WO2010019702A2 - Ddr1-binding agents and methods of use thereof - Google Patents

Ddr1-binding agents and methods of use thereof Download PDF

Info

Publication number
WO2010019702A2
WO2010019702A2 PCT/US2009/053596 US2009053596W WO2010019702A2 WO 2010019702 A2 WO2010019702 A2 WO 2010019702A2 US 2009053596 W US2009053596 W US 2009053596W WO 2010019702 A2 WO2010019702 A2 WO 2010019702A2
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
tumor
ddrl
seq
cancer
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2009/053596
Other languages
French (fr)
Other versions
WO2010019702A3 (en
Inventor
Austin L. Gurney
Edward Thein Htun Van Der Horst
Sanjeev H. Satyal
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Mereo Biopharma 5 Inc
Original Assignee
Oncomed Pharmaceuticals Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Oncomed Pharmaceuticals Inc filed Critical Oncomed Pharmaceuticals Inc
Priority to US13/058,684 priority Critical patent/US8652843B2/en
Publication of WO2010019702A2 publication Critical patent/WO2010019702A2/en
Publication of WO2010019702A3 publication Critical patent/WO2010019702A3/en
Anticipated expiration legal-status Critical
Priority to US14/148,669 priority patent/US9206256B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2851Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the lectin superfamily, e.g. CD23, CD72
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/75Agonist effect on antigen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/32Fusion polypeptide fusions with soluble part of a cell surface receptor, "decoy receptors"

Definitions

  • the present invention relates to the field of oncology and provides novel compositions and methods for treating and diagnosing cancer.
  • the present invention provides antibodies against DDRl for the treatment and diagnosis of solid tumors.
  • Cancer is one of the leading causes of death in the developed world, with over one million people diagnosed with cancer and 500,000 deaths per year in the United States alone. Overall it is estimated that more than 1 in 3 people will develop some form of cancer during their lifetime. There are more than 200 different types of cancer, four of which — breast, lung, colorectal, and prostate — account for over half of all new cases (Jemal et al., 2003, Cancer J. Clin. 53:5-26).
  • breast cancers are a mixture of cancer cells and normal cells, including mesenchymal (stromal) cells, inflammatory cells, and endothelial cells.
  • mesenchymal (stromal) cells including mesenchymal (stromal) cells, inflammatory cells, and endothelial cells.
  • Stem cells are cells that: (1) have extensive proliferative capacity; 2) are capable of asymmetric cell division to generate one or more kinds of progeny with reduced proliferative and/or developmental potential; and (3) are capable of symmetric cell divisions for self-renewal or self-maintenance.
  • the best-studied example of adult cell renewal by the differentiation of stem cells is the hematopoietic system where developmentally immature precursors (hematopoietic stem and progenitor cells) respond to molecular signals to form the varied blood and lymphoid cell types.
  • Other cells including cells of the gut, breast ductal system, and skin are constantly replenished from a small population of stem cells in each tissue, and recent studies suggest that most other adult tissues also harbor stem cells, including the brain.
  • Solid tumor stem cell Tumors derived from a "solid tumor stem cell” (or “cancer stem cell” from a solid tumor) subsequently undergo chaotic development through both symmetric and asymmetric rounds of cell divisions.
  • solid tumors contain a distinct and limited (possibly even rare) subset of cells that share the properties of normal "stem cells", in that they extensively proliferate and efficiently give rise both to additional solid tumor stem cells (self- renewal) and to the majority of tumor cells of a solid tumor that lack tumorigenic potential.
  • mutations within a long-lived stem cell population may initiate the formation of cancer stem cells that underlie the growth and maintenance of tumors and whose presence contributes to the failure of current therapeutic approaches.
  • the invention provides agents which bind to and/or modulate the activity of the discoidin domain receptor 1 (DDRl) and compositions, such as pharmaceutical compositions, comprising those agents.
  • the agents are antibodies.
  • the agents are antibodies that specifically bind to DDRl (e.g., human DDRl).
  • the agents that specifically bind to and/or modulate the activity of DDRl further specifically bind to and/or modulate the activity of the discoidin domain receptor 2 (DDR2).
  • DDR2 discoidin domain receptor 2
  • the methods comprise reducing the frequency of cancer stem cells in a tumor, reducing the number of cancer stem cells in a tumor, reducing the tumorigenicity of a tumor, and/or reducing the tumorigenicity of a tumor by reducing the number or frequency of cancer stem cells in the tumor.
