterC'notes") , request. getParameter ("hi story") , request. getParameter ("gtent") , request. getParameter ("sptent") , request. getParameter ("subtent") , request. getParameter ("othertent") , maldionly, request. getParameter ("lowRM") , request. getParameter (" hi ghRM")) ;
//Java. sql .Statement temps = myRS.getStatementO ;
//String s; } else { myRS = dbBean. runANDSearch(request.getParameter("sampleid") , request. getParameter ("identifier") , request. getParameter ("genus") , request. getParameter ("species") , request. getParameter ("subspecies") , request. getParameter ("other") , request. getParameter ("notes") , request. getParameter ("hi story") , request. getParameter ("gtent") , request. getParameter ("sptent") , request. getParameter ("subtent") , request. getParameter ("othertent") , maldionly, request. getParameter ("mass") , Integer. parselnt( request. getParameter ("masse rror")) , request. getParameter("mi nintensity") , request. getParameter ("lowRM") , request. getParameter (" hi ghRM")) ;
if (myRS. next () ) { myRS. first () ;
%>
<table border="0" cell padding = "0" cellspacing = "0" width= 100%> <span style="color: rgb(255,255, 255);">
<th bgcolor = #008700><span style="color : rgb(231,229, 38);">Sample ID</thx/span>
<th bgcolor = #008700><span style="color : rgb(231,229, 38);">Sample Number</thx/span>
<th bgcolor = #008700><span style="color : rgb(231,229, 38) ; ">Date</thx/span>
<th bgcolor = #008700xspan style="color : rgb(231,229, 38);">Sample Genus-Speci es-Subspeci es</thx/span>
<th bgcolor = #008700xspan style="color : rgb(231,229, 38) ; ">Notes</thx/span>
<th bgcolor = #008700xspan style="color : rgb(231,229, 38) ; ">Hi story</thx/span> </span>
<% int i = 0;
String mColor; %>
<% do { i++; if ( i % 2 == 0) { mColor= "#ffdθae"; }else { mColor = "#ecac7d"; } %>
<tr>
<td style="vertical -align: top; background-color: <%=mColor%>" align="center"xa h ref =" . \st rai nDetai 1. j sp?sampl ei d=<%=myRS . getSt ri ng (1)%>" styl e="col or : rgb(0 ,0,0); f ont-wei ght : bol d ; "x%=myRS . getSt ri ng ("sampl e_i d")%x/ax/td>
<td styl e="vertτcal -align: top; background-color:
<%=mCol or%>"xa href="strai nDetai 1. j sp?sampl ei d=<%=myRS. getStri ng(" sampl e_i d")%>" style="color : rgb(0,0,0) ;font-weight: bold;"xspan style="color : rgb(0 ,0,0); f ont-wei ght : bol d ; "x%=myRS . getStri ng ("i dent")%x/spanx/ax/tdx/span>
<td style="text-align: center ; vertical -align: top; background-color: <%=mColor%>" width="100"xspan style="color : rgb(0 ,0,0); f ont-wei ght : bol d ; "x%=myRS . getStri ng ("date")%>&nbsp&nbsp</tdx/span>
<td styl e="vertical -align: top; background-color:
<%=mCo"l or%>"xa href="strai nDetai 1. j sp?sampl ei d=<%=myRS. getStri ng(" sampl e_i d")%>" style="color : rgb(0,0,0) ;font-weight: bold; text-align: center; "xix%
if (myRS.getlnt("tentative_genus") == 1 && myRS.getStringC'genus") != null) { out.write("<span style='color: rgb(225, 43, 43); font-weight: bold; >");
out. write (myRS.getSt ring ("genus")) ;
out.write("</span>") ;
} else if (myRS.getStringC'genus") !=null) {
out. write (myRS.getSt ring ("genus")) ;
if (myRS.getlnt("tentative_species") == 1 && myRS.getStringC'species") != null) {
out.write("<span style='color : rgb(225, 43, 43); font-weight: bold; '>");
out.writeC ") ;
out. write (myRS.getSt ring ("species")) ;
out.write("</span>") ;
} else if(myRS.getString("species") !=null) {
out.writeC ") ;
out. write (myRS.getSt ring ("species")) ;
if (myRS.getlnt("tentative_subspecies") ==1 && myRS.getStringC'subspecies") != null) {
out.write("<span style='color : rgb(225, 43, 43); font-weight: bold; '>");
out.writeC ") ;
out. write (myRS.getSt ring ("subspecies")) ;
out.write("</span>") ; } else if (myRS.getStringC'subspecies") !=null) {
out.writeC' ") ;
out. write (myRS.getStringC'subspecies")) ;
if (myRS.getlnt("tentative_subtype") ==1 && myRS.getStringC'subtype") != null) {
out.write("<span style='color: rgb(225, 43, 43); font-weight: bold; '>");
out.writeC" ") ;
out. write (myRS.getStringC'subtype")) ;
out.write("</span>") ;
} else if(myRS.getString("subtype") !=null) {
out.writeC ") ;
out. write (myRS.getStringC'subtype")) ;
//This is to add speration between the name and notes
out.writeC ") ;
%x/ix/ax/td>
<td styl e="vertical -align: top; background-color:
<%=mCol or%>"xa href="updatestrai n . j sp?sampl ei d=<%=myRS. getStri ngC'sampl e_i d")%>" styl e="col or : rgb(0, 0 , 0) ; font-wei ght : bol d ; "><%=myRS . getStri ng("notes")%x/ax/td>
<td styl e="vertical -align: top; background-color: <%=mColor%>"xspan style="color : rgb(O,O,O) ; font-weight: bold;"x% if (myRS.getStringC'history") != null ) { out. print (myRS. getStri ng(" hi story")) ; } else { out.print("No History"); } %x/tdx/span>
</tr> <% } while (myRS. next ()) ;
%> <%
//dbBean . closemyRSO ; //myRS.closeO ; dbBean. dbclose() ;%>
<%}else{%>
<span style="color: white" ><center>No strain was found with the entered search criteria. Press the back button on your browser to start a new search. </center> </span>
<%}} else { out.write("<span style='color : white1 ><center>Your connection has expired. Please Log In again. </centerx/span>") ;
}%>
</table> </body> </html>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%> <%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "<i>In Silico</i> Search", "StrainDetailTitle", application. getReal Path("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<% dbBean . dbConnectO ;
%>
<table border =0 cellspacing=8 cellpadding=O style="text-align: left; width: 90%">
<tr>
<td colspan="2">
<table cellspacing="0" cellpadding="O" style="width: 80%" align=center> <%
ResultSet maldiRS;
String mstr = null ; if (request. getParameter("andor") .compareTo("and") == 0) { mstr = dbBean . runANDInSi 1 i coSearchStr( request . getParameter ("i denti fi er") , request. getParameter ("genus") , request. getParameter ("species") , request. getParameter (" subspecies") , request. getParameter ("other") , request. getParameter ("protein") , request. getParameter ("notes") , request. getParameter ("mass") , request. getParameter ("masse rror")) ;
} else { mstr = dbBean . runORInSi 1 i coSearchStr (request . getParameter ("i denti fi er") , request. getParameter ("genus") , request. getParameter ("species") , request. getParameter (" subspecies") , request. getParameter ("subtype") , request. getParameter ("protein") , request. getParameter( notes"), request. getParameter("mass") , request. getParameter ("masse rror")) ; maldiRS = dbBean. getRS(mstr) ; if (maldiRS != null) { int j = 0; while (maldiRS. next ()) { j++; %>
<td style="vertical -align: top; text-align: left;"> <table boder="0" cellpadding="O" cellspacing = "0"> <tr>
<td>
<bxi>ln Silico</i> lD:</b> </td> <td>
<a href=" . /i nsilicodatawi thgraph . jsp?i nsilicoid=<%=maldi RS. getlnt(l)%>"> <%=mal di RS . getlnt (l)%x/a>
</td> </tr> <tr>
<td>
<b>ldenti fi cati on : &nbsp ; </b> </td> <td>
<%=mal di RS . getStri ng(2)%> </td> </tr> <tr>
<td>
<b>Date:</b> </td> <td>
<%=mal di RS . getDate(3)%> </td> </tr> <tr>
<td>
<b>Average Molecular weight:&nbsp&nbsp</b> </td> <td>
<%=mal di RS . getStri ng(4)%> </td> </tr> <tr>
<td>
<b>Protei n : &nbsp&nbsp</b> </td> <td>
<%=mal di RS . getStri ng(5)%> </td> </tr> <tr>
<td>
<b>Strai n :</b> </td> <td>
<%=mal di RS . getSt ri ng (7)%>&nbsp ; <%=mal di RS . getSt ri ng (8)%>&nbsp ; <%=mal di RS . getSt ri ng (9 )%>&nbsp;<%=maldiRS.getString(10)%>&nbsp;
</td> </tr> <tr>
<td valign="top">
<b>AA Seq : </b> </td> <td>
<%String aa = maldiRS.getString("aa_seq") ; out.write(aa.charAt(0)) ; for(int v = l; v < aa.lengthO ; v++) { out.write(aa.charAt(v)) ; if ((v % 20) == 0) { out.write("<br>"); } }
%>
</td> </tr> <tr>
<td>
<b>Notes:</b> </td> <td>
<a href="updatei nsi 1 i conotes . j sp?i nsi 1 i coi d=<%=mal di RS . getStri ng(l)%>">update</a>
</td> </tr> <tr>
<td colspan=2> <%=mal di RS . getSt ri ng (6)%> </td> </tr>
</table>
</td>
<td>&nbsp</td>
<% if (j % 3 == 0) { %>
<trxtd>&nbsp</tdx/tr> <tr>
<%}%>
<%if (j % 6 == 0) { %>
</tr>
<%}%> <%
}} else{ %> No in Si Ii co Data Found
</table> </td> </tr> </table>
<%dbBean.dbClose(); out.writeCpageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getlisernameO , "insert Species" , "insertSpeciesTitle", application. getReal Path("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%> <% dbBean . dbConnectO ; int rtrn; rtrn = dbBean. insertNewSpecies( request. getParameter ("name")) ; if (rtrn > 0) { out . wri te C'lnsert successful l ! ") ;
} el se i f (rtrn == -1) { out.write("An error occurred while processing this request, please try again, if this continues contact support."); dbBean. dbCloseO ; %> <brxcenterxa href="insertstrain. jsp">Insert New Strain</ax/center>
<%out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%> <%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getUsernameO , "Strain Detail " , "StrainDetailTitle", application. getReal Path("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ; %> <% dbBean . dbConnectO ; %> <%
ResultSet myRS; myRS = dbBean. searchBySampl eld (request. getParameter ("sampleid")) ; myRS. next() ; %> <% if (myRS != null) {
String updateURL = "updatestrain. jsp?sampleid=" + request. getParameter ("sampleid") ; %>
<table border =0 cellspacing=8 cellpadding=O style="text-align: left; width: 90%">
<tr>
<td colspan="2" style="text-align: center"> <hl>Strain Detail </hl>
<a href="<%=updateURL%>">Update Strain</a>&nbsp&nbsp&nbsp </td> </tr> <tr>
<td>
<b>ldenti fi cati on : </b> </td> <td>
<%=myRS . getSt ri ng (2)%> </td> </tr>
<tr>
<td>
<b>Date: </b>
</td>
<td>
<%=myRS . getDate (3)%>
</td> </tr>
<tr>
<td>
<b>Strain: </b>
</td>
<td>
<%=myRS . getSt ri ng (4)%>
</td> </tr>
<tr>
<td>
<b>Hi story </b>
</td> <td>
<%if (myRS.getString(6) != null ) { out. print(myRS.getString(6)) ; } else { out.print("No History");
%>
</td> </tr>
<tr>
<td>
<b>τentative Genus :</b>
</td>
<td>
<%if (myRS.getBoolean(7)) { out.write("<span style='color: RED; font-weight: bold; '>"); out.writeC'True"); out.write("</span>") ; }else{ out.writeC'False");
}%> </td> </tr>
<tr>
<td>
<b>τentative Species :</b>
</td>
<td>
<%if (myRS.getBoolean(δ)) { out.write("<span style='color: RED; font-weight: bold; '>"); out.writeC'True"); out.write("</span>") ;
}else{ out.writeC'False");
}%> </td> </tr>
<tr>
<td>
<b>τentative Subspecies :</b>
</td>
<td>
<%if (myRS.getBoolean(9)) { out.write("<span style='color: RED; font-weight: bold; '>"); out.writeC'True"); out.write("</span>") ; }else{ out.writeC'False");
}%> </td> </tr>
<tr> <td>
<b>Tentative Other Type:</b>
</td>
<td>
<%if (myRS.getBoolean(lO)) { out.write("<span style='color: RED; font-weight: bold; '>"); out.write("τrue") ; out.write("</span>") ; }else{ out.writeC'False"); }%> </td> </tr>
<tr>
<td>
<b>Notes: </b>
</td> </tr> <tr>
<td colspan="2">
<%=myRS . getSt ri ng (5)%>
</td>
<%myRS.close();%> </tr>
<tr align=' center '> <% myRS = dbBean.getMaldi (request. getParameterC'sampl eid")) ; if (myRS. next O) {
%xtdxa h ref=" st rainMALDIDATA. j sp?sampleid=<%=request. getParameter ("sampleid")%>">MALDI Data</axbrx/td>
<%
} myRS.closeO ;
%>
<% myRS = dbBean.getMSMS(request.getParameter("sampleid")) ; if (myRS. next ()) {
%>
<tdxa h ref=" st rainMSMSData. j s p?sampleid=<%= request. get Parameter ("sampleid")%>">MS/MS Data</axbrx/td> <% } myRS.closeO ; %>
</tr> </table>
<%dbBean . dbcl ose () ; %> <%}else{%>
<center>No strain was found with Sample ID <%=request.getParameter("sampleid")%x/center>
<%out.write(pageSource. get Page Footer ()) ;%> <%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%> <%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getUsernameO , "MALDI Data" , "StrainDetailTitle", application. getReal Path("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<% dbBean . dbConnectO ;
%>
<table border =0 cellspacing=8 cellpadding=O style="text-align: left; width: 90%">
<tr> <td>
<b> <big>MALDl-TOF Data </big> </bxbr> </td> </tr> <tr>
<td colspan="2">
<table cellspacing="0" cellpadding="O" style="width: 90%" align=center> <trxtd>&nbsp</tdx/tr> <%
ResultSet maldiRS; maldiRS = dbBean. getMaldi (request. getParameter("sampleid")) ; if (maldiRS != null) { int j = 0; while (maldiRS. next ()) { j++; %>
<td>
<table boder="0" cellpadding="O" cellspacing = "0">
<tr>
<td>
<b>Maldi ID:</b> </td> <td>
<a h ref =" . /mal di datawi thgraph . j sp?mal di i d=<%=mal di RS . getlnt (1)%>"> <%=mal di RS . getlnt (l)%x/a>
</td> </tr> <tr>
<td>
<b>Date:</b> </td> <td>
<%=mal di RS . getDate(5)%> </td> </tr> <tr>
<td>
<b>Target Spot Number :&nbsp&nbsp</b> </td> <td>
<%=mal di RS . getStri ng(3)%> </td> </tr> <tr>
<td>
<b>Notes:</b> </td> <td>
<a href="updatemal di notes . j sp?mal di i d=<%=mal di RS . getStri ng(l)%>">Update</a>
</td> </tr> <tr>
<td colspan=2>
<%=mal di RS . getSt ri ng (4)%> </td> </tr> </table> </td> <td>&nbsp</>
<% if (j % 3 == 0) { %>
<trxtd>&nbsp</tdx/tr> <tr>
<%}%>
<%if (j % 6 == 0) { %>
</tr>
<%}%> <%
}} else{ %> This sample does not currently have MALDI-TOF data
</table> </td> </tr> </table>
<%dbBean.dbClose(); out.write(pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%> <%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getUsernameO , "MS/MS Data" , "StrainDetailTitle", application. getReal Path("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<% dbBean . dbConnectO ;
%>
<table border =0 cellspacing=8 cellpadding=O style="text-align: left; width: 100%">
<tr>
<td colspan="2">
<table cellspacing="0" cellpadding="O" style="width: 100%" align=center> <%
ResultSet maldiRS; maldiRS = dbBean. getMSMS(request. getParameter("sampl ei d")) ; if (maldiRS != null) { int j = 0; while (maldiRS. next ()) { j++; %>
<td style="vertical -align: top; text-align: left;"> <table boder="0" cellpadding="O" cellspacing = "0" style="text-align: left; width: 100%; ">
<tr>
<td style="vertical -align: top; text-align: left;">
<b>MS/MS ID:</b> </td> <td style="vertical -align: top; text-align: left;">
<a h ref=" . /msmsdatawi thgraph . j sp?msmsi d=<%=mal di RS . getlnt (1)%>"> <%=mal di RS . getlnt (l)%x/a>
</td> </tr> <tr>
<td style="vertical -align: top; text-align: left;">
<b>Compare : &nbsp ; </b> </td>
<td style="vertical -align: top; text-align: left; "><a href=" ./msmscomparesetup. jsp?msmsid=<%=maldi RS. getlnt (l)%>"xi>In Si 1 i co</i ></a>
&nbsp;&nbsp; <a href=" ./msmstomsmscomparesetup. jsp?msmsid=<%=maldi RS. getlnt (l)%>">MS/MS</a>
</td> </tr> <tr>
<td style="vertical -align: top; text-align: left;">
<b>Date:</b> </td> <td style="vertical -align: top; text-align: left;">
<%=mal di RS . getDate (2)%> </td> </tr> <tr> <td style="vertical -align: top; text-align: left;">
<b>Precursor Ion Mass:&nbsp&nbsp</b> </td> <td>
<%=mal di RS . getSt ri ng (4)%> </td> </tr> <tr>
<td style="vertical -align: top; text-align: left;">
<b>Protei n : &nbsp&nbsp</b> </td> <td style="vertical -align: top; text-align: left;">
<%=mal di RS . getStri ng(5)%> </td> </tr>
<tr>
<td>
<b>Notes:</b> </td> <td>
<a href=" . /updatemsmsnotes . j sp?msmsi d=<%=mal di RS . getStri ng(l)%>">Update</a>
</td> </tr> <tr> <td col span ="2">
<%=mal di RS . getStri ng (6)%> </td> </tr> </table> </td>
<% if (j % 3 == 0) { %>
<trxtd>&nbsp</tdx/tr> <tr>
<%if (j 6 == 0) { %> </tr>
<%
}} else{ %> This sample does not currently have MALDI-TOF data
</table> </td> </tr> </table>
<%dbBean.dbClose(); out.write(pageSource. getPageFooter ()) ;%> <%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getlisernameO , "insert Subspecies" , "insertSubspeciesTitle" , application. getReal Path("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%> <% dbBean . dbConnectO ; int rtrn; rtrn = dbBean. insertNewSubspecies( request. getParameter ("name")) ; if (rtrn > 0) { out . wri te C'lnsert successful l ! ") ;
} el se i f (rtrn == -1) { out.write("An error occurred while processing this request, please try again, if this continues contact support."); dbBean. dbCloseO ; %> <brxcenterxa href="insertstrain. jsp">Insert New Strain</ax/center>
<%out. write (pageSource. getPageFooter ()) ;%>
<%@ page language="java" %>
<%@ page import="java.io.OutputStream" %>
<%@ page import="java. awt. image. Bufferedlmage" %>
<%@ page import=" Java. awt. *" %>
<%@ page import="com. sun. image. codec. j peg. *" %>
<%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="gBean" class="psm. graph. maldiGraph"/>
<% int intA = Integer. parselnt(request. getParameter("rangeA")) ; int intB = Integer .parselnt(request.getParameter("rangeB")) ; int topnum = Integer. parselnt(request.getParameter("topnum")) ; int b;
String[] maldiids = request. getParameterValues("checkid") ; if (maldiids[0] .compareτo("on") == 0 ) { b = 1; } else { b = 0; }
Font font = new Font("ARIAL" , Font. BOLD , 12); response. setContentτype("image/jpeg") ;
Bufferedlmage blmg = new Bufferedlmage(850, 620, Bufferedlmage. TYPE_INT_RGB) ;
Graphics2D biContext = blmg.createGraphicsO ; biContext. setBackgroundCCotor. WHITE) ; bi Context. cl earRect (0,0, 850, 620);
//Turn on antialiasing bi Context . setRenderi ngHi nt (Renderi ngHi nts . KEY_ANTIALIASING ,
Renderi ngHi nts . VALUE_ANTIALIAS_ON) ; biContext. setColorCColor. BLACK) ; bi Context . drawLi ne (60 , 40 , 60 , 540) ; bi Context . drawLi ne (60 , 540 , 810 , 540) ; biContext. setFont(font) ;
//Draws the Y Numbers int j =1; biContext . drawStri ng("0" , 35 , 545) ; biContext. drawLine(53, 540, 60, 540); for (j = 1; j<=100; j++) { if (j % 10 == 0) {
String num; num = ""; num = num + j ; biContext. drawString(num, 30, 545 - j*5); biContext. drawLine(53, 540-j*5, 60, 540-j*5); } else { biContext. drawLine(58 , 540 -j *5, 60, 540-j*5 );
} int div = (intB - intA) / 5; int 1 ;
String num; num = ""; num = num + intA; biContext. drawStri ng(num, 60 , 570); //Draws the X numbers for (1=1; 1 <=5; 1++) { int i = 0; i = i ntA + div*l ; num = ""; num = num + i ; int centerint = num.length() / 2 * 7; if (num.length()%2 !=0) { centerint+= 3;
} biContext. drawString(num, (60 + 150*0) - centerint) , 570);
bi Context. drawLine(60+150*"l , 540, 60+150*1 , 555);
for (1=1; 1 <=10; 1++) { biContext.drawLine(60+(75*l), 540, 60+(75*l), 550);
} for (1=1; 1 <= 20; 1++) { if (1 % 2 != 0 ) { double shift = 1 * 37.5; int lshift = (int) shift; biContext.drawl_ine(60+Ishift, 540, 60+Ishift, 545);
} dbBean . dbConnectO ;
//draw the lines
//Draw the first id biContext = gBean.gDraw(biContext, dbBean. getMaldiGraphSubtractionData(maldiids[b] , maldiids[b+l] , intA, intB, Integer . parselnt(request.getParameter("ppm"))) , intA, intB, topnum/2 + (topnum % 2), 540, 5, 750, Color. RED);
//draw the secod id biContext = gBean.gDraw(bi Context, dbBean . getMaldiGraphSubtractionData(maldiids [b+1] , maldiids[b] , intA, intB,
Integer . parselnt(request.getParameter("ppm"))) , intA, intB, topnum /2, 540, 5, 750,
Col or. CYAN); biContext. setColor(Color. RED) ; biContext = gBean.gDrawTitle(biContext, dbBean. getMal diAndSampl elnfo(mal di i ds [b] ),
870, 10); bi Context . setCol or(Col or . CYAN) ; biContext = gBean.gDrawTitle(biContext, dbBean. getMal diAndSampl elnfo(maldi ids [b+1] ),
870, 22); bi Context . setCol or(Col or . BLACK) ; biContext. drawStringC'Mass to Charge (M/Z)", 365, 610); FontMetrics fm = biContext. getFontMetricsO ; biContext. rotate(-Math. PI / 2, 10, 325 - (fm.getHeight()/2)) ; biContext. drawString("% Intensity", 10,325); OutputStream output = response. getOutputStreamO ;
ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ;
JPEGEncodeParam param = encoder. getDefault3 PEGEncodeParam(blmg) ; param. setQualityC (float) 1, false); encoder. setJPEGEncodeParamCparam) ; encoder. encode (blmg) ; output. closeO ; dbBean.dbCloseO ;
%>
<%@ page language="java" %>
<%@ page import="java.io.OutputStream" %>
<%@ page import="java. awt. image. Bufferedlmage" %>
<%@ page import=" Java. awt. *" %>
<%@ page import="com. sun. image. codec. j peg. *" %>
<%@page import="java. sql . *" %>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="gBean" class="psm. graph. maldiGraph"/>
<% int intA = Integer. parselnt(request. getParameter("rangeA")) ; int intB = Integer .parselnt(request.getParameter("rangeB")) ; int topnum = Integer. parselnt(request.getParameter("topnum")) ; int b;
String[] maldiids = request. getParameterValues("checkid") ; if (maldiids[0] .compareτo("on") == 0 ) { b = 1; } else { b = 0; }
Font font = new Font("ARIAL" , Font. BOLD , 12); response. setContentτype("image/jpeg") ;
Bufferedlmage blmg = new Bufferedlmage(850, 620, Bufferedlmage. TYPE_INT_RGB) ;
Graphics2D biContext = blmg.createGraphicsO ; biContext. setBackgroundCCotor. WHITE) ; bi Context. cl earRect (0,0, 850, 620);
//Turn on antialiasing bi Context . setRenderi ngHi nt (Renderi ngHi nts . KEY_ANTIALIASING ,
Renderi ngHi nts . VALUE_ANTIALIAS_ON) ; biContext. setColorCColor. BLACK) ; bi Context . drawLi ne (60 , 40 , 60 , 540) ; bi Context . drawLi ne (60 , 540 , 810 , 540) ; biContext. setFont(font) ;
//Draws the Y Numbers int j =1; biContext . drawStri ng("0" , 35 , 545) ; biContext. drawLine(53, 540, 60, 540); for (j = 1; j<=100; j++) { if (j % 10 == 0) {
String num; num = ""; num = num + j ; biContext. drawString(num, 30, 545 - j*5); biContext. drawLine(53, 540-j*5, 60, 540-j*5); } else { biContext. drawLine(58 , 540 -j *5, 60, 540-j*5 );
} int div = (intB - intA) / 5; int 1 ;
String num; num = ""; num = num + intA; biContext. drawStri ng(num, 60 , 570); //Draws the X numbers for (1=1; 1 <=5; 1++) { int i = 0; i = i ntA + div*l ; num = ""; num = num + i ; int centerint = num.length() / 2 * 7; if (num.length()%2 !=0) { centerint+= 3;
} biContext. drawString(num, (60 + 150*0) - centerint) , 570);
bi Context. drawLine(60+150*"l , 540, 60+150*1 , 555);
for (1=1; 1 <=10; 1++) { biContext.drawLine(60+(75*l), 540, 60+(75*l), 550);
} for (1=1; 1 <= 20; 1++) { if (1 % 2 != 0 ) { double shift = 1 * 37.5; int lshift = (int) shift; biContext.drawl_ine(60+Ishift, 540, 60+Ishift, 545);
} dbBean . dbConnectO ;
//draw the lines
//Draw the first id biContext = gBean.gDraw(biContext, dbBean. getMSMSGraphSubtractionData(maldiids[b] , maldiids[b+l] , intA, intB, request. getParameter("masserror")) , intA, intB, topnum/2 + (topnum % 2), 540, 5, 750, Color. RED);
//draw the secod id biContext = gBean.gpraw(biContext, dbBean. getMSMSGraphSubtractionData(maldiids[b+l] , maldiids[b], intA, intB, request. getParameter("masserror")) , intA, intB, topnum /2, 540, 5, 750, Col or. CYAN); biContext. setColor(Color . RED) ; biContext = gBean.gDrawTitle(biContext, dbBean. getMSMSAndSampl elnfo(mal di i ds [b] ),
870, 10); bi Context . setCol or(Col or . CYAN) ; biContext = gBean.gDrawTitle(biContext, dbBean. getMSMSAndSampl elnfo(mal di i ds [b+1] ),
870, 22); biContext. setColor(Color . BLACK) ; biContext. drawStringC'Mass to Charge (M/Z)", 365, 610); FontMetrics fm = biContext. getFontMetricsO ; biContext. rotate(-Math. PI / 2, 10, 325 - (fm.getHeight()/2)) ; biContext. drawString("% Intensity", 10,325);
OutputStream output = response. getOutputStreamQ ; ZlPEGlmageEncoder encoder = jPEGCodec.createJPEGEncoder(output) ;
JPEGEncodeParam param = encoder. getDefault3 PEGEncodeParam(blmg) ; param. setQualityC (float) 1, false); encoder. setJPEGEncodeParamCparam) ; encoder. encode (blmg) ; output. closeO ; dbBean.dbCloseO ;
%>
<%@page contentType="text/html "%>
<%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getUsernameO , "insert Subtype" , "insertSubtypeTitle", application. getReal Path("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%> <% dbBean . dbConnectO ; int rtrn; rtrn = dbBean. insertNewSubtype( request. getParameter ("name")) ; i f (rtrn > 0) { out . wri te C'lnsert successful l ! ") ;
} el se i f (rtrn == -1) { out.write("An error occurred while processing this request, please try again, if this continues contact support."); dbBean. dbCloseO ; %> <brxcenterxa href="insertstrain. jsp">Insert New Strain</ax/center>
<%out. write (pageSource. getPageFooter ()) ;%>
<%@page import="Java. math. *" %> <%
Biglnteger 1 = Biglnteger .valueOf(1) ; for (int i = 1; i <= 65; i++) {
1 = 1.multiply(Biglnteger .valueOf (i)) ; out.write(l . toStringO) ;
%>
<%@page contentType="text/html "%>
<%@page pageEncodi ng="UTF-8"%>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTempl atePage (dbBean. getllsernameO , "MALDI Comparison" , "MaI di Compari sonTi tl e" , appl i cati on . getReal Path ("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<form>
<tabl e al i gn=center> <tr>
<td>
MALDI-TOF ID:
</td> <td>
<%=request . getParameter("mal di i d")%> </td> </tr> <tr>
<td>
Threshold (%):&nbsp </td <td colspand="3">
<input type="text" name="threshold" value="10"> </td> </tr> <tr>
<td>
Mass Range: </td> <td>
<input type="text" name="rangea" value="4000"> </td> <td>
To: </td> <td>
<input type="text" name="rangeb" value="14000"> </td> </tr> <tr>
<td>
Data Uncertainty (ppm) :&nbsp </td> <td colspan="3">
<input type="text" name="uncertainty" value="50"> </td> </tr> <tr>
<td>
Number of Matches to Return :&nbsp </td> <td C9lspan="3">
<input type="text" name="topmatches" value="10"> </td> </tr> <tr>
<td al i gn=ri ght col span=4>
<input type="submit" value="G0"> </td> </tr> </table> </form>
<%out.write(pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Update <i>In Silico</i> Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeaderO) ; dbBean. dbCloseO ;
%>
<table align = center> <tr>
<td colspan=2> <% dbBean . dbConnectQ ; dbBean. executeStringC'UPDATE in_silico SET notes='" + request . getParameter ("notes") + "' WHERE in_silico_id = " + request . getParameter ("i nsi 1 i coi d")) ; out.write("Update Completed. ") ; dbBean. dbCloseO ; %>
</td> </tr> </table>
<%out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Update <i>In Silico</i> Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out.write(pageSource. getPageHeaderO) ;
String [] insilico; i nsi 11 co = dbBean . getlnSi 1 i coSampl elnfo(request . getParameter("i nsi 1 i coi d")) ; dbBean. dbCloseO ;
%>
<form action="updateinsilicoconfi rm. jsp"> <table align = center> <tr>
<td>
<i>ln Silico</i> ID Number: </td> <td>
<input type="text" readonly name="insilicoid" val ue="<%=request . getParameter ("i nsi 1 i coi d")%>">
</td> </tr> <tr>
<td>
Notes </td> <td>
<textarea name="notes"><%=insilico[2]%x/textarea> </td> </tr> <tr>
<td colspan="2" align=center>
<input type="submit" value="Update"> </td> </tr> </table> </form> <%out. write (pageSource. get Page Footer ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Update MALDI Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<table align = center> <tr>
<td colspan=2> <% dbBean . dbConnectQ ; dbBean. executeStringC'UPDATE maldi_tof SET notes='" + request. getParameter ("notes") + "' WHERE maldi_tof_id = " + request. getParameter ("maldi id")) ; out.writeC'Update Completed. ") ; dbBean. dbCloseO ; %>
</td> </tr> </table>
<%out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Update MALDI Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out.write(pageSource. getPageHeader()) ;
String [] maldi ; mal di = dbBean . getMal di Sampl elnfo(request . getParameter("mal di id")) ; dbBean. dbCloseO;
%>
<form action="updatemaldiconfi rm. jsp"> <table align = center>
<tr>
<td>
MALDI ID Number: </td> <td>
<input type="text" readonly name="maldiid" val ue="<%=request . getParameter("mal di i d")%>">
</td> </tr> <tr>
<td>
Notes </td> <td>
<textarea name="notes"x%=maldi [2]%></textarea> </td> </tr> <tr>
<td C9lspan="2" align=center>
<input type="submit" value="Update"> </td> </tr> </table> </form> <%out. write (pageSource. get Page Footer ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Update MS/MS Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<table align = center> <tr>
<td colspan=2> <% dbBean . dbConnectQ ; dbBean . executeStri ngC'UPDATE ms_ms SET notes='" + request . getParameter ("notes") + "' WHERE ms_ms_id = " + request. getParameter ("msmsid")) ; out.writeC'Update Completed. ") ; dbBean. dbCloseO ; %>
</td> </tr> </table>
<%out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Update MS/MS Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeader ()) ;
String [] msms; msms = dbBean. getMSMSSamplelnfo( request. getParameter ("msmsid")) ; dbBean. dbCloseO ;
%>
<form acti on="updatemsmsconfi rm . j sp"> <tabl e al i gn = center>
<tr>
<td>
MS/MS ID Number: </td> <td>
<input type="text" readonly name="msmsid" value="<%=request. getParameter ("msmsid")%>">
</td> </tr> <tr>
<td>
Notes </td> <td>
<textarea name="notes"x%=msms [2]%></textarea> </td> </tr> <tr>
<td C9lspan="2" align=center>
<input type="submit" value="Update"> </td> </tr> </table> </form> <%out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%> <%@page import="java. sql . *" %> <jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope="session"/>
<% dbBean . dbConnectO ; pageSource. spi itTempl atePage (dbBean. getUsernameO , "Update Strain" , "UpdateSt rai nTi tie", appl i cati on . getReal Path ("/") , dbBean) ; out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<% dbBean . dbConnectO ;
%>
<% i nt sampl elD , crntCycl e ; crntCycl e=O ;
//This handles all the update code and the cycle code
//Si nce we cycl e usi ng rm numbers , and sampl e_i ds aren ' t necessarri l y equi val ent or i n the same order we need to
//grab the sample ID from the RM number
//First update the previous sample if (request. getParameterC'submit") != null) { int gtent, sptent, subtent, othertent; if (request. getParameterC'gtent") == null) { gtent = 0; } else { gtent = 1; if (request. getParameterC'sptent") == null) { sptent = 0; } else { sptent = 1; if (request. getParameterC'subtent") == null) { subtent = 0; } else { subtent = 1; } if (request. getParameterC'othertent") == null) { othertent = 0; } else { othertent = 1; if
(dbBean. updateStrai n (Integer . parselnt( request. getParameter ("sampleid")) , Integer. pars elnt( request. getParameter ("i dent")) , Integer. parselnt( request. getParameter ("number")) request. getParameter ("date") , Integer. parselnt( request. getParameter ("genus")) , Integer . parselnt( request. getParameter ("species")) , Integer. parselnt( request. getParameter ("su bspecies")) , integer. parselnt( request. getParameter ("subtype")) , request. getParameter (" notes") , request. getParameterC'history") , gtent , sptent, subtent, othertent) ==0) { out.writeC'Update Successful! !");
//Now Handle the cycling if the update was successfull, otherwise dont update if (request. getParameterC'lowCycle") == "" | | request. getParameterC'lowCycle") == null | | request. getParameterC'lowCycle") .compareTo("0") == 0 | | request. getParameterC'highCycle") == "" | | request. getParameterC'highCycle") == null I I request. getParameterC'lowCycle") .compareTo(request. getParameterC'highCycle")) == 0) { samplelD = Integer. parselnt( request. getParameter(" sampleid")) ; } else { crntCycle = Integer. parselnt(request.getParameter("lowCycle")) + 1; sampleID = dbBean.getSampleIDFromldent(crntCycle, Integer. parselnt( request. getParameter ("i dent"))) ; if (sampleID == 0) {
//No sample existed or an error occurred crntCycle = crntCycle -1; sampleID = Integer. par selnt( request. getParameter("sampleid")) ;
} else{ out.write("Update Failed, please press back and make sure that your data is correct and that your login has not timed out."); sampleID = Integer. parselnt( request. getParameter ("sampleid")) ;
} else { sampleID = Integer. parselnt( request. getParameter ("sampleid")) ;
%>
;
Figure imgf000330_0001
} else { sSpecies = myRS.getString(6) ;
String sSubSpecies; if (myRS.getString(7) == null) { sSubSpecies = ""; } else { sSubSpecies = myRS.getString(7) ;
String sOther; if (myRS.getString(δ) == null) { sOther = ""; } else { sOther = myRS.getString(δ) ; int tGenus = myRS.getlnt(ll) ; int tSpecies = myRS.getInt(12) ; int tSubSpecies = myRS.getlnt(13) ; int tOther = myRS.getInt(14) ; myRS. close () ;
%>
<form action="updatestrai n . jsp"> <table bordeer="0" cell padding = "O1 cellspacing = "2" align="center"> <tr> <td col span = "3">
<centerxa h ref ="del etesampl econf i rm . j sp?sampl ei d=<%=sampl elD%>">Del ete Strai n</ax/center> </td> </tr> <tr>
<td>
Sample ID: </td> <td C9lspan="2">
<input type="text" name = "sampleid" value="<%=sampleID%>" readonly> </td> </tr>
<tr>
<td> identifier (RM):&nbsp </td> <td>
<select name="ident">
myRS.getlnt("ide
myRS.getlnt("ide
Figure imgf000331_0001
</select> </td> </tr> <tr> if
Figure imgf000332_0001
Number (1222):&nbsp </td> <td>
<input type=text name="number" value="<%=sNumber%>"> </td> </tr> <tr>
<td>
Date (2005-8-24): </td> <td>
<input type=text name="date" value="<%=sDate%>"> </td> </tr> <tr>
<td>
Genus: </td> <td>
<sel ;
Figure imgf000332_0002
String cmpr = sGenus; if (myRS.getStringC'name") !=null) { if (cmpr.c9mpareTo(myRS.getString("name")) == 0) { out.write("<option value='" + myRS.getlnt("genus_id") + "' selected>" + myRS.getStringC'name"));
} else { out.write("<option value='" + myRS.getInt("genus_id") + '">" + myRS.getStringC'name"));
} else { if (cmpr .compareTo("")==0) { out.write("<option value='" + myRS.getlnt("genus_id") + "' selected>No Genus");
} else { out.write("<option value='" + myRS.getlnt("genus_id") + '">No Genus");
} } while (myRS. next ()) ; myRS.closeO ;
%>
</select> </td> <td> <% if (tGenus == 0) { out.write("<input type=' checkbox1 name='gtent ' value='l'>Tentative") ; }else { out.write("<input type=' checkbox1 name='gtent ' value='l' checked>τentative") ;
%>
</td> </tr> <tr>
<td>
Species: </td> <td>
<select name="species"> <% myRS = dbBean.getSpeciesO ; if (myRS. next O) { myRS. first O ; do {
String cmpr = sSpecies; if (myRS.getStringC'name") !=null) { if (cmpr .compareTo(myRS.getString("name")) == 0) { out.write("<option value='" + myRS.getlnt("species_id") + "' selected>" + myRS.getStringC'name"));
} else { out.write("<option value='" + myRS.getInt("species_id") + '">" + myRS.getStringC'name"));
} else { if (cmpr.compareTo("")==0) { out.write("<option value='" + myRS.getlnt("species_id") + "' selected>No Species");
} else { out.write("<option value='" + myRS.getlnt("species_id") + '">No Species");
} } while (myRS. next ()) ; myRS.closeO ; %>
</select> </td> <td> <% if (tSpecies == 0) { out.write("<input type=' checkbox1 name=' sptent ' value='l'>τentative") ; }else { out.write("<input type=' checkbox1 name=' sptent ' value='l' checked>τentative") ; }
%>
</td> </tr> <tr>
<td>
Subspecies: </td> <td>
<select name="subspecies"> <% myRS = dbBean.getSubSpeciesO ; if (myRS. next ()) { myRS. fir st O ; do {
String cmpr = sSubSpecies; if (myRS.getStringC'name") !=null) { if (cmpr .compareTo(myRS.getString("name")) == 0) { out.write("<option value='" + myRS.getlnt("subspecies_id") + "' selected>" + myRS.getStringC'name"));
} else { out.write("<option value='" + myRS.getlnt("subspecies_id") + '">" + myRS.getStringC'name"));
} else { if (cmpr.compareTo("")==0 ) { out.write("<option value='" + myRS.getlnt("subspecies_id") + "' selected>No Subspecies");