  • the invention also provides methods of using the agents in the treatment of cancer and/or in the inhibition of the growth of tumors comprising cancer stem cells. [0008]
  • the invention provides a method of inhibiting the growth of a tumor in a subject, comprising administering to the subject a therapeutically effective amount of an agent that modulates the activity of DDRl .
  • the tumor comprises cancer stem cells.
  • the agent reduces tumorigenicity of the tumor by reducing the number and/or frequency of cancer stem cells in the tumor.
  • the agent is an antibody, such as an antibody that specifically binds to DDRl .
  • the agent reduces the frequency of cancer stem cells in the tumor.
  • the invention provides a method of reducing the tumorigenicity of a tumor comprising cancer stem cells by reducing the number and/or frequency of cancer stem cells in the tumor, wherein the method comprises contacting the tumor with an effective amount of an agent that modulates the activity of DDRl .
  • the agent is an antibody, such as an antibody that specifically binds to DDRl .
  • the invention provides an antibody that modulates the activity of
  • the antibody reduces the frequency of cancer stem cells in a tumor, reduces the number of cancer stem cells in a tumor, reduces the tumorigenicity of a tumor, and/or reduces the tumorigenicity of a tumor by reducing the number and/or frequency of cancer stem cells in the tumor.
  • the antibody specifically binds to DDRl .
  • Pharmaceutical compositions comprising both the antibody and a pharmaceutically acceptable vehicle are further provided, as are cell lines that produce the antibody. Methods of treating cancer and/or inhibiting tumor growth in a subject (e.g., a human) comprising administering to the subject an effective amount of a composition comprising the antibody are also provided. Methods of inhibiting inflammation and/or fibrosis in a subject comprising administering to the subject an effective amount of a composition comprising the antibody are further provided.
  • the agent or antibody specifically binds to the extracellular domain of DDRl. In certain embodiments, the agent or antibody binds the discoidin domain of DDRl . In certain embodiments, the agent or antibody binds to at least one amino acid in the sequence SASSSWSDSTAAR (SEQ ID NO:30) within human DDRl . In some embodiments, the agent or antibody further binds to additional amino acid residues within DDRl . In certain embodiments, the agent or antibody competes with an antibody that binds to at least one ammo acid m the sequence SASSSWSDSTAAR (SEQ ID NO:30) within human DDRl .
  • the invention provides an antibody that specifically binds to an extracellular domain of human DDRl .
  • the antibody comp ⁇ ses a heavy chain va ⁇ able region having at least 90% sequence identity to SEQ ID NO:33, and/or a light chain va ⁇ able region having at least 90% sequence identity to SEQ ID NO:35.
  • the antibody comp ⁇ ses a heavy chain va ⁇ able region having at least 95% sequence identity to SEQ ID NO:33, and/or a light chain va ⁇ able region having at least 95% sequence identity to SEQ ID NO:35.
  • the antibody compnses a heavy chain va ⁇ able region comp ⁇ smg (a) a heavy chain CDRl comp ⁇ sing GYTFTD YFMK (SEQ ID NO:22), or a va ⁇ ant thereof comp ⁇ sing 1, 2, 3 or 4 ammo acid substitutions; (b) a heavy chain CDR2 comp ⁇ smg DINPNNGDTFYIQKFKG (SEQ ID NO:23), or a va ⁇ ant thereof comp ⁇ sing 1, 2, 3 or 4 ammo acid substitutions; and/or (c) a heavy chain CDR3 comp ⁇ smg SRDLAY (SEQ ID NO:24), or a va ⁇ ant thereof comp ⁇ sing 1, 2, 3 or 4 amino acid substitutions.
  • the antibody further comp ⁇ ses a light chain va ⁇ able region comp ⁇ smg (a) a light chain CDRl comp ⁇ smg KSSQSLLYSNGKTYLN (SEQ ID NO:27), or a va ⁇ ant thereof comp ⁇ sing 1, 2, 3 or 4 amino acid substitutions; (b) a light chain CDR2 comp ⁇ sing QVSKLDS (SEQ ID NO:28), or a va ⁇ ant thereof comp ⁇ smg 1, 2, 3 or 4 ammo acid substitutions; and/or (c) a light chain CDR3 comp ⁇ sing VQGTDFPQT (SEQ ID NO:29), or a va ⁇ ant thereof comp ⁇ smg 1, 2, 3 or 4 ammo acid substitutions.