} else { out.write("<option value='" + myRS.getlnt("subspecies_id") + '">No Subspecies");
} } while (myRS. next ()) ; myRS.closeO ; %>
</select> </td> <td> <% if (tSubSpecies == 0) { out.write("<input type=' checkbox1 name=' subtent ' value='l'>τentative") ; }else { out.write("<input type=' checkbox1 name=' subtent ' value='l' checked>τentative") ; }
%>
</td> </tr> <tr>
<td>
Subtype: </td> <td>
<sel
Figure imgf000334_0001
if (myRS.getStringC'name") !=null) { if (cmpr .compareTo(myRS.getString("name")) == 0) { out.write("<option value='" + myRS.getlnt("subtype_id") + '" selected>" + myRS.getStringC'name"));
} else { out.write("<option value='" + myRS.getInt("subtype_id") + '">" + myRS.getStringC'name")); } else { if (cmpr .compareTo("")==0) { out.write("<option value='" + myRS.getlnt("subtype_id") + "' selected>No Subtype");
} else { out.write("<option value='" + myRS.getlnt("subtype_id") + '">No Subtype");
} } while (myRS. next()) ; myRS. close () ; %>
</select> </td> <td> <% if (tOther == 0) { out.write("<input type=' checkbox1 name='othertent ' val ue=' l'>Tentative") ; }else { out.write("<input type=' checkbox1 name='othertent ' value='l' checked>τentative") ; }
%>
</td> </tr> <tr>
<td style="vertical -align: top">
Notes: </td> <td colspan="2">
<textarea name="notes" cols="65" rows="10"x%=sNotes%x/textarea> </td> <tr> <tr>
<td style="vertical -align: top">
History: </td> <td colspan="2">
<textarea name="hi story" cols="65" rows="5"><%=sHistory%x/textarea> </td> <tr> <tr>
<td C9lspan="3" align="right">
<input type=" submit" value="Submit Update" name="submit"> </td> </tr> </table> </form> <%dbBean . dbcl ose () ; %>
<%out.write(pageSource. getPageFooter ()) ;%> <%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
Figure imgf000336_0001
<%out.write(pageSource.getPageFooter()) ; %>
<%@page contentType="text/html "%>
<%@page pageEncodi ng="UTF-8"%>
<%@page import="java. util . *" %>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<jsp: useBean id="frMaldi" class="psm.mformat.formatMALDITemp" scope="session"/>
<jsp:useBean id="dbBean" class="psm.db.dbAccess" scope ="session" />
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Compare MS Data to Database", "insertMALDITitle" , appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeader ()) ; frMaldi . formatMALDIFile(request) ;
Java. text . Si mpleDateFormat df = new Java. text. SimpleDateFormat("yyMMdd") ; Calendar cd = Calendar. getlnstanceO ; %>
<form action="uploadfileredi rect. jsp"> <table align="center"> <tr>
<td colspan="2">
<center>Please check and make sure the data from the file was pased cor recti y<br>and make any changes you wish before hitting submi t . <brxbrx/center>
</td> </tr> <tr>
<td>
Identification Number :&nbsp </td> <td>
<input type=text name="ident" readonly size=33 val ue="Temporaryl">
</td> </tr> <tr>
<td> Date: </td> <td>
<input readonly type=text name="date" size=33 val ue="<%=df. format (cd . getTi me ())%>">
</td> </tr> <tr>
<td>
Filename: </td> <td>
<input type="text" name="notes" size=33 val ue="<%=f rMal di . getNotes ()%>">
</td> </tr> <tr>
<td>
Mass to Charge/Intensity:
</td
<td heignt=100px>
<textarea readonly name="mz" cols=25><%
ArrayList mz = f rMaldi .getMaldiMZ() ;
ArrayList intensity = f rMaldi .getMaldilntensityO ; for (int i= 0; i < mz.sizeO; i++) { out.write(mz.get(i) + "\t\t" +intensity.get(i) + "\n" );
%></textarea> </tr>
<tr>
<td colspan="3" align=center>
<br>
<input type="submit"> </td> </tr> </table> </form> <% dbBean.dbCloseO ; ou t.writeCpageSource. get Page Footer ()) ; %>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
<jsp: useBean id="dbBean" class="psm.db.dbAccess" scope = "session"/>
<jsp:useBean id="pageSource" class="psm.web. pageCode"/>
<% dbBean . dbConnectO ; pageSource. splitTemplatePage(dbBean.getUsername() , "Insert MALDI Data", "insertMALDITitle", appl icati on. getReal Path ("/"), dbBean); out. write (pageSource. getPageHeader ()) ; dbBean. dbCloseO ;
%>
<form method=post action="uploadcompareparse. jsp" enctype="MULTIPART/FORM-DATA"> <table align = center> <tr>
<td col span = 2>
<centerxhl>Upload MALDI-TOF MS Data</hlx/center> </td> </tr> <tr>
<td>
Fi nd Fi 1 e : </td> <td>
<i nput type="fi l e" name="mal di fi l e"> </td> </tr> <tr> <tdx/td>
<td col span="l" al i gn=l eft>
<input type="submit" value="Send"> </td> </tr> </table> </form> <%out. write (pageSource. getPageFooter ()) ;%>
<%@page contentType="text/html "%> <%@page pageEncodi ng="UTF-8"%>
Figure imgf000340_0001
/Vc
* box . j ava
*
* Created on July 13, 2005, 12:58 PM
* This is used as a container class to keep a list of two related objects */ package psm.db.box; /**
* ©author Brandon
*/ public class box { private String ol; private String o2 ;
/** Creates a new instance of box */ public box(String mol, String mo2) { setθl(mol) ; set02(mo2) ; } public String getOlO { return ol; } public void setOl(String ol) { this.ol = ol; } public String getO2() { return o2; } public void setO2 (String o2) { this.o2 = o2 ; }
/Vc
* masscolorbox. Java
*
* Created on August 25, 2005, 11:42 AM
* To change this template, choose Tools | Options and locate the template under
* the Source Creation and Management node. Right-click the template and choose
* Open. You can then make changes to the template in the Source Editor.
Vc / package psm.db.box; import java.awt.*;
/Vc Vc Vc
* ©author User
Vc / public class masscolorbox { private int mass; private Color highlighted;
/** Creates a new instance of masscolorbox */ public masscolorboxO {
public int getMassO { return mass; } public void setMass(int mass) { this. mass = mass;
public Color getHighlightedO { return highlighted;
public void setHighlighted(Color highlighted) { thi s . highlighted = highlighted;
* box . j ava
*
* Created on July 13, 2005, 12:58 PM
* This is a container that holds the values from an ms_ms to in silico compare and computes the p value and stores the related information
package psm.db.box; import Java. math.*;
* ©author Brandon
*/ public class scorecontainer { private String mid; private String score; private String scorebeta; private int lc_k; private int uc_k; private int n; private double nstar;
//THese are not input able private double s; private double pvalue;
/** Creates a new instance of box */ public scorecontainer(String fmid, String fscore, int flc_k, int fuc_k, int fn, double fnstar) { setMid(fmid); setScore(fscore) ; setLc_k(flc_k); setuc_k(fuc_k) ; setN(fn); setNstar(fnstar) ;
//Computation setS(l - Math.exp(-n/nstar)); setPvalue(PkO); } public scorecontainer (String fmid, String f score, String f scorebeta, int flc_k, int fuc_k, int fn, double fnstar) { setMid(fmid); setScore(fscore) ; setScorebeta(fscorebeta) ; setLc_k(flc_k); setuc_k(fuc_k) ; setN(fn); setNstar(fnstar) ;
//Computation setS(l - Math.exp(-n/nstar)) ; setPvalue(PkO); } public scorecontainer (String fmid, String f score, String f scorebeta) { setMid(fmid); setScore(fscore) ; setScorebeta(fscorebeta) ; setLc_k(0); setuc_k(θ); setN(0); setNstar(O); setS(O); setPvalue(O) ; } public scorecontainer(scorecontainer sc) { setMid(sc.getMidO); setScore(sc.getScoreO) ; setLc_k(sc.getLc_k()) ; setuc_k(sc.getuc_kθ) ; setN(sc.getNθ); setNstar(sc.getNstarO) ; setS(sc.getsQ); setPvalue(sc.getPvalueO) ;
private double Pk() {
BigDecimal pval = BigDecimal .valueOf (0) ; for (int k=getLc_k();k<=getUc_k();k++) {
BigDecimal p = factks(k) .divide (fact (getuc_k() - k)); .valueOf (Math. pow(getS() , k) * Math.
Figure imgf000344_0001
return pval .doubleValue() ;
private BigDecimal fact (int x) {
BigDecimal 1 = BigDecimal .valueOf (1) ; for (int i = 2; i <= x; i++) {
1 = 1.mul ti ply (BigDecimal . val ueOf (i)) ; return 1 ;
} private BigDecimal factks(int x) {
//This function takes the first part of the p value, κ!/k! //This is equivalent to the multiplication of all the numbers of k+1 to K //Makes for a smaller number, the larger one does not need to be stored. BigDecimal 1 = BigDecimal .valueOf (1) ; for (int i = x + 1; i <= getUc_k() ; i++) { 1 = 1.mul ti pi y(BigDecimal .valueOf (i)) ; return 1 ;
}
public String getMidO { return mid; } public void setMid(String mid) { this. mid = mid;
} public String getScoreO { return score;
} public void setScore(String score) { this. score = score;
} public String getScorebetaO { return scorebeta;
public void setScorebeta(String score) { this. scorebeta = score;
public int getLc_k() { return lc_k;
} public void setl_c_k(int lc_k) { this.lc_k = lc_k;
public int getuc_k() { return uc_k;
} public void setuc_k(int uc_k) { this.uc_k = uc_k;
public int getN() { return n;
} public void setN(int n) { this.n = n;
} public double getNstar() { return nstar;
public void setNstar (double nstar) { this. nstar = nstar;
public double gets() { return s;
} private void sets(double s) { this. s = s;
} public double getPvalueO { return pvalue;
private void setPvalue(double pvalue) { this. pvalue = pvalue; * dbAccess. Java
*
* Created on June 22, 2005, 10:07 AM
package psm.db; import Java. beans. *; import java.io.*; import Java. sql . *; import Java. util . *;
/**
* ©author Brandon Garbus public class dbAccess { private String SQLQuery; private String password; private String username; private Java. sql .Statement stmt; private Connection myConn; public String buildCompareString(int intensityBound, int lowerMassBound, int higherMassBound, int error) {
/*
*THIS IS NOT USED ANYMORE use bui 1 dCompareStri ngForTemp
*This is because all data is now stored in temporary tables for comparison to reduce
*search times!
//$cmpr$ = the comparison ID
//$cmprTo$ = the comparison ID cmpr is currently being compared to
//$lowMass$ = the lower mass bound
//$highMass$ = the higher mass bound
//$mi nlntensi ty$ = the minimum intensity range
//$error$ = the error range in ppm (parts per million)
*The Formula used for the comparison is SUM(A+B - [2*ABS(A-B)]) / SUM (A+B) where A and B are the intensities of two seperate data sets to compare
*τhis gives a range of -1.0 to 1.0 which is then multiplied by 100 to get a percentage
*τhe select statement allows for a multitiude of search options, it deals with correcting error and takes the average of the two masses (which is not used for comparison)
*and combines the two intensities into one row. */
String selStr;
//First create the select statement without any values in it //This is the select statement for data within the same table. For MALDI data not in this table a seperate
//Temporary table will be built and joined the same way selStr = "SELECT ROUND(sum(score2)/sum(score) * 100,0) score FROM ((select (a. mass + b.mass) / 2 mass, a. intensity as 1Ai 1 , b. intensity as 1Bi 1 , (SELECT Ai + Bi) as 'score1 , (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from maldi_tof_data a, maldi_tof_data b where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and a. intensity > $minlntensity$ and a. mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and (a.maldi_tof_id < b.maldi_tof_id or a.maldi_tof_id < b.maldi_tof_id) and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$) union (select distinct a. mass, a. intensity as 1Ai 1 , 0 as 1Bi 1 , (SELECT Ai + Bi) as 'score1 , (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from maldi_tof_data a where a.maldi_tof_id = $cmpr$ and a. intensity > $minlntensity$ and a. mass between $lowMass$ and $highMass$ and a. mass not in"; selStr += " (select distinct a. mass from maldi_tof_data b where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and (a.maldi_tof_id < b. maldi _tof_id or a.maldi_tof_id < b.maldi_tof_id) and b. maldi _tof_id = $cmprTo$ and b.mass between $lowMass$ and $highMass$))" ; selStr += " union (select distinct b.mass, 0 as 1Ai 1 , intensity as 1Bi 1 , (SELECT Ai + Bi) as 'score1 , (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from maldi_tof_data b where b. maldi _tof_id = $cmprTo$ and b. intensity > $minlntensity$ and b.mass between $lowMass$ and $highMass$"; selStr += " and b.mass not in (select b.mass from maldi_tof_data a where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and a. intensity > $mi nlntensi ty$ and (a.maldi_tof_id < b.maldi_tof_id or a.maldi_tof_id < b. maldi _tof_id) and a.maldi_tof_id = $cmpr$ and a. mass between $lowMass$ and $highMass$))) maldi";
//now using the definitions above, insert the values selStr = selStr . replace("$lowMass$" , Integer . toString(lowerMassBound)) ; selStr = selStr . replace("$highMass$" , Integer . toString(higherMassBound)) ; selStr = selStr . replace("$minlntensity$" , integer . toString(intensityBound)) ;
//Convert ppm to a percentage and replace it everywhere double mErr = error/1000000.0; selStr = selStr. replace("$error$", Double. toString(mErr)) ; return selStr; } public String buildCompareStringForTemp(int intensityBound, int lowerMassBound, int higherMassBound, int error) {
//$cmpr$ = the comparison ID
//$cmprTo$ = the comparison ID cmpr is currently being compared to
//$lowMass$ = the lower mass bound
//$highMass$ = the higher mass bound
//$mi nlntensi ty$ = the minimum intensity range
//$error$ = the error range in ppm (parts per million)
*The Formula used for the comparison is SUM(A+B - [2*ABS(A-B)]) / SUM (A+B) where A and B are the intensities of two seperate data sets to compare
*τhis gives a range of -1.0 to 1.0 which is then multiplied by 100 to get a percentage
*τhe select statement allows for a multitiude of search options, it deals with correcting error and takes the average of the two masses (which is not used for comparison)
*and combines the two intensities into one row. */
String selStr;
//First create the select statement without any values in it //This is the select statement for data within the same table. For MALDI data not in this table a seperate
//Temporary table will be built and joined the same way //Check the mass range, if it is between 4 and 14 thousand use the comparison table of data that is already thresholded if (lowerMassBound == 4000 & higherMassBound == 14000) { selStr = "SELECT ROUND(sum(score2)/sum(score) * 100,0) score FROM ((select (a. mass + b.mass) / 2 mass, a. intensity as 1Ai1, b. intensity as 1Bi1, (SELECT Ai + Bi) as 'score1, (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from maldiTemp a, maldi ratl b where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and a. intensity > $mi nlntensi ty$ and a. mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b. maldi_tof_id = $cmprTo$) union (select distinct a. mass, a. intensity as 1Ai1, 0 as 1Bi1, (SELECT Ai + Bi) as 'score1, (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from maldiTemp a where a.maldi_tof_id = $cmpr$ and a. intensity > $mi nlntensi ty$ and a. mass between $lowMass$ and $highMass$ and a. mass not in"; selStr += " (select distinct a. mass from maldiratl b where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and b.maldi_tof_id = $cmprTo$ and b.mass between $lowMass$ and $highMass$))" ; selStr += " union (select distinct b.mass, 0 as 1Ai 1 , intensity as 1Bi 1 , (SELECT Ai + Bi) as 'score1 , (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from maldiratl b where b. maldi _tof_id = $cmprTo$ and b. intensity > $minlntensity$ and b.mass between $lowMass$ and $highMass$"; selStr += " and b.mass not in (select b.mass from maldiTemp a where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and a. intensity > $minlntensity$ and a.maldi_tof_id = $cmpr$ and a. mass between $lowMass$ and $highMass$))) maldi"; } else { selStr = "SELECT ROUND(sum(score2)/sum(score) * 100,0) score FROM ((select (a. mass + b.mass) / 2 mass, a. intensity as 1Ai1, b. intensity as 1Bi1, (SELECT Ai + Bi) as 'score1, (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from maldiTemp a, maldiτemp2 b where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and a. intensity > $minlntensity$ and a. mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b. maldi_tof_id = $cmprTo$) union (select distinct a. mass, a. intensity as 1Ai1, 0 as 1Bi1, (SELECT Ai + Bi) as 'score1, (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from maldiTemp a where a.maldi_tof_id = $cmpr$ and a. intensity > $minlntensity$ and a. mass between $lowMass$ and $highMass$ and a. mass not in"; selStr += " (select distinct a. mass from maldiτemp2 b where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and b. maldi_tof_id = $cmprTo$ and b.mass between $lowMass$ and $highMass$))" ; selStr += " union (select distinct b.mass, 0 as 'Ai , intensity as 'Bi ' , (SELECT Ai + Bi) as 'score' , (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from maldiτemp2 b where b. maldi _tof_id = $cmprTo$ and b.intensity > $minlntensity$ and b.mass between $lowMass$ and $highMass$"; selStr += " and b.mass not in (select b.mass from maldiTemp a where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and a. intensity > $minlntensity$ and a.maldi_tof_id = $cmpr$ and a. mass between $lowMass$ and $highMass$))) maldi";
//now using the definitions above, insert the values selStr = selStr . replace("$lowMass$" , Integer . toString(lowerMassBound)) ; selStr = selStr. replace("$highMass$", Integer . toString(higherMassBound)) ; selStr = selStr . replace("$minlntensity$" , integer . toString(intensityBound)) ;
//Convert ppm to a percentage and replace it everywhere double mErr = error/1000000.0; selStr = selStr. replace("$error$", Double. toString(mErr)) ;
//Since this is the tempTable the ID is always 0 return selStr; } public String buildCompareStringForTempMassOnly(int intensityBound, int lowerMassBound, int higherMassBound, int error) { //$cmpr$ = the comparison ID
//$cmprTo$ = the comparison ID cmpr is currently being compared to //$lowMass$ = the lower mass bound //$highMass$ = the higher mass bound //$mi nlntensi ty$ = the minimum intensity range //$error$ = the error range in ppm (parts per million)
/*
*The Formula used for the comparison is SUM(A+B - [2*ABS(A-B)]) / SUM (A+B) where A and B are the intensities of two seperate data sets to compare
*τhis gives a range of -1.0 to 1.0 which is then multiplied by 100 to get a percentage
*τhe select statement allows for a multitiude of search options, it deals with correcting error and takes the average of the two masses (which is not used for comparison) *and combines the two intensities into one row. */
String selStr;
//First create the select statement without any values in it
//This is the select statement for data within the same table. For MALDI data not in this table a seperate
//Temporary table will be built and joined the same way
//Check the mass range, if it is between 4 and 14 thousand use the comparison table of data that is already thresholded if (lowerMassBound == 4000 & higherMassBound == 14000) {
//This was the original, new one is used for calculating pvalue //selStr = "SELECT ROUND(((SELECT COUNT(*) FROM (select DISTINCT a.mass mass from maldiTemp a, maldiratl b where a. intensity > $minlntensity$ AND b. intensity > $minlntensity$ AND a.mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and a.mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$) m)) * 2 /((select COUNT(*)from maldiTemp a where a. intensity > $minlntensity$ AND a.mass between $lowMass$ and $highMass$ AND a.maldi_tof_id = $cmpr$) +(Select COUNT(*)from maldiratl b where b. intensity > $minlntensity$ AND b.mass between $lowMass$ and $highMass$ AND b.maldi_tof_id = $cmprτo$)) * 100, 0) score"; selStr = "SELECT lc_k, uc_k, n, Round(lc_k * 2 / (n + uc_k) * 100, 0) as score FROM (SELECT (SELECT COUNT(*) FROM (select DISTINCT a.mass from maldiTemp a, maldiratl b where a. intensity > $mi nlntensi ty$ AND b. intensity > $minlntensity$ AND a.mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and a.mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$) as m) as lc_k, (select COUNT(*) from maldiTemp a where a. intensity > $minlntensity$ AND a.mass between $lowMass$ and $highMass$ AND a.maldi_tof_id = $cmpr$) as n, (Select COUNT(*) from maldiratl b where b. intensity > $mi nlntensi ty$ AND b.mass between $lowMass$ and $highMass$ AND b.maldi_tof_id = $cmprTo$) as uc_k) as tbl " ;
} else {
//selStr = "SELECT ROUND(((SELECT COUNT(*) FROM (select DISTINCT a.mass mass from maldiTemp a, maldiτemp2 b where a. intensity > $minlntensity$ AND b. intensity > $minlntensity$ AND a.mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and a.mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$) m)) * 2 /((select COUNT(*)from maldiTemp a where a. intensity > $minlntensity$ AND a.mass between $lowMass$ and $highMass$ AND a.maldi_tof_id = $cmpr$) +(Select COUNT(*)from maldiτemp2 b where b. intensity > $mi nlntensi ty$ AND b.mass between $lowMass$ and $highMass$ AND b.maldi_tof_id = $cmprτo$)) * 100, 0) score"; selStr = "SELECT lc_k, uc_k, n, Round(lc_k * 2 / (n + uc_k) * 100, 0) as score FROM (SELECT (SELECT COUNT(*) FROM (select DISTINCT a.mass from maldiTemp a, maldiτemp2 b where a. intensity > $minlntensity$ AND b. intensity > $minlntensity$ AND a.mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and a.mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$) as m) as lc_k, (select COUNT(*) from maldiTemp a where a. intensity > $mi nlntensi ty$ AND a.mass between $lowMass$ and $highMass$ AND a.maldi_tof_id = $cmpr$) as n, (Select COUNT(*) from maldiτemp2 b where b. intensity > $mi nlntensi ty$ AND b.mass between $lowMass$ and $highMass$ AND b.maldi_tof_id = $cmprTo$) as uc_k) as tbl";
//now using the definitions above, insert the values selStr = selStr . replace("$lowMass$" , Integer . toString(lowerMassBound)) ; selStr = selStr . replace("$highMass$" , Integer . toString(higherMassBound)) ; selStr = selStr . replace("$minlntensity$" , integer . toString(intensityBound)) ;
//Convert ppm to a percentage and replace it everywhere double mErr = error/1000000.0; sel Str = sel Str . repl ace ("$error$" , Doubl e . toStri ng (mErr) ) ;
//Si nce thi s i s the tempTabl e the ID i s always 0 retu rn sel Str ; public String buildCompareStringwithoutTotalScore(int intensityBound, int lowerMassBound, int higherMassBound, int error) { //$cmpr$ = the comparison ID
//$cmprTo$ = the comparison ID cmpr is currently being compared to //$lowMass$ = the lower mass bound //$highMass$ = the higher mass bound //$mi nlntensi ty$ = the minimum intensity range //$error$ = the error range in ppm (parts per million)
/*
*The Formula used for the comparison is SUM(A+B - [2*ABS(A-B)]) / SUM (A+B) where A and B are the intensities of two seperate data sets to compare
*τhis gives a range of -1.0 to 1.0 which is then multiplied by 100 to get a percentage
*τhe select statement allows for a multitiude of search options, it deals with cor recti ng error and takes the average of the two masses (which is not used for comparison)
*and combines the two intensities into one row.
String selStr;
//First create the select statement without any values in it //This is the select statement for data within the same table. For MALDI data not in this table a seperate
//Temporary table will be built and joined the same way //This is the statement to get the results of the comparison without the score if (lowerMassBound == 4000 & higherMassBound == 14000) { selStr = "(select (a. mass + b.mass) / 2 mass, a. intensity as 1Ai1, b. intensity as 1Bi1, (SELECT Ai + Bi) as 'score1, (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from maldiTemp a, maldiratl b where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and a. intensity > $mi nlntensi ty$ and a. mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$) union (select distinct a. mass, a. intensity as 1Ai1, 0 as 1Bi1, (SELECT Ai + Bi) as 'score1, (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from maldiTemp a where a.maldi_tof_id = $cmpr$ and a. intensity > $mi nlntensi ty$ and a. mass between $lowMass$ and $highMass$ and a. mass not in"; selStr += " (select distinct a. mass from maldiratl b where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and b.maldi_tof_id = $cmprTo$ and b.mass between $lowMass$ and $highMass$))" ; selStr += " union (select distinct b.mass, 0 as 'Ai', intensity as 'Bi', (SELECT Ai + Bi) as 'score', (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from maldiratl b where b.maldi_tof_id = $cmprTo$ and b. intensity > $minlntensity$ and b.mass between $lowMass$ and $highMass$"; selStr += " and b.mass not in (select b.mass from maldiTemp a where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and a. intensity > $mi nlntensi ty$ and a.maldi_tof_id = $cmpr$ and a. mass between $lowMass$ and $highMass$))" ; } else { selStr = "(select (a. mass + b.mass) / 2 mass, a. intensity as 'Ai', b. intensity as 'Bi', (SELECT Ai + Bi) as 'score', (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from maldiTemp a, malditemp2 b where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and a. intensity > $mi nlntensi ty$ and a. mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$) union (select distinct a. mass, a. intensity as 'Ai', 0 as 'Bi', (SELECT Ai + Bi) as 'score', (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from maldiTemp a where a.maldi_tof_id = $cmpr$ and a. intensity > $mi nlntensi ty$ and a. mass between $lowMass$ and $highMass$ and a. mass not in"; selStr += " (select distinct a. mass from malditemp2 b where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and b.maldi_tof_id = $cmprTo$ and b.mass between $lowMass$ and $highMass$))" ; selStr += " union (select distinct b.mass, 0 as 'Ai', intensity as 'Bi', (SELECT Ai + Bi) as 'score1 , (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from mal di temp2 b where b.maldi_tof_id = $cmprTo$ and b. intensity > $minlntensity$ and b.mass between $lowMass$ and $highMass$"; selStr += " and b.mass not in (select b.mass from maldiTemp a where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and a. intensity > $minlntensity$ and a.maldi_tof_id = $cmpr$ and a. mass between $lowMass$ and $highMass$))" ;
//now using the definitions above, insert the values selStr = selStr . replace("$lowMass$" , Integer . toString(lowerMassBound)) ; selStr = selStr . replace("$highMass$" , Integer . toString(higherMassBound)) ; selStr = selStr . replace("$minlntensity$" , integer . toString(intensityBound)) ;
//Convert ppm to a percentage and replace it everywhere double mErr = error/1000000.0; selStr = selStr . replace("$error$" , Double. toString(mErr)) ; return selStr; } public String buildCompareStringForTempWithoutTotalScore(int intensityBound, int lowerMassBound, int higherMassBound, int error) {
/*
*τhis is not the same as above because the data in the temp table is deleted for in database comparisons
*τhi s is to help reduce clutter while increasing search times and reducing the memory load
//$cmpr$ = the comparison ID
//$cmprTo$ = the comparison ID cmpr is currently being compared to
//$lowMass$ = the lower mass bound
//$highMass$ = the higher mass bound
//$minlntensity$ = the minimum intensity range
//$error$ = the error range in ppm (parts per million)
*The Formula used for the comparison is SUM(A+B - [2*ABS(A-B)]) / SUM (A+B) where A and B are the intensities of two seperate data sets to compare
*τhi s gives a range of -1.0 to 1.0 which is then multiplied by 100 to get a percentage
*τhe select statement allows for a multitiude of search options, it deals with correcting error and takes the average of the two masses (which is not used for comparison)
*and combines the two intensities into one row.
String selStr;
//First create the select statement without any values in it //This is the select statement for data within the same table. For MALDI data not in this table a seperate
//Temporary table will be built and joined the same way if (lowerMassBound == 4000 & higherMassBound == 14000) { selStr = "(select (a. mass + b.mass) / 2 mass, a. intensity as 1Ai1, b. intensity as 1Bi1, (SELECT Ai + Bi) as 'score1, (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from maldiTemp a, maldiratl b where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and a. intensity > $minlntensity$ and a. mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$) union (select distinct a. mass, a. intensity as 1Ai1, 0 as 1Bi1, (SELECT Ai + Bi) as 'score1, (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from maldiTemp a where a.maldi_tof_id = $cmpr$ and a. intensity > $minlntensity$ and a. mass between $lowMass$ and $highMass$ and a. mass not in"; selStr += " (select distinct a. mass from maldiratl b where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and b.maldi_tof_id = $cmprTo$ and b.mass between $lowMass$ and $highMass$))" ; selstr += " union (select distinct b.mass, 0 as 1Ai 1 , intensity as 1Bi 1 , (SELECT Ai + Bi) as 'score1 , (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from maldiratl b where b.maldi_tof_id = $cmprTo$ and b. intensity > $minlntensity$ and b.mass between $lowMass$ and $highMass$"; selstr += " and b.mass not in (select b.mass from maldiTemp a where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and a. intensity > $minlntensity$ and a.maldi_tof_id = $cmpr$ and a. mass between $lowMass$ and $highMass$))" ; } else { selstr = "(select (a. mass + b.mass) / 2 mass, a. intensity as 1Ai1, b. intensity as 1Bi1, (SELECT Ai + Bi) as 'score1, (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from maldiTemp a, maldiτemp2 b where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and a. intensity > $mi nlntensi ty$ and a. mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$) union (select distinct a. mass, a. intensity as 1Ai1, 0 as 1Bi1, (SELECT Ai + Bi) as 'score1, (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from maldiTemp a where a.maldi_tof_id = $cmpr$ and a. intensity > $mi nlntensi ty$ and a. mass between $lowMass$ and $highMass$ and a. mass not in"; selstr += " (select distinct a. mass from maldiτemp2 b where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and b.maldi_tof_id = $cmprTo$ and b.mass between $lowMass$ and $highMass$))" ; selstr += " union (select distinct b.mass, 0 as 'Ai ' , intensity as 'Bi ' , (SELECT Ai + Bi) as 'score' , (SELECT score - (ABS(Ai - Bi) * 2.0)) as 'score2' from maldiτemp2 b where b.maldi_tof_id = $cmprTo$ and b.intensity > $minlntensity$ and b.mass between $lowMass$ and $highMass$"; selstr += " and b.mass not in (select b.mass from maldiTemp a where a. mass between (b.mass - (b.mass * $error$)) and (b.mass + (b.mass * $error$)) and a. intensity > $mi nlntensi ty$ and a.maldi_tof_id = $cmpr$ and a. mass between $lowMass$ and $highMass$))" ; selstr = selstr . replace("$lowMass$" , Integer . toString(lowerMassBound)) ; selstr = selstr . replace("$highMass$" , Integer . toString(higherMassBound)) ; selstr = selstr . replace("$minlntensity$" , integer . toString(intensityBound)) ;
//Convert ppm to a percentage and replace it everywhere double mErr = error/1000000.0; selstr = selstr . replace("$error$" , Double. toString(mErr)) ;
//Since this is the tempTable the ID is always 0 return selstr;
} public boolean changePassowrd(String newpwd) { try {
String mySQL = "SET PASSWORD = PASSWORD('"; mySQL = mySQL. concat(newpwd) ; mySQL = mySQL. concat("')"); stmt = myConn.createStatementO ; stmt.executeUpdate(mySQL) ; password = newpwd; return true; } catch (SQLException e) { e. printStackTraceO ; return false; } catch (Exception e) { e. printStackTraceO ; return false; }
} public void deleteMaldiTempData(int tmpID, String tmpTable) { try { stmt = myConn.createStatementO; stmt.executeUpdate("DELETE FROM " + tmpTable + " WHERE maldi_tof_id = " + tmpID) ;
} catch (SQLException e) {
} catch (Exception e) { }
} public dbAccessO { myConn = null ; SQLQuery= "";
public int dbCloseO { if (myConn != null) { try {myConn. cl ose ();} catch(Exception e) {e. printStackTraceO ; } return 0; } public int dbConnectO {
String url = "jdbc:mysql : //local host: 3306/psm" ; try {
Class.forNameC'com.mysql . jdbc. Driver") ; myConn = DriverManager .getConnection(url , username, password); if(myConn != null){ if (username. compareTo("rmandrell ") == 0 | username. compareTo("psmlogin") == 0) {
SQLQuery = "SELECT DISTINCT sampl e . sampl e_i d ,
CONCAT(i denti fier.i dent, sample. number) , sample. date, concat_ws(' ' , genus. name, species. name, subspecies. name, subtype. name) , sample. notes, sample. history, sampl e . tentati ve_gen us , sampl e . tentati ve_speci es , sampl e . tentati ve_subspeci es , sample. tentati ve_subtype FROM identifier, sample, strain, genus, species, subspecies, subtype WHERE strain. genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND sample. strain_id = strain. strain_id AND identifier .i denti fier_id = sampl e. i denti f i er_i d" ; } else {
SQLQuery = "SELECT DISTINCT sampl e . sampl e_i d ,
CONCAT(i denti fier.i dent, sample. number) , sample. date, concat_ws(' ' , genus. name, species. name, subspecies. name, subtype. name) , CASE WHEN sample. notes LIKE '%CONFIDENTIAL%' THEN 'CONFIDENTIAL See Rob Mandrel 1 before using1 ELSE sample. notes END, sample. history, sample. tentati ve_genus, sample. tentati ve_species, sample. tentati ve_subspecies, sample. tentati ve_subtype FROM identifier, sample, strain, genus, species, subspecies, subtype WHERE strain. genus_id = genus. genus_id AND strai n. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND sample. strai n_id = strain. strai n_id AND identifier .i denti fier_id = sampl e.i denti f i er_i d" ; return 0; } else { return 3;
}
} catch (SQLException e) { return 1; } catch ( Exception e) { return 2; } public int dbConnect(String db) {
String url = "jdbc:mysql ://localhost: 3306/" + db; try {
Class.forNameC'com.mysql .jdbc. Driver") ; myConn = DriverManager .getConnection(url , username, password); if(myConn != null){ if (username. compareTo("rmandrell ") == 0 | username. compareTo("psmlogin") == 0) {
SQLQuery = "SELECT DISTINCT sampl e . sampl e_i d ,
CONCAT(i dentifier.i dent, sample. number) , sample. date, concat_ws(' ' , genus. name, species. name, subspecies. name, subtype. name) , sample. notes, sample. history, sampl e . tentati ve_gen us , sampl e . tentati ve_speci es , sampl e . tentati ve_subspeci es , sample. tentati ve_subtype FROM identifier, sample, strain, genus, species, subspecies, subtype WHERE strain. genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND sample. strain_id = strain. strain_id AND identifier .i denti fier_id = sampl e. i denti f i er_i d" ; } else {
SQLQuery = "SELECT DISTINCT sampl e . sampl e_i d ,
C0NCAT(i dentifier.i dent, sample. number) , sample. date, concat_ws(' ' , genus. name, species. name, subspecies. name, subtype. name) , CASE WHEN sample. notes LIKE '%CONFIDENTIAL%' THEN 'CONFIDENTIAL See Rob Mandrel 1 before using1 ELSE sample. notes END, sample. history, sample. tentati ve_genus, sample. tentati ve_species, sample. tentati ve_subspecies, sample. tentati ve_subtype FROM identifier, sample, strain, genus, species, subspecies, subtype WHERE strain. genus_id = genus. genus_id AND strai n. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND sample. strai n_id = strain. strai n_id AND identifier .i denti fier_id = sampl e.i denti f i er_i d" ; return 0; } else { return 3;