  • the ammo acid substitutions are conservative ammo acid substitutions.
  • the invention provides an antibody, 20M102, produced by the hyb ⁇ doma cell line deposited as ATCC deposit number PTA- 10051.
  • the antibody is a humanized version of 20M102.
  • the invention provides an antibody which specifically binds to the same DDRl epitope as the epitope to which antibody 2OM 102 binds.
  • the invention provides an antibody which competes with any of the antibodies as desc ⁇ bed in the aforementioned embodiments and/or aspects, as well as other aspects/embodiments desc ⁇ bed elsewhere herein, for specific binding to DDRl .
  • the agent or antibody that specifically binds to and/or modulates the activity of DDRl further specifically binds to and/or modulates the activity of DDR2.
  • the antibody binds the discoidin domain of DDR2.
  • the agent or antibody is an antagonist of DDRl . In some embodiments, the agent or antibody is also an antagonist of DDR2.
  • the agent or antibody inhibits the binding of a hgand to DDRl .
  • the agent or antibody inhibits the binding of collagen to DDRl .
  • the agent or antibody inhibits or blocks the activation of DDRl .
  • the agent or antibody inhibits or blocks phosphorylation of DDRl.
  • the agent or antibody inhibits or blocks collagen-mduced phosphorylation of DDRl .
  • the agent or antibody also inhibits the binding of collagen to DDR2.
  • the antibody is a recombinant antibody.
  • the antibody is a monoclonal antibody, a chime ⁇ c antibody, a humanized antibody, or a human antibody.
  • the antibody is an antibody fragment.
  • the antibody or antibody fragment is monovalent, monospecific, bivalent, bispecific, or multispecific.
  • the antibody is conjugated to a cytotoxic moiety.
  • the antibody is isolated.
  • the antibody is substantially pure.
  • the polypeptide is an antibody and/or a fragment of an antibody. In some embodiments, the polypeptide is isolated. In certain embodiments, the polypeptide is substantially pure. In some embodiments, the polypeptide compnses the amino acid sequence of SEQ ID NO:33, and/or the ammo acid sequence of SEQ DD NO:35. In some embodiments, the polypeptide compnses at least a portion of the ammo acid sequence of SEQ ID NO:33, and/or at least a portion of the ammo acid sequence of SEQ ID NO: 35. Pharmaceutical compositions comp ⁇ smg both the polypeptide and a pharmaceutically acceptable vehicle are further provided, as are cell lines that produce the polypeptide.
  • the invention provides a polynucleotide molecule encoding any of the antibodies and/or polypeptides of the aforementoned aspects, as well as other aspects as desc ⁇ bed herein
  • an expression vector compnses the polynucleotide molecule.
  • a host cell compnses the expression vector.
  • the host cell is a hybndoma cell line.
  • DDRl is human DDRl.
  • DDR2 is human DDR2.
  • the treatment methods further comprise administering at least one additional therapeutic agent appropriate for effecting combination therapy (e.g., a chemotherapeutic agent or other anticancer agent, if cancer is to be treated).
  • at least one additional therapeutic agent appropriate for effecting combination therapy e.g., a chemotherapeutic agent or other anticancer agent, if cancer is to be treated.
  • the tumors which are targeted comprise cells which are Hesl -expressing cells and/or which are LGR5 -expressing cells.
  • the Hesl -expressing cells and/or LGR5- expressing cells are cancer stem cells.
  • the tumors which are targeted are breast, colorectal, hepatic, renal, lung, pancreatic, ovarian, prostate, or head and neck tumors.
  • the present invention further provides methods of treating cancer in a subject.
  • the method comprises administering to a subject a therapeutically effective amount of any of the antibodies or polypeptides described in the aforementioned aspects, as well as other aspects and embodiments described elsewhere herein.
  • the cancer to be treated is breast cancer, colorectal cancer, hepatic cancer, kidney cancer, liver cancer, lung cancer, pancreatic cancer, gastrointestinal cancer, melanoma, ovarian cancer, prostate cancer, cervical cancer, bladder cancer, glioblastoma, and head and neck cancer.
  • the methods further comprise administering to the subject at least one additional anti-cancer agent.
  • the present invention further provides methods of identifying and/or isolating cancer stem cells (e.g., based on expression of DDRl), screening for anti-cancer agents, and screening patients for suitability for treatment with the agents described herein.
  • the present invention further provides methods of identifying an antibody that inhibits activity of DDRl, wherein the method comprises assaying antibodies for specific binding to DDRl and for specific binding to a variant of DDRl .
  • a reduction in binding by an antibody to the variant DDRl as compared to native/wildtype DDRl identifies an antibody that inhibits activity of DDRl.
  • the variant of DDRl comprises a sequence in which the sequence SASSSWSDSTAAR
  • sequence SASSSASDSTAAR SEQ ID NO:31
  • Figure 3 FACS analysis of antibody binding to DDRl va ⁇ ants.
  • Figure 3 A shows antibody binding to DDRl wildtype, DDRl W53A, DDRl D68A and DDRl Rl 05 A va ⁇ ants.
  • Figure 3B shows antibody binding to DDRl Ll 1OA, DDRl El 13Q and DDRl S175A va ⁇ ants and DDR2.
  • Figure 4. Tyrosine phosphorylation assay with antibodies 2OM 102 and 2OM 104.
  • FIG. 5 Detection of DDRl protein expression m OMP-C37 tumor cells. Cryosections of OMP-C37 colon tumor were stained with 2OM 102 (panels A and C) or control antibody (panels B and D). Immunofluorescence shows the localization of DDRl protein in panel A, and panel C represents an image of nuclear DAPI staining for the cryosection. Shown in panel B is immunofluorescence associated with a control antibody, and panel D is the nuclear DAPI stam.
  • OMP-C37 cells and treated with anti-DDRl antibody or control antibody in the presence or absence of mnotecan.
  • Mice with established tumors were treated with control antibody, 2OM 102, innotecan or combination of 20M 102 and mnotecan.
  • the combined treatment with 2OM 102 and mnotecan (circles) reduced tumor volume (y-axis mm 3 ) as compared to animals treated with either control antibody (diamonds) or 20M102 (squares) or mnotecan alone (mangles).
  • DDRl diaminoacetyl
  • antibody is used to mean an immunoglobulin molecule that recognizes and specifically binds to a target, such as a protein, polypeptide, peptide, carbohydrate, polynucleotide, lipid, or combinations of the foregoing through at least one antigen recognition site within the va ⁇ able region of the immunoglobulin molecule.
  • antibodies of the present invention include antagonist antibodies that specifically bind to a cancer stem cell marker protein and interfere with, for example, hgand binding, receptor dime ⁇ zation, expression of a cancer stem cell marker protein, and/or downstream signaling of a cancer stem cell marker protein.
  • disclosed antibodies include agonist antibodies that specifically bind to a cancer stem cell marker protein and promote, for example, hgand binding, receptor dime ⁇ zation, and/or signaling by a cancer stem cell marker protein.
  • disclosed antibodies do not interfere with or promote the biological activity of a cancer stem cell marker protein but inhibit tumor growth by, for example, antibody internalization and/or recognition by the immune system.
  • antibody encompasses intact polyclonal antibodies, mtact monoclonal antibodies, antibody fragments (such as Fab, Fab', F(ab')2, and Fv fragments), single chain Fv (scFv) mutants, multispecific antibodies such as bispecif ⁇ c antibodies generated from at least two intact antibodies, monovalent or monospecific antibodies, chime ⁇ c antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antigen determination portion of an antibody, and any other modified immunoglobulin molecule comprising an antigen recognition site so long as the antibodies exhibit the desired biological activity.
  • antibody fragments such as Fab, Fab', F(ab')2, and Fv fragments
  • scFv single chain Fv mutants
  • multispecific antibodies such as bispecif ⁇ c antibodies generated from at least two intact antibodies, monovalent or monospecific antibodies, chime ⁇ c antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antigen determination portion of an antibody, and any other modified immunoglobulin molecule comprising an antigen recognition site
  • An antibody can be any of the five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, or subclasses (lsotypes) thereof (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2), based on the identity of their heavy-chain constant domains referred to as alpha, delta, epsilon, gamma, and mu, respectively.
  • the different classes of immunoglobulins have different and well known subunit structures and three-dimensional configurations.
  • Antibodies can be naked or conjugated to other molecules such as toxins, radioisotopes, etc.