}
} catch (SQLException e) { return 1; } catch ( Exception e) { return 2; }
public int dumpMALDIDataToTemp(int maldiid, int intensity, int lmass, int hmass, String tmpTable) { int id; try {
//FIRST cleanup the table, delete anything that is more than a day old stmt = myConn.createStatementO ; stmt.executeUpdate("DELETE FROM malditemp WHERE createdTime <
DATE_ADD(CURRENT_TIMESTAMP, INTERVAL -30 MINUTE)"); stmt = myConn.createStatementO; stmt.executeUpdate("DELETE FROM malditemp2 WHERE createdTime <
DATE_ADD(CURRENT_TIMESTAMP, INTERVAL -30 MINUTE)");
//set then get the last ID used stmt = myConn.createStatementO; stmt.executeUpdateC'UPDATE lastidused set id = id + 1 WHERE description = 'maldi';"); java.sql .ResultSet myRS = getRS("SELECT id FROM lastidused WHERE description =' maldi1"); myRS. next O ; id = myRS.getlntC'id"); myRS. closet) ; stmt = myConn.createStatementO;
//WE only want to insert the data we are going to use, so only insert data with the proper ranges
String maxStr = "SELECT intensity FROM maldi _tof_data where maldi_tof_id = " + maldiid + " AND mass BETWEEN " + lmass + " AND " + hmass + " ORDER BY intensity DESC Limit 1"; String templlnStr = ""; if (tmpTable.compareTo("malditemp") == 0) { templlnStr = "INSERT INTO " + tmpTable + " (SELECT * FROM (SELECT " + id + " as 'maldi^of^d' , mass, (intensity * 100 / (" + maxStr + ")) as 'intensity1 , CURRENT_TIMESTAMP FROM maldi_tof_data where maldi_tof_id = " + maldiid + " AND mass between " + lmass + " AND " + hmass + ") m WHERE intensity > " + intensity + ")";
} else if (tmpTable. compareTo("malditemp2") == 0) { templlnStr = "INSERT INTO " + tmpTable + " (SELECT * FROM (SELECT " + id + " as 'maldi_tof_id' , mass, (intensity * 100 / (" + maxStr + ")) as 'intensity1 , CURRENT_TIMESTAMP FROM maldi_tof_data where maldi_tof_id = " + maldiid + " AND mass between " + lmass + " AND " + hmass + ") m WHERE intensity > " + intensity + ")"; } s tmt.executeUpdate (templlnStr) ; stmt.closeO ; } catch (SQLException e) { return 0; } catch (Exception e) { return 0; } return id;
public int dumpINSILICODataToTemp(int insilicoid, int intensity, int lmass, int hmass, String tmpTable, String residue) { int id; try {
//FIRST cleanup the table, delete anything that is more than a day old stmt = myConn.createStatementO ; stmt.executeUpdate("DELETE FROM malditemp WHERE createdTime <
DATE_ADD(CURRENT_TIMESTAMP, INTERVAL -30 MINUTE)");
//FIRST cleanup the table, delete anything that is more than a day old stmt = myConn.createStatementO; stmt.executeUpdateC'DELETE FROM malditemp2 WHERE createdTime <
DATE_ADD(CURRENT_TIMESTAMP, INTERVAL -30 MINUTE)");
//set then get the last ID used stmt = myConn.createStatementO; stmt.executeUpdateC'UPDATE lastidused set id = id + 1 WHERE description = 'maldi ' ;"); java.sql .ResultSet myRS = getRS("SELECT id FROM lastidused WHERE description =' maldi 1"); myRS. next O ; id = myRS.getlntC'id"); myRS.closeO ; stmt = myConn.createStatementO;
String templlnStr = ""; if (tmpTable.compareTo("malditemp") == 0) { templlnStr = "INSERT INTO " + tmpTable + " (SELECT " + id + " as 'in_silico_id' , mass, intensity, CURRENT_TIMESTAMP FROM in_silico_data where in_silico_id = " + insilicoid + " AND mass between " + lmass + " AND " + hmass + J J
} else if (tmpTable. compareTo("malditemp2") == 0) { templlnStr = "INSERT INTO " + tmpTable + " (SELECT " + id + " as 'in_silico_id' , mass, intensity, CURRENT_TIMESTAMP FROM in_silico_data where in_silico_id = " + insilicoid + " AND mass between " + lmass + " AND " + hmass; if (residue. length O > 0) { templlnStr += " AND ("; for (int v = 0; v < residue.length() ; v++) { tempi InStr += "in_si"lico_data. residue LIKE '%" + residue.charAt(v) + "%'"; if (v != (residue. lengthO - I)) { tempi InStr += " OR ";
} templlnStr += ")";
tempi InStr += ")";
} stmt.executeUpdate (templlnStr) ; stmt.closeO ; } catch (SQLException e) { return 0; } catch (Exception e) { return 0;
} return id;
} public int dumpMSMSDataToTemp(int msmsid, int intensity, int lmass, int hmass, String tmpTable) { int id; try {
//FIRST cleanup the table, delete anything that is more than a day old stmt = myConn.createStatementO ; stmt.executeUpdate("DELETE FROM malditemp WHERE createdTime <
DATE_ADD(CURRENT_TIMESTAMP, INTERVAL -30 MINUTE)");
//FIRST cleanup the table, delete anything that is more than a day old stmt = myConn.createStatementO; stmt.executeUpdate("DELETE FROM malditemp2 WHERE createdTime <
DATE_ADD(CURRENT_TIMESTAMP, INTERVAL -30 MINUTE)");
//set then get the last ID used stmt = myConn.createStatementO; stmt.executeUpdateC'UPDATE lastidused set id = id + 1 WHERE description = 'maldi ' ;"); java.sql .ResultSet myRS = getRS("SELECT id FROM lastidused WHERE description =' maldi 1"); myRS. next O ; id = myRS.getlntC'id"); myRS.closeO ; stmt = myConn.createStatementO;
//WE only want to insert the data we are going to use, so only insert data with the proper ranges
String maxStr = "SELECT intensity FROM ms_ms_data where ms_ms_id = " + msmsid + " AND mass BETWEEN " + lmass + " AND " + hmass + " ORDER BY intensity DESC Limit 1";
String templlnStr = ""; if (tmpTable.compareTo("malditemp") == 0) { templlnStr = "INSERT INTO " + tmpTable + " (SELECT * FROM (SELECT " + id + " as 'ms_ms_id', mass, (intensity * 100 / (" + maxStr + ")) as 'intensity1, CURRENT_TIMESTAMP FROM ms_ms_data where ms_ms_id = " + msmsid + " AND mass between " + lmass + " AND " + hmass + ") m WHERE intensity > " + intensity + ")";
} else if (tmpTable. compareTo("malditemp2") == 0) { templlnStr = "INSERT INTO " + tmpTable + " (SELECT * FROM (SELECT " + id + " as 'ms_ms_id', mass, (intensity * 100 / (" + maxStr + ")) as 'intensity1, CURRENT_TIMESTAMP FROM ms_ms_data where ms_ms_id = " + msmsid + " AND mass between " + lmass + " AND " + hmass + ") m WHERE intensity > " + intensity + ")";
} stmt.executeUpdate (tempi InStr) ; stmt.closeO ; } catch (SQLException e) { return 0; } catch (Exception e) { return 0;
} return id;
} public int executeString(String myString) { try { stmt = myConn.createStatementO ; stmt.executeUpdate(myString) ; stmt. close() ; } catch (SQLException e) { return 1; } catch (Exception e) { return 2; } return 0; } public int findAndReplace(int 1 Range, int hRange, String strReplace, String strwith, int ident, String autolncStr, int inStart, int genus, int species, int subspecies, int other, String rdate) {
//Find and replace searches through a list of identifier numbers and replaces occurances of the strReplace string with the strwith String //This function also supports comma delimited lists, try { int i=0;
String selStr = "SELECT * FROM sample WHERE number BETWEEN " + 1 Range + " AND " + hRange + " AND notes LIKE '%" + strReplace + "%' and identifier_id = " + ident + " ORDER BY number ASC";
Java. sql . ResultSet myRS = getRS(selStr) ;
String [] replLst = strwith. split(" ,"); int[] smplids = new int[replLst. length] ;
Figure imgf000357_0001
replace then there are items in the list thten use the last item in the list int z = 0; while (myRS. next ()) {
String getRepl = myRS.getString("notes") ; int mid;
String mRepl = replLst[z] ; if (autolncStr != "" && autolncStr != null) { mRepl = mRepl . replace(autolncStr, Integer. toString((i + inStart)));
} getRepl = getRepl . replace(strReplace, mRepl); mid = myRS.getInt("sample_id") ; smplids[z] = mid;
//myRS.closeO ; stmt = myConn.createStatementO ; if (rdate != "") { stmt.executeUpdateC'UPDATE sample set notes = '" + getRepl + 111 , date = '" + rdate + "' WHERE sample_id = " + mid);
} else { stmt.executeUpdateC'UPDATE sample set notes = '" + getRepl + 111 WHERE sample_id = " + mid);
} i++;
//Increase z until it hits the last item in the array, if (z < repl Lst. length - 1) { z++;
} myRS.closeO ;
//Check and see if the strain needs to be updated. These will all be zero if no update d , s. sm.
Figure imgf000358_0001
int strainID;
//Next we need to get the strain id
String slctStrain = "SELECT strain_id FROM strain WHERE genus_id=" + genus + " AND species_id=" + species + " AND subspecies_id=" + subspecies + " AND subtype_id=" + other; myRS = getRS(slctStrain) ; if (myRS. next ()) { //the strain already exists, use this id strainID = myRS.getInt("strain_id") ; } else {
//the strain does not exist, make a new one and use the new id myRS. close () ;
//Insert the strain ID, now get it the same way as above
String insrtStrain; insrtStrain = "INSERT INTO strain (genus_id, species_id, subspecies_id, subtype_id) VALUES(" + genus + "," + species + "," + subspecies + "," + other +")"; stmt . executeUpdate(i nsrtStrai n) ; stmt.closeO ; myRS = getRS(slctStrain) ; myRS. next O ; strainID = myRS.getInt("strain_id") ;
myRS.closeO ; stmt = myConn.createStatementO ; stmt.executeUpdateC'UPDATE sample SET strain_id = " + strainID + " WHERE sample_id = " + smplids[z2]) ;
} return i ; } catch (SQLException e) { return 0; } catch (Exception e) { return 0; } public int findAndReplaceAppend(int 1 Range, int hRange, String strwith, int ident, String autolncStr, int inStart, int append, int genus, int species, int subspecies, int other, String rdate) {
//Find and replace searches through a list of identifier numbers and replaces occurances of the strReplace string with the strwith String //This function also supports comma delimited lists, try { int i=0; int[] smplids = new int [hRange - 1 Range + I] ;
String selStr = "SELECT * FROM sample WHERE number BETWEEN " + 1 Range + " AND " + hRange + " AND identifier_id = " + ident + " ORDER BY number ASC"; java.sql .ResultSet myRS = getRS(selStr) ;
String [] replLst = strwith. split(" ,");
//if replLst onoly has one item then there is no list if (replLst. length == 1 | | replLst == null) { while (myRS. next ()) {
String getRepl = myRS.getString("notes") ; smplidsti] = myRS.getlnt("sampϊe_id") ;
String mRepl = strwith; if (autolncStr != "" && autolncStr != null) { mRepl = mRepl . replace(autolncStr, Integer .toString((i + inStart)));
} int mid; mid = myRS.getInt("sample_id") ; if (append ==0) { getRepl += mRepl ; } else { getRepl = mRepl + getRepl ;
stmt = myConn.createStatementO ; if (rdate != "") { stmt.executeUpdateC'UPDATE sample set notes = '" + getRepl + 111 , date = '" + rdate + '" WHERE sample_id = " + mid);
} else { stmt.executeUpdateC'UPDATE sample set notes = '" + getRepl + 111 WHERE sample_id = " + mid); i++; } myRS.closeO ;
//Check and see if the strain needs to be updated. These will all be zero if no update if ((genus + species + subspecies + other) > 0) { for (int z=0; z < smplids. length; z++) {
String getstrf romSmpl = SELECT s.genus_id , s.species_id , s. subspecies_id, s.subtype_id FROM sample sm, strain s WHERE s.strain_id = sm.strain_id AND sm. sample_id = " + smplids[z] ; myRS = getRS(getStrfromSmpl) ; myRS. next O ; if (genus == 0) { genus = myRS.getlnt("genus_id") ; if (species == 0) { species = myRS.getlnt("species_id") ; if(subspecies == 0) { subspecies = myRS.getlnt("subspecies_id") ; if(other == 0) { other = myRS.getlnt("subtype_id") ; int strainID;
//Next we need to get the strain id
String slctStrain = "SELECT strain_id FROM strain WHERE genus_id=" + genus + " AND species_id=" + species + " AND subspecies_id=" + subspecies + AND subtype_id=" + other; myRS = getRS(slctStrain) ; if (myRS. next Q) {
//the strain already exists, use this id strainID = myRS.getInt("strain_id") ; } else {
//the strain does not exist, make a new one and use the new id myRS.closeO ;
//Insert the strain ID, now get it the same way as above
String insrtStrain; insrtStrain = "INSERT INTO strain (genus_id, species_id, subspecies_id, subtype_id) VALUESC" + genus + "," + species + "," + subspecies + "," + other +")"; stmt . executeUpdate(i nsrtStrai n) ; stmt. close () ; myRS = getRS(slctStrain) ; myRS. nextO ; strainID = myRS.getInt("strain_id") ;
myRS. close () ; stmt = myConn.createStatementO ; stmt.executeUpdateC'UPDATE sample SET strain_id = " + strainID + " WHERE sample_id = " + smplids[z]);
} return i ; } catch (SQLException e) { return 0; } catch (Exception e) { return 0;
} public ArrayList getAllMalch'DataID(String andor, String ident. String rmLo, String rmHi , String Genus, String Species, String Subspecies, String Subtype, String notes, String History, String mdate) {
ArrayList maldild = new ArrayListO;
//Fi rst connect to the database dbConnectO ;
//Now get all the maldi_tof_ids that are in the maldi_tof_data table
String selStr; if (mdate != "") { selStr = "SELECT DISTINCT a. mal di_tof_i d FROM maldi_tof_data a, maldi_tof b WHERE a.maldi_tof_id = b.maldi_tof_id AND b.date >= '" + mdate + '" AND b.sample_id in (";
} else { selStr = "SELECT DISTINCT a. mal di_tof_i d FROM maldi_tof_data a, maldi_tof b WHERE a.maldi_tof_id = b.maldi_tof_id AND b.sample_id in ("; if (andor .compareTo("and") == 0) { selStr += runANDSearchStrC" , ident, Genus, Species, Subspecies, Subtype, notes, History, 1, "", 500, "", rmLo, rmHi); } else { selStr += runORSearchStrC" , ident, Genus, Species, Subspecies, Subtype, notes, History, 1, rmLo, rmHi); selStr += ")";
ResultSet myRS = getRS(selStr) ; try { while (myRS. next ()) { maldild. add (new lntege r (myRS. getlnt ("mal di_tof_id"))) ;
//close the result set and connection myRS.closeO ;
} catch (SQLException e) { return null ; } catch (Exception e) { return null ; } dbCloseO;
//Return the array list return maldild;
public ArrayList getAlllnSilicoDataID(String andor. String ident, String Genus, String Species, String Subspecies, String Subtype, String protein, String notes, String mass, String masserror) {
ArrayList insilicoid = new ArrayListO;
//Fi rst connect to the database dbConnect O ;
//Now get al l the mal di_tof_i ds that are i n the mal di_tof_data tabl e
Stri ng sel Str ; if (andor . compareTo("and") == 0) { selStr = runANDlnSilicoSearchStr (ident, Genus, Species, Subspecies, Subtype, protein, notes, mass, masserror); } else { selStr = runORlnSilicoSearchStr (ident, Genus, Species, Subspecies, Subtype, protein, notes, mass, masserror);
ResultSet myRS = getRS(selStr) ; try { while (myRS. next ()) { insilicoid. add (new integer (myRS. getlnt("in_silico_id"))) ;
//close the result set and connection myRS.closeO ;
} catch (SQLException e) { return null ; } catch (Exception e) { return null ; } dbCloseO;
//Return the array list return insilicoid;
} public ArrayList getAllMSMSDataID(String andor, String ident, String Genus, String Species, String Subspecies, String Subtype, String protein, String notes, String mass, String masserror) {
ArrayList msmsid = new ArrayListO;
//Fi rst connect to the database dbConnect O ;
//Now get al l the mal di_tof_i ds that are i n the mal di_tof_data tabl e
Stri ng sel Str ; if (andor .compareTo("and") == 0) { selStr = runANDMSMSSearchStr (ident, Genus, Species, Subspecies, Subtype, protein, notes, mass, masserror); } else { selStr = runORMSMSSearchStr (ident, Genus, Species, Subspecies, Subtype, protein, notes, mass, masserror);
ResultSet myRS = getRS(selStr) ; try { while (myRS. next O) { msmsid. add (new Integer(myRS.getInt("ms_ms_id"))) ;
//close the result set and connection myRS.closeO ; } catch (SQLException e) { return null ; } catch (Exception e) { return null ;
} dbCloseO;
//Return the array list return msmsid; } public ArrayList getMALDILISTWithSQLSel (String mdate, String selStmt) { ArrayList malαild = new ArrayListO; //Fi rst connect to the database dbConnectO ;
//Now get all the maldi_tof_ids that are in the maldi_tof_data table String selStr; if (mdate != "") { selStr = "SELECT DISTINCT a. mal di_tof_i d FROM maldi_tof_data a, maldi_tof b WHERE a.maldi_tof_id = b.maldi_tof_id AND b.date >= '" + mdate + '" AND b.sample_id in ("; } else { selStr = "SELECT DISTINCT a. mal di_tof_i d FROM maldi_tof_data a, maldi_tof b WHERE a.maldi_tof_id = b.maldi_tof_id AND b.sample_id in ("; selStr += selStmt; selStr += ")";
ResultSet myRS = getRS(selStr) ; try { while (myRS. next ()) { mal di id. add (new lntege r (myRS. getlnt ("mal di_tof_id"))) ;
//close the result set and connection myRS.closeO ;
} catch (SQLException e) { return null ; } catch (ExcceeppttiKon e) { return null ;
dbCloseO;
//Return the array list return maldild; } public Java, sql . ResultSet getGenusO { return getRS("SELECT * FROM genus ORDER BY name");
public Java, sql . ResultSet getldentPrefixO { return getRS("SELECT * FROM identifier");
public int getLastllsedStrainNumberO { try {
Java. sql .ResultSet myRS = getRS("SELECT MAX(number) FROM SAMPLE"); myRS. next () ; return myRS.getlnt(l) ; } catch (SQLException e) { return -1; } catch (Exception e) { return -1; } public Java. sql . ResultSet getMaldi (String sampleid) { String mQuery; mQuery = "SELECT * FROM maldi_tof WHERE sample_id ="; mQuery = mQuery. concat(sampl ei d) ; return getRS(mQuery) ;
public Java. sql . ResultSet getMaldiAndSamplelnfo(String maldiid) {
String mQuery; mQuery = "SELECT CONCAT(identifier .ident, sample. number) , maldi_tof .date, maldi_tof . target_spot_number , concat_ws(' ' , genus. name, species. name, subspecies. name, subtype. name) , sample. samp] e_id, sample. notes FROM identifier , sample, maldi_tof, species, strain, genus, subspecies, subtype WHERE maldi_tof . sample_id = sample. sample_id AND strain. genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND identifier .identifier_id = sample. identifier_id AND sample. strain_id = strain. st rain_id AND maldi_tof .maldi_tof_id = "; mQuery = mQuery. concat(mal di i d) ; return getRS(mQuery) ;
public Java. sql . ResultSet getInSilicoAndSamplelnfo(String insilicoid) {
String mQuery; mQuery = "SELECT in_silico. identification, in_silico.date, concat_ws(' ' , genus. name, species. name, subspecies. name, subtype. name) , in_silico. protein, i n_si Ii co. notes , in_silico.average_mw FROM in_silico, species, strain, genus, subspecies, subtype WHERE strain. genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND in_silico. strain_id = strain. strain_id AND i n_silico. i n_silico_id = "; mQuery = mQuery. concat(i nsi 1 i coi d) ; return getRS(mQuery) ;
public Java. sql . ResultSet getMSMSAndSamplelnfo(String msmsid) {
String mQuery; mQuery = "SELECT CONCAT(identifier .ident, sample. number) , ms_ms.date, ms_ms. protein, concat_ws(' ' , genus. name, species. name, subspecies. name, subtype. name) , sample. sample_id, sample. notes, ms_ms. precursor_ion_mtoz FROM identifier , sample, ms_ms, species, strain, genus, subspecies, subtype WHERE ms_ms. sample_id = sample. sample_id AND strain. genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND identifier .identifier_id = sample. identifier_id AND sample. strain_id = strain. st rain_id AND ms_ms.ms_ms_id = "; mQuery = mQuery. concat(msmsi d) ; return getRS(mQuery) ; public Java. sql . ResultSet getINSILICOAndSamplelnfo(String msmsid) {
String mQuery; mQuery = "SELECT in_silico. identification, in_silico.date, in_si Ii co. protein, concat_ws(' ' , genus. name, species. name, subspecies. name, subtype. name) , in_silico.in_silico_id, in_silico. notes, in_silico.aa_seq FROM in_silico, species, strain, genus, subspecies, subtype WHERE strain. genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strai n . subtype_id AND in_silico. strain_id = strain. strain_id AND i n_s i 1 i co . i n_s i 1 i co_i d = " ; mQuery = mQuery. concat(msmsi d) ; return getRS(mQuery) ; } public String [] getMaldiSamplelnfo(String maldiid) {
String mQuery; mQuery = "SELECT CONCAT(identifier.ident, sample. number) , maldi_tof .date, maldi_tof . target_spot_number, concat_ws(' ' , genus. name, species. name, subspecies. name, subtype. name) , sample. samp] e_id, maldi_tof. notes FROM identifier, sample, maldi_tof, species, strain, genus, subspecies, subtype WHERE maldi_tof . sample_id = sample. sample_id AND strain. genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND identifier .identifier_id = sample. identifier_id AND sample. strain_id = strain. st rain_id AND maldi_tof .maldi_tof_id = "; mQuery = mQuery. concat(mal di i d) ;
Java. sql . ResultSet myRS = getRS(mQuery) ;
String [] rmNum = new String[3] ; try { myRS. next O ; rmNum = myRS.getString(l) ; rmNum = myRS.getString(4) ; rmNum = myRS.getString(β) ; } catch (SQLException e) { rmNum[0] = "Not Found"; rmNum[l] = "Not Found";
} return rmNum;
public String [] getMSMSSamplelnfo(String msmsid) { String mQuery; mQuery = "SELECT CONCAT(identifier .ident, sample. number) , ms_ms.date, concat_ws(' ' , genus. name, species. name, subspecies. name, subtype. name) , sample. sample_id, ms_ms. notes FROM identifier , sample, ms_ms, species, strain, genus, subspecies, subtype WHERE ms_ms. sample_id = sample. samp] e_id AND strain. genus_τd = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND identifier .identifier_id = sample. identifier_id AND sample. st rai n_id = strain. strain_id AND ms_ms.ms_ms_id = "; mQuery = mQuery. concat(msmsi d) ;
Java .sql . .RF reessuullttSset myRS = getRS(mQuery) ;
St ri ng[] r -mmNNuumm = = new String[3] ; try { myRS. r lextO; rmNum [0] == r mryRS.getString(l) rmNum "I] == r mryRS.getString(3) rmNum :21 == r mryRS.getString(5)
} catch (SQLException e) { rmNum = "Not Found"; rmNum = "Not Found"; rmNum = "Not Found";
} return rmNum;
} public Java. sql . ResultSet getInSilicoErrorData(int idl, int id2, String intensity, String masserror, String rangeA, String rangeB, String residue) { int maldiTempld = dumpMSMSDataToTemp(idl, Integer . parselnt(intensity) , Integer. parselnt(rangeA) , Integer. parselnt(rangeB) , "malditemp") ; int cmprTold = dumpINSILICODataToTemp(τd2 , Integer . parselnt(i intensity) , Integer . parselnt(rangeA) , Integer . parselnt(rangeB) , "malditemp2" , residue);
String getcmprdata = "SELECT r.insilico, r.x, r. Error, y. residue FROM (SELECT c.insilico, c.msms as x, c.insilico - c.msms as Error FROM (SELECT b.mass as insilico, '' as msms, '' as intensity FROM maldiτemp2 b WHERE b. intensity > $minlntensity$ and b.mass between $lowMass$ and $highMass$ and b.maldi_tof_id = $cmprTo$ AND b.mass not in (SELECT insilico FROM (select b.mass as insilico, a. mass as msms from malch'Temp a, maldiτemp2 b where a. intensity > $minlntensity$ AND b. intensity > $minlntensity$ AND a. mass between (b.mass - $error$) and (b.mass + $error$) and a. mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.ma]di_tof_id = $cmprTo$) t) UNION select b.mass as insilico, a. mass as msms, a. intensity as intensity from maldiTemp a, maldiτemp2 b where a. intensity > $minlntensity$ AND b. intensity > $minlntensity$ AND a. mass between (b.mass - $error$) and (b.mass + $error$) and a. mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$ order by insilico) as c where c. msms != ' ') r, in_silico_data y WHERE r. insilico = y.mass AND y.in_silico_id = $id2$" getcmprdata getcmprdata. replace("$minlntensity$" , intensity) ; getcmprdata getcmprdata. replace("$error$" , masserror) ; getcmprdata getcmprdata. replace("$lowMass$" , rangeA) ; getcmprdata getcmprdata. replace("$highMass$" , rangeB) ; getcmprdata getcmprdata. replace("$cmpr$" , Integer . toSt ring (maldiTempld)) ; getcmprdata getcmprdata. replace("$cmprTo$" , Integer . toSt ring (cmprTold)) ; getcmprdata getcmprdata . repl ace ("$i d2$" , Integer . toSt ri ng (i α2) ) ; retu rn getRS(getcmprdata) ;
publ i c J ava . sql . Resul tSet getmsi l i coMSMSMatchedData(i nt iiddll,, iinntt iidd22,, String Ξnsi ty , Stri ng masserror , Stri ng rangeA , Stri ng rangeB , Stri ng resi due) { int maldiTempld = dumpMSMSDataToTemp(idl, Integer . parselnt(intensity) , Integer. parselnt(rangeA) , Integer. parselnt(rangeB) , "malditemp") ; int cmprTold = dumpINSILICODataToTemp(τd2 , Integer . parselnt(i intensity) , Integer . parselnt(rangeA) , Integer . parselnt(rangeB) , "malditemp2" , residue);
String getcmprdata = "SELECT Round(r .insilico, 1) as insilico,
ROUND(r.msms,,li)) as msms, Round(r .intensity, 1) as intensity, y.iontype, y. residue
FROM (SELECT b.mass as insilico, ' ' as msms, ' ' as intensity FROM maldiτemp2 b WHERE b. intensity > $minlntensity$ and b.mass between $lowMass$ and $highMass$ and b.maldi_tof_id = $cmprTo$ AND b.mass not in (SELECT insilico FROM (select b.mass as insilico, a. mass as msms from maldiTemp a, maldiτemp2 b where a. intensity > $minlntensity$ AND b. intensity > $minlntensity$ AND a. mass between (b.mass - $error$) and (b.mass + $error$) and a. mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b.maldi_tof_id = $cmprTo$) t) UNION select b.mass as insilico, a. mass as msms, a. intensity as intensity from maldiTemp a, maldiτemp2 b where a. intensity > $mi nlntensi ty$ AND b. intensity > $minlntensity$ AND a. mass between (b.mass - $error$) and (b.mass + $error$) and a. mass between $lowMass$ and $highMass$ and b.mass between $lowMass$ and $highMass$ and a.maldi_tof_id = $cmpr$ and b. . maldi_tof_id = $cmprTo$) r, in_silico_data y WHERE r. insilico = y.mass AND y- .in_silico_id = $id2$ ORDER BY intensity DESC, msms DESC"; getcmprdata getcmprdata replace("$mi nlntensi ty$" , intensity) getcmprdata getcmprdata replace("$error$" , masserror); getcmprdata getcmprdata replaceC"■'$lowMass$", rangeA); getcmprdata getcmprdata replaceC'$highMass$", rangeB) getcmprdata getcmprdata replaceC $cmpr$" , Integer .toSt ring (maldiTempld)) ; getcmprdata getcmprdata. replace(" $!cmprTo$" , Integer .toSt π ng (cmprTold)) ; getcmprdata getcmprdata. replace("$id2$", Integer . toSt ring (id2)) ; return getRS(getcmprdata) ;
} publ i c Stri ng [] getInSi l i coSampl elnfo(Stri ng i nsi l i coi d) { Stri ng mQuery ; mQuery = "SELECT i n_si l i co . i denti fi cati on , i n_si l i co . date , concat_ws ( ' genus. name, species. name, subspecies. name, subtype. name) , in_silico. notes FROM identifier, sample, in_silico, species, strain, genus, subspecies, subtype WHERE strain. genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND identifier .identifier_id = sample.identifier_id AND i n_silico. strai n_id = strain. strain_id AND in_silico.in_silico_id = "; mQuery = mQuery.concat(insilicoid) ;
Java. sql . ResultSet myRS = getRS(mQuery) ;
String[] rmNum = new String[3] ; try { myRS. next O ; rmNum = myRS.getString(l) rmNum = myRS.getString(3) rmNum = myRS.getString(4)
} catch (SQLException e) { rmNum = "Not Found"; rmNum = "Not Found"; rmNum = "Not Found";
} return rmNum;
} public iava. sql . ResultSet getMaldiData(String maldiid){
String mdQuery = "SELECT mass, intensity FROM MALDI_TOF_DATA WHERE maldi_tof_id = "; mdQuery = mdQuery. concat(mal di i d) ; return getRS(mdQuery) ;
public Java. sql . ResultSet getMSMS(String sampleid) { String mQuery; mQuery = "SELECT * FROM ms_ms WHERE sample_id =" ; mQuery = mQuery. concat(sampl ei d) ; return getRS(mQuery) ;
public Java. sql . ResultSet getMSMSData(String msmsid){
String mdQuery = "SELECT mass, intensity FROM ms_ms_data WHERE ms_ms_id = "; mdQuery = mdQuery. concat(msmsi d) ; return getRS(mdQuery) ;
public Java. sql .ResultSet getINSILICOData(String insilicoid){
String mdQuery = "SELECT mass, intensity FROM in_silico_data WHERE in_silico_id = "; mdQuery = mdQuery. concat(i nsi 1 i coi d) ; return getRS(mdQuery) ;
public Java. sql . ResultSet getTempMaldiData(String maldiid){
String mdQuery = "SELECT mass, intensity FROM maldiTemp WHERE maldi_tof_id = mdQuery = mdQuery. concat(mal di i d) ; return getRS(mdQuery) ;
public Java. sql . ResultSet getMaldiGraphData(String maldiid, int rangeA, int rangeB){
String subStr = "SELECT MAX(intensity) FROM maldi_tof_data WHERE maldi_tof_id = " + maldiid + " AND mass BETWEEN " + rangeA + " AND " + rangeB;
String mdQuery = "SELECT mass, (intensity * 100 / (" + subStr + ")) as 'intensity' FROM MALDI_TOF_DATA WHERE maldi_tof_id = "; mdQuery = mdQuery + maldiid; mdQuery = mdQuery. concat(" AND mass BETWEEN '"); mdQuery = mdQuery + rangeA; mdQuery = mdQuery.concat(" ' AND '"); mdQuery = mdQuery + rangeB + "' ORDER BY intensity DESC;"; return getRS (mdQuery) ;
public Java. sql . ResultSet getMSMSGraphData(String msmsid, int rangeA, int rangeB){
String subStr = "SELECT MAX(intensity) FROM ms_ms_data WHERE ms_ms_id = " + msmsid + " AND mass BETWEEN " + rangeA + " AND " + rangeB;
String mdQuery = "SELECT ROUND(mass, 1) mass, (intensity * 100 / (" + subStr + ")) as 'intensity' FROM ms_ms_pATA WHERE ms_ms_id = "; mdQuery = mdQuery + msmsid; mdQuery = mdQuery. concat(" AND mass BETWEEN '"); mdQuery = mdQuery + rangeA; mdQuery = mdQuery. concat(" ' AND '"); mdQuery = mdQuery + rangeB + "' ORDER BY intensity DESC;"; return getRS(mdQuery) ;
public Java. sql . ResultSet getINSILICOGraphData(String insilicoid, int rangeA, int rangeB) {
String mdQuery = "SELECT ROUND(mass, 1) mass, intensity FROM in_silico_DATA WHERE in_silico_id = "; mdQuery = mdQuery + insilicoid; mdQuery = mdQuery. concat(" AND mass BETWEEN '"); mdQuery = mdQuery + rangeA; mdQuery = mdQuery. concat(" ' AND '"); mdQuery = mdQuery + rangeB + "'"; return getRS(mdQuery) ;
public Java. sql . ResultSet getINSILICOGraphData(String insilicoid, int rangeA, int rangeB, String residue){
String mdQuery = "SELECT ROUND(mass, 1) mass, intensity FROM in_silico_DATA WHERE in_silico_id = "; mdQuery = mdQuery + insilicoid; mdQuery = mdQuery. concat(" AND mass BETWEEN '"); mdQuery = mdQuery + rangeA; mdQuery = mdQuery. concat(" ' AND '"); mdQuery = mdQuery + rangeB + "'"; if (residue. lengthO > 0) { mdQuery += " AND ("; for (int i = 0; i < residue.length() ; i++) { mdQuery += "residue LIKE '%" + residue. charAt(i) + "%'"; if(i != (residue. lengthO - I)) { mdQuery += " OR ";
} mdQuery += ")";
} return getRS(mdQuery) ; publ i c Java. sql . Resul tSet getMal di GraphSubtracti onData(Stri ng mal di i dl, Stri ng mal di i d2 , i nt rangeA, i nt rangeB , i nt error) {
Stri ng subStr = "SELECT MAX(i ntensi ty) FROM mal di_tof_data WHERE mal di_tof_i d = " + mal di i dl + " AND mass BETWEEN " + rangeA + " AND " + rangeB ;
String sQuery = "SELECT mass, (intensity * 100 / (" + subStr + ")) as 'intensity' FROM maldi_tof_data where maldi_tof_id = $idl$ and mass not in (select a. mass mass from maldi_tof_data a, maldi_tof_data b where a. mass between (b.mass - (b.mass * ($error$))) and (b.mass + (b.mass * ($error$))) and a. mass between $rangeA$ and $rangeB$ and b.mass between $rangeA$ and $rangeB$ and a.maldi_tof_id = $idl$ and b.maldi_tof_id = $id2$) and mass between $rangeA$ and $rangeB$ ORDER by intensity DESC"; sQuery = sQuery. replace("$idl$" , maldiidl); sQuery = sQuery. replace("$id2$" , maldiid2); sQuery = sQuery. replace("$rangeA$" , Integer . toString(rangeA)) ; sQuery = sQuery. replace("$rangeB$" , Integer . toString(rangeB)) ; double perror = error/1000000.0; sQuery = sQuery. replace("$error$" , Double. toString(perror)) ; return getRS(sQuery) ; public Java. sql . ResultSet getMSMSGraphSubtractionData(String msmsidl, String msmsid2, int rangeA, int rangeB, String error) {
String subStr = "SELECT MAX(intensity) FROM ms_ms_data WHERE ms_ms_id = " + msmsidl + " AND mass BETWEEN " + rangeA + " AND " + rangeB;
String sQuery = "SELECT mass, (intensity * 100 / (" + subStr + ")) as 'intensity' FROM ms_ms_data where ms_ms_id = $idl$ and mass not in (select a. mass mass from ms_ms_data a, ms_ms_data b where a. mass between (b.mass - $error$) and (b.mass + $error$) and a. mass between $rangeA$ and $rangeB$ and b.mass between $rangeA$ and $rangeB$ and a.ms_ms_id = $idl$ and b.ms_ms_id = $id2$) and mass between $rangeA$ and $rangeB$ ORDER by intensity DESC"; sQuery = sQuery. replace("$idl$" , msmsidl); sQuery = sQuery. replace("$id2$" , msmsid2); sQuery = sQuery. replace("$rangeA$" , Integer . toString(rangeA)) ; sQuery = sQuery. replace("$rangeB$" , Integer . toString(rangeB)) ; sQuery = sQuery. replace("$error$" , error); return getRS(sQuery) ; public Java. sql . ResultSet getTempMaldiGraphData(String maldiid, int intensityA, int intensityB){
String subStr = "SELECT MAX(intensity) FROM maldiTemp WHERE maldi_tof_id = " + maldiid + " AND mass BETWEEN " + intensityA + " AND " + intensityB;
String mdQuery = "SELECT mass, (intensity * 100 / (" + subStr + ")) as 'intensity' FROM maldiTemp WHERE maldi_tof_id = "; mdQuery = mdQuery + maldiid; mdQuery = mdQuery. concat(" AND mass BETWEEN '"); mdQuery = mdQuery + intensityA; mdQuery = mdQuery. concat(" ' AND '"); mdQuery = mdQuery + intensityB + "' ORDER BY intensity DESC;"; return getRS(mdQuery) ;
public int getLocationID(String location) {
String selStr = "SELECT location_id FROM location WHERE name = '" + location
+ ; if (location. compareToC") == 0) { selStr = "SELECT location_id FROM location WHERE name is null"; }
int id; try {
ResultSet myRS = getRS(selStr) ; if (myRS !=null && myRS. next ()) { id = myRS.getlnt("location_id"); myRS. close O ; stmt.closeO ; return id; } else { if (myRS != null) {myRS.closeO ; } if (location. compareToC") == 0) { executeStringC'lNSERT INTO location(name) VALUES(null)") ; } else { executeStringC'lNSERT INTO location(name) VALUESC" + location
+"')"); myRS = getRS(selStr) ; myRS. next() ; id = myRS.getlnt(""location_id"); myRS. close O ; stmt.closeO ; return id; }
} catch (SQLException e) { return 0;
} public String getPasswordO { return password;
public Java. sql . ResultSet getRS(String myStmt) {
//Handles all necessarry code for creating a record set
Java. sql . ResultSet myRS; myRS = null ;
//Exit out if there is no connection if (myConn == null) {return null ;} try { stmt = myConn.createStatement(ResultSet. FETCH_FORWARD, Resul tSet . CONCUR_UPDATABLE) ; myRS = stmt.executeQuery(myStmt) ;
}catch (SQLException e) { e. printStackTraceO ; }catch (Exception e) { e. printStackTraceO ; }finally { if (myRS!=null) { return myRS;
}else { return null ;
}
} public int getSampleIDFromldent(int num, int ident) { try {
Java. sql .ResultSet myRS = getRS("SELECT sample_id FROM sample WHERE number = " + num + " AND identifier_id = " + ident); myRS. next () ; return myRS.getInt("sample_id") ; } catch (SQLException e) { return 0; } catch (Exception e) { return 0; } } public Java, sql . ResultSet getSpeciesQ { return getRS("SELECT * FROM species ORDER BY name");
public Java, sql . ResultSet getSubSpeciesQ { return getRS("SELECT * FROM subspecies ORDER BY name");
public Java. sql . ResultSet getSubτype() { return getRS("SELECT * FROM subtype ORDER BY name");
public String getllsernameO { return username; } public int insertMSMS (String identNum, String mdate. String precionmass, String notes, String protein, ArrayList mz, ArrayList intensity) {