  • antibody fragment refers to a portion of an intact antibody and refers to the antigenic determining va ⁇ able regions of an intact antibody.
  • antibody fragments include, but are not limited to, Fab, Fab 1 , F(ab')2, and Fv fragments, linear antibodies, single chain antibodies, and multispecific antibodies formed from antibody fragments.
  • an "Fv antibody” refers to the minimal antibody fragment that contains a complete antigen-recognition and -binding site either as two-chams, in which one heavy and one light chain va ⁇ able domain form a non-covalent dimer, or as a smgle-chain (scFv), in which one heavy and one light chain va ⁇ able domain are covalently linked by a flexible peptide linker so that the two chains associate in a similar dime ⁇ c structure.
  • the complementary determining regions (CDRs) of each va ⁇ able domain interact to define the antigen-bmdmg specificity of the Fv dimer.
  • a single va ⁇ able domain (or half of an Fv) can be used to recognize and bmd antigen, although generally with lower affinity.
  • a “monoclonal antibody” as used herein refers to a homogenous antibody population involved in the highly specific recognition and binding of a single antigenic determinant, or epitope. This is in contrast to polyclonal antibodies that typically include different antibodies directed against different antigenic determinants.
  • the term “monoclonal antibody” encompasses both intact and full-length monoclonal antibodies as well as antibody fragments (such as Fab, Fab', F(ab')2, Fv), single chain (scFv) mutants, fusion proteins comprising an antibody portion, and any other modified immunoglobulin molecule comprising an antigen recognition site.
  • “monoclonal antibody” refers to such antibodies made m any number of manners including, but not limited to, by hyb ⁇ doma, phage selection, recombinant expression, and transgenic animals.
  • humanized antibody refers to forms of non-human (e.g., mu ⁇ ne) antibodies that are specific immunoglobulin chains, chime ⁇ c immunoglobulins, or fragments thereof that contain minimal non-human sequences.
  • humanized antibodies are human immunoglobulins in which residues from the complementary determining region (CDR) are replaced by residues from the CDR of a non-human species (e.g., mouse, rat, rabbit, hamster) that have the desired specificity, affinity, and/or capability.
  • CDR complementary determining region
  • the Fv framework region (FR) residues of a human immunoglobulin are replaced with the corresponding residues in an antibody from a non-human species that has the desired specificity, affinity, and/or capability.
  • the humanized antibody can be further modified by the substitution of additional residues either in the Fv framework region and/or withm the replaced non-human residues to refine and optimize antibody specificity, affinity, and/or capability.
  • the humanized antibody will compnse substantially all of at least one, and typically two or three, va ⁇ able domains containing all, or substantially all, of the CDR regions that correspond to the non-human immunoglobulin; whereas all, or substantially all, of the FR regions are those of a human immunoglobulin consensus sequence.
  • the humanized antibody can also compnse at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region or domain
  • human antibody as used herein means an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human made using any technique known in the art.
  • This definition of a human antibody includes intact or full-length antibodies, fragments thereof, and/or antibodies comprising at least one human heavy and/or light chain polypeptide such as, for example, an antibody comprising mu ⁇ ne light chain and human heavy chain polypeptides.
  • chimeric antibodies refers to antibodies wherein the amino acid sequence of the immunoglobulin molecule is de ⁇ ved from two or more species. Typically, the va ⁇ able region of both light and heavy chains corresponds to the va ⁇ able region of antibodies de ⁇ ved from one species of mammals (e.g.
  • chime ⁇ c antibody includes monovalent, divalent and polyvalent antibodies.
  • epitopes can be formed both from contiguous ammo acids and noncontiguous ammo acids juxtaposed by tertiary folding of a protein.
  • Epitopes formed from contiguous amino acids are typically retained upon protein denaru ⁇ ng, whereas epitopes formed by tertiary folding (often referred to as “conformational epitopes”) are typically lost upon protein denatu ⁇ ng.
  • An epitope typically includes at least 3, and more usually, at least 5 or 8-10 ammo acids in a unique spatial conformation.
  • “Selectively binds” or “specifically binds” means at times that an antibody binds to a protein with a K 0 of about 0.1 mM or less, at times about 1 ⁇ M or less, at times about 0.1 ⁇ M or less, at times about 0.01 ⁇ M or less, and at times about 1 nM or less. Because of the sequence identity between homologous proteins in different species, specific binding can include an antibody that recognizes a cancer stem cell marker protein in more than one species. It is understood that an antibody or binding moiety that specifically binds to a first target may or may not specifically bind to a second target. As such, "specific binding” does not necessarily require (although it can include) exclusive binding, i.e. binding to a single target.