//Fist check that the identification number exists String slctStr = "SELECT sample. sample_id, CONCAT(identifier .ident, sample. number) FROM identifier, sample WHERE identifier.identifier_id = sample. identifier_id AND CONCAT(identifier .ident, sample. number) = '" + identNum "+" , int sampleid, msmsid;
ResultSet myRS = getRS(slctStr) ; try { if (myRS. next ()) { sampleid = myRS.getlnt("sample_id") ; } else { return 1; } myRS.closeO ;
precu 1",1"
Figure imgf000371_0001
for (int i=0; i < mz.sizeO; i++) {
String tempi InStr = "INSERT INTO ms_ms_data (ms_ms_id, mass, intensity) VALUES("; tempi InStr += msmsid + "," + mz.get(i) + "," + intensity.get(i) ; tempi InStr += ")"; stmt.executeUpdate (tempi InStr) ;
} catch (SQLException e) { return 9;
} return 0;
} public int insertLocus (String Locus, String Genus, String Species, String Subspecies, String Subtype, String Strain, String Location, String Location2, String Start, String End, String FR, String NT, String AA, String MW, String IEP, String gene, String code, String Cog, String eel, String ec2 , String product, String notes) int g = i nsertNewGenus (Genus) ; int s = insertNewSpecies (Species) ; int sp = insertNewSubspecies(Subspecies) ; int sb = insertNewSubtype(Subtype) ;
String slctStrain = "SELECT strain_id FROM strain WHERE genus_id=" + g + " AND species_id=" + s + " AND subspecies_id=" + sp + " AND subtype_id=" + sb; int strainID; Java. sql . ResultSet myRS; try { myRS = getRS(slctStrain) ; if (myRS != null && myRS. next()) {
//the strain already exists, use this id strainID = myRS.getInt("strain_id") ; myRS. close () ; stmt.closeO ; } else {
//the strain does not exist, make a new one and use the new id if (myRS != null) {myRS.closeO ; }
//Insert the strain ID, now get it the same way as above String insrtStrain; insrtStrain = "INSERT INTO strain (genus_id, species_id, subspecies_id, subtype_id) VALUESC" + g + " , " + s + " , " + sp + " , " + sb +")"; executeString(insrtStrain) ; myRS = getRS(slctStrain) ; myRS. next O ; strainID = myRS.getInt("strain_id") ; myRS.closeO ; stmt.closeO ; } catch (SQLException e) { return 1; }
//Setup for entry into dbase Cog = Cog.replace("COG", ""); gene = gene. replace( , "W1"); product = product. replaceC , "W1"); product = product. replace("\"", "\\\""); product = product. replace("\n" , ""); product = product. replace("\r", ""); if (MW.compareToC'N/A") == 0 | | MW == "") {MW= "null";} if (lEP.compareTo("N/A") == 0 | | IEP == "") (IEP= "null";} if (AA.compareTo("N/A") == 0 | | AA == "") {AA= "null";}
//Get the strain number int 1 = 0;
String ident, num;
Strain = Strain. replace(" ", "");
//Check and See if the first character is a number or alphabet character if (isDigit(Strain.substring(O,l))) {
//The first character is a number, see if there are any Alphabet Characters in the string boolean alphaln = false; for (int i = 0; i < Strain. length Q ; "!++) { if (!isDigit(Strain. substπ ng(i , i+1))) { alphaln = true;
} if (alphaln) { num = "null"; ident = Strain; } else { num = Strain; ident = "null"; }
} else { while ( 1 < Strain. lengthO && ( ! isDigit(Strain. substringO ,1+1)) I Strain. substringO ,1+1). compareTo("0") == O)) { 1++; ident = Strain. substring(0, 1); num = Strain. substring(ϊ) ;
if (num == "" M num.compareToC") == 0) { num = "null"; } int smpllD= 0;
//now check and see if this sample is in the database, if not inser it try {
String selStr = "SELECT sample_id FROM sample, identifier WHERE sample. i denti fie r_id = identifier .identifier_id and CONCAT_WS(' ' , identifier. name, sample. number) = '" + Strain +"'"; myRS = getRS(selStr) ; if (myRS != null && myRS. next ()) { //it exists smpllD = myRS.getInt("sample_id") ; myRS.closeO ; stmt.closeO ; } else {
//it does not exist if (myRS != null ) { myRS.closeO ; stmt.closeO ;}
//Now we need to see if the identifier name exists
String selld; if (ident.compareτo("null") == 0) { selld = "SELECT identifier_id FROM identifier WHERE name is " + ident;
} else { selld = "SELECT identifier_id FROM identifier WHERE name = '" + ident + ;
} myRS = getRS(selld) ; int idlD; if (myRS != null && myRS. next ()) {
//it exists idlD = myRS.getlnt("identifier_id"); myRS.closeO ; } else {
//it doesnt exist if (myRS != null) {myRS.closeO;}
String insidlD; if (ident.compareτo("null") == 0) { insidlD = "INSERT INTO i denti fi er(name) VALUES(" + ident +
} else { insidlD = "INSERT INTO i denti fi er(name) VALUESC" + ident +
n_id, i denti fier_id, number) ";
Figure imgf000373_0001
stmt. close () ; }
} catch (SQLException e) { return 1; }
//the sample is now in the database, insert the locus
String insString; if (notes == null | | notes == "") { insString = "INSERT INTO locus (sample_id, name, location_id, Iocation2_id, start, end, FR, NT, AA1MW, IEP, gene, Code, COG, ECl, EC2 , Product) "; insString += "VALUES(" + smpllD + ",'" + Locus + '"," + getLocationlD(Location) + "," + getLocationID(Location2) + "," + Start + "," + End + "," + FR + "," + NT + "," + AA + "," + MW + "," + IEP + ",'" + gene +
111 ,#CODE#,#COG#,#EC1#,#EC2#, '" + product + + ")";
} else { insString = "INSERT INTO locus (sample_id, name, location_id,
Iocation2_id, start, end, FR, NT, AA1MW, IEP, gene, Code, COG, ECl, EC2 , Product, notes) "; insString += "VALUES(" + smpllD + "," + Locus + '"," + getLocationlD(Location) + "," + getLocationID(Location2) + "," + Start + "," + End + "," + FR + "," + NT + "," + AA + "," + MW + "," + IEP + ",'" + gene + 111 ,#CODE#,#COG#,#EC1#,#EC2#,\"" + product + "\" , '" + notes + '")";
if (code.compareToC"-") == 0 | | code == "") { insString = insString. replace("Code, ", ""); insString = insString. replace("#CODE#, ", ""); } else { insString = insString. replace("#CODE#" , + code + );
if (ecl.compareToC"-") == 0 | | eel == "" | | ecl.compareToC") == 0) { insString = insString. replace("ECl, ", ""); insString = insString. replace("#ECl#, ", ""); } else { insString = insString. replace("#ECl#" , + eel + );
if (ec2.compareTo("-") == 0 | | ec2 == "" | | ec2.compareTo("") == 0) { insString = insString. replace("EC2 ,", ""); insString = insString. replace("#EC2#, ", ""); } else { insString = insString. replace("#EC2#" , + ec2 + );
if (Cog.compareToC"-") == 0 | | Cog == "" | | Cog.compareToC"") == 0) { insString = insString. replaceC'COG, ", ""); insString = insString. replace("#COG#, ", ""); } else { insString = insString. replace("#COG#" , + Cog + );
executeString(insString) ; return 0;
} public int insertMALDI (String identNum, String mdate, String targetnum, String notes, ArrayList mz, ArrayList intensity) {
//Fist check that the identification number exists
String slctStr = "SELECT sample. sample_id, CONCAT(identifier .ident, sample. number) FROM identifier, sample WHERE identifier.identifier_id = sample. identifier_id AND CONCAT(identifier .ident, sample. number) = '" + identNum "+" J int sampleid, maldiid; ResultSet myRS = getRS(slctStr) ; try { if (myRS. next ()) { sampleid = myRS.getlnt("sample_id") ; } else { return 1; } myRS.closeO ;
String insStr = "INSERT INTO MALDI_TOF(sample_id, target_spot_number , notes, date) VALUES(" + sampleid + ",'" + targetnum + " ' , '" + notes + "1,1" + mdate + stmt.executellpdate(insStr, java.sql .Statement. RETURN_GENERATED_KEYS) ; myRS = stmt.getGeneratedKeysO ; myRS. next() ; maldiid = myRS.getlnt(l) ; myRS.closeO ; for (int i=0; i < mz.sizeO; i++) {
String tempi InStr = "INSERT INTO maldi_tof_data (maldi_tof_id, mass, intensity) VALUES("; templlnStr += maldiid + "," + mz.get(i) + "," + intensity. get(i) ; tempi InStr += ")"; s tmt.executeUpdate (templlnStr) ;
//Now make sure this data is normalized and in the maldiratl table //First get the max intensity
Java. sql . ResultSet maxRS = getRS("SELECT max(intensity) as 'intensity' FROM maldi_tof_data WHERE maldi_tof_id = " + maldiid + " AND mass between 4000 AND 14000") ; maxRS. next () ; int maxlnt = maxRS.getInt("intensity") ; maxRS.closeO ;
//now update the inteni sties stmt = myConn.createStatementO ;
String updStr = "insert into maldiratl (SELECT maldi_tof_id, mass, (intensity * 100 / " + maxlnt + ") FROM maldi_tof_data WHERE mass between 4000 and 14000 and maldi_tof_id = " + maldiid + ")"; stmt.executeupdate(updstr) ;
} catch (SQLException e) { return 9;
}
//No MALDIID will be 9 when inserted b/c it already exists return maldiid;
} public int insertINSILICO (String identNum, String Genus, String Species, Strin subspecies, String subtype, String mw, String protein, String notes, ArrayList mz)
//Fist check that the identification number exists
String strainname = Genus + " " + Species + " " + subspecies + " " + subtype; strainname = strainname. trimQ ;
String slctStr = "SELECT strain_id FROM strain WHERE genus_id=" + Genus + " AND species_id=" + Species + " AND subspecies_id=" + subspecies + " AND subtype_id=" + subtype; int strainid, msmsid; ResultSet myRS = getRS(slctStr) ; try { if (myRS. next ()) { strainid = myRS.getInt("strain_id") ; } else {
//the strain does not exist, make a new one and use the new id myRS.closeO ;
//Insert the strain ID, now get it the same way as above String insrtStrain; insrtStrain = "INSERT INTO strain (genus_id, species_id, subspecies_id, subtype_id) VALUES(" + Genus + "," + Species + "," + subspecies + "," + subtype +")"; stmt . executeUpdate(i nsrtStrai n) ; stmt.closeO ; myRS = getRS(slctStr); myRS. next O ; strainid = myRS.getInt("strain_id") ; myRS.closeO ;
String insStr = "INSERT INTO in_silico(date, identification, strain_id, average_mw, protein, notes) VALUES(CURDATEO , 1 " + identNum + '" ," + strainid + "," + mw + ", '" + protein + " ' , '" + notes + "')"; stmt.executeUpdate(insStr, java.sql .Statement. RETURN_GENERATED_KEYS) ; myRS = stmt.getGeneratedKeysO ; myRS. next O ; msmsid = myRS.getlnt(l) ; myRS.closeO ; for (int i=0; i < mz.sizeO; i++) {
String tempi InStr = "INSERT INTO in_silico_data (in_silico_id, mass, intensity) VALUES("; tempi InStr += msmsid + "," + mz.get(i) + ",10O)"; stmt.executeUpdate(templlnStr) ;
} catch (SQLException e) { return 9; } return 0;
} public int insertTempMALDI (ArrayList mz, ArrayList intensity, int lmass, int hmass) { int sampleid, maldiid; int id =0; try {
//FIRST cleanup the table, delete anything that is more than a day old stmt = myConn.createStatementO ; stmt.executeUpdateC'DELETE FROM malditemp WHERE createdTime <
DATE_ADD(CURRENT_TIMESTAMP, INTERVAL -30 MINUTE)");
//set then get the last ID used stmt = myConn.createStatementO; stmt.executeUpdateC'UPDATE lastidused set id = id + 1 WHERE description = 'maldi ' ;"); java.sql .ResultSet myRS = getRS("SELECT id FROM lastidused WHERE description =' maldi 1"); myRS. next O ; id = myRS.getlntC'id"); myRS.closeO ; for (int i=0; i < mz.sizeO; i++) { stmt = myConn.createStatementO ;
String tempi InStr = "INSERT INTO maldiTemp (maldi_tof_id, mass, intensity, createdTime) VALUES("; tempi InStr += Integer. toString(id) + "," + mz.get(i) + "," + intensity. get (i) ; tempi InStr += ", CURRENT_TIMESTAMP)" ; stmt.executeUpdate(templlnStr) ; stmt.closeO ; }
//Now make sure this data is normalized //First get the max intensity
Java. sql . ResultSet maxRS = getRS("SELECT max(intensity) FROM maldiTemp WHERE maldi_tof_id = " + id + " AND mass between " + lmass + " AND " + hmass) ; maxRS. next O ; int maxlnt = maxRS.getlnt(l) ; maxRS.closeO ;
//now update the inteni sties stmt = myConn.createStatementO;
String updStr = "UPDATE maldiTemp set intensity = (intensity * 100 / " + maxlnt + ")"; stmt.executeupdate(updstr) ;
} catch (SQLException e) { return 0; } catch (Exception e) { return 0;
return id; } public int insertNewldentifier (String identifier, String notes) { try {
//First check to see if the name is already in the db ResultSet myRS = getRS("SEl_ECT * FROM identifier WHERE ident = '" + identifier + );
//if it is return the number 3 if (myRS. next O) { myRS.closeO ; return 3;
} myRS.closeO ;
String instStmt; inststmt = "INSERT INTO identifier (ident, notes) VALUESC" + identifier + "', '" + notes +"')"; stmt.executeupdate(inststmt) ; return 0; } catch (SQLException e) { return 1; } catch (Exception e) { return 2;
} public int insertNewGenus(String genusname) { try {
//First check to see if the name is already in the db
ResultSet myRS = getRS("SELECT * FROM genus WHERE name = '" + genusname + );
//if it is return the id if (my RS. next O) { int id = myRS.getlnt("genus_id") ; myRS. close () ; stmt.closeO ; return id;
} myRS. close () ; stmt.closeO ;
String instStmt; instStmt = "INSERT INTO genus (name) VALUESC" + genusname + '")"; stmt = myConn.createStatementO ; stmt.executeupdate(inststmt) ;
ResultSet myrRS = stmt.getGeneratedκeys() ; myrRS. next() ; int id = myrRS. getlnt(l) ; myrRS. closeO ; stmt.closeO ; return id;
} catch (SQLException e) { return -1; } catch (Exception e) { return -1; } } public i { try eady in the db species WHERE name = '" + speciesname
VALUESC" + speciesname + '")"; () ;
} ca } ca
Figure imgf000378_0001
} public int insertNewSubspecies (String subspeciesname) { try {
//First check to see if the name is already in the db ResultSet myRS = getRS("SEl_ECT * FROM subspecies WHERE name = '" + subspeciesname + "'");
//if it is return the id if (myRS. next O) { int id = myRS.getlnt("subspecies_id") ; myRS. close () ; stmt. close O ; return id; } myRS. close () ; stmt. close O ; String instStmt; inststmt = "INSERT INTO subspecies (name) VALUESC " + subspeciesname + stmt = myConn.createStatementO ; stmt.executeupdate(inststmt) ;
ResultSet myrRS = stmt.getGeneratedKeysO ; myrRS. next() ; int id = myrRS. getlnt(l) ; myrRS. closeO ; stmt.closeO ; return id; } catch (SQLException e) { return -1; } catch (Exception e) { return -1;
} public i try eady in the db subtype WHERE name = '" + othername +
VALUESC" + othername + "')"; O;
} ca } ca
Figure imgf000379_0001
} public int insertNewStrain(int ident, int number, String mdate, int genus, int species, int subspecies, int subtype, String notes, String history, int gtent, int sptent, int subtent, int othertent) { int strainID; try {
//First check and make sure that the ident + number does not already exist.
ResultSet myRS = getRS("SEl_ECT * FROM sample WHERE identifier_id = " + ident + " AND number = " + number); if (myRS.nextO) { return 3; notes = notes. replaceC , "W1"); notes = notes. replace("\"", "\\\""); history = history. replace( , "W1"); history = history. replace("\"" , "\\\"");
//Next we need to get the strain id
String slctStrain = "SELECT strain_id FROM strain WHERE genus_id=" + genus + " AND species_id=" + species + " AND subspecies_id=" + subspecies + " AND subtype_id=" + subtype; myRS = getRS(slctStrain) ; if (myRS. next Q) {
//the strain already exists, use this id strainID = myRS.getInt("strain_id") ; } else {
//the strain does not exist, make a new one and use the new id myRS.closeO ;
//Insert the strain ID, now get it the same way as above
String insrtStrain; insrtStrain = "INSERT INTO strain (genus_id, species_id, subspecies_id, subtype_id) VALUES(" + genus + "," + species + "," + subspecies + "," + subtype +")"; stmt . executeUpdate(i nsrtStrai n) ; stmt.closeO ; myRS = getRS(slctStrain) ; myRS. next O ; strainID = myRS.getInt("strain_id") ;
myRS.closeO ;
String insrtSample = ""; insrtSample= "INSERT INTO sample (strain_id, identifier_id, number, notes, history, date, tentative_genus, tentative_species, tentative_subspecies, tentative_subtype) VALUESC" + strainID + "," + ident + "," + number + ","; if (notes == "") { insrtSample = insrtSample + "null,"; } else { insrtSample = insrtSample + "'" + notes + "',"; if (history == "") { insrtSample = insrtSample + "null ,"; } else { insrtSample = insrtSample + "'" + history + "' ,"; if (mdate.trimO == "") { insrtSample = insrtSample + "null ,"; } else { insrtSample = insrtSample + "'" + mdate +"' ,"; insrtSample = insrtSample + gtent + "," + sptent + "," + subtent + "," + othertent + ")"; stmt = myConn.createStatementO ; stmt.executeUpdate(insrtSample) ; stmt.closeO ;
//Update teh last update date executeStringC'UPDATE lastupdate SET date=CURRENT_τiMESTAMP") ; return 0; } catch (SQLException e) { return 1; } catch (Exception e) { return 2; } public Java. sql . ResultSet runANDSearch(String sampleid, String identifier,
Stri ng genus, String species, String subspecies, String other, String notes, Str history, String gtent, String sptent, String subtent, String othertent, int maldionly, String mass, int masserror, String minintensity, String lowRM, String highRM) {
String SQLSearchQuery; if (username.compareTo("rmandrell ") == 0 | username.compareTo("psmlogin") ==
0) {
SQLSearchQuery = "SELECT DISTINCT sample. sample_id, CONCAT(identifier .ident, sample. number) 'ident1 , sample. date, genus. name 'genus1 , species. name 'species' , subspecies. name 'subspecies' , subtype. name 'subtype' , sample. notes, sample. history, sample. tentative_genus, sample. tentative_species, sample. tentative_subspecies, sample. tentative_subtype FROM identifier, sample, strain, genus, species, subspecies, subtype WHERE strain. genus_id = genus. genus_id AND strai n. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND sample. strai n_id = strai n . strai n_id AND identifier . identifiers' d = sample. identifier_id" ;
} else {
SQLSearchQuery = "SELECT DISTINCT sample. sample_id,
CONCAT(identifier .ident, sample. number) 'ident' , sample. date, genus. name 'genus' , species. name 'species' , subspecies. name 'subspecies' , subtype. name 'subtype' , CASE WHEN sample. notes LIKE '%CONFIDENTIAL%' THEN 'CONFIDENTIAL See Rob Mandrel 1 before using' ELSE sample. notes END 'notes' , sample. history, sample. tentative_genus, sample. tentative_species, sample. tentative_subspecies, sample. tentative_subtype FROM identifier, sample, strain, genus, species, subspecies, subtype WHERE strai n.genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND sample. strai n_id = strain. strai n_id AND identifier . identifier_id = sample. identifier_id" ;
} if (sampleid == "" & identifier == "" & genus == "" & species == "" & subspecies == "" & other == "" & notes == "" & history == "" & gtent. compareTo("Any") == 0 & sptent. compareTo("Any") == 0 & subtent. compareTo("Any") == 0 & othertent. compareTo("Any") == 0 & maldionly != 1 & mass=="" & (lowRM == "" | highRM == "")) { return getRS(SQLSearchQuery + " ORDER BY identifier .ident, sample. number") ; } else {
String addToQuery = " AND ("; boolean isFirst; isFi rst = true; if (sampleid != "" ) { addToQuery = addToQuery. concat("sample.sample_id LIKE '%"); addToQuery = addToQuery. concat(sampl ei d) ; addToQuery = addToQuery. concat("%'") ; i sFi rst = false; if (identifier != ""){ if (MsFi rst) { addToQuery = addToQuery. concat(" AND ");} addToQuery = addToQuery. concat("CONCAT(identifier .ident, sample. number) LIKE '%"); addToQuery = addToQuery. concat(identifier) ; addToQuery = addToQuery. concat("%'") ; isFirst = false; } if (genus != "" ) { if (HsFi rst) { addToQuery = addToQuery.concat(" AND ");} addToQuery = addToQuery. concat("genus. name LIKE '%"); addToQuery = addToQuery. concat(genus) ; addToQuery = addToQuery. concat("%' "); i sFi rst = false; if (species != "") { if (H sFi rst) { addToQuery = addToQuery. concat(" AND ");} addToQuery = addToQuery. concat("species. name LIKE '%"); addToQuery = addToQuery. concat(speci es) ; addToQuery = addToQuery. concat("%' ") ; i sFi rst = false; if (subspecies != "" ) { if (HsFi rst) { addToQuery = addToQuery. concat(" AND ");} addToQuery = addToQuery. concat("subspecies. name LIKE '%"); addToQuery = addToQuery. concat(subspecies) ; addToQuery = addToQuery. concat("%' ") ; i sFi rst = false; if (other != "") { if (HsFi rst) { addToQuery = addToQuery. concat(" AND ");} addToQuery = addToQuery. concat("subtype. name LIKE '%"); addToQuery = addToQuery. concat(other) ; addToQuery = addToQuery. concat("%' "); i sFi rst = false; } if (notes != "") { if (HsFi rst) { addToQuery = addToQuery. concatC" AND ");} addToQuery = addToQuery. concat("sample. notes LIKE '%"); addToQuery = addToQuery. concat(notes) ; addToQuery = addToQuery. concat("%' "); i sFi rst = false; if (history != "" ) { if (HsFi rst) { addToQuery = addToQuery. concatC AND ");} addToQuery = addToQuery. concat("sample. hi story LIKE '%"); addToQuery = addToQuery. concat(hi story) ; addToQuery = addToQuery. concat("%' "); i sFi rst = false; } if (gtent.compareTo("Any") != 0 ) { if (HsFi rst) { addToQuery = addToQuery. concatC AND ");} addToQuery = addToQuery. concat("sample.tentative_genus = '"); if (gtent.compareTo("true") == 0) { addToQuery = addToQuery. concat("l") ;
} else { addToQuery = addToQuery. concat("0") ; addToQuery = addToQuery. concatC" '"); i sFi rst = fal se ; } i f (sptent . compareToC'Any") ! = 0 ) { i f ( H sFi rst) { addToQuery = addToQuery. concat C AND ") ; } addToQuery = addToQuery . concat ("sampl e . tentati ve_speci es = ' ") ; i f (sptent . compareτo("true") == 0) { addToQuery = addToQuery. concat("l") ;
} else { addToQuery = addToQuery. concat("0") ;
} addToQuery = addToQuery. concatC '"); i sFi rst = false; if (subtent.compareToC'Any") != 0 ) { if (UsFirst) { addToQuery = addToQuery. concatC" AND ");} addToQuery = addToQuery. concat("sample.tentative_subspecies = '"); if (subtent.compareToC'true") == 0) { addToQuery = addToQuery. concat("l") ; } else { addToQuery = addToQuery. concat("0") ; addToQuery = addToQuery. concat(" '"); isFirst = false; } if (othertent.compareToC'Any") != 0 ) { if (UsFirst) { addToQuery = addToQuery. concatC" AND ");} addToQuery = addToQuery. concat("sample.tentative_subtype = '"); if (othertent.compareTo("true") == 0) { addToQuery = addToQuery. concat("l") ;
} else { addToQuery = addToQuery. concat("0") ; addToQuery = addToQuery. concat(" '"); isFirst = false; if (mass != "" ) { double percEr = masserror / 1000000.0; String [] allMass = mass. split (" , ") ; for(int j=0; j<allMass. length; j++) { if OisFirst) { addToQuery = addToQuery. concat(" AND ");} if Cj > 0){ addToQuery += " AND ";} addToQuery = addToQuery. concat("maldi_tof_data. mass between ") ; addToQuery = addToQuery. concat(allMass[j]) ; addToQuery = addToQuery. concatC" - (") ; addToQuery = addToQuery. concat(allMass[j]) ; addToQuery = addToQuery. concatC"*") ; addToQuery = addToQuery. concatCDouble. toStringCpercEr)) ; addToQuery = addToQuery. concatC") "); addToQuery = addToQuery. concatC" AND ") ; addToQuery = addToQuery. concatCallMass[j]) ; addToQuery = addToQuery. concatC" + C"); addToQuery = addToQuery. concatCallMass[j]) ; addToQuery = addToQuery. concatC"*") ; addToQuery = addToQuery. concatCDoubl e. toStringCpercEr)) ; addToQuery = addToQuery. concatC") ");
addToQuery = addToQuery. concatC" AND"); addToQuery = addToQuery. concatC" maldi_tof_data. intensity >= ") ; addToQuery = addToQuery. concatCmi ni ntensi ty) ; isFirst = false; } if ClowRM != "" & highRM != "" ) { if OisFirst) { addToQuery = addToQuery. concatC" AND ");} addToQuery = addToQuery. concatC'sample. number >= ") ; addToQuery = addToQuery. concat O owRM) ; addToQuery = addToQuery. concatC" AND sample. number <= ") ; addToQuery = addToQuery. concatChi ghRM) ; isFirst = false; } if Cφaldionly == 1) { if OisFirst) { addToQuery = addToQuery. concatC" AND ");} addToQuery = addToQuery. concatC'mal di_tof . sample_id = sample. sample_id AND maldi_tof .maldi_tof_id = maldi_tof_data.maldi_tof_id") ; addToQuery = "SELECT DISTINCT sample. sample_id,
CONCATCi dentifier .ident, sample. number) 'ident1 , sample. date, genus. name 'genus1 , species. name 'species' , subspecies. name 'subspecies' , subtype. name 'subtype' , sample. notes, sample. history, sample. tentative_genus, sample. tentative_species, sample. tentative_subspecies, sample. tentative_subtype FROM identifier, sample, strain, genus, species, subspecies, subtype, maldi_tof, maldi_tof_data WHERE strain. genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strai n . subtype_id AND sample. strai n_id = strain. strai n_id AND identifier .identifier_id = sample. identifier_id " + addToQuery; } else { if (mass != "") { addToQuery = addToQuery. concat(" AND maldi_tof . sample_id = sample. sample_id AND maldi_tof .maldi_tof_id = maldi_tof_data.maldi_tof_id ") ; addToQuery = "SELECT DISTINCT sample. sample_id,
CONCAT(identifier .ident, sample. number) 'ident' , sample. date, genus. name 'genus' , species. name 'species' , subspecies. name 'subspecies' , subtype. name 'subtype' , sample. notes, sample. history, sample. tentative_genus, sample. tentative_species, sample. tentative_subspecies, sample. tentative_subtype FROM identifier, sample, strain, genus, species, subspecies, subtype, maldi_tof, maldi_tof_data WHERE strai n.genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND sample. strai n_id = strain. strai n_id AND identifier. identifier_id = sample. identifier_id " + addToQuery; } else { addToQuery = SQLSearchQuery.concat(addToQuery) ;
} addToQuery = addToQuery. concatC") ORDER BY identifier. ident, sample. number") ; return getRS(addToQuery) ;
} public Java. sql . ResultSet runORSearch(String sampleid, String identifier, String genus, String species, String subspecies, String other, String notes, String history, String gtent, String sptent, String subtent, String othertent, int maldionly, String lowRM, String highRM) { String SQLSearchQuery; if (username. compareTo("rmandrell ") == 0 | username.compareTo("psmlogin") == 0) {
SQLSearchQuery = "SELECT DISTINCT sample. sample_id,
CONCAT(identifier .ident, sample. number) 'ident' , sample. date, genus. name 'genus' , species. name 'species' , subspecies. name 'subspecies' , subtype. name 'subtype' , sample. notes, sample. history, sample. tentative_genus, sample. tentative_species, sample. tentative_subspecies, sample. tentative_subtype FROM identifier, sample, strain, genus, species, subspecies, subtype WHERE strai n.genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND sample. strai n_id = strain. strai n_id AND identifier .identifier_id = sample. identifier_id" ;
} else {
SQLSearchQuery = "SELECT DISTINCT sample. sample_id,
CONCAT(identifier .ident, sample. number) 'ident' , sample. date, genus. name 'genus' , species. name 'species' , subspecies. name 'subspecies' , subtype. name 'subtype' , CASE WHEN sample. notes LIKE '%CONFIDENTIAL%' THEN 'CONFIDENTIAL See Rob Mandrel 1 before using' ELSE sample. notes END 'notes' , sample. history, sample. tentative_genus, sample. tentative_species, sample. tentative_subspecies, sample. tentative_subtype FROM identifier, sample, strain, genus, species, subspecies, subtype WHERE strai n.genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND sample. strai n_id = strain. strai n_id AND identifier .identifier_id = sample. identifier_id" ;
if (sampleid == "" & identifier == "" & genus == "" & species == "" & subspecies == "" & other == "" & notes == "" & history == "" & gtent.compareTo("Any") == 0 & sptent.compareTo("Any") == 0 & subtent . compareTo("Any") == 0 & othertent.compareTo("Any") == 0 & maldionly != 1 &
(lowRM =="" I highRM=="")) { return getRS(SQLSearchQuery + " ORDER BY identifier .i dent, sample. number") ; } else {
String addToQuery; addToQuery = SQLSearchQuery; addToQuery = addToQuery + " AND ("; boolean isFirst = true; if (sampleid != "" ) { addToQuery = addToQuery. concat("sample.sample_id LIKE '%"); addToQuery = addToQuery. concat(sampl ei d) ; addToQuery = addToQuery. concat("%' "); isFirst = false; } if (identifier != ""){ if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat("CONCAT(identifier.i dent, sample. number) LIKE '%"); addToQuery = addToQuery. concat(identifier) ; addToQuery = addToQuery. concat("%' "); isFirst = false; } if (genus != "" ) { if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat(" genus. name LIKE '%"); addToQuery = addToQuery. concat(genus) ; addToQuery = addToQuery. concat("%' "); isFirst = false; if (species != "") { if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat(" species. name LIKE '%"); addToQuery = addToQuery. concat(speci es) ; addToQuery = addToQuery. concat("%' "); isFirst = false; if (subspecies != "" ) { if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat(" subspecies. name LIKE '%"); addToQuery = addToQuery. concat(subspecies) ; addToQuery = addToQuery. concat("%' "); isFirst = false; if (other != "") { if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat(" subtype. name LIKE '%"); addToQuery = addToQuery. concat(other) ; addToQuery = addToQuery. concat("%' "); isFirst = false; } if (notes != "") { if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat(" sample. notes LIKE '%"); addToQuery = addToQuery. concat(notes) ; addToQuery = addToQuery. concat("%' "); isFirst = false; if (history != "" ) { if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat(" sample. history LIKE '%"); addToQuery = addToQuery. concat(hi story) ; addToQuery = addToQuery.concat("%' ") ; isFirst = false; } if (gtent.compareTo("Any") != 0 ) { if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat("sample.tentative_genus = '"); if (gtent.compareτo("true") == 0) { addToQuery = addToQuery. concat("l") ;
} else { addToQuery = addToQuery. concat("0") ;
} addToQuery = addToQuery. concat(" '"); isFirst = false; } if (sptent.compareTo("Any") != 0 ) { if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat("sample.tentative_species = '"); if (sptent.compareToC'true") == 0) { addToQuery = addToQuery. concat("l") ;
} else { addToQuery = addToQuery. concat("0") ; addToQuery = addToQuery. concat(" '"); isFirst = false; if (subtent.compareTo("Any") != 0 ) { if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat("sample.tentative_subspecies = '"); if (subtent.compareTo("true") == 0) { addToQuery = addToQuery. concat("l") ; } else { addToQuery = addToQuery. concat("0") ; addToQuery = addToQuery. concat(" '"); isFirst = false; } if (othertent.compareTo("Any") != 0 ) { if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat("sample.tentative_subtype = '"); if (othertent.compareToC'true") == 0) { addToQuery = addToQuery. concat("l") ;
} else { addToQuery = addToQuery. concat("0") ; addToQuery = addToQuery. concat(" '"); isFirst = false; if (IOWRM != "" & highRM != "" ) { if (UsFirst) { addToQuery = addToQuery. concat(" AND ");} addToQuery = addToQuery. concat("sample. number >= ") ; addToQuery = addToQuery. concat(lowRM) ; addToQuery = addToQuery. concat(" AND sample. number <= ") ; addToQuery = addToQuery. concat(hi ghRM) ; isFirst = false; } addToQuery = addToQuery. concat(") ORDER BY identifier .i dent, sample. number") ; return getRS(addToQuery) ;
} public String runANDSearchStr (String sampleid, String identifier, String genus, String species, String subspecies, String other, String notes, String history, int maldionly, String mass, int masserror, String minintensity, String lowRM, String highRM) { String SQLSearchQuery; if (username. compareTo("rmandrell ") == 0 | username.compareTo("psmlogin") 0) {
SQLSearchQuery = "SELECT DISTINCT sample. sample_id FROM identifier, sample, strain, genus, species, subspecies, subtype WHERE strain. genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND sample. strain_id = strain. strain_id AND identifier. identifier_id = sample. identifier_id" ;
} else {
SQLSearchQuery = "SELECT DISTINCT sample. sample_id FROM identifier, sample, strain, genus, species, subspecies, subtype WHERE strain. genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND sample. strain_id = strain. strain_id AND identifier .identifier_id = sample. identifier_id" ;
if (sampleid == "" & identifier == "" & genus == "" & species == "" & subspecies == "" & other == "" & notes == "" & history == "" & maldionly != 1 & mass=="" & (lowRM == "" | highRM == "")) { return SQLSearchQuery; } else {
String addToQuery = " AND ("; boolean isFirst; isFi rst = true; if (sampleid != "" ) { addToQuery = addToQuery. concat("sample.sample_id LIKE '%"); addToQuery = addToQuery. concat(sampl ei d) ; addToQuery = addToQuery. concat("%' "); i sFi rst = false; if (identifier != ""){ if (HsFi rst) { addToQuery = addToQuery. concat(" AND ");} addToQuery = addToQuery. concat("CONCAT(identifier.i dent, sample. number) LIKE '%"); addToQuery = addToQuery. concat(identifier) ; addToQuery = addToQuery. concat("%' "); i sFi rst = false; if (genus != "" ) { if (HsFi rst) { addToQuery = addToQuery. concat(" AND ");} addToQuery = addToQuery. concat("genus. name LIKE '%"); addToQuery = addToQuery. concat(genus) ; addToQuery = addToQuery. concat( %'"); i sFi rst = false; } if (species != "") { if (HsFi rst) { addToQuery = addToQuery. concat(" AND ");} addToQuery = addToQuery. concat("species. name LIKE '%"); addToQuery = addToQuery. concat(speci es) ; addToQuery = addToQuery. concat("%' "); i sFi rst = false; if (subspecies != "" ) { if (HsFi rst) { addToQuery = addToQuery. concat(" AND ");} addToQuery = addToQuery. concat("subspecies. name LIKE '%"); addToQuery = addToQuery. concat(subspecies) ; addToQuery = addToQuery. concat("%' "); i sFi rst = false; if (other != "") { if (UsFirst) { addToQuery = addToQuery.concat(" AND ");} addToQuery = addToQuery. concat("subtype. name LIKE '%"); addToQuery = addToQuery. concat (other) ; addToQuery = addToQuery. concat("%' ") ; isFirst = false; if (notes != "") { if (UsFirst) { addToQuery = addToQuery. concat(" AND ");} addToQuery = addToQuery. concat("sample. notes LIKE '%"); addToQuery = addToQuery. concat(notes) ; addToQuery = addToQuery. concat("%' "); isFirst = false; if (history != "" ) { if (UsFirst) { addToQuery = addToQuery. concat(" AND ");} addToQuery = addToQuery. concat("sample. hi story LIKE '%"); addToQuery = addToQuery. concat(hi story) ; addToQuery = addToQuery. concat("%' "); isFirst = false; if (mass != "" ) {
String [] allMass = mass. split (" , ") ; for(int j = 0; j < allMass. length; j++) { double percEr = masserror / 1000000.0; if (UsFirst) { addToQuery = addToQuery. concat(" AND ");} addToQuery = addToQuery. concat("maldi_tof_data. mass between ") ; addToQuery = addToQuery. concat(allMass[j]) ; addToQuery = addToQuery. concat(" - (") ; addToQuery = addToQuery. concat(allMass[j]) ; addToQuery = addToQuery. concat("*") ; addToQuery = addToQuery. concat(Doubl e. toString(percEr)) ; addToQuery = addToQuery. concat(") "); addToQuery = addToQuery. concat(" AND ") ; addToQuery = addToQuery. concat(allMass[j]) ; addToQuery = addToQuery. concat(" + (") ; addToQuery = addToQuery. concat(allMass[j]) ; addToQuery = addToQuery. concat("*") ; addToQuery = addToQuery. concat(Doubl e. toString(percEr)) ; addToQuery = addToQuery. concat(") "); addToQuery = addToQuery. concat(" AND maldi_tof_data. intensity >=
"); addToQuery = addToQuery. concat(mi ni ntensi ty) ;
} isFirst = false; if (lowRM != "" & highRM != "" ) { if (UsFirst) { addToQuery = addToQuery. concat(" AND ");} addToQuery = addToQuery. concat("sample. number >= ") ; addToQuery = addToQuery. concat(lowRM) ; addToQuery = addToQuery. concat(" AND sample. number <= ") ; addToQuery = addToQuery. concat(hi ghRM) ; isFirst = false;
} if (maldionly == 1) { if (UsFirst) { addToQuery = addToQuery. concat(" AND ");} addToQuery = addToQuery. concatC'mal di_tof . sample_id = sample. sample_id AND maldi_tof .maldi_tof_id = maldi_tof_data.maldi_tof_id") ; addToQuery = "SELECT DISTINCT sample. samp] e_id FROM identifier, sample, strain, genus, species, subspecies, subtype, maldi_tof, maldi_tof_data WHERE strain. genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecτes_id = strain. subspecies_id AND subtype. subtype_id = strai n . subtype_id AND sample. strain_id = strain. strain_id AND identifier .identifier_id = sample. identifier_id " + addToQuery; } else { if (mass != "") { addToQuery = addToQuery. concat(" AND maldi_tof . samp]e_id = sample. sample_id AND maldi_tof .maldi_tof_id = maldi_tof_data.maldi_tof_id ") ; addToQuery = "SELECT DISTINCT sample. sample_id FROM identifier, sample, strain, genus, species, subspecies, subtype, maldi_tof, maldi_tof_data WHERE strain. genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND sample. strain_id = strain. strain_id AND identifier .identifier_id = sample. identifier_id " + addToQuery; } else { addToQuery = SQLSearchQuery.concat(addToQuery) ;
} addToQuery = addToQuery. concat(") "); return addToQuery;
} public String runANDInSilicoSearchStr(String identifier, String genus, String species, String subspecies, String other, String protein, String notes, String mass, String masserror) {
String SQLSearchQuery;
SQLSearchQuery = "SELECT DISTINCT i .in_silico_id, i .identification, i .date, i .average_mw, i . protein, i . notes, g.name Genus, sp.name Species, sub. name Subspecies, st.name Subtype, i .aa_seq FROM in_silico i , genus g, species sp, subspecies sub, subtype st, strain sn WHERE sn.strain_id = i .strain_id AND sn.genus_id = g.genus_id AND sn. species_id = sp. species_id AND sub. subspecies_id = sn. subspecies_id AND st. subtype_id = sn. subtype_id" ; if (identifier == "" & genus == "" & species == "" & subspecies == "" & other == "" & notes == "" & mass=="" & protein == "") { return SQLSearchQuery; } else {
String addToQuery = " AND ("; boolean isFirst; isFi rst = true; if (protein != "" ) { addToQuery = addToQuery. concat("i . protein LIKE '%"); addToQuery = addToQuery. concat(protei n) ; addToQuery = addToQuery. concat("%' "); i sFi rst = false; if (identifier != ""){ if (MsFi rst) { addToQuery = addToQuery. concat(" AND ");} addToQuery = addToQuery. concat("i .identification LIKE '%"); addToQuery = addToQuery. concat(identifier) ; addToQuery = addToQuery. concat("%' "); i sFi rst = false; if (genus != "" ) { if (MsFi rst) { addToQuery = addToQuery. concat(" AND ");} addToQuery = addToQuery. concat("g. name LIKE '%"); addToQuery = addToQuery. concat(genus) ; addToQuery = addToQuery. concat("%' "); i sFi rst = false; if (species != "") { if (MsFi rst) { addToQuery = addToQuery. concat(" AND ");} addToQuery = addToQuery. concat("sp. name LIKE '%"); addToQuery = addToQuery. concat(speci es) ; addToQuery = addToQuery. concat("%' "); i sFi rst = false; if (subspecies != "" ) { if (UsFirst) { addToQuery = addToQuery.concat(" AND ");} addToQuery = addToQuery. concat("sub. name LIKE '%"); addToQuery = addToQuery. concat(subspecies) ; addToQuery = addToQuery. concat("%' "); isFirst = false; if (other != "") { if (UsFirst) { addToQuery = addToQuery. concat(" AND ");} addToQuery = addToQuery. concat("st. name LIKE '%"); addToQuery = addToQuery. concat(other) ; addToQuery = addToQuery. concat("%' ") ; isFirst = false; if (notes != "") { if (UsFirst) { addToQuery = addToQuery. concatC" AND ");} addToQuery = addToQuery. concat("i . notes LIKE '%"); addToQuery = addToQuery. concat(notes) ; addToQuery = addToQuery. concat("%' ") ; isFirst = false; } if (mass != "" ) { if (UsFirst) { addToQuery = addToQuery. concatC" AND ");} addToQuery = addToQuery. concat("i .average_mw > ") ; addToQuery = addToQuery. concat(mass + "-" + masserror + " AND i.average_mw < " + mass + "+" + masserror); isFirst = false;
} addToQuery = addToQuery. concatC) ") ; return SQLSearchQuery . concat(addToQuery) ;
} public String runANDMSMSSearchStr (String identifier, String genus, String species, String subspecies, String other, String protein, String notes, String mass, String masserror) {
String SQLSearchQuery;
SQLSearchQuery = "SELECT DISTINCT i .ms_ms_id, i.sample_id, i .date, i . precursor_ion_mtoz, i . protein, i . notes, g.name Genus, sp.name Species, sub. name Subspecies, st.name Subtype FROM ms_ms i , genus g, species sp, subspecies sub, subtype st, strain sn, sample sm, identifier ident WHERE sm.sample_id = i .sample_id AND sm.strain_id = sn.strain_id AND sm.identifier_id = ident.identifier_id AND sn.genus_id = g.genus_id AND sn. species_id = sp. species_id AND sub. subspecies_id = sn. subspecies_τd AND st. subtype_id = sn. subtype_id" ; if (identifier == "" & genus == "" & species == "" & subspecies == "" & other == "" & notes == "" & mass=="" & protein == "") { return SQLSearchQuery; } else {
String addToQuery = " AND ("; boolean isFirst; isFi rst = true; if (protein != "" ) { addToQuery = addToQuery. concat("i . protein LIKE '%"); addToQuery = addToQuery. concat(protei n) ; addToQuery = addToQuery. concat("%' "); isFirst = false; } if (identifier != ""){ if (UsFirst) { addToQuery = addToQuery. concat(" AND ");} addToQuery = addToQuery. concat("CONCAT_ws(' ' , ident. ident, sm. number) LIKE '%"); addToQuery = addToQuery.concat(identifier) ; addToQuery = addToQuery. concat("%' "); isFirst = false; if (genus != "" ) { if (UsFirst) { addToQuery = addToQuery. concatC AND ");} addToQuery = addToQuery. concat("g. name LIKE '%"); addToQuery = addToQuery. concat(genus) ; addToQuery = addToQuery. concat( %'"); isFirst = false; if (species != "") { if (UsFirst) { addToQuery = addToQuery. concatC" AND ");} addToQuery = addToQuery. concat("sp. name LIKE '%"); addToQuery = addToQuery. concat(speci es) ; addToQuery = addToQuery. concat("%' ") ; isFirst = false; if (subspecies != "" ) { if (UsFirst) { addToQuery = addToQuery. concatC AND ");} addToQuery = addToQuery. concat("sub. name LIKE '%"); addToQuery = addToQuery. concat(subspecies) ; addToQuery = addToQuery. concat("%' "); isFirst = false; } if (other != "") { if (UsFirst) { addToQuery = addToQuery. concatC AND ");} addToQuery = addToQuery. concat("st. name LIKE '%"); addToQuery = addToQuery. concat(other) ; addToQuery = addToQuery. concat("%' "); isFirst = false; if (notes != "") { if (UsFirst) { addToQuery = addToQuery. concatC AND ");} addToQuery = addToQuery. concat("i . notes LIKE '%"); addToQuery = addToQuery. concat(notes) ; addToQuery = addToQuery. concat("%' "); isFirst = false; if (mass != "" ) { if (UsFirst) { addToQuery = addToQuery. concatC AND ");} addToQuery = addToQuery. concat("i . precursor_ion_mtoz > ") ; addToQuery = addToQuery. concat(mass + "-" + masserror + " AND i . precursor_ion_mtoz < " + mass + "+" + masserror); isFirst = false; } addToQuery = addToQuery. concatC) ") ; return SQLSearchQuery . concat(addToQuery) ;
} public String runORSearchStr (String sampleid, String identifier, String genus, String species, String subspecies, String other, String notes, String history, int maldionly, String lowRM, String highRM) { String SQLSearchQuery; if (username. compareTo("rmandrell ") == 0 | username.compareTo("psmlogin") = 0) {
SQLSearchQuery = "SELECT DISTINCT sample. sample_id FROM identifier, sample, strain, genus, species, subspecies, subtype WHERE strain. genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND sample. strain_id = strain. strain_id AND identifier .identifier_id = sample. identifier_id" ; } else {
SQLSearchQuery = "SELECT DISTINCT sample. sample_id FROM identifier, sample, strain, genus, species, subspecies, subtype WHERE strain. genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strai n . subtype_id AND sample. strain_id = strain. strain_id AND identifier. identifier_id = sample. identifier_id" ;
if (sampleid == "" & identifier == "" & genus == "" & species == "" & subspecies == "" & other == "" & notes == "" & history == "" & maldionly != 1 & (IOWRM =="" I highRM=="")) { return SQLSearchQuery; } else {
String addToQuery; addToQuery = SQLSearchQuery; addToQuery = addToQuery + " AND ("; boolean isFirst = true; if (sampleid != "" ) { addToQuery = addToQuery. concat("sample.sample_id LIKE '%"); addToQuery = addToQuery. concat(sampl ei d) ; addToQuery = addToQuery. concat("%' "); isFirst = false; } if (identifier != ""){ if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat("CONCAT(identifier.i dent, sample. number) LIKE '%"); addToQuery = addToQuery. concat(identifier) ; addToQuery = addToQuery. concat("%' "); isFirst = false; } if (genus != "" ) { if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat(" genus. name LIKE '%"); addToQuery = addToQuery. concat(genus) ; addToQuery = addToQuery. concat("%' "); isFirst = false; if (species != "") { if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat(" species. name LIKE '%"); addToQuery = addToQuery. concat(speci es) ; addToQuery = addToQuery. concat("%' "); isFirst = false; if (subspecies != "" ) { if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat(" subspecies. name LIKE '%"); addToQuery = addToQuery. concat(subspecies) ; addToQuery = addToQuery. concat("%' "); isFirst = false; if (other != "") { if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat(" subtype. name LIKE '%"); addToQuery = addToQuery. concat(other) ; addToQuery = addToQuery. concat("%' "); isFirst = false; } if (notes != "") { if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat(" sample. notes LIKE '%"); addToQuery = addToQuery.concat(notes) ; addToQuery = addToQuery. concat("%' "); isFirst = false; if (history != "" ) { if (UsFirst) { addToQuery = addToQuery. concatC" OR ");} addToQuery = addToQuery. concat(" sample. history LIKE '%"); addToQuery = addToQuery. concat(hi story) ; addToQuery = addToQuery. concat("%' ") ; isFirst = false; if (IOWRM != "" & highRM != "" ) { if (UsFirst) { addToQuery = addToQuery. concat(" AND ");} addToQuery = addToQuery. concat("sample. number >= ") ; addToQuery = addToQuery. concat(lowRM) ; addToQuery = addToQuery. concat(" AND sample. number <= ") ; addToQuery = addToQuery. concat(hi ghRM) ; isFirst = false; } addToQuery = addToQuery. concat(") ") ; return addToQuery;
} public String runORInSilicoSearchStr (String identifier, String genus, String species, String subspecies, String other, String protein, String notes, String mass, String masserror) {
String SQLSearchQuery;
SQLSearchQuery = "SELECT DISTINCT i .in_silico_id, i .identification, i .date, i .average_mw, i . protein, i . notes, g.name Genus, sp.name Species, sub. name Subspecies, st.name Subtype, i .aa_seq FROM in_silico i , genus g, species sp, subspecies sub, subtype st, strain sn WHERE sn.strain_id = i .strain_id AND sn.genus_id = g.genus_id AND sn. species_id = sp. species_id AND sub. subspecies_id = sn. subspecies_id AND st. subtype_id = sn. subtype_id" ; if (identifier == "" & genus == "" & species == "" & subspecies == "" & other == "" & notes == "" & mass=="" & protein == "") { return SQLSearchQuery; } else {
String addToQuery = " OR ("; boolean isFirst; isFi rst = true; if (protein != "" ) { addToQuery = addToQuery. concat("i . protein LIKE '%"); addToQuery = addToQuery. concat(protei n) ; addToQuery = addToQuery. concat("%' "); isFirst = false; if (identifier != ""){ if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat("i .identification LIKE '%"); addToQuery = addToQuery. concat(identifier) ; addToQuery = addToQuery. concat("%' "); isFirst = false; } if (genus != "" ) { if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat("g. name LIKE '%"); addToQuery = addToQuery. concat(genus) ; addToQuery = addToQuery. concat("%' "); isFirst = false; } if (species != "") { if (UsFirst) { addToQuery = addToQuery.concat(" OR ");} addToQuery = addToQuery. concat("sp. name LIKE '%"); addToQuery = addToQuery. concat(speci es) ; addToQuery = addToQuery. concat("%' ") ; isFirst = false; if (subspecies != "" ) { if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat("sub. name LIKE '%"); addToQuery = addToQuery. concat(subspecies) ; addToQuery = addToQuery. concat("%' ") ; isFirst = false; } if (other != "") { if (UsFirst) { addToQuery = addToQuery. concatC" OR ");} addToQuery = addToQuery. concat("st. name LIKE '%"); addToQuery = addToQuery. concat(other) ; addToQuery = addToQuery. concat("%' "); isFirst = false; if (notes != "") { if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat("i . notes LIKE '%"); addToQuery = addToQuery. concat(notes) ; addToQuery = addToQuery. concat("%' "); isFirst = false; if (mass != "" ) { if (UsFirst) { addToQuery = addToQuery. concat(" OR ");} addToQuery = addToQuery. concat("i .average_mw > ") ; addToQuery = addToQuery. concat(mass + "-" + masserror + " AND i.average_mw < " + mass + "+" + masserror); isFirst = false; } addToQuery = addToQuery. concat(") "); return SQLSearchQuery . concat(addToQuery) ;
} public String runORMSMSSearchStr (String identifier, String genus, String species, String subspecies, String other, String protein, String notes, String mass, String masserror) {
String SQLSearchQuery;
SQLSearchQuery = "SELECT DISTINCT i .ms_ms_id, i .sample_id, i .date, i . precursor_ion_mtoz, i . protein, i . notes, g.name Genus, sp.name Species, sub. name Subspecies, st.name Subtype FROM ms_ms i , genus g, species sp, subspecies sub, subtype st, strain sn, sample sm, identifier ident WHERE sm.sample_id = i .sample_id AND sm.strain_id = sn.strain_id AND sm.identifier_id = ident.identifier_id AND sn.genus_id = g.genus_id AND sn. species_id = sp. species_id AND sub. subspecies_id = sn. subspecies_id AND st. subtype_id = sn. subtype_id" ; if (identifier == "" & genus == "" & species == "" & subspecies == "" & other == "" & notes == "" & mass=="" & protein == "") { return SQLSearchQuery; } else {
String addToQuery = " OR ("; boolean isFirst; isFi rst = true; if (protein != "" ) { addToQuery = addToQuery. concat("i . protein LIKE '%"); addToQuery = addToQuery. concat(protei n) ; addToQuery = addToQuery.concat("%' ") ; isFirst = false; if (identifier != ""){ if (UsFirst) { addToQuery = addToQuery. concatC OR ");} addToQuery = addToQuery. concat("CONCAT_ws(' ' , ident.ident, sm. number) LIKE '%"); addToQuery = addToQuery. concat(identifier) ; addToQuery = addToQuery. concat("%' ") ; isFirst = false; if (genus != "" ) { if (UsFirst) { addToQuery = addToQuery. concatC" OR ");} addToQuery = addToQuery. concat("g. name LIKE '%"); addToQuery = addToQuery. concat(genus) ; addToQuery = addToQuery. concat( %'"); isFirst = false; } if (species != "") { if (UsFirst) { addToQuery = addToQuery. concatC" OR ");} addToQuery = addToQuery. concat("sp. name LIKE '%"); addToQuery = addToQuery. concat(speci es) ; addToQuery = addToQuery. concat("%' "); isFirst = false; if (subspecies != "" ) { if (UsFirst) { addToQuery = addToQuery. concatC OR ");} addToQuery = addToQuery. concat("sub. name LIKE '%"); addToQuery = addToQuery. concat(subspecies) ; addToQuery = addToQuery. concat("%' "); isFirst = false; if (other != "") { if (UsFirst) { addToQuery = addToQuery. concatC OR ");} addToQuery = addToQuery. concat("st. name LIKE '%"); addToQuery = addToQuery. concat(other) ; addToQuery = addToQuery. concat("%' "); isFirst = false; if (notes != "") { if (UsFirst) { addToQuery = addToQuery. concatC OR ");} addToQuery = addToQuery. concat("i . notes LIKE '%"); addToQuery = addToQuery. concat(notes) ; addToQuery = addToQuery. concat("%' "); isFirst = false; } if (mass != "" ) { if (UsFirst) { addToQuery = addToQuery. concatC OR ");} addToQuery = addToQuery. concat("i . precursor_ion_mtoz > ") ; addToQuery = addToQuery. concat(mass + "-" + masserror + " AND i . precursor_ion_mtoz < " + mass + "+" + masserror); isFirst = false;
} addToQuery = addToQuery. concatC) ") ; return SQLSearchQuery . concat(addToQuery) ;
} public Java. sql . ResultSet searchBySampleld(String sampleid) {
String addToQuery = " AND sample. samp] e_id = '"; addToQuery = addToQuery. concat(sampl ei d) ; addToQuery = addToQuery. concatC '"); return getRS(SQLQuery.concat(addToQuery)) ; public Java. sql . ResultSet searchBySampleldStandard(String sampleid) { String mQuery; if (username.compareTo("rmandre"π ") == 0 | username.compareTo("psmlogin") ==
0) { mQuery = "SELECT sample. sample_id, identifier.!' dent, sample, number, sample. date, genus. name, species. name, subspecies. name, subtype. name, sample. notes, sampl e . hi story, sampl e . tentati ve_genus , sampl e . tentati ve_speci es , sample. tentati ve_subspecies, sample. tentati ve_subtype FROM identifier, sample, strain, genus, species, subspecies, subtype WHERE strain. genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecies_id = strain. subspecies_id AND subtype. subtype_id = strain. subtype_id AND sample. strain_id = strain. strain_id AND identifier .identifier_id = sampl e. i denti f i er_i d" ; } else { mQuery = "SELECT sample. sampl e_id, identifier .i dent, sample. number , sample. date, genus. name, species. name, subspecies. name, subtype. name, CASE WHEN sample. notes LIKE ^CONFIDENTIAL^1 THEN 'CONFIDENTIAL See Rob Mandrel 1 before using1 ELSE sample. notes END, sample. history, sample. tentati ve_genus, sample. tentati ve_species, sample. tentati ve_subspecies, sample. tentati ve_subtype FROM identifier, sample, strain, genus, species, subspecies, subtype WHERE strain. genus_id = genus. genus_id AND strain. species_id = species. species_id AND subspecies. subspecτes_id = strain. subspecies_id AND subtype. subtype_id = strai n . subtype_id AND sample. strain_id = strain. strain_id AND identifier .i denti fier_id = sampl e.i denti f i er_i d" ; mQuery = mQuery + " AND sampl e_id = " + sampleid; return getRS(mQuery) ;
public boolean isDigit(String schar) { if (schar. compareToC'O") == 0) { return true; } else if(schar. compareToC'l") == 0) { return true; } else if(schar.compareτo("2") == 0) { return true; }else if(schar.compareτo("3") == 0) { return true; }else if(schar. compareτo("4") == 0) { return true; }else if(schar.compareτo("5") == 0) { return true; }else if(schar. compareτo("6") == 0) { return true; }else if(schar.compareτo("7") == 0) { return true; }else if(schar.compareτo("8") == 0) { return true; }else if(schar. compareτo("9") == 0) { return true; } else { return false; } public void setPassword(String password) { this. password = password;
public void setUsername(String username) { this. username = username; } public int updateStrain(int sampleid, int ident, int number, String mdate, int genus, int species, int subspecies, int subtype, String notes, String history, int gtent, int sptent, int subtent, int othertent) {
//Si mi liar to insert except the insert is an update statement instead of an insert statement, and we need the sample_id
String slctStrain = "SELECT strain_id FROM strain WHERE genus_id=" + genus + " AND species_id=" + species + " AND subspecies_id=" + subspecies + " AND subtype_id=" + subtype; int strainID; notes = notes. replaceC , "W1"); notes = notes. replace("\"", "\\\""); history = history. replace( , "W1"); history = history. replace("\"" , "\\\""); try {
ResultSet myRS = getRS(slctStrain) ; if (myRS. next Q) {
//the strain already exists, use this id strainID = myRS.getInt("strain_id") ; } else {
//the strain does not exist, make a new one and use the new id myRS.closeO ;
//Insert the strain ID, now get it the same way as above String insrtStrain; insrtStrain = "INSERT INTO strain (genus_id, species_id, subspecies_id, subtype_id) VALUES(" + genus + "," + species + "," + subspecies + "," + subtype +")"; stmt . executeUpdate(i nsrtStrai n) ; stmt.closeO ; myRS = getRS(slctStrain) ; myRS. next O ; strainID = myRS.getInt("strain_id") ;
myRS.closeO ; String insrtSample = ""; insrtSample= "UPDATE sample set " + "strain_id=" + strainID + " ,identifier_id=" + ident + ",number=" + number; if (notes != "") { insrtSample = insrtSample + ", notes='" + notes + "'"; if (history != "") { insrtSample = insrtSample + ", history='" + history + "'"; if (mdate.trimO != "") { insrtSample = insrtSample + ", date = '" + mdate + "'"; insrtSample = insrtSample + " , tentative_genus=" + gtent + " , tentative_species=" + sptent + " , tentative_subspecτes=" + subtent + " , tentative_subtype=" + othertent + " WHERE sample_id = " + sampleid; stmt = myConn.createStatementO ; stmt.executeUpdate(insrtSample) ; return 0; } catch (SQLException e) { return 1; } catch (Exception e) { return 2; } /Vc
* nucelotidei nsert. Java
* Created on August 8, 2005, 3:57 PM
Vc / package psm.gene; import Java. beans. *; import java.io.*; import javax. servlet. http. HttpServletRequest; import javax. servlet. http. HttpServletResponse; import javax. servlet.ServletlnputStream; import java.io.Serializable; import Java. sql . *; import psm.db.dbAccess;
/**
* @author User
Vc / public class nucelotideinsert { private String fileName; public nucelotideinsertO { } public int insertNucleotide(HttpServletRequest request, psm.db.dbAccess myDB) throws IOException {
/*
*String ext is short for extension, this is used to determine where the info should be placed
*AA or NT, becuase both have the same format
*/
ServletlnputStream inStr = request. getlnputStreamO ; byte[] line = new byte [128]; int i = i nStr . readLi ne(li ne, 0, 128);
//The length of the boundary should be greater than three, anything less means an error has occurred, so exit, if Ci < 3) { return 1;
}
//Boundary length is the first line minus the first two CR1S that terminate it int boundaryLength = i - 2;
//Retrieves the boundary minus the two CR's
String boundary = new String(line, 0, boundaryLength); fileName = null ; int locusID = -1;
String sequence = ""; boolean is Fi Ie = false; while Ci != -1) {
//Store the current line as a string //iterate to next line i = inStr.readLine(line, 0, 128); String newLine = new String (line, 0, i); if CHsFi Ie) {
//All we care about is the file so loop through all the fields until you hit this. if (newLine.indexOf("filename=\"") != -1) { fileName = new String(line, newLine.indexOf ("filename=\"") + 10 , newLi ne . i ndexOf ("\"" , newLi ne . i ndexOf ("f i 1 ename=\""))) ; fileName = fileName. replace("\"" , ""); fileName = fileName. trim (); isFile= true;
} else {
//if no filename was entered exit if (fileName==null) { return 2; } //Do not read the very last line if (! new/Line, startswith (boundary) & newLine.indexOf ("Content") == -1 & newLi ne. length () > 4) {
//This is where reading of the lines of the file occurs. while (i != -1 && ! newLine. startswith (boundary)) { i = inStr.readLine(line, 0, 128);
//There are two types of lines in this file, one with locus with a preceeding >
// and a line that contains the code if (newLine.i ndexOf (">") != -1) {
//We are dealing with a new locus
//The locusName is the entire line minus teh > sign and minus the last carriage return if (locusID != -1){
//this means there is data we need to insert String insStr = ""; if (fileName. substri ng(fileName. i ndexOf(" .") + 1) .compareTolgnoreCaseC'AA") == 0) { insStr = "INSERT INTO genelist. nucleotidesequence VAl_UES(" + locusID + ",'" + sequence. trim() + "')";
} else if (fileName. substri ng(fileName.i ndexOf (".") + IJ.compareTolgnoreCaseC'NT") == 0) { insStr = "INSERT INTO genelist. nucleotide VALUESC + locusID + ", '" + sequence + '")";
} if (myDB.executeString(insStr) != 0) { return 6; } else {
//insrt successful 1 reset the variable sequence = "";
}
String locusName = newLine. substri ng(newl_ine.i ndexOf (">") + 1, newLine.length() - 2);
//Now we want to discover the ID of this locus Java. sql . ResultSet myRS;
String selstr = "SELECT locus_id FROM genelist. locus WHERE name = '" + locusName + "'"; myRS = myDB.getRS(selStr) ; try { if (myRS. next ()) { locusID = myRS.getlnt("locus_id"); } else {
//Do not continue without an ID return 5; } myRS.closeO ;
} catch (SQLException e) { return -1; } catch (Exception e) { return -2; }
} else if(newl_ine.trimθ != "" && newLi ne. trim() . compareTo("") != 0) {
//Now we are dealing with a line that has nucleotide info in it sequence = sequence. concat(newLine) ; } else { i = inStr.readLine(line, 0, 128); if (i ==-1) {
String insStr = ""; if (fi leName. substri ng(fi leName. i ndexθf(" .") + l).compareTolgnoreCase("AA") == 0) { insStr = "INSERT INTO genelist. nucleotidesequence VALUES(" + locuslD + ",'" + sequence. trim() + "')";
} else if (fi leName. substri ng(fi leName. indexθf(" .") + IJ.compareTolgnoreCaseC'NT") == 0) { insStr = "INSERT INTO genelist. nucleotide VALUESC + locuslD + ", '" + sequence + '")";
if (myDB.executeString(insStr) != 0) { return 6; } else {
//insrt successful 1 reset the variable sequence = "";
} if Ci!= -1) { newLine = new String (line, 0, i);
}
} newLine = null ;
} return 0;
} public String getFileNameO { return fi leName;
} public void setFi leName (St ring fi leName) { thi s . fi leName = fi leName; * mal di Graph . Java
*
* Created on June 27, 2005, 12:03 PM package psm. graph; import Java. beans. *;
Figure imgf000401_0001
public class maldiGraph extends Object implements Serializable { public mal di Graph () { } public Graphics2p gDraw(Graphics2D biCtx, Java. sql .ResultSet myRS, int intA, int intB, int topWrite, int bottom, int step, int xlength) { float iteration = (float) (intB - intA) / xlength; //gives what value coordinate 1 has for the iteration
int topτen=0; try { if (myRS. next()) { myRS. first() ; do { topTen++; float dx = myRS.getlntC'mass"); dx = (dx - intA) / iteration; int y = Math. round(myRS.getInt("intensity")) ; y = y * step; int x = Math. round(dx) ; biCtx. setColor(Color . RED) ; biCtx.drawLine((60 + x) , (bottom - y) , (60 + x), bottom); if (topTen <= topwrite) {
String mass = myRS.getStringC'mass") ; int ofset = mass.length() / 2 * 7; if (ofset % 2 !=0) {ofset+=3;} bi Ctx . setCol or(Col or . BLACK) ; biCtx.drawString(mass, 60 + x - ofset, (bottom -y) - 10);
} while (myRS. next ()) ; myRS.closeO ;
} catch (SQLException e) { } catch (Exception e) { } finally {
} return biCtx; public Graphics2D gDrawPluslnSiliclnfo(Graphics2D biCtx, Java, sql . ResultSet myRS, int intA, int intB, int topWrite, int bottom, int step, int xlength) { float iteration = (float)(intB - intA) / xlength; //gives what value coordinate 1 has for the iteration
int topτen=0; try {
Thread. si eep(50); if (myRS. next ()) { myRS. first () ; do { topTen++; while(myRS.getInt("msms") == 0.0) { myRS. next() ; float dx = myRS.getFloatC'msms") ; dx = (dx - intA) / iteration; int y = Math. round(myRS.getInt("intensity")) ; y = y * step; int x = Math. round(dx) ; bi Ctx . setCol or (Col or . RED) ; bi Ctx. draw/Line ((60 + x) , (bottom - y) , (60 + x), bottom); if (topTen <= topWrite) {
String mass = myRS.getStringC'msms") + ", " + myRS . getStri ng("i nsi 1 i co") ; int ofset = mass.length() / 2 * 7; if (ofset % 2 !=0) {ofset+=3;} bi Ctx . setCol or(Col or . BLACK) ; biCtx.drawString(mass, 60 + x - ofset, (bottom -y) - 18);
String type = myRS.getStringC'iontype") + ", " + myRS. getst ring ("residue") ; biCtx.drawString(type, 60 + x - ofset, (bottom - y) - 6);
}
} while (myRS. next ()) ; myRS.closeO ;
} catch (SQLException e) { } catch (Exception e) { } finally {
} return biCtx;
} public Graphics2D gDrawPluslnSiliclnfoSingle(Graphics2D biCtx,
Java. sql . ResultSet myRS, int intA, int intB, int topWrite, int bottom, int step, int xlength) { float iteration = (float)(intB - intA) / xlength; //gives what value coordinate 1 has for the iteration int topτen=0; try {
Thread. sleep(50) ; if (myRS.nextO) { myRS.firstO ; do { topTen++; if(myRS.getInt("msms") == 0.0) { myRS.lastO ; } else { boolean different = false; whileO different) { double msms = myRS.getDouble("msms") ; double insilico = myRS.getDouble("insilico") ; myRS. next() ; if(msms == myRS.getDouble("msms") | insilico == myRS . getDoubl e("i nsi 1 i co")) { while (msms == myRS.getDouble("msms") | insilico myRS . getDoubl e("i nsi 1 i co")) { myRS. next() ;
} else { myRS. previous O ; different = true; } float dx = myRS.getFloatC'msms") ; dx = (dx - intA) / iteration; int y = Math. round(myRS.getInt("intensity")) ; y = y * step; int x = Math. round(dx) ; bi Ctx . setCol or (Col or . RED) ; bi Ctx. draw/Line ((60 + x) , (bottom - y) , (60 + x), bottom); if (topTen <= topwrite) {
String mass = myRS.getStringC'msms") + ", " + myRS . getStri ng("i nsi 1 i co") ; int ofset = mass.length() / 2 * 7; if (ofset % 2 !=0) {ofset+=3;} bi Ctx . setCol or(Col or . BLACK) ; biCtx.drawString(mass, 60 + x - ofset, (bottom -y) - 18);
String type = myRS.getStringC'iontype") + ", " + myRS. getst ring ("residue") ; biCtx.drawString(type, 60 + x - ofset, (bottom - y) 6) ;
}
}
} while (myRS.nextO); myRS.closeO ;
} catch (SQLException e) { return null ; } catch (Exception e) { return null ; } finally {
} return bictx;
} public Graphics2p gDraw(Graphics2D bictx, Java. sql .ResultSet myRS, int intA, int intB, int topWrite, int bottom, int step, int xlength, Color 1 Col or) { float iteration = (float)U'ntB - intA) / xlength; //gives what value coordinate 1 has for the iteration
int topτen=0; try { if (myRS. next ()) { myRS.fi rst() ; do { topTen++; float dx = myRS.getlntC'mass"); dx = (dx - intA) / iteration; int y = Math. round(myRS.getInt("intensity")) ; y = y * step; int x = Math . round(dx) ; bictx. setColor(lColor) ; bictx. drawl_ine((60 + x) , (bottom - y) , (60 + x), bottom); if (topTen <= topWrite) {
String mass = myRS.getStringC'mass") ; int ofset = mass.length() / 2 * 7; if (ofset % 2 !=0) {ofset+=3;} bi Ctx . setCol or(Col or . BLACK) ; bictx. drawString(mass, 60 + x - ofset, (bottom -y) - 10);
} while (myRS. next ()) ; myRS.closeO ;
} catch (SQLException e) { } catch (Exception e) { } finally {
} return bictx; } public Graphics2D gDrawTitle(Graphics2D bictx, Java. sql . ResultSet myRS, int xlength) { try { if (myRS. next ()) { myRS. first p ;
String myTitle = myRS.getStrinq(l) + " Date: " + myRS.getString(2) + " Target Spot Number: + myRS.getString(3) ; bictx. drawstring (myTitle, (xlength/2) - ((myTitle. length()/2)*6) , 10) ;
} myRS.closeO ; } catch (SQLException e) {
} catch (Exception e) {
} return bictx; } public Graphics2D gDrawTitle(Graphics2D bictx, Java. sql . ResultSet myRS, int xlength, int yPlac) { try { if (myRS. next ()) { myRS. first p ;
String myTitle = myRS.getString(l) + " Date: " + myRS.getString(2) + " Target Spot Number: + myRS.getString(3) ; bictx. drawstring (myTitle, (xlength/2) - ((myTitle. length()/2)*6) , yPlac) ;
} myRS.closeO ; } catch (SQLException e) {
} catch (Exception e) {
} return bictx;
public Graphics2D gDrawMSMSTitle(Graphics2D bictx, Java. sql . ResultSet myRS, int xlength) { try { if (myRS. next ()) { myRS. first p ;
String myTitle = myRS.getString(l) + " Date: " + myRS.getString(2) + " Protein: " + myRS.getString(3) ; bictx. drawstring (myTitle, (xlength/2) - ((myTitle. length()/2)*6) , 10) ;
} myRS.closeO ; } catch (SQLException e) {
} catch (Exception e) { } return bictx; } public Graphics2D gDrawMSMSTitleAA(Graphics2D bictx, Java. sql . ResultSet myRS, int xlength) { try { if (myRS. next O) {
Date: " + (myTitle. length()/2)*6) , 10); -l)/2) ;
Figure imgf000405_0001
)/2) , aa. length O) ; bictx. drawstring (aal, xlength/2 - (aal.length() * 6 / 2) , 22); bictx. drawString(aa2, xlength/2 - (aa2.1engthp * 6 / 2) , 34); font = new Font ("ARIAL" , Font. BOLD , 12); biCtx.setFont(font) ;
} myRS. close () ; } catch (SQLException e) {
} catch (Exception e) { } return bictx;
public Graphics2D gDrawMSMSTitle(Graphics2D bictx, Java. sql . ResultSet myRS, int xlength, int yPlac) { try 4 (myRS. next ()) {
Date: (myTitle. length()/2)*6) ,
Figure imgf000406_0001
} catch (Exception e) { } return bictx; } public Graphics2D mi rroredGraphs(Bufferedlmage blmg, dbAccess myDB, int intA, int intB, int maldiidl, int maldiid2, int topnum, int xSize, int ySize, int spacing)
Graphics2D mGraph = blmg.createGraphicsO ;
//Set Antialiasing on mGraph . setRenderi ngHi nt(Renderi ngHi nts . KEY_ANTIALIASING, Renderi ngHi nts . VALUE_ANTIALIAS_ON) ;
Font font = new Font("ARIAL" , Font. BOLD, 12); mGraph . setFont(font) ;
//Get the length and width of the border int x, y; x = xSize - spacing; y = ySize - spacing;
//Set the backgorund color and clear the space mGraph. setBackg round (Col or .WHITE) ; mGraph. clearRect(0, 0, xSize, ySize);
//Get the first MALDl-TOF Data myDB.dbConnectO ; double singleltera = (double) (intB - intA) / x; double intltera = (y/200.0); try {
Java. sql . ResultSet myRS = myDB.getMaldiGraphData(lnteger . toString(maldiidl) , intA, intB) ; int z = 0; while (myRS. next O) { int xl = (spacing/2) + (int) ((myRS.getInt("mass") - intA) / singleltera + .5) ; int y2 = (int) (intltera * (myRS.getInt("intensity")) + .5) ; mGraph. setCol or (Color. RED) ; mGraph. drawLine(xl, ySize / 2, xl, ySize / 2 - y2) ; z++; } myRS. close () ; } catch (SQLException e) {
//This shoudlnt happen if it does there is nothing to do }
//Get the second malditofdata try {
Java. sql . ResultSet myRS2 = myDB.getMaldiGraphData(lnteger . toString(maldiid2) , intA, intB) ; int z = 0; while (myRS2. next()) { int xl = (spacing/2) + (int) ((myRS2.getlnt("mass") - intA) / singleltera + .5) ; int y2 = (int) (intltera * (myRS2.getlnt("intensity")) + ■ 5) ; mGraph. setCol or (Color. RED) ; mGraph. drawl_ine(xl, ySize / 2, xl, ySize / 2 + y2) ; z++; myRS2.closeO ; } catch (SQLException e) {
//This shoudlnt happen if it does there is nothing to do
myDB.dbCloseO ;
//Draw the labels and tick marks onn y axis
//get the iterations half the total size of the rect area divided by 100 double itera = (y /200.0); mGraph. setCol or (Color. BLACK) ; for (int i = 0; i <= 100; i ++) { if (i %10 ==0) {
//Every ten steps draw a label and a larger tick mark int xl,x2; xl = (spacing/2) ; x2 = (spacing/2) - 5;
Figure imgf000407_0001
mGraph. drawLine(xl, y2 , xl - 5, y2) ; mGraph. drawStri ng(lnteger .toString(i) , x2 - 25, y2 + 5);
//Draw Right mGraph. drawLine(xSize - xl, yl, xSize - xl + 5, yl) ; mGraph. drawStri ng(lnteger .toString(i) , xSize - spacing/2 + 10, yl +
mGraph. drawLine(xSize - xl, y2 , xSize - spacing/2 + 5, y2) ; mGraph. drawStri ng(lnteger .toString(i) , xSize - spacing/2 + 10, y2 + 5);
} else { int xl,x2; xl = (spacing/2) ; x2 = (spacing/2) - 2; int yl, y2; yl = (ySize /2) + (int) ((itera*i) + .5); y2 = (ySize /2) - (int) ((itera*i) + .5) ;
//draw left mGraph.drawl_ine(xl, yl, x2 , yl) ; mGraph.drawl_ine(xl, y2 , x2 , y2) ;
//Draw Right mGraph.drawl_ine(xSize - xl, yl, xSize - xl + 2 , yl) ; mGraph.drawLine(xSize - xl, y2 , xSize - spacing/2 + 2, y2) ;
}
//Draw Labels for x axis double iterate = x / 25.0; double intlter = (intB - intA) / 5; for (int i =0; i <=25; i ++) { if (i % 5 == 0) { int xl; xl = (spacing/2 + (int) (i -'iterate + .5));