  • binding means specific binding.
  • isolated or purified refer to material that is substantially or essentially free from components that normally accompany it in its native state. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography.
  • a protein e.g., an antibody
  • nucleic acid of the present disclosure that is the predominant species present in a preparation is substantially purified.
  • an isolated nucleic acid is separated from open reading frames that naturally flank the gene and encode proteins other than the protein encoded by the gene.
  • an isolated antibody is separated from other non-immunoglobulin proteins and from other immunoglobulin proteins with different antigen binding specificities. It can also mean that the nucleic acid or protein is in some embodiments at least 80% pure, in some embodiments at least 85% pure, in some embodiments at least 90% pure, in some embodiments at least 95% pure, and in some embodiments at least 99% pure.
  • cancer and “cancerous” refer to or describe the physiological condition in mammals in which a population of cells are characterized by unregulated cell growth. Examples of cancer include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia.
  • cancers include squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma and various types of head and neck cancers.
  • Tumor and "neoplasm” as used herein refer to any mass of tissue that results from excessive cell growth or proliferation, either benign (noncancerous) or malignant (cancerous), including pre-cancerous lesions.
  • Metalastasis refers to the process by which a cancer spreads or transfers from the site of origin to other regions of the body with the development of a similar cancerous lesion at the new location.
  • a “metastatic” or “metastasizing” cell is one that loses adhesive contacts with neighboring cells and migrates via the bloodstream or lymph from the primary site of disease to invade neighboring body structures.
  • cancer stem cell refers to a population of cells from a solid tumor that: (1) have extensive proliferative capacity; 2) are capable of asymmetric cell division to generate one or more kinds of differentiated progeny with reduced proliferative or developmental potential; and (3) are capable of symmetric cell divisions for self-renewal or self-maintenance.
  • Cancer stem cells undergo self-renewal versus differentiation in a chaotic manner to form tumors with abnormal cell types that can change over time as mutations occur.
  • Solid tumor stem cells differ from the "cancer stem line" provided by U.S. Pat. No. 6,004,528.
  • the "cancer stem line” is defined as a slow growing progenitor cell type that itself has few mutations but which undergoes symmetric rather than asymmetric cell divisions as a result of tumorigenic changes that occur in the cell's environment.
  • This "cancer stem line” hypothesis thus proposes that highly mutated, rapidly proliferating tumor cells arise largely as a result of an abnormal environment, which causes relatively normal stem cells to accumulate and then undergo mutations that cause them to become tumor cells.
  • solid tumor stem cell model is fundamentally different from the "cancer stem line” model and as a result exhibits utilities not offered by the "cancer stem line” model.
  • solid tumor stem cells are not “mutationally spared”.
  • the "mutationally spared cancer stem line" described by U.S. Pat. No. 6,004,528 can be considered a pre-cancerous lesion, while solid tumor stem cells are cancer cells that may themselves contain the mutations that are responsible for tumorigenesis starting at the pre-cancerous stage through later stage cancer. That is, solid tumor stem cells (“cancer stem cells”) would be included among the highly mutated cells that are distinguished from the "cancer stem line" in U.S. Pat. No.
  • the genetic mutations that lead to cancer can be largely intrinsic within the solid tumor stem cells as well as being environmental.
  • the solid tumor stem cell model predicts that isolated solid tumor stem cells can give rise to additional tumors upon transplantation (thus explaining metastasis) while the "cancer stem line” model would predict that transplanted "cancer stem line” cells would not be able to give rise to a new tumor, since it was their abnormal environment that was tumorigenic.
  • the ability to transplant dissociated, and phenotypically isolated human solid tumor stem cells to mice is distinguished from the "cancer stem line” model.
  • solid tumor stem cells likely divide both symmetrically and asymmetrically, such that symmetric cell division is not an obligate property.
  • solid tumor stem cells can divide rapidly or slowly, depending on many variables, such that a slow proliferation rate is not a defining characte ⁇ stic.
  • cancer cell refers to the total population of cells de ⁇ ved from a tumor or a pre-cancerous lesion, including both non-tumo ⁇ gemc cells, which compose the bulk of the tumor cell population, and tumo ⁇ genic stem cells (cancer stem cells).