//Draw labels and large tick marks
//Draw bottom mGraph.drawl_ine(xl, ySize - (spacing/2), xl, ySize - (spacing/2) + 10 ); int 1 Intensity = intA + ((int) ((i / 5)*intlter + .5));
String IbI = integer .toStringO intensity) ; mGraph.drawStringObl , xl - "IbI .length O * 3, ySize - spacing/2 + 25) ;
//Draw top mGraph.drawl_ine(xl, (spacing/2), xl, (spacing/2) - 10 ) ; mGraph.drawStringObl , xl - "IbI .length O * 3, spacing/2 - 16) ;
} else { int xl; xl = (spacing/2 + (int) (i -'iterate + .5));
//draw bottom mGraph.drawl_ine(xl, ySize - (spacing/2), xl, ySize - (spacing/2) + 5
);
//draw top mGraph.drawl_ine(xl, (spacing/2), xl, (spacing/2) - 5 );
}
//Draw the border mGraph. setCol or (Color. BLACK) ; mGraph.drawRect(spacing/2, spacing/2, x,y); mGraph.drawl_ine((spacing/2) , (ySize/2), xSize - (spacing/2), (ySize/2));
//Draw title myDB.dbConnectO ;
String [] ml = myDB.getMaldiSamplelnfo(lnteger .toString(maldiidl)) ; String [] m2 = myDB.getMaldiSamplelnfo(lnteger .toString(maldiid2)) ; mGraph.drawStringC'Combined Graph of " + ml[0] + " And " + m2 [0] , xSize / 2 -70, 10); myDB.dbCloseO ;
//Draw Axis labels
Font titleFont = new Font("ARIAL" , Font. BOLD, 14); mGraph. setFont(titleFont) ; mGraph. drawString("Mass to Charge (M/Z)", xSize/2 - 70, ySize - 5); FontMetrics fm = mGraph. getFontMetri cs (); mGraph. rotate(-Math. PI / 2, 10, (ySize + fm.getHeight())/2) ; mGraph. drawString("% Intensity", 10,(ySize + fm.getHeight())/2) ; return mGraph; } public Graphics2D mi rroredMSMSGraphs(Bufferedlmage blmg, dbAccess myDB, int intA, int intB, int maldiidl, int maldiid2, int topnum, int xSize, int ySize, int spacing) {
Graphics2D mGraph = blmg.createGraphicsO ;
//Set Antialiasing on mGraph . setRenderi ngHi nt(Renderi ngHi nts . KEY_ANTIALIASING, Renderi ngHi nts .VALUE_ANTIALIAS_ON) ;
Font font = new Font("ARIAL" , Font. BOLD, 12); mGraph . setFont(font) ;
//Get the length and width of the border int x, y; x = xSize - spacing; y = ySize - spacing;
//Set the backgorund color and clear the space mGraph . setBackg round (Col or .WHITE) ; mGraph. clearRect(0, 0, xSize, ySize);
//Get the first MALDl-TOF Data myDB.dbConnectO ; double singleltera = (double) (intB - intA) / x; double intltera = (y/200.0); try {
Java. sql . ResultSet myRS = myDB.getMSMSGraphData(lnteger . toString(maldiidl) , intA, intB) ; int z = 0; while (myRS. next ()) { int xl = (spacing/2) + (int) ((myRS.getInt("mass") - intA) / singleltera + .5) ; int y2 = (int) (intltera * (myRS.getInt("intensity")) + .5) ; mGraph. setCol or (Color. RED) ; mGraph. drawLine(xl, ySize / 2, xl, ySize / 2 - y2) ; z++; } myRS.closeO ; } catch (SQLException e) { //This shoudlnt happen if it does there is nothing to do
//Get the second malditofdata try {
Java. sql . ResultSet myRS2 = myDB.getMSMSGraphData(lnteger . toString(maldiid2) , intA, intB) ; int z = 0; while (myRS2. next Q) { int xl = (spacing/2) + (int) ((myRS2.getlnt("mass") - intA) / singleltera + .5) ; int y2 = (int) (intltera * (myRS2.getlnt("intensity")) + ■ 5) ; mGraph. setColor(Color. RED) ; mGraph . drawLi ne(xl, ySize / 2, xl, ySize / 2 + y2) ; z++; myRS2.closeO ; } catch (SQLException e) {
//This shoudlnt happen if it does there is nothing to do
myDB.dbCloseO ;
//Draw the labels and tick marks onn y axis
//get the iterations half the total size of the rect area divided by 100 double itera = (y /200.0); mGraph. setCol or (Color. BLACK) ; for (int i = 0; i <= 100; i ++) { if (i %10 ==0) {
//Every ten steps draw a label and a larger tick mark int xl,x2; xl = (spacing/2) ; x2 = (spacing/2) - 5; int yl, y2; yl = (ySize /T) + (int) ((itera*i) + .5); y2 = (ySize /T) - (int) ((itera*i) + .5) ;
//Draw left mGraph . drawLi ne(xl, yl, x2 , yl) ; mGraph. drawStri ng(lnteger .toString(i) , x2 - 25, yl + 5); mGraph. drawl_ine(xl, y2 , xl - 5, y2) ; mGraph. drawStri ng(lnteger .toString(i) , x2 - 25, y2 + 5);
//Draw Right mGraph. drawl_ine(xSize - xl, yl, xSize - xl + 5, yl) ; mGraph. drawStri ng(lnteger .toString(i) , xSize - spacing/2 + 10, yl + 5); mGraph. drawLine(xSize - xl, y2 , xSize - spacing/2 + 5, y2) ; mGraph. drawStri ng(lnteger .toString(i) , xSize - spacing/2 + 10, y2 + 5);
} else { int xl,x2; xl = (spacing/2) ; x2 = (spacing/2) - 2; int yl, y2; yl = (ySize /T) + (int) ((itera*i) + .5); y2 = (ySize /T) - (int) ((itera*i) + .5) ; //draw left mGraph. drawLine(xl, yl, x2 , yl) ; mGraph. drawLine(xl, y2 , x2 , y2) ;
//Draw Right mGraph.drawl_ine(xSize - xl, yl, xSize - xl + 2 , yl) ; mGraph.drawl_ine(xSize - xl, y2 , xSize - spacing/2 + 2, y2) ;
}
//Draw Labels for x axis double iterate = x / 25.0; double intlter = (intB - intA) / 5; for (int i =0; i <=25; i ++) { if (i % 5 == 0) { int xl; xl = (spacing/2 + (int) (i -'iterate + .5));
//Draw labels and large tick marks
//Draw bottom mGraph.drawl_ine(xl, ySize - (spacing/2), xl, ySize - (spacing/2) + 10 ); int 1 Intensity = intA + ((int) ((i / 5)*intlter + .5));
String IbI = integer . toStringO intensity) ; mGraph. drawStri ng(l bl , xl - TbI .length O * 3, ySize - spacing/2 + 25) ;
//Draw top mGraph. drawLine(xl, (spacing/2), xl, (spacing/2) - 10 ) ; mGraph. drawStri ng(lbl , xl - "IbI .length O * 3, spacing/2 - 16) ;
} else { int xl; xl = (spacing/2 + (int) (i -'iterate + .5));
//draw bottom mGraph.drawl_ine(xl, ySize - (spacing/2), xl, ySize - (spacing/2) + 5
//draw top mGraph.drawl_ine(xl, (spacing/2), xl, (spacing/2) - 5 );
}
//Draw the border mGraph. setCol or (Color. BLACK) ; mGraph. drawRect(spaci ng/2 , spacing/2, x,y); mGraph. drawLi ne((spaci ng/2) , (ySize/2), xSize - (spacing/2), (ySize/2));
//Draw Axis labels
Font titleFont = new Font("ARIAL" , Font. BOLD, 14); mGraph. setFont(titleFont) ; mGraph. drawStri ng("Mass to Charge (M/Z)", xSize/2 - 70, ySize - 5); FontMetrics fm = mGraph. getFontMetricsO ; mGraph. rotate(-Math. PI / 2, 10, (ySize + fm.getHeight())/2) ; mGraph. drawString("% Intensity", 10, (ySize + fm.getHeight())/2) ; titleFont = new Font("ARIAL" , Font. PLAIN, 10); mGraph. setFont(titleFont) ; mGraph. rotate (+Math. PI / 2, 10, (ySize + fm.getHeight())/2) ; return mGraph;
}
/Vc
* scatterPlot. Java
*
* Created on August 24, 2005, 10:35 AM package psm. graph; import java.io.OutputStream; import java. beans. *; import java.io.Serializable; import java.awt.*; import com. sun. image. codec. j peg. *; import Java. awt . image. Bufferedlmage; import Java. sql . *; import psm.db.dbAccess; import psm.db.box.masscolorbox; /**
* ©author Brandon Garbus public class scatterPlot { public scatterPlotO {
} public Graphics2D maldi Scatter (dbAccess myDB, Bufferedlmage blmg, String [] maldiids, int xSize, int ySize, int 1 Range, int hRange, int fontSize, int spacing, int topnum, int err, int intensity) {
//Create the set of colors for the highlighted regions int alpha = 60; Color[] highlight :ser = new Color [17] ; highlighter[O] new Color(215,25,25, alpha); highl ighter I] = new Color(215,25,130, alpha); highl ighter 2] = new Color(215,25,190, alpha); highl ighter 3] = new Color(155,25,215, alpha); highl ighter 4] = new Color(25,120,215, alpha); highl ighter 5] = new Color(25,175,215, alpha); highl ighter 6] = new Color(25,215,180, alpha); highl ighter 7] = new Color(25,215,137, alpha); highl ighter 8] = new Color(25,215,85, alpha); highl ighter "9] = new Color(195,215,25, alpha); highl ighter 10] = new Color(215,160,25, alpha) highl ighter II] = new Color(195,35,130, alpha) highl ighter 12] = new Color(215,80,25, alpha); highl ighter 13] = new Color(195,215,25, alpha) highl ighter 14] = new Color(35, 180, 195, alpha) highl ighter 15] = new Color(215, 130,25, alpha) highl ighter 16] = new Color(40, 170, 50, alpha);
//This array is used to store highlighted mass regions masscolorbox[] mBox = new masscolorbox[topnum] ;
//xSize and ySize are the size of the image, x and y are the size of the plot
Graphics2D plot = blmg.createGraphicsO ; plot. setBackground(Color .WHITE) ; pi ot . cl ear Rect (0,0, xSi ze , ySi ze) ;
//Set rendering hints pi ot . setRenderi ngHi nt (Renderi ngHi nts . KEY_ANTIALIASING , Renderi ngHi nts . VALUE_ANTIALIAS_ON) ;
//Set the size of the graph to make room for labels and iterations int x,y; x = xSize - spacing; y = ySize - spacing;
//Set the font
Font font = new Font("ARIAL" , Font. BOLD , fontSize); plot. setFont(font) ; plot. setColor(Color. BLACK);
//Draw the plot centered plot.draw3DRect( (spacing/2), (spacing/2), x, y, true);
//This helps keep track and make sure that the select all checkbox isnt in the list when we go get stuff int 1 ; if (maldiids[0] .compareτo("on") == 0) {
1=1; } else {
1 =0; }
//Draw y iterations double ylter = (double) y / (maldi ids. length -1 + 1); for (int i = 1; i <= maldi ids. length -1 ; i++) { int yl = ySize - (spacing/2); yl -= Math. rint (ylter * i);
//Draw the iteration marks on the left for the RM numbers pi ot . setCol or (Col or . BLACK) ; plot.drawLine((spacing/2) , yl , (spacing/2) - 5, yl) ;
//Draw the guidelines inside the plot pi ot . setCol or (Col or . LIGHT_GRAY) ; plot.drawLine((spacing/2) , yl , xSize - (spacing/2), yl) ;
//Draw the x iterations and labels double miter = (double) (hRange - 1 Range) / 5; double xlter = (double) (x / 10); for (int i = 0; i <=10; i ++) { int xl = (spacing/2); xl += (int) xlter * i ; if (i % 2 ==0) {
//Draw the tick marks pi ot . setCol or (Col or . BLACK) ; plot.drawLine( xl, ySize - (spacing/2), xl, ySize - (spacing/2) + 10);
//Draw the label int IbI Int = (int) ((I Range + miter * i/2));
String xLabel = Integer . toString(lbl Int) ; int x2 = xl; x2 -= (int) Math.rint(xLabel .lengthO * 3.5); plot.drawString(xLabel , x2 , ySize - (spacing/4)); } else {
//draw smaller tick marks plot.drawLine( xl, ySize - (spacing/2), xl, ySize - (spacing/2) + 5);
} //Cycle through the maldi samples and add them to the plot
//Connect to the database
//counter int z = 0;
//this counts how many topnumbers were actualyl highlighted int total count = 0; myDB.dbConnectO ;
//write the title
Font fontTitle = new Font("ARIAL" , Font. BOLD , fontSize + 4); plot. setFont(fontτitle) ;
//1 (lower case "L")being the first maldi sample
Java. sql . Resul tSet myTitleRS = myDB.getMaldiAndSamplelnfo(maldiids[l]) ;
String title; try { myTitleRS. next Q ; title = "Comparison Scatter Plot for Strain: " + myTitleRS. getString(l) + " Sample: " + myTitleRS. getString(2) ; } catch (SQLException e) { title= "Comparison Scatter Plot";
} plot.drawStringCtitle, (xSize/2) - title. length() * 4, 15);
//set the font back to the original plot. setFont(font) ;
//Draw Labels plot.drawStringC'Mass to Charge (M/Z)", (xSize/2) - 60, ySize - 15);
//This keeps the RM number of the cpared to sample String rmNumberCmp = ""; String rmName = ""; for (int i =1; i < maldi ids. length; i++ ) { try {
//get the y coordinate int yl = ySize - (spacing/2); yl -= Math. rint(ylter * (i-1 + I));
String [] rmNum = myDB.getMaldiSamplelnfo(maldiids[i]) ; pi ot . setCol or (Col or . BLACK) ;
Font fontLabel = new Font("ARIAL" , Font. BOLD , fontSize - 4); plot. setFont(fontLabel) ; plot. drawStri ng( rmNum [0] , 0, yl + 3);
Resul tSet myRS = myDB.getMaldiGraphData(maldiids[i] , 1 Range, hRange) ; plot. setFont(font) ; if (i==D { rmNumberCmp = rmNum[0]; rmName = rmNum [1] ; pi ot. setCol or (highlighter [15]); plot. fill Rect(0, yl - 3, xSize - (spacing/2), (yl + 3) - (yl -
} else if (rmNumberCmp. compareTo( rmNum [O]) == 0) { plot. setCol or (highlighter [15]); plot. fill Rect(0, yl - 3, xSize - (spacing/2), (yl + 3) - (yl - -> ) ) J
} else if (rmName. compareTo(rmNum[l])==0) { plot. setCol or (highlighter [16]); plot. fill Rect(0, yl - 3, xSize - (spacing/2), (yl + 3) - (yl - -> ) ) J while (myRS. next ()) {
//normally checking the intensty would be done i nthe select statement however since the statement first normalizes the data
//its easier to do it here. if (myRS.getlntC'mass") != 0 && myRS.getInt("intensity") >= intensity) {
//This gets the increment for 1 mass/charge unit double masslter = (double) (hRange - lRange) / x; int xl; double xO;
//Get the x coordiante xO = (myRS.getlntC'mass") - lRange) / masslter; xl = (int) xO; xl += (spacing/2) ;
//Draw the point on the plot int radius = 2; plot.setColor(new Col or (15, 15, 165)) ; plot.drawOval (xl, yl - (radius/2), radius, radius); plot.fillOval (xl, yl - (radius/2), radius, radius);
//Draw highlighted error regions if (z < topnum) {
//select z mod 15 for automatic rollover plot.setColor(highlighter[z % 15]); mBox = new masscoTorboxO ; mBox_ .setMass (myRS.getlntC'mass")) ; mBox[z] . setHighlighted(highlighter [z%15]) ; double xlHd, x2Hd; double error = Cerr / 1000000.0) * myRS.getlntC'mass"); xlHd = (double) ( myRS.getlntC'mass") - error - lRange)
/ masslter; x2Hd = (double) ( myRS.getlntC'mass") + error - lRange) / masslter;
//Round xlHd += 0.5; x2Hd += 0.5; int xlH, x2H; xlH = (int) xlHd; x2H = (int) x2Hd; xlH += (spacing/2); x2H += (spacing/2); plot.fillRect(xlH, spacing / 2, x2H - xlH, ySize - spacing)
//plot.drawRect(xlH, spacing / 2, x2H - xlH, ySize - spacing) total count++;
}
Z++;
}
//set z = to the topnumber in case there are less points inthe first sample than the topnumber z = topnum; myRS.closeO ; } catch (SQLException e) {
}
}
//Build the legend for the highlighted colors
//first sort the array from least mass to greatest mass //Bubble sort is simple and fast enough for this for (int i=0; i < total count; i++) { for (int j =0; j < totalcount -1; j++) { if (mBox[j + l].getMass() < mBox[j] .getMassO) { masscolorbox tmp = mBox[j]; mBox[j] = mBox[j+l]; mBox[j+l] = tmp;
for (int i=0; i < total count; i++){ plot. setColor(mBox[i] . getHighlightedO) ; plot.fillRect(xSize - 50, (spacing / 2) + i * 15, 10, 5); pi ot . setCol or(Col or . BLACK) ; plot . drawStri ng (Integer . toStri ng(mBox[i ] . getMassO) , xSize - 37,
(spacing/2) + 7 + i*15);
//close the database myDB.dbCloseO ; return plot;
public Graphics2D MSMSScatter(dbAccess myDB, Bufferedlmaqe blmg, String [] maldiids, int xSize, int ySize, int 1 Range, int hRange, int fontSize, int spacing, int topnum, double err, int intensity) {
//Create the set of colors for the highlighted regions int alpha = 60; Color[] highlight :ser = new Color [17] ; highlighter[O] new Color(215,25,25, alpha); highl ighter I] = new Color(215,25,130, alpha); highl ighter 2] = new Color(215,25,190, alpha); highl ighter 3] = new Color(155,25,215, alpha); highl ighter 4] = new Color(25,120,215, alpha); highl ighter 5] = new Color(25,175,215, alpha); highl ighter 6] = new Color(25,215,180, alpha); highl ighter 7] = new Color(25,215,137, alpha); highl ighter 8] = new Color(25,215,85, alpha); highl ighter "9] = new Color(195,215,25, alpha); highl ighter 10] = new Color(215,160,25, alpha) highl ighter II] = new Color(195,35,130, alpha) highl ighter 12] = new Color(215,80,25, alpha); highl ighter 13] = new Color(195,215,25, alpha) highl ighter 14] = new Color(35, 180, 195, alpha) highl ighter 15] = new Color(215, 130,25, alpha) highl ighter 16] = new Color(40, 170, 50, alpha);
//This array is used to store highlighted mass regions masscolorbox[] mBox = new masscol orbox [topnum] ;
//xSize and ySize are the size of the image, x and y are the size of the plot
Graphics2D plot = blmg.createGraphicsO ; plot. setBackground(Color .WHITE) ; pi ot . cl ear Rect (0,0, xSi ze , ySi ze) ;
//Set rendering hints pi ot . setRenderi ngHi nt (Renderi ngHi nts . KEY_ANTIALIASING , Renderi ngHi nts . VALUE_ANTIALIAS_ON) ;
//Set the size of the graph to make room for labels and iterations int x,y; x = xSize - spacing; y = ySize - spacing;
//Set the font Font font = new Font("ARIAL" , Font. BOLD , fontSize); plot. setFont(font) ; plot. setColor(Color. BLACK);
//Draw the plot centered plot.draw3DRect( (spacing/2), (spacing/2), x, y, true);
//This helps keep track and make sure that the select all checkbox isnt in the list when we go get stuff int 1 ; if (maldiids[0] .compareτo("on") == 0) {
1=1; } else {
1 =0; }
//Draw y iterations double ylter = (double) y / (maldi ids. length -1 + 1); for (int i = 1; i <= maldi ids. length -1 ; i++) { int yl = ySize - (spacing/2); yl -= Math. rint (ylter * i);
//Draw the iteration marks on the left for the RM numbers pi ot . setCol or (Col or . BLACK) ; plot.drawLine((spacing/2) , yl , (spacing/2) - 5, yl) ;
//Draw the guidelines inside the plot pi ot . setCol or (Col or . LIGHT_GRAY) ; plot.drawLine((spacing/2) , yl , xSize - (spacing/2), yl) ;
//Draw the x iterations and labels double miter = (double) (hRange - 1 Range) / 5; double xlter = (double) (x / 10); for (int i = 0; i <=10; i ++) { int xl = (spacing/2); xl += (int) xlter * i ; if (i % 2 ==0) {
//Draw the tick marks pi ot . setCol or (Col or . BLACK) ; plot.drawLine( xl, ySize - (spacing/2), xl, ySize - (spacing/2) + 10);
//Draw the label int IbI Int = (int) ((I Range + miter * i/2));
String xLabel = Integer . toString(lbl Int) ; int x2 = xl; x2 -= (int) Math.rint(xLabel .lengthO * 3.5); plot.drawString(xLabel , x2 , ySize - (spacing/4)); } else {
//draw smaller tick marks plot.drawLine( xl, ySize - (spacing/2), xl, ySize - (spacing/2) + 5);
}
//Cycle through the maldi samples and add them to the plot
//Connect to the database
//counter int z = 0;
//this counts how many topnumbers were actualyl highlighted int total count = 0; myDB.dbConnectO ; //write the title
Font fontTitle = new Font("ARIAL" , Font. BOLD , fontSize + 4); plot. setFont(fontτitle) ;
//1 (lower case "L")being the first maldi sample
Java. sql . ResultSet myTitleRS = myDB.getMSMSAndSamplelnfo(maldiids[l]) ;
String title; try { myTitleRS. next Q ; title = "Comparison Scatter Plot for Strain: " + myTitleRS. getString(l) + " Sample: " + myTitleRS. getString(2) ; } catch (SQLException e) { title= "Comparison Scatter Plot"; } plot.drawStringCtitle, (xSize/2) - title. lengthO * 4, 15); //set the font back to the original plot. setFont(font) ;
//Draw Labels plot.drawStringC'Mass to Charge (M/Z)", (xSize/2) - 60, ySize - 15);
//This keeps the RM number of the cpared to sample String rmNumberCmp = ""; String rmName = ""; for (int i =1; i < maldi ids. length; i++ ) { try {
//get the y coordinate int yl = ySize - (spacing/2); yl -= Math.rintCylter * (i-1 + I));
String [] rmNum = myDB.getMSMSSamplelnfo(maldiids[i]) ; pi ot . setCol or (Col or . BLACK) ;
Font fontLabel = new Font("ARIAL" , Font. BOLD , fontSize - 4); plot. setFont(fontLabel) ; plot. drawStri ng( rmNum [0] , 0, yl + 3);
ResultSet myRS = myDB.getMSMSGraphData(maldiids[i] , 1 Range, hRange) ; plot. setFont(font) ; if (i==D { rmNumberCmp = rmNum[0] ; rmName = rmNum [I] ; pi ot. setCol or (highlighter [15]); plot. fill Rect(0, yl - 3, xSize - (spacing/2), (yl + 3) - (yl - 3));
} else if (rmNumberCmp. compareTo(rmNum[0]) == 0) { plot. setCol or (highlighter [15]); plot. fill Rect(0, yl - 3, xSize - (spacing/2), (yl + 3) - (yl - 3));
} else if (rmName. compareTo(rmNum[l])==0) { plot. setCol or (highlighter [16]); plot. fill Rect(0, yl - 3, xSize - (spacing/2), (yl + 3) - (yl - 3)); while (myRS. next ()) {
//normally checking the intensty would be done i nthe select statement however since the statement first normalizes the data
//its easier to do it here. if (myRS.getlntC'mass") != 0 && myRS.getInt("intensity") >= intensity) {
//This gets the increment for 1 mass/charge unit double masslter = (double) (hRange - lRange) / x; int xl; double xO;
//Get the x coordiante xO = (myRS.getlntC'mass") - lRange) / masslter; xl = (int) xθ; xl += (spacing/2) ;
//Draw the point on the plot int radius = 2; plot.setColor(new Col or (15, 15, 165)) ; plot.drawOval (xl, yl - (radius/2), radius, radius); plot.fillOval (xl, yl - (radius/2), radius, radius);
//Draw highlighted error regions if (z < topnum) {
//select z mod 15 for automatic rollover plot.setColor(highlighter[z % 15]); mBox[z] = new masscolorbox() ; mBox[z] .setMass(myRS.getInt("mass")) ; mBox[z] . setHighlighted(highlighter [z%15]) ; double xlHd, x2Hd; double error = err; xlHd = (double) ( myRS.getlntC'mass") - error - lRange)
/ masslter; x2Hd = (double) ( myRS.getlntC'mass") + error - lRange) / masslter;
//Round xlHd += 0.5; x2Hd += 0.5; int xlH, x2H; xlH = (int) xlHd; x2H = (int) x2Hd; xlH += (spacing/2); x2H += (spacing/2); plot.fillRect(xlH, spacing / 2, x2H - xlH, ySize - spacing) ;
//plot.drawRect(xlH, spacing / 2, x2H - xlH, ySize - spacing) ; total count++;
} z++;
}
//set z = to the topnumber in case there are less points inthe first sample than the topnumber z = topnum; myRS.closeO ; } catch (SQLException e) {
}
}
//Build the legend for the highlighted colors
//first sort the array from least mass to greatest mass
{
Figure imgf000420_0001
for (int i=0; i < totalcount; i++){ plot. setColor(mBox[i] . getHighlightedQ) ; plot. fill Rect(xSi ze - 50, (spacing / 2) + i * 15, 10, 5); pi ot . setCol or (Col or . BLACK) ; plot.drawString(lnteger . toString(mBox[i] .getMassO) , xSize - 37, (spacing/2) + 7 + i*15);
//close the database myDB.dbCloseO ; return plot;
/Vc
* formatMALDI . Java
*
* Created on June 30, 2005, 2:45 PM
Vc / package psm.mformat; import Java. beans. *; import java.io.*; import javax. servlet. http. HttpServletRequest; import javax. servlet. http. HttpServletResponse; i mport j avax . servl et . Servl etlnputStream ; i mport j ava . uti l . * ; import Java. text. SimpleDateFormat ; import java. text. Decimal Format;
/**
* ©author Brandon
Vc / public class formatinsilico { private ArrayList maldiMZ; private String number; private String notes; private String fileName; private double MW; private String protein; private String Genus; private String Species; private String subspecies; private String subtype; public formatinsilicoO { setMaldiMZ(new ArrayListO) ; } public int formatMALDlFile(HttpServletRequest request) throws lOException { setMaldiMZ(new ArrayListO); setNumberC""); setNotesC""); setGenusC""); setSpeciesC""); setSubspeciesC""); setSubtypeC"");
ServletlnputStream inStr = request. getlnputStreamO ; byte[] line = new byte [1024]; int i = inStr. readLine(line, 0, 1024);
//The length of the boundary should be greater than three, anything less means an error has occurred, so exit, if Ci < 3) { return 1; }
//Boundary length is the first line minus the first two CR1S that terminate it int boundaryLength = i - 2;
//Retrieves the boundary minus the two CR's
String boundary = new String(line, 0, boundaryLength); setFileName(null) ;
String tempStr = ""; bool ean i s Fi I e = fal se ; whi l e Ci ! = -1) { unti l you + 10 ,
Figure imgf000423_0001
i f ( ! newLi ne . startswi th (boundary) & newLi ne . i ndexOf ("Content") ==
-D {
//This is where reading of the lines of the file occurs, int lCount = 0; //keeps track of the line count while (i != -1 && ! newLine. startswith (boundary)) { lCount ++; //Increment the line count indicating the current position relative to the file contents i = inStr. readLine(line, 0, 1024); if (lCount > 1) {
//if lCount is greater than 11 then we are now on the data lines and can start processing that data
//Columns are seperated by a series of spaces, and the peak numbers have a width of a minimum of 3 characters, and both Mass and intensity columns have
//a decimal point, this will be used to determine the position of the numbers and to grab them if (newLine. lengthO < 5) { return 0;} //the last line could possibly be a carriage return, we dont care about this, so just exit.
//This format is going to assume a tab delimited file, with the first line containing:
//RM# MW Protein Notes //M/z intensity if (lCount == 2) { //This is the first line
String [] fstline = null; newLine = newLine. trim(); fstline = newLine. split("\t") ;
//The first string in fstline should be the rm number setNumber(fstline[0]) ;
//The second should be the strain String [] strain = fstline [1] . split(" ") ; switch (strain. length) { case 4: setSubtype(strain[3]) ; case 3: setSubspecies (strain [2]) ; case 2: setSpecies (strain [I]) ; case 1: setGenus (strain [O]) ; }
//The third should be the MW weight setMW(Double. parseDouble(fstline[2])) ; if (f stl ine. length > 3) { //This is the protein setProtein(fstline[3]) ; if (fstl ine. length > 4) { //the rest are notes setNotes(fstline[4]) ;
} else { try {
//Not the first line, dump into array String [] dataLine = null; newLine = newLine. trim Q ; dataLine = new/Line. split("\t") ;
//This should containt one set of strings, the first being the mass to charge ratio
//and the second being the intensity. double mz = Double. parseDouble(datal_ine [O]) ; getMaldiMZO . add (new Double (mz)) ; catch (Exception e) { return 9; }
String(line, 0, i)
Figure imgf000424_0001
}
//iterate to next line i = inStr . readLine(line, 0, 1024);
} return 0;
} public String getNumber() { return number;
} public void setNumber (String number) { this. number = number;
public String getNotesO { return notes; public void setNotes (String notes) { this. notes = notes; } public ArrayList getMaldiMZO { return maldiMZ; } public void setMaldi MZ (ArrayList maldiMZ) { thi s .maldiMZ = maldiMZ; } public String getFileNameO { return fileName; } public double getMW() { return MW; } public void setMW(double MW) { thi s. MW = MW; } public String getProtein() { return protein; } public void setProtein (String protein) { thi s. protein = protein; } public void setFileName(String fileName) { thi s . fileName = fileName; } public String getGenusO { return Genus; } public void setGenus(String Genus) { this. Genus = Genus; } public String getSpeciesO { return Species; } public void setSpecies (String Species) { thi s. Species = Species; } public String getSubspeciesO { return subspecies; } public void setSubspecies (String subspecies) { this. subspecies = subspecies; } public String getSubtypeO { return subtype; } public void setSubtype(String subtype) { this. subtype = subtype;
/Vc
* formatMALDI . Java
*
* Created on June 30, 2005, 2:45 PM
Vc / package psm.mformat; import Java. beans. *; import java.io.*; import javax. servlet. http. HttpServletRequest; import javax. servlet. http. HttpServletResponse; import javax. servlet.ServletlnputStream; import java. util . *; import Java. text. SimpleDateFormat ; import java. text. Decimal Format;
/**
* ©author Brandon
Vc / public class formatMALDI { private ArrayList maldiMZ; private ArrayList maldi Intensity; private String targetNum; private Date mdate; private String number; private String notes; private String fileName; public formatMALDI () { maldiMZ = new ArrayListO; maldi Intensity = new ArrayListO;
public int formatMALDlFile(HttpServletRequest request) throws lOException { maldiMZ = new ArrayListO; maldi Intensity = new ArrayListO; mdate= null ; number =nil . notes = targetNum =
ServletlnputStream inStr = request. getlnputStreamO ; byte[] line = new byte [1024]; int i = inStr. readLine(line, 0, 1024);
//The length of the boundary should be greater than three, anything less means an error has occurred, so exit, if Ci < 3) { return 1;
//Boundary length is the first line minus the first two CR1S that terminate it int boundaryLength = i - 2;
//Retrieves the boundary minus the two CR's
String boundary = new String(line, 0, boundaryLength); fileName = null ;
String tempStr = ""; boolean isFi Ie = false; while (i != -1) {
//Store the current line as a string
String newLine = new String(line, 0, i); if (H sFile) {
//All we care about is the file so loop through all the fields until you hit this. if (newLine.indexOf("filename=\"") != -1) {
fileName = new String(line, newLine.indexOf ("filename=\"") + 10 , newLine.indexOf ("\"", newLine.indexOf ( filename=\"") + 10)); fileName = fileName. replace("\"" , ""); fileName = fileName. trim (); if (fileName. contains ("\\")) { fileName = fileName. substring(fileName.lastIndexθf("\\") + 1, fileName. lengthO); fileName = fileName. substring(O, fileName. length() - 4); String [] info = fileName. split("_") ; number = info[0] ; targetNum = info[2] ; if (info. length > 3) { notes = i nfo[3] ; } ) ;
Figure imgf000428_0001
if (! newLine. startswith (boundary) & newLine.indexOf ("Content") ==
-D {
//This is where reading of the lines of the file occurs, int lCount = 0; //keeps track of the line count while (i != -1 && ! newLine. startswith (boundary)) { lCount ++; //Increment the line count indicating the current position relative to the file contents i = inStr. readLine(line, 0, 1024);
//On the filename three is the sample name date and target number, we want this information if (lCount > 1) {
//if lCount is greater than 11 then we are now on the data lines and can start processing that data
//Columns are seperated by a series of spaces, and the peak numbers have a width of a minimum of 3 characters, and both Mass and intensity columns have
//a decimal point, this will be used to determine the position of the numbers and to grab them if (newLine. lengthO < 5) { return 0;} //the last line could possibly be a carriage return, we dont care about this, so just exit.
String [] pline = newLine. split("\t") ;
//now assign this into the mass array, in a new positon. double dx = Double. parseDouble(pli ne [O]) ; //This is for rounding, add .5 to the decimal , and when converted to an int the decimal drops off dx += .5; int di = (int)dx; maldiMZ.add(new integer(di)) ;
//Change to a double and round to the first decimal place dx = Double. parseDoubleCpli ne [I]) ; dx += 0.05;
Decimal Format dF = new Decimal Format("00.0") ; maldi intensity. add (new Double (Double. parseDoubl e(dF. format ((dx))))) ;
/* if ((i==boundaryl_ength+2 | | i==boundaryLength+4 && new
String(line, 0, i) .startswith(boundary))) { pw. pri nt(newLi ne. substri ng(0, newLi ne.length()-2)); } else { pw. print(newLine) ;
** / newLine = new String (line, 0, i);
} }
//iterate to next line i = inStr . readLine(line, 0, 1024); } return 0;
} public String getTargetNum() { return targetNum;
public void setTargetNum(String targetNum) { this. targetNum = targetNum;
public Date getMdateO { return mdate;
} public void setMdate(Date mdate) { this. mdate = mdate;
} public String getNumber() { return number;
} public void setNumber (String number) { this. number = number;
} public String getNotesO { return notes;
} public void setNotes (String notes) { this. notes = notes;
} public ArrayList getMaldiMZ() { return maldiMZ;
public void setMaldi MZ (ArrayList maldiMZ) { thi s .maldiMZ = maldiMZ;
public ArrayList getMaldilntensityO { return maldi Intensity;
public void setMaldi lntensity(ArrayList maldi intensity) { thi s .maldi intensity = maldi intensity;
public String getFileNameO { return fileName;
}
/Vc
* formatMALDI . Java
*
* Created on June 30, 2005, 2:45 PM
Vc / package psm.mformat; import Java. beans. *; import java.io.*; import javax. servlet. http. HttpServletRequest; import javax. servlet. http. HttpServletResponse; i mport j avax . servl et . Servl etlnputStream ; i mport j ava . uti l . * ; import Java. text. SimpleDateFormat ; import java. text. Decimal Format;
/**
* ©author Brandon
Vc / public class formatMALDITemp { private ArrayList maldiMZ; private ArrayList maldi Intensity; private String notes; private String fileName; public formatMALDITempO { maldiMZ = new ArrayListO; maldi Intensity = new ArrayListO; public int formatMALDlFile(HttpServletRequest request) throws lOException { maldiMZ = new ArrayListO; maldi Intensity = new ArrayListO; notes = "";
ServletlnputStream inStr = request. getlnputStreamO ; byte[] line = new byte [1024]; int i = inStr. readLine(line, 0, 1024);
//The length of the boundary should be greater than three, anything less means an error has occurred, so exit, if Ci < 3) { return 1; }
//Boundary length is the first line minus the first two CR1S that terminate it int boundaryLength = i - 2;
//Retrieves the boundary minus the two CR's
String boundary = new String(line, 0, boundaryLength); fileName = null ;
String tempStr = ""; boolean isFi Ie = false; while Ci != -1) {
//Store the current line as a string String newLine = new String(line, 0, i); if (lisFile) {
//All we care about is the file so loop through all the fields until you hit this. if (newLine.indexθf("filename=\"") != -1) { fi l eName = new Stri ng (l i ne , newLi ne . i ndexOf ("fi l ename=\" ") + 10 , newLi ne . i ndexOf ("\" " , newLi ne . i ndexOf ("f i 1 ename=\" ") )) ; fileName = fileName. replace("\"" , ""); fileName = fileName. trim (); fileName = fileName. substring(0, fileName. lengthO - 4); notes = fileName;
Figure imgf000432_0001
if (! new/Line, startswith (boundary) & newLine.indexOf ("Content") ==
-D {
//This is where reading of the lines of the file occurs, int lCount = 0; //keeps track of the line count while (i != -1 && ! newLine. startswith (boundary)) { lCount ++; //Increment the line count indicating the current position relative to the file contents i = inStr. readl_ine(line, 0, 1024);
//On the filename three is the sample name date and target number, we want this information if (lCount > 1) {
//if lCount is greater than 11 then we are now on the data lines and can start processing that data
//Columns are seperated by a series of spaces, and the peak numbers have a width of a minimum of 3 characters, and both Mass and intensity columns have
//a decimal point, this will be used to determine the position of the numbers and to grab them if (newLine. lengthO < 5) { return 0;} //the last line could possibly be a carriage return, we dont care about this, so just exit.
String [] pline = newLine. split("\t") ;
//now assign this into the mass array, in a new positon. double dx = Double. parseDouble(pli ne [O]) ; //This is for rounding, add .5 to the decimal, and when converted to an int the decimal drops off dx += .5; int di = (int)dx; maldiMZ. add(new integer(di)) ;
//Change to a double and round to the first decimal place dx = Double. parseDouble(pli ne [I]) ; dx += 0.05;
Decimal Format dF = new Decimal Format("00.0") ; maldi intensity. add (new Double (Double. parseDoubl e(d F. format ((dx))))) ;
if ((i==boundaryl_ength+2 | | i==boundaryl_ength+4 && new String(line, 0, i) .startswith(boundary))) {
DW. pri nt(newl_i ne. substri ng(0, newLi ne. length () -2)); else { pw. print(newLine) ;
** / newLine = new String (line, 0, i); } }
//iterate to next line i = inStr. readLine(line, 0, 1024); } return 0;
} public String getNotesO { return notes;
} public void setNotes (String notes) { this. notes = notes;
} public ArrayList getMaldiMZ() { return maldiMZ;
} public void setMaldi MZ (ArrayList maldiMZ) { this. maldiMZ = maldiMZ;
} public ArrayList getMaldilntensityO { return maldi Intensity;
public void setMaldi lntensity(ArrayList maldi intensity) { this. maldi intensity = maldi intensity;
public String getFileNameO { return fileName;
}
/Vc
* formatMALDI . Java
*
* Created on June 30, 2005, 2:45 PM
Vc / package psm.mformat; import Java. beans. *; import java.io.*; import javax. servlet. http. HttpServletRequest; import javax. servlet. http. HttpServletResponse; i mport j avax . servl et . Servl etlnputStream ; i mport j ava . uti l . * ; import Java. text. SimpleDateFormat ; import java. text. Decimal Format;
/**
* ©author Brandon
Vc / public class formatMSMSData { private ArrayList maldiMZ; private ArrayList maldi Intensity; private String targetNum; private Date mdate; private String number; private String notes; private String fileName; private double MW; private String protein; public formatMSMSDataO { maldiMZ = new ArrayListO; maldi Intensity = new ArrayListO; } public int formatMALDlFile(HttpServletRequest request) throws IOException { maldiMZ = new ArrayListO; maldi Intensity = new ArrayListO; mdate= null ; number = notes = targetNum =
ServletlnputStream inStr = request. getlnputStreamO ; byte[] line = new byte [1024]; int i = inStr. readLine(line, 0, 1024);
//The length of the boundary should be greater than three, anything less means an error has occurred, so exit, if Ci < 3) { return 1; }
//Boundary length is the first line minus the first two CR1S that terminate it int boundaryLength = i - 2;
//Retrieves the boundary minus the two CR's
String boundary = new String(line, 0, boundaryLength); fileName = null ;
String tempStr = ""; bool ean i s Fi I e = fal se ; whi l e Ci ! = -1) { the fields until you hit thi lename=\"") + 10 , newLi ne . i
Figure imgf000435_0001
if (! newLine. startswith (boundary) & newLine.indexOf ("Content") ==
-D {
//This is where reading of the lines of the file occurs, int lCount = 0; //keeps track of the line count while (i != -1 && ! newLine. startswith (boundary)) { lCount ++; //Increment the line count indicating the current position relative to the file contents i = inStr. readl_ine(line, 0, 1024); if (lCount > 1) {
//if lCount is greater than 11 then we are now on the data lines and can start processing that data
//Columns are seperated by a series of spaces, and the peak numbers have a width of a minimum of 3 characters, and both Mass and intensity columns have
//a decimal point, this will be used to determine the position of the numbers and to grab them if (newLine. lengthO < 5) { return 0;} //the last line could possibly be a carriage return, we dont care about this, so just exit.
//This format is going to assume a tab delimited file, with the first line containing:
//RM# MW Protein Notes //M/z intensity if (lCount == 2) { //This is the first line
String [] fstline = null ; newLine = newLine. trim (); fstline = newLine. split("\t") ;
//The first string in fstline should be the rm number setNumber(fstline[0]) ;
//Second line is the date if (fstline. length > 2) { //This is the date SimpleDateFormat df = new SimpleDateFormat("MM/dd/yy") ; try { mdate = df.parse( fstline[l]); } catch (Exception e){ mdate = null ; } //The third should be the MW weight setMW(Double. parseDouble(fstline[2])) ;
//The third is teh protein name and the fourth are any notes
//These two are optional and may not exist if (f stl ine. length > 3) {
//This is the protein setProtein(fstline[3]) ; } if (f stl ine. length > 4) {
//the rest are notes setNotes(fstline[4]) ;
} else {
//Not the first line, dump into array String [] dataLine = null; newLine = newLine. trim() ; dataLine = newLine. split("\t") ;
//This should containt one set of strings, the first being the mass to charge ratio
//and the second being the intensity. double mz = Double. parseDouble(dataLine [O]) ; maldiMZ. add (new Double(mz)); double intens = Double.parseDouble(dataLine[l]) ; maldi intensity. add (new Double (i ntens)) ;
}
Λif ((i==boundaryLength+2 | | i==boundaryLength+4 && new
String(line, 0, i) .startswith(boundary))) { pw. print (newLine. substring(O, newLine.length()-2)) ; } else { pw. print(newLine) ;
Vc Vc / newLine = new String (line, 0, i);
}
//iterate to next line i = inStr . readLine(line, 0, 1024);
} return 0;
} public String getTargetNum() { return targetNum;
public void setTargetNum(String targetNum) { thi s . targetNum = targetNum;
public Date getMdateO { return mdate; public void setMdate(Date mdate) { this.mdate = mdate; } public String getNumberO { return number; } public void setNumber (String number) { this. number = number; } public String getNotesO { return notes; } public void setNotes (String notes) { this. notes = notes; } public ArrayList getMaldiMZ() { return maldiMZ; } public void setMaldi MZ (ArrayList maldiMZ) { this. maldiMZ = maldiMZ; } public ArrayList getMaldilntensityO { return maldi Intensity; } public void setMaldi lntensity(ArrayList maldi intensity) { thi s .maldi intensity = maldi intensity; } public String getFileNameO { return fileName; } public double getMW() { return MW; } public void setMW(double MW) { thi s. MW = MW; } public String getProtein() { return protein; } public void setProtein (String protein) { thi s. protein = protein; } importGeneli st . Java
*
* Created on November 17, 2005, 1:01 PM
* To change this template, choose Tools | Options and locate the template under
* the Source Creation and Management node. Right-click the template and choose
* Open. You can then make changes to the template in the Source Editor.
package psm.mformat; import Java. sql . *; import java. beans. *; import java.io.*; import javax. servlet. http. HttpServletRequest; import javax. servlet. http. HttpServletResponse; import javax. servlet.ServletlnputStream; import Java. util . *; import psm.db.dbAccess;
* ©author User public class importGenelist {
/** Creates a new instance of importGenelist */ public importGeneli stO {
public int uploadGenelist(HttpServletRequest request, dbAccess db) throws lOException{
ServletlnputStream inStr = request. getlnputStreamO ; byte[] line = new byte [1024]; int i = inStr . readl_ine(line, 0, 1024);
//The length of the boundary should be greater than three, anything less means an error has occurred, so exit, if Ci < 3) { return 1; }
//Boundary length is the first line minus the first two CR1S that terminate it int boundaryLength = i - 2;
//Retrieves the boundary minus the two CR's
String boundary = new String(line, 0, boundaryLength);
String fileName = null; boolean isFi Ie = false; while Ci != -1) {
//Store the current line as a string String newLine = new String (line, 0, i); if (HsFiIe) { //determine when we reach the file if (newLine.i ndexOf ("filename=\"") != -1) { fileName = new String(line, newLine.indexOf ("filename=\"") + 10 , newLi ne . i ndexOf ("\"" , newLi ne . i ndexOf ( f i 1 ename=\""))) ; fileName = fileName. replace("\"" , ""); fileName = fileName. trim (); is Fi Ie= true;
} else if (newLine. startswith (boundary) && isFile) { return 0;
} else { //if no filename was entered exit if (fileName==null) { return 2; } //Do not read the very last line if (! new/Line, startswith (boundary) & newLine.indexOf ("Content") == -D { while (i != -1 && ! newLine. startswith (boundary)) { i = inStr . readl_ine(line, 0, 1024); newLine = new String (line, 0, i); if (newLine. compareTo("\r\n") == 0) {
//end of file exit return 0;
} if (newLine. trim () != "") {
String[] row = newLine. split("\t") ;
/*
*0 LOCUS
*1 Genus
*2 Species
*3 Subspecies
*4 Subtype
*5 Strain
*6 Location
*7 Location2
*8 Start
*9 End
*10 GBK Coordinates
*11 F/R
*12 NT
*13 AA
*14 MW
*15 IEP
*16 Gene
*17 Code
*18 COG
*19 EC#1
*20 EC#2
*21 Product
*22 Notes
*/
String notes; if (row. length == 23) { notes = row[22] ; } else { notes = ""; } int p = db.insertLocus(row[0] , row[l] , row[2] , row[3] , row[4] , row[5] , row[6] , row[7] , row[8] , row[9] , row [11] , row [12] , row[l 3] , row [14] , row[15] , row [16] , row[17] , row[18] , row [19] , row[20] , row[21] , notes) ; if (p != 0) {return 1;} row = null ;
} //Terminate loop if statement } //terminate second loop i = inStr . readLine(line, 0, 1024); }//terminate if statenemt
} //terminate else statemtn //iterate to next line i = inStr. readLine(line, 0, 1024); }//terminate loop return 0;
/Vc
* importStrai n . Java
*
* Created on October 21, 2005, 11:20 AM
Vc / package psm.mformat; import Java. sql . *; import Java. beans.*; import java.io.*; import javax. servlet. http. HttpServletRequest; import javax. servlet. http. HttpServletResponse; import javax. servlet.ServletlnputStream; import Java. util . *; import psm.db.dbAccess; /**
*
* @author User
Vc / public class importStrai n {
/** Creates a new instance of importStrai n */ public importStrai n() {
public int parseandlmportStrain(HttpServletRequest request, dbAccess db) throws lOException { boolean updDate = false, updGenus = false, updSpecies = false, updSubspecies = false, updSubtype = false, updNotes = false, updHist = false, append = false;
ServletlnputStream inStr = request. getlnputstream() ; int len = 1024;
byte[] line = new byte [len]; int i = i nStr. readLi ne(li ne, 0, len);
//The length of the boundary should be greater than three, anything less means an error has occurred, so exit, if Ci < 3) { return 1;
//Boundary length is the first line minus the first two CR1S that terminate it int boundaryLength = i - 2;
//Retrieves the boundary minus the two CR's
String boundary = new String(line, 0, boundaryLength);
String fileName = null; boolean isFi Ie = false; while Ci != -1) {
//Store the current line as a string String newLine = new String (line, 0, i); if (M sFi Ie) { //determine when we reach the file if (newLine.i ndexOf ("filename=\"") != -1) { fileName = new String (line, newLine. indexθf("filename=\"") + 10 , newLi ne . i ndexOf ("\"" , newLi ne . i ndexOf ("f i 1 ename=\""))) ; fileName = fileName. replace("\"" , ""); fileName = fileName. trim (); is Fi Ie= true; } else if (newLine. startswith (boundary) && isFile) { return 0; } else if ( newLine.indexOf ("name=\"") != -1) { //get options
//this is a field
// get the field name int pos = newLine. indexOf("name=\"") ;
String fieldName = newLine. substring(pos+6, newLine. length()-3) ;
//All the field names are options, and are only there if checked if (fieldName.compareTo("date") == 0) { updDate = true; } else if (fieldName. compareTo("Genus") == 0) { updGenus = true; } else if (fieldName. compareToC'Species") == 0) { updSpecies = true; } else if (fieldName. compareToC'Subspecies") == 0) { updSubspecies = true; } else if(fieldName.compareTo("Subtype") == 0) { updSubtype = true; } else if (fieldName. compareToC'notes") == 0) { updNotes = true; } else if(fi el dName.compareTo("Hi story") == 0) { updHist = true; } else if (fieldName. compareτo("append") == 0) { append = true; }
} else {
//if no filename was entered exit if (fileName==null) { return 2;
}
//Do not read the very last line if (! new/Line, startswith (boundary) & newLine.indexOf ("Content") == -D { while (i != -1) { i = inStr . readl_ine(line, 0, len); newLine = new String (line, 0, i); if (newLine. compareTo("\r\n") == 0) {
//end of file exit return 0; } if (newLine.trimO != "" && newLine. trim() .compareTo(boundary + "--") != 0) {
String[] row = newLine. split("\t") ;
//The String columns should be as follows
//Y) identifier + Number
//2) Date
//3) Genus
//4) Species
//5) Subspecies
//6) Subtype
//7) Notes
//8) History int sampleid = 0; int gtent = 0, stent = 0, sptent = 0, otent = 0;
//Check for name tentativity and parse out any ? mark if (row[2].indexOf("?") != -1 ) { row[2].replace("?",""); gtent = 1; if (row[3].indexOf("?") != -1 ) { row[3].replace("?",""); stent = 1; } if (row[4].indexθf("?") != -1 ) { row[4].replace("?",""); sptent = 1; if (row[5].indexOf("?") != -1 ) { row[5].replace("?",""); otent = 1; }
//First get the sample_id String sel Sample = "SELECT sample_id FROM sample, identifier WHERE identifier .identifier_id = sample. identifier_id AND CONCAT(identifier .ident, sample. number) = '" + row[0] +" ' " ;
Java. sql . ResultSet myRS; try {
Figure imgf000443_0001
database
//Get a list of all the identifiers in the DB, compare it to the sample and try to seperate the prefix from the numbers myRS = db.getldentPrefixO ; int prlD = -1; //keeps track of the prefix id String prfx = "";
//Cycle through the prefixes and compare it to the ident string while (myRS. next O) { if (row[0] .startsWith(myRS.getString("ident"))) {
//if the string starts with one of the prefixes check and see if it identified with an earlier one as well
//if the string did, then choose the longer of the two, assuming that is the correct one. if (prlD == -1) { prlD = myRS.getlnt("identifier_id"); prfx = myRS.getStringC'ident") ; } else { if (prfx.length() < myRS.getStringC'ident") .lengthO) { prlD = myRS.getlnt("identifier_id") ; prfx = myRS.getStringC'ident");
} }
}//end while
//if prlD still equals -1 then the identifier doesn't exist, so exit if (prlD ==-1) { return 1; } else {
//now insert the strain int idNumber =
Integer. parselnt(row[0] . substring(prfx.length())) ; int erd; if (row. length == 8) { erd = db. i nsertNewStrai n(prip, idNumber, row[l] , db.insertNewGenus(row[2] . trimO) , db.insertNewSpecies(row[3] . trimO) , db.insertNewSubspecies(row[4] . trim()) , db.insertNewSubtype(row[5] . trim()) , row[6] . trimO , row[7] . trim() ,gtent, stent, sptent, otent) ;
} else { era = db. i nsertNewStrai n(prip, idNumber, row[l] , db.insertNewGenus(row[2] . trim()) , db.insertNewSpecies(row[3] . trim()) , db.insertNewSubspecies(row[4] . trimO) , db.insertNewSubtype(row[5] . trimO) , row[6] . trim() , "",gtent, stent, sptent, otent);
//if a db error occurred exit if (erd != 0 ) { return 1; } else {
//skip the rest of the loop continue; }
}
} } catch (SQLException e) { return 1; }
String slctStrain = "SELECT strain_id FROM strain WHERE genus_id=" + db.insertNewGenus(row[2] . trimO) + " AND species_id=" + db.insertNewSpecies(row[3] . trimQ) + " AND subspecies_id=" + db.insertNewSubspecies(row[4] . trimO) + " AND subtype_id=" + db. i nsertNewSubtype(row[5] . trimO) ; int strainID; try { myRS = db.getRS(slctStrain) ; if (myRS. next Q) {
//the strain already exists, use this id strainID = myRS.getInt("strain_id") ; } else {
//the strain does not exist, make a new one and use the new id myRS.closeO ;
//Insert the strain ID, now get it the same way as above
String insrtStrain; insrtStrain = "INSERT INTO strain (genus_id, species_id, subspecies_id, subtype_id) VALUES(" + db.insertNewGenus(row[2] . trimO) + "," + db.insertNewSpecies(row[3] . trimO) + "," + db.insertNewSubspecies(row[4] . trimO) + "," + db.insertNewSubtype(row[5] . trim()) db. executeStri ng(i nsrtStrai n) ; myRS = db.getRS(slctStrain) ; myRS. nextO ; strainID = myRS.getInt("strain_id") ; myRS.closeO ;
} catch (SQLException e) { return 1;
//Check waht to update then udpate it
String updStmt = "UPDATE sample SET ";
//Date if (updDate) { updStmt += "date = '" + row[l] + "',"; }
//Genus if (updGenus) { updstmt += "tentative_genus = " + gtent + ",";
//Species if (updSpecies) { updstmt += "tentative_species = " + stent + ","; }
//Subspecies if (updSubspecies) { updstmt += "tentative_subspecies = " + sptent + ",";
//Subtype if (updSubtype) { updstmt += "tentative_subtype = " + otent + ",";
if (updGenus | | updSpecies | | updSubtype | | updSubspecies) { updstmt += "strain_id = " + strainID + ",";
//Notes if (updNotes) { if (append) { updstmt += " notes=CONCAT_WS(' ', sample. notes, 1 " + row[6].trim() + "'),";
} else { updstmt += " notes='" + row[6] .trimO + '" ,"; }
//History if (updHist && row. length == 8) { if (append) { updstmt += " history=CONCAT_WS(' ', sample. history, '" + row[7] . trim() + '"),";
} else { updstmt += " history="' + row[7] . trim() + '",";
}
//Remove the last comma from the statement updstmt = updstmt. substring(O, updstmt. length() - 1); updstmt += " WHERE sample_id = " + Integer. toString(sampleid) ; db. executeStri ng(updstmt) ; } //Terminate loop if statement } //terminate second loop i = inStr . readLine(line, 0, len); }//terminate if statenemt
} //terminate else statemtn //iterate to next line i = inStr . readl_ine(line, 0, len); }//terminate loop return 0; } //termiante function public int parseandlmportNoteData(HttpServletRequest request, dbAccess db) throws IOException { boolean updDate = false, updGenus = false, updSpecies = false, updSubspecies = false, updSubtype = false, updNotes = false, updHist = false, append = false;
ServletlnputStream inStr = request. getlnputStreamO ; int len = 1024; byte[] line = new byte [len]; int i = i nStr. readLi ne(li ne, 0, len);
//The length of the boundary should be greater than three, anything less means an error has occurred, so exit, if Ci < 3) { return 1; } inate
+ 10
Figure imgf000446_0001
if (! newLine. startswith (boundary) & newLine.indexOf ("Content") == -D { while (i != -1) { i = inStr . readLine(line, 0, len); newLine = new String (line, 0, i); if (newLine. compareTo("\r\n") == 0) { //end of file exit return 0; } if (newLine. trim () != "" && newLine. trim() .compareTo(boundary + "--") != 0) {
String updstmt = "UPDATE sample s, identifier i set s. notes = CONCAT_ws('%n9tes%' , s. notes, ' ') WHERE CONCAT(i .ident, s. number) = '%RMNUM%' AND s . i denti f i er_i d = i .identifier_id" ;
String[] row = newLine. split("\t") ; updstmt = updstmt. replaceAll ("%notes%", row[l] .trimO); updstmt = updstmt. replaceAll ("%RMNUM%", row[0] .trim()); db. executeStri ng(updstmt) ; } //Terminate loop if statement } //terminate second loop i = inStr . readl_ine(line, 0, len); }//terminate if statenemt
} //terminate else statemtn //iterate to next line i = inStr . readLine(line, 0, len); }//terminate loop return 0; } //termiante function
} //terminate class
/Vc
* pageCode. Java
*
* Created on August 11, 2005, 1:10 PM
Vc / package psm.web; import Java. beans. *; import java.io.Serializable; import java.io.*; import psm.db.dbAccess; import Java. sql . *; /**
* ©author User
Vc / public class pageCode { private String pageHeader; private String pageFooter; public pageCodeO {
} public int splitTemplatePage(String username, String title, String titleSource, String Appdi rectory, dbAccess myDB) {
File tmplateFile = new FiIeC Appdi rectory + "/template/template. html ") ; try {
FileReader myFilereader = new FileReaderCtmplateFile) ; BufferedReader inStr = new BufferedReaderCmyFilereader) ; String tmpStr = ""; boolean footer = false; while CtmpStr != null & tmpStr != "null") { if CtmpStr != "") { if CtmpStr. indexθfC"$MIDDLE$") != -1) { footer = true; } else if Cfooter==true) { pageFooter += tmpStr; } else { pageHeader += tmpStr;
} tmpStr = inStr . readLineC) ;
String splitPage[];
//Setup the page by replacing the appropriate markers with what is requi red pageHeader = pageHeader . replaceC"$τiTLE$" , title); pageHeader = pageHeader . replaceC"$USERNAME$" , username); pageHeader = pageHeader . replaceC'null ", ""); pageFooter = pageFooter . replaceC'null ", "");
//Get the strains last update
ResultSet myRS = myDB.getRSC'SELECT date FROM lastupdate") ; myRS. nextC) ; pageHeader = pageHeader . replaceC"$LASTDATE$" , myRS.getStringC'date")) ; myRS.closeC) ; if CmyDB. getUsernameC) ■ compareToC'rmandrell ") != 0 && myDB.getUsernameC) -compareToCpsmlogin") != 0) {
//find admin only items and remove it from the page int start = pageHeader .indexOf("<! --adminonly{-->") ; int end = pageHeader. indexOf("<! --}adminonly-->") ; while (start != -1 && end != -1) { end += 17; pageHeader = pageHeader. replace (pageHeader. substri ng (start, end) , start = pageHeader . i ndexθf("<! --admi nonly{-->") ; end = pageHeader . i ndexθf("<! --}adminonly-->") ;
} start = pageFooter .indexOf("<! --admi nonly{-->") ; end = pageFooter .indexOf("<! --}adminonly-->") ; while (start != -1 && end != -1) { end +=17; pageFooter = pageFooter. replace (pageFooter. substri ng (start, end) , start = pageFooter .indexOf("<! --admi nonly{-->") ; end = pageFooter . i ndexθf("<! --}adminonly-->") ;
} my Fi I e reader . cl ose () ; return 0; } catch (Exception e) { return 1; }
} public String getPageHeader() { return pageHeader;
public void setPageHeader (String pageHeader) { this. pageHeader = pageHeader;
public String getPageFooter() { return pageFooter;
public void setPageFooter (String pageFooter) { this. pageFooter = pageFooter;
<?xml version="1.0" encoding="UTF-8"?>
<!-- You may freely edit this file. See commented blocks below for -->
<!-- some examples of how to customize the build. -->
<!-- (if you delete it and reopen the project it will be recreated.) -->
<project name="PSM_web" default="default" basedir=".">
<description>Builds, tests, and runs the project PSM_web.</description>
<import file="nbproject/build-impl .xml "/>
<! --
There exist several targets which are by default empty and which can be used for execution of your tasks. These targets are usually executed before and after some main targets. They are:
-pre-init: called before initialization of project properties -post-init: called after initialization of project properties -pre-compile: called before javac compilation -post-compile: called after javac compilation -pre-compi 1 e-si ngl e : called before javac compilation of single file -post-compi 1 e-si ngl e : called after javac compilation of single file -pre-compi 1 e-test : called before javac compilation of JUnit tests -post-compi 1 e-test : called after javac compilation of JUnit tests -pre-compi 1 e-test-si ngl e : called before javac compilation of single JUnit test
-post-compi 1 e-test-si ngl e : called after javac compilation of single JUunit test
-pre-dist: called before jar building
-post-dist: called after jar building
-post-clean: called after cleaning build products
-pre-run-deploy: called before deploying
-post-run-deploy: L cΛalIl ieeud d afit LCeΓr u dteψpliuoyyii rniyg
Example of pluging an obfuscator after the compilation could look like
<target name="post-compile">
<obfuscate>
<fileset di r="${build. classes. di r}"/>
</obfuscate> </target>
For list of available properties check the imported nbproject/build-impl .xml file.
Other way how to customize the build is by overriding existing main targets. The target of interest are:
1 mi t-macrodef-javac : defines macro for javac compilation inii t-macrodef-j uni t : defines macro for junit execution i ni t-macrodef-debug : defines macro for class debugging do-dist: jar archive building run : execution of project javadoc-build: javadoc generation
Example of overriding the target for project execution could look like
<target name="run" depends="<PROJNAME>-impl . jar">
<exec dir="bin" executable="launcher .exe"> <arg file="${dist. jar}"/>
</exec> </target>
Notice that overridden target depends on jar target and not only on compile target as regular run target does. Again, for list of available properties which you can use check the target you are overriding in nbproject/build-impl .xml file. -->
</project>
Installation and Setup of PSMDB
Author: Brandon Garbus Last Update: 9/18/2005
Description
This documentation provides a series of steps for installing and securing the ?psmdb? server on a Dell PowerEdge 2800. while these steps may be applied to any PC the installation steps for Windows 2000 are specific for any RAID configuration. The client machine in this document refers to the PC that has direct access to the psmdb server. This machine is able to directly connect to MySQL to make backups and insert MALDI-TOF MS data. Note that these instructions assume that the SCSI RAID device is already installed and configured correctly, in the event of a failure of the hardware please consult the hardware documentation or call Dell technical support.
Material s
Windows 2000 CD-ROM Manufacturer SCSI/RAID Drivers
Restore Disc Most Recent psmdb backup
Norton internet Security Most Recent MySQL DB backup
USB Floppy Drive Dell PowerEdge Service and Diagnostic
Utilities
Procedure
1. Installation of Windows 2000 on the Dell PowerEdge 2800 a. First attach the USB Floppy drive to one of the USB ports on the machine. b. Power on the server and insert the Windows 2000 CD-ROM. c. insert the Manufacturers SCSI/RAID Drivers into the floppy drive. d. When prompted press F8 to install the third party RAID drivers and follow the onscreen instructions to install the drivers. e. If an error occurs, or the amount of disk space present looks incorrect it may be necessary to reconfigure the RAID array. Consult manual documentation for this. f. Continue following onscreen instructions until Windows 2000 is installed.
2. Installation of hardware drivers. a. insert the pell PowerEdge Service and Diagnostic Utilities CD-ROM b. if AutoRun is enabled Internet Explorer should open and display a web page. c. Select PowerEdge 2800 under Select Server: d. Select Microsoft windows 2000 under Select Drivers/Utilities Set and press continue. e. install the following sets of drivers by extracting the respective zip files (These are self extracting zip files) by clicking on the hyperlinks. i. Intel: Chipset Software Installation Utility (Driver) ii. Microsoft: SCSI Port fix for BSOD OxDl for W2κ (Patch/Upgrade) iii. Intel: PRO Gigabit Adapters (Driver) iv. ATI: Radeon 7000M (Driver)
3. Installing Service Pack 3 and Service Pack 4 a. insert the custom Restore Disc. b. Navigate to the directory Restore Disc\Server. c. Double click on w2Ksp3.exe and follow the on screen instructions for installation. A reboot may be necessary. d. When finished do the same for w2kSP4_EN.exe. Again, a reboot may be required.
4. Installing the Microsoft Installer a . wi th the Restore Di sc sti l l i n the CD-ROM and i n the . \Server di rectory i nstal l lnstMsiw . exe by doubl e cl i cki ng on the i con and fol l owi ng the onscreen i nstructi ons . Another reboot may be requi red .
5. Installing Norton Internet Security. a. Insert the Norton Internet Security CD-ROM and follow the onscreen instructions for installation. A reboot may be necessary.
6. Setting up the network connection a . Pl ug i n the RJ -45 Ethernet cabl e i nto the server . b . Navi gate to Network and Di al -up Connecti ons . Start > Setti ngs > Network and Di al -up Connecti ons . There shoul d be two connecti ons al ready l i sted . Local Area Connecti on and Local Area Connecti on 2 . c. Right click on Local Area Connection and select Properties. d. Select the Sharing tab. Make sure that Enable Internet Connection Sharing for this connection is disabled, NOT checked. e. Select the General tab. Select internet Protocol (TCP/IP) and click the Properties button. f. Select the option use the following IP address. Use the below information to fill out the fields. i. IP Address: 147.49.4.115 ii. Subnet mask: 255.255.O.O iii. Default gateway: 147.49.254.252 iv. Preferred DNS server: 147.49.50.52 v. Alternate DNS server: 147.49.50.49 g. Click the Advanced button, h. Select the WINS tab. i. Disable NetBIOS by selecting the Disable NetBios over TCP/IP option. j. Select the Options tab. k. Select TCP/IP filtering.
1. Click the Properties button m. For UDP Ports and IP Protocols Select the Permit Only option. n. Press OK. Until you exit out of Local Area Connection.
7. Password protect the screen saver a. Right Click on an empty area of the desktop. b. Select Properties. c. Select the Screen Saver tab. d. For a screen saver select Logon Screen Saver, or Blank. e. Make sure the Password protected checkbox is selected. f . Press OK .
8. Di sabl e Unnecessary servi ces a . Cl i ck Start > Setti ngs > Control Panel . b . Doubl e cl i ck Admi ni strati ve Tool s . c . Doubl e cl i ck Component Servi ces . d . in the l eft tree-vi ew sel ect Servi ces (Local ) . e . Di sabl e the fol l owi ng servi ces by ri ght cl i cki ng on a servi ce , sel ecti ng Properti es , and sel ect Di sabl ed for the Startup type . i . Messenger ii . Print Spooler iii. Remote Registry Service iv. Routing and Remote Access v. Server f. Reboot the machine.
9. Installing Windows Updates a. Open Internet Explorer. b. if prompted by Norton internet Security, make sure to permit IE to access the internet, if not prompted, and IE will not display a web page, manually add IE to the permitted applications list in Norton internet Security Firewall. c. in IE select Tools > windows Update. d. Follow the onscreen instructions to install all critical security patches and hardware updates. Do NOT install the following i. windows Media Player Upgrade i i . . Net i i i . Di rect X e. It will be necessary to reboot and repeat this process many times until all updates have installed successfully.
10. Configuring IPSec a. For further information on IPSec documentation can be obtained at http : //www. mi crosoft . com/technet/i tsol uti ons/network/securi ty/i psecl d . mspx b. Click Start > Settings > Control Panel. c. Double click Administrative Tools. d. Double click Local Security Policy. e. in the left tree-view select IP Security Policies on Local Machine. f. Right click in the right pane and select Manage IP filter lists and filter actions. g. Click Add. h. For the name type ?psmdb? i . Click Add? i. A wizard will appear, click next.
K. For Source address select Any IP Address. Press next 1. For Destination address select A specific IP Address. m. Enter 147.49.4.115 for the IP Address. Press next, n. For Select a protocol type: choose TCP. Press next.
0. Select the To this port: option and enter 80 (From any port to this port: 80). Press Next. p. Press Finish. q. Press OK. r. Follow the same procedure described above for the following filter
1. Name: MySQL Rule ii . Protocol : TCP iii. Source Port: ANY iv. Destination Port: 3306 v. Source: A specific IP Address
1. IP Address: 147.49.3.158 (This is the client IP address) vi . Destination: A specific IP Address
1. IP Address: 147.49.4.115 s. Follow that same procedure again for this rule i. Name: All Inbound Traffic ii . Protocol : Any iii . Source: Any iv. Source Port: Any v. Destination: A specific IP Address
I. IP Address: 147.49.4.115 vi . Destination Port: Any t. Select the Manage Filter Actions tab. u. Click Add? v. Press next. For the name enter Block. Press next. w. Select the Block option. Press next. x. Press finish. y. Press Close. z. Back in the Local Security Settings right click in the right pane and select
Create IP Security Policy. aa. Press Next. bb. For name enter PSMDBPolicy. Press next. cc. Make sure the Acticate the default response rule box is unchecked. Press next. dd. Make sure the Edit properties checkbox IS checked. ee. Select Add? ff. Press next. gg. Press next. (This rule does not specifiy a tunnel)
Fm. Press next. (All network connections) ii. Press next, (windows 2000 default (Kerberos V5 protocol)) jj. Select All inbound Traffic. Make sure the option circle is selected. kk. Press next.
II. Select Block. Press next. Press finish. mm. Repeat the same steps for MySQL Rule and the psmdb Rule except choose Permit, instead of Block, nn. Press OK.
00. Right click on the PSMDBPolicy in the right pane and choose Assign, pp. Close Local Security Settings.
11. User Account Settings a. In Control Panel double click on Users and Passwords. b. Make sure the Users must enter a user name and password to use this computer, checkbox is checked. c. Select the Guest account under users for this computer: d. Create a long hard to guess password for this account. By click Set Password? e. Select the Advanced tab. f . Check Requi re users to press Ctrl -Al t-Del ete before l oggi ng on . g. Click the Advanced button. h. in the left pane select the Users folder.
1. Make sure the Guest account is disabled by right clicking on Guest, and selecting Properties. Make sure these checkboxes are checked. i . User cannot change password ii. Password never expires iii . Account is disabled j . Press OK. k. Close Local users and Groups.
1. Press OK.
12. Installation of Java a. with the Restore Disc in the CD Reader double click on idk-l_5_0_05-windows-i 586-p.exe. b. Follow the instructions to install Java. c. Right click on My Computer. Click Properties. d. Click the Advanced tab. e. Click Enviornment Variables? button. f. Click New? under User variables for Administrator. g. Enter the following information π . Variable Name: JAVA_HOME ii . Variable Value: c:\Program Files\Java\jdkl.5.0_04
1. This should be where you installed Java h. Press OK. Repeat the process for: i . Variable Name: PATH ii . Variable Value: c:\Program Files\Java\jdkl.5.0_04\bin
1. This should be where the \bin directory is in the Java directory
13. Installation of MySQL a. with the Restore Disc in the CD Reader double click on Setup.exe b. Follow the onscreen installation instructions, check the box at the end that permits you to configure the server. c. Press next. d. Select Detailed Configuration. Press next. e. Select Server Machine. Press next. f. Select Multifunctional Database. Press next. g. Press next. Select Manual Setting. For Concurrent connections choose 50. Press next. h. Press next. i . Press next. i. Press next.
K. Enter the root password. Press next.
1. Press execute.
14. Installation of MySQL utilities a. Install mysql-administrator-1.1.2-win.msi from the Restore CD. Simply follow the onscreen instructions. b. Do the same for mysql-query-browser-1.1.14-win.msi . c. Copy mysql -connector-java-3.1.10-bin. jar from the CD to C:\mysqljdbc (This directory will need to be created).
15. Restoring the databases a. Open MySQL Administrator. Click the ellipses button. b. Click Add new Connection. And fill out the form, i . Username: root ii. Password: (The root password) iii. Hostname: local host c. Click Apply. Click Close. d. Enter the password again and press OK. e. in the left pane select Restore. Then click on the Open Backup File button. f. Inert the most recent backup CD and find the most recent database backup. It will be psmdbbak DATE CREATED. sql g. Next click on start restore, h. Close MySQL Administrator. i . Naviage to the MySQL Installation Directory (C:\Program Files\MySQL\MySQL Server
4.1) and go to the Data directory. j. Copy the mysql folder from the backup cd and replace the folder and all of its contents on the machine. k. Make sure the folder is not read only. Right click on the folder. Select
Properties, if the checkbox for Read-only is checked, uncheck it. Do the same procedure for every file in the /Data/mysql directory.
16. Installation of Apache a. Run jakarta-tomcat-5.5.9.exe from the CD-ROM b. Press next until you reach the Choose Components part of the install. c. Click the + sign next to the word Tomcat and make sure the Service checkbox is selected. Press next. d. Press next. e. Press next. f. For HTTP/1.1 Connector Port erase 8080 and enter 80. g. Enter a password for administrator login, n. Press next. i . Press Install .
17. Installation of PSM_Web a. From the backup CD copy the PSM_web directory into the webapps directory of the Apache Tomcat installation (Apache Tomcat Di rectory/webapps) b. Navigate to the Directory, Tomcat Install ation/conf/Catalina/local host c. Copy PSM_web.xml from the Restore CD to this location d. Follow the same steps above, except with USDACl ub.