  • tumor cell will be modified by the term “non-tumorigenic” when referring solely to those tumor cells lacking the capacity to renew and differentiate to distinguish those tumor cells from cancer stem cells.
  • tumorigenic refers to the functional features of a solid tumor stem cell including the properties of self-renewal (giving ⁇ se to additional tumongemc cancer stem cells) and proliferation to generate all other tumor cells (giving ⁇ se to differentiated and thus non-tumo ⁇ gemc tumor cells) that allow solid tumor stem cells to form a tumor.
  • These properties of self-renewal and proliferation to generate all other tumor cells confer on cancer stem cells the ability to form palpable tumors upon serial transplantation into an immunocompromised mouse compared to non-tumo ⁇ gemc tumor cells, which are unable to form tumors upon serial transplantation.
  • non-tumo ⁇ gemc tumor cells may form a tumor upon primary transplantation into an immunocompromised mouse after obtaining the tumor cells from a solid tumor, but those non-tumo ⁇ gemc tumor cells do not give ⁇ se to a tumor upon se ⁇ al transplantation.
  • stem cell cancer marker(s) As used herein, the terms "stem cell cancer marker(s)", “cancer stem cell marker(s)”,
  • tumor stem cell marker(s) refers to a gene or genes or a protein, polypeptide, or peptide expressed by the gene or genes whose expression level, alone or in combination with other genes, is correlated with the presence of tumongemc cancer cells compared to non-tumo ⁇ gemc cells.
  • the correlation can relate to either an increased or decreased expression of the gene (e.g. increased or decreased levels of mRNA or the peptide encoded by the gene).
  • biopsy tissue refers to a sample of tissue or fluid that is removed from a subject for the purpose of determining if the sample contains cancerous tissue.
  • biopsy tissue or fluid is obtained because a subject is suspected of having cancer, and the biopsy tissue or fluid is then examined for the presence or absence of cancer.
  • the term “subject” refers to any animal (e.g., a mammal), including, but not limited to humans, non-human p ⁇ mates, rodents, and the like, which is to be the recipient of a particular treatment.
  • the terms “subject” and “patient” are used interchangeably herein m reference to a human subject.
  • “Pharmaceutically acceptable” refers to approved or appro vable by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, including humans.
  • “Pharmaceutically acceptable salt” refers to a salt of a compound that is pharmaceutically acceptable and that possesses the desired pharmacological activity of the parent compound.
  • “Pharmaceutically acceptable excipient, carrier or adjuvant” refers to an excipient, carrier or adjuvant that can be administered to a subject, together with at least one antibody of the present disclosure, and which does not destroy the pharmacological activity thereof and is nontoxic when administered in doses sufficient to deliver a therapeutic amount of the antibody.
  • “Pharmaceutically acceptable vehicle” refers to a diluent, adjuvant, excipient, or carrier with which at least one antibody of the present disclosure is administered.
  • an effective amount refers to an amount of an antibody, polypeptide, polynucleotide, small organic molecule, or other drug effective to "treat” a disease or disorder in a subject or mammal.
  • the therapeutically effective amount of the drug has a therapeutic effect and as such can reduce the number of cancer cells; decrease tumorigenicity, tumorigenic frequency or tumorigenic capacity; reduce the number or frequency of cancer stem cells; reduce the tumor size; inhibit or stop cancer cell infiltration into peripheral organs including, for example, the spread of cancer into soft tissue and bone; inhibit and stop tumor metastasis; inhibit and stop tumor growth; relieve to some extent one or more of the symptoms associated with the cancer; reduce morbidity and mortality; improve quality of life; or a combination of such effects.
  • Methods to determine tumorigenicity or tumorigenic frequency or capacity are demonstrated in copending application U.S. 11/776,935, incorporated by reference herein in its entirety.
  • cytostatic and/or cytotoxic refer to both 1) therapeutic measures that cure, slow down, lessen symptoms of, and/or halt progression of a diagnosed pathologic condition or disorder and 2) prophylactic or preventative measures that prevent and/or slow the development of a targeted pathologic condition or disorder.
  • those in need of treatment include those already with the disorder; those prone to have the disorder; and those in whom the disorder is to be prevented.