Claims

WHAT IS CLAIMED IS:
1. A method for identification of an unknown protein comprising:
(i) comparing mass-to-charge (m/z) fragment ion peaks from an mass spectrum of the unknown protein to that of m/z fragment ion peaks from mass spectra of known protein sequences; and
(ii) matching the m/z fragment ion peaks from the mass spectrum of the unknown protein to the m/z fragment ion peaks from the mass spectra of known protein sequences to provide mass spectrometry peak matches; (iii) scoring the mass spectrometry peak matches using a USDA peak matching algorithm thereby providing a USDA peak matching score; and (iv) ranking the USDA peak matching score from highest to lowest; wherein the highest USDA peak matching score constitutes an identification of the unknown protein.
2. The method of claim 1 , wherein the USDA peak matching algorithm is USDA peak matching algorithm α, which has the formula:
2 x (Number of peak matches)
USDA a Score = 100 x
(Number of peaks in the mass spectrum of the unknown protein + Number of peaks in the mass spectrum of known protein sequences)
3. The method of claim 1 , wherein the USDA peak matching algorithm is USDA peak matching algorithm β, which has the formula:
Number of peak matches USD Aβ Score = 100 x
(Number of MS/MS fragment ion peaks)
4. The method of claim 1 , wherein the difference between the highest USDA peak matching score and the second highest USDA peak matching score is equal to or greater than 2.
5. The method of claim 1, wherein the mass spectra are members selected from the group consisting of MS spectra and MS/MS spectra.
6. The method of claim 5, wherein the mass spectrum of the unknown protein is an MS spectrum and wherein the mass spectra of known protein sequences are MS spectra of known proteins.
7. The method of claim 5, wherein the mass spectrum of the unknown protein is an MS/MS spectrum and wherein the mass spectra of known protein sequences are members of the group consisting of in silico MS/MS spectra generated from a genomically-derived database of protein sequences and MS/MS spectra of known proteins.
8. The method of claim 7, wherein the mass spectra of known protein sequences are in silico MS/MS spectra generated from a genomically-derived database of protein sequences.
9. The method of claim 8, further comprising:
(v) confirming that the highest USDA peak matching score constitutes an identification of the unknown protein, wherein the confirming comprises: plotting the difference in m/z (Am/z ) between an MS/MS fragment ion of the unknown protein and its matched fragment ion from the in silico MS/MS spectra generated from a genomically-derived database of protein sequences as a function of MS/MS fragment ion m/z, thereby providing a plot of Am/z vs MS/MS fragment ion m/z, wherein a correct protein identification is indicated when the plot of Am/z vs MS/MS fragment ion m/z reveals a characteristic systematic error related to the inherent calibration error of the mass analyzer, and wherein an incorrect protein identification is indicated when the plot of Am/z vs MS/MS fragment ion m/z reveals statistically random error.
10. The method of claim 8, further comprising:
(v) confirming that the highest USDA peak matching score constitutes an identification of the unknown protein, wherein the confirming comprises: performing steps (i) - (iv) , wherein the in silico MS/MS spectra generated from a genomically-derived database of protein sequences are limited to spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, glutamate (E) residue or proline (P) residue, and
(vi) observing that the difference between the highest USDA peak matching score and the second highest USDA peak matching score is equal to or greater than the difference between the highest USDA peak matching score and the second highest USDA peak matching score obtained when steps (i) - (iv) are performed using in silico MS/MS spectra generated from a genomically-derived database of protein sequences that are not limited spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, glutamate (E) residue or proline (P) residue, thereby confirming that the highest USDA peak matching score constitutes an identification of the unknown protein.
11. The method of claim 10, wherein the confirming comprises: performing steps (i) - (iv) , wherein the in silico MS/MS spectra generated from a genomically-derived database of protein sequences are limited to spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue; and
(vi) observing that the difference between the highest USDA peak matching score and the second highest USDA peak matching score is equal to or greater than the difference between the highest USDA peak matching score and the second highest USDA peak matching score obtained when steps (i) - (iv) are performed using in silico MS/MS spectra generated from a genomically-derived database of protein sequences that are not limited spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, thereby confirming that the highest USDA peak matching score constitutes an identification of the unknown protein.
12. The method of claim 1, wherein the unknown protein is a protein toxin.
13. The method of claim 1, wherein identification of the unknown protein is used to identify the source organism from which the unknown protein derived.
14. The method of claim 13, wherein the source organism is a member selected from the group consisting of: viruses, microorganisms, insects, plants, and animals.
15. The method of claim 13, wherein the source organism is a microorganism selected from the group consisting of: bacteria and fungi.
16. The method of claim 15, wherein the source organism is a bacterium that is a member selected from the group consisting of Campylobacter, Escherichia coli, Listeria, and Salmonella.
17. A computer readable storage medium storing instructions that, when executed by a computer, causes the computer to perform a method for identification of an unknown protein comprising:
(i) comparing mass-to-charge (m/z) fragment ion peaks from an mass spectrum of the unknown protein to that of m/z fragment ion peaks from mass spectra of known protein sequences; and
(ii) matching the m/z fragment ion peaks from the mass spectrum of the unknown protein to the m/z fragment ion peaks from the mass spectra of known protein sequences to provide mass spectrometry peak matches; (iii) scoring the mass spectrometry peak matches using a USDA peak matching algorithm thereby providing a USDA peak matching score; and (iv) ranking the USDA peak matching score from highest to lowest; wherein the highest USDA peak matching score constitutes an identification of the unknown protein.
18. The method of claim 17, wherein the USDA peak matching algorithm is USDA peak matching algorithm α, which has the formula:
2 x (Number of peak matches)
USDA a Score = 100 x
(Number of peaks in the mass spectrum of the unknown protein + Number of peaks in the mass spectrum of known protein sequences)
19. The method of claim 17, wherein the USDA peak matching algorithm is USDA peak matching algorithm β, which has the formula:
Number of peak matches USD Aβ Score = 100 x
(Number of MS/MS fragment ion peaks)
20. The method of claim 17, wherein the difference between the highest USDA peak matching score and the second highest USDA peak matching score is equal to or greater than 2.
21. The method of claim 17, wherein the mass spectra are members selected from the group consisting of MS spectra and MS/MS spectra.
22. The method of claim 21, wherein the mass spectrum of the unknown protein is an MS spectrum and wherein the mass spectra of known protein sequences are MS spectra of known proteins.
23. The method of claim 21, wherein the mass spectrum of the unknown protein is an MS/MS spectrum and wherein the mass spectra of known protein sequences are members of the group consisting of in silico MS/MS spectra generated from a genomically-derived database of protein sequences and MS/MS spectra of known proteins.
24. The method of claim 23, wherein the mass spectra of known protein sequences are in silico MS/MS spectra generated from a genomically-derived database of protein sequences.
25. The method of claim 24, further comprising:
(v) confirming that the highest USDA peak matching score constitutes an identification of the unknown protein, wherein the confirming comprises: plotting the difference in m/z (AmIz ) between an MS/MS fragment ion of the unknown protein and its matched fragment ion from the in silico MS/MS spectra generated from a genomically-derived database of protein sequences as a function of MS/MS fragment ion m/z, thereby providing a plot of Am/z vs MS/MS fragment ion m/z, wherein a correct protein identification is indicated when the plot of Am/z vs MS/MS fragment ion m/z reveals a characteristic systematic error related to the inherent calibration error of the mass analyzer, and wherein an incorrect protein identification is indicated when the plot of Am/z vs MS/MS fragment ion m/z reveals statistically random error.
26. The method of claim 24, further comprising:
(v) confirming that the highest USDA peak matching score constitutes an identification of the unknown protein, wherein the confirming comprises: performing steps (i) - (iv) , wherein the in silico MS/MS spectra generated from a genomically-derived database of protein sequences are limited to spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, glutamate (E) residue or proline (P) residue, and
(vi) observing that the difference between the highest USDA peak matching score and the second highest USDA peak matching score is equal to or greater than the the difference between the highest USDA peak matching score and the second highest USDA peak matching score obtained when steps (i) - (iv) are performed using in silico MS/MS spectra generated from a genomically-derived database of protein sequences that are not limited spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, glutamate (E) residue or proline (P) residue, thereby that the highest USDA peak matching score constitutes an identification of the unknown protein.
27. The method of claim 26, wherein the confirming comprises: performing steps (i) - (iv) , wherein the in silico MS/MS spectra generated from a genomically-derived database of protein sequences are limited to spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue; and
(vi) observing that the difference between the highest USDA peak matching score and the second highest USDA peak matching score is equal to or greater than the difference between the highest USDA peak matching score and the second highest USDA peak matching score obtained when steps (i) - (iv) are performed using in silico MS/MS spectra generated from a genomically-derived database of protein sequences that are not limited spectra generated by displaying only fragment ions generated by fragmentation at an aspartate (D) residue, thereby confirming that the highest USDA peak matching score constitutes an identification of the unknown protein.
28. The method of claim 17, wherein the unknown protein is a protein toxin.
29. The method of claim 17, wherein identification of the unknown protein is used to identify the source organism from which the unknown protein derived.
30. The method of claim 29, wherein the source organism is a member selected from the group consisting of: viruses, microorganisms, insects, plants, and animals.
31. The method of claim 30, wherein the source organism is a microorganism selected from the group consisting of: bacteria and fungi.
2. The method of claim 31, wherein the source organism is a bacterium that is a member selected from the group consisting of Campylobacter, Escherichia coli, Listeria, and Salmonella.
PCT/US2009/054796 2008-08-22 2009-08-24 Rapid identification of proteins and their corresponding source organisms by gas phase fragmentation and identification of protein biomarkers Ceased WO2010022400A2 (en)

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US9103908P 2008-08-22 2008-08-22
US61/091,039 2008-08-22
US19160908P 2008-09-09 2008-09-09
US61/191,609 2008-09-09
US12/415,741 US8160819B2 (en) 2008-08-22 2009-03-31 Rapid identification of proteins and their corresponding source organisms by gas phase fragmentation and identification of protein biomarkers
US12/415,741 2009-03-31

Publications (2)

Publication Number Publication Date
WO2010022400A2 true WO2010022400A2 (en) 2010-02-25
WO2010022400A3 WO2010022400A3 (en) 2010-07-08

Family

ID=41707690

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2009/054796 Ceased WO2010022400A2 (en) 2008-08-22 2009-08-24 Rapid identification of proteins and their corresponding source organisms by gas phase fragmentation and identification of protein biomarkers

Country Status (2)

Country Link
US (1) US8160819B2 (en)
WO (1) WO2010022400A2 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3438274A4 (en) * 2016-03-31 2019-12-25 Shimadzu Corporation METHOD FOR IDENTIFYING A MICROORGANISM

Families Citing this family (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2585453C (en) * 2004-10-28 2020-02-18 Cerno Bioscience Llc Qualitative and quantitative mass spectral analysis
WO2007037301A1 (en) * 2005-09-29 2007-04-05 Kyowa Hakko Kogyo Co., Ltd. Process for producing useful substance
CN102317789B (en) * 2008-10-31 2014-08-27 生物梅里埃公司 Methods for separation, characterization, and/or identification of microorganisms using mass spectrometry
US9671408B2 (en) * 2008-11-18 2017-06-06 Protein Metrics Inc. Wild-card-modification search technique for peptide identification
CN103109346B (en) * 2010-11-08 2016-09-28 Dh科技发展私人贸易有限公司 Systems and methods for rapid screening of samples by mass spectrometry
US9074236B2 (en) 2012-05-01 2015-07-07 Oxoid Limited Apparatus and methods for microbial identification by mass spectrometry
HK1208284A1 (en) * 2012-05-29 2016-02-26 Biodesix, Inc. Deep-maldi tof mass spectrometry of complex biological samples, e.g., serum, and uses thereof
CN107077592B (en) * 2014-03-28 2021-02-19 威斯康星校友研究基金会 High quality accuracy filtering of improved spectrogram matching of high resolution gas chromatography-mass spectrometry data with a unit resolution reference database
US10192727B2 (en) * 2017-03-28 2019-01-29 Varian Semiconductor Equipment Associates, Inc. Electrodynamic mass analysis
JP6994921B2 (en) * 2017-12-05 2022-01-14 日本電子株式会社 Mass spectrometric data processing device and mass spectrometric data processing method
WO2019165347A1 (en) * 2018-02-26 2019-08-29 Leco Corporation Method for ranking library hits in mass spectrometry
US10763072B1 (en) 2019-03-15 2020-09-01 Applied Materials, Inc. Apparatus, system and techniques for mass analyzed ion beam
US12614608B2 (en) 2022-04-21 2026-04-28 Shimadzu Corporation Method and apparatus for constructing microbial identification database

Family Cites Families (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7020559B1 (en) * 1998-11-17 2006-03-28 University Of Maryland Methods for identifying and classifying organisms by mass spectrometry and database searching
DE19856014C2 (en) * 1998-12-04 2000-12-14 Bruker Daltonik Gmbh Daughter ion spectra with time-of-flight mass spectrometers
US6379970B1 (en) * 1999-04-30 2002-04-30 The Arizona Board Of Regents On Behalf Of The University Of Arizona Analysis of differential protein expression
US6446010B1 (en) * 1999-06-15 2002-09-03 The Rockefeller University Method for assessing significance of protein identification
US6677160B1 (en) * 1999-09-29 2004-01-13 Pharmacia & Upjohn Company Methods for creating a compound library and identifying lead chemical templates and ligands for target molecules
US6393367B1 (en) * 2000-02-19 2002-05-21 Proteometrics, Llc Method for evaluating the quality of comparisons between experimental and theoretical mass data
US20020152033A1 (en) * 2001-02-23 2002-10-17 Beavis Ronald C. Method for evaluating the quality of database search results by means of expectation value
US7197402B2 (en) * 2004-10-14 2007-03-27 Highchem, Ltd. Determination of molecular structures using tandem mass spectrometry

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3438274A4 (en) * 2016-03-31 2019-12-25 Shimadzu Corporation METHOD FOR IDENTIFYING A MICROORGANISM
US11085928B2 (en) 2016-03-31 2021-08-10 Shimadzu Corporation Microorganism identification method

Also Published As

Publication number Publication date
WO2010022400A3 (en) 2010-07-08
US20100057372A1 (en) 2010-03-04
US8160819B2 (en) 2012-04-17

Similar Documents

Publication Publication Date Title
WO2010022400A2 (en) Rapid identification of proteins and their corresponding source organisms by gas phase fragmentation and identification of protein biomarkers
Elias et al. Comparative evaluation of mass spectrometry platforms used in large-scale proteomics investigations
Nesvizhskii Protein identification by tandem mass spectrometry and sequence database searching
Demirev et al. Top-down proteomics for rapid identification of intact microorganisms
Lange et al. Targeted quantitative analysis of Streptococcus pyogenes virulence factors by multiple reaction monitoring
Searle Scaffold: a bioinformatic tool for validating MS/MS‐based proteomic studies
Henzel et al. Protein identification: the origins of peptide mass fingerprinting
Lange et al. Selected reaction monitoring for quantitative proteomics: a tutorial
Gillet et al. Targeted data extraction of the MS/MS spectra generated by data-independent acquisition: a new concept for consistent and accurate proteome analysis
Woodin et al. Software for automated interpretation of mass spectrometry data from glycans and glycopeptides
Broeckling et al. Comprehensive tandem-mass-spectrometry coverage of complex samples enabled by data-set-dependent acquisition
Yuan et al. pParse: A method for accurate determination of monoisotopic peaks in high‐resolution mass spectra
Bertsch et al. De novo peptide sequencing by tandem MS using complementary CID and electron transfer dissociation
Ning et al. Computational analysis of unassigned high‐quality MS/MS spectra in proteomic data sets
Sennels et al. Improved results in proteomics by use of local and peptide-class specific false discovery rates
Blank-Landeshammer et al. Combining de novo peptide sequencing algorithms, a synergistic approach to boost both identifications and confidence in bottom-up proteomics
Zeng et al. Uncovering missing glycans and unexpected fragments with pGlycoNovo for site-specific glycosylation analysis across species
Rudomin et al. Directed Sample Interrogation Utilizing an A ccurate M ass Ex clusion-Based Data-Dependent Acquisition Strategy (AMEx)
Kelleher From primary structure to function: biological insights from large-molecule mass spectra
Cristoni et al. Bioinformatics in mass spectrometry data analysis for proteomics studies
Pardanani et al. Primer on medical genomics part IV: expression proteomics
Rusilowicz et al. AlacatDesigner─ computational design of peptide concatamers for protein quantitation
Alves et al. Robust accurate identification of peptides (RAId): deciphering MS2 data using a structured library search with de novo based statistics
VerBerkmoes et al. Mass spectrometric approaches for characterizing bacterial proteomes
Tolmachev et al. Characterization of strategies for obtaining confident identifications in bottom-up proteomics measurements using hybrid FTMS instruments

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 09808918

Country of ref document: EP

Kind code of ref document: A2

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 09808918

Country of ref document: EP

Kind code of ref document: A2