  • a subject is successfully "treated” according to the methods of the present invention if the patient shows one or more of the following: a reduction in the number of or complete absence of cancer cells; a reduction in the tumor size; inhibition of or an absence of cancer cell infiltration into peripheral organs including, for example, the spread of cancer into soft tissue and bone; inhibition of or an absence of tumor metastasis; inhibition or an absence of tumor growth; relief of one or more symptoms associated with the specific cancer; reduced morbidity and mortality; improvement in quality of life; reduction in tumorigenicity; reduction in the number or frequency of cancer stem cells; or some combination of effects.
  • polynucleotide or “nucleic acid” refer to a polymer composed of a multiplicity of nucleotide units (ribonucleotide or deoxyribonucleotide or related structural variants) linked via phosphodiester bonds, including but not limited to, DNA or RNA.
  • the term encompasses sequences that include any of the known base analogs of DNA and RNA.
  • gene refers to a nucleic acid (e.g., DNA) sequence that comprises coding sequences necessary for the production of a polypeptide, precursor, or RNA (e.g., rRNA, tRNA).
  • the polypeptide can be encoded by a full length coding sequence or by any portion of the coding sequence so long as the desired activity or functional properties (e.g., enzymatic activity, ligand binding, signal transduction, immunogenicity, etc.) of the full- length polypeptide or fragment are retained.
  • the term also encompasses the coding region of a structural gene and the sequences located adjacent to the coding region on both the 5' and 3' ends for a distance of about 1 kb or more on either end such that the gene corresponds to the length of the full-length mRNA.
  • the term "gene" encompasses both cDNA and genomic forms of a gene.
  • polypeptide peptide
  • protein protein fragment
  • amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers.
  • amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function similarly to the naturally occurring amino acids.
  • Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma-carboxyglutamate, and O-phosphoserine.
  • amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., an alpha carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs can have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
  • amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions similarly to a naturally occurring amino acid.
  • amino acid variants refers to amino acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical or associated (e.g., naturally contiguous) sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode most proteins. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine.
  • nucleic acid variations are "silent variations", which are one species of conservatively modified variations.
  • Every nucleic acid sequence herein which encodes a polypeptide also desc ⁇ bes silent va ⁇ ations of the nucleic acid.
  • each codon in a nucleic acid except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan
  • TGG which is ordinarily the only codon for tryptophan
  • ammo acid sequences one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single ammo acid or a small percentage of ammo acids in the encoded sequence is a "conservatively modified variant", including where the alteration results in the substitution of an ammo acid with a chemically similar ammo acid.
  • Conservative substitution tables providing functionally similar ammo acids are well known in the art (See, for example, Table 1). Guidance concerning which amino acid changes are likely to be phenotypically silent can also be found in Bowie et al., 1990, Science 247:1306 1310.
  • Such conservatively modified vanants are in addition to and do not exclude polymorphic va ⁇ ants, interspecies homologs, and alleles.
  • Typical conservative substitutions include: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagme (N), Glutamme (Q); 4) Argimne (R), Lysine (K); 5) Isoleucme (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Se ⁇ ne (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins (1984)).
  • changes are typically of a minor nature, such as conservative ammo acid substitutions that do not significantly affect the folding or activity of the protein.
  • solid tumors consist of a heterogeneous population of cells. That the majority of these cells lack tumorigenicity suggested that the development and maintenance of solid tumors also relies on a small population of stem cells (i.e., tumorigenic cancer cells) with the capacity to proliferate and efficiently give rise both to additional tumor stem cells (self- renewal) and to the majority of more differentiated tumor cells that lack tumorigenic potential (i.e., non- tumorigenic cancer cells).
  • HSC hematopoietic stem cells
  • AML acute myelogenous leukemia
  • Stem cells from solid tumors have more recently been isolated based on their expression of a unique pattern of cell-surface receptors and on the assessment of their properties of self-renewal and proliferation in culture and in xenograft animal models.
  • An ESA+ CD44+ CD24-/low Lineage- population greater than 50-fold enriched for the ability to form tumors relative to unfractionated tumor cells was discovered (Al-Hajj et al., 2003, Proc. Nat 'I. Acad. Sci.
  • the ability to isolate tumorigenic cancer stem cells from the bulk of non-tumorigenic tumor cells has led to the identification of cancer stem cell markers, genes with differential expression in cancer stem cells compared to non-tumorigenic tumor cells or normal epithelium, using microarray analysis.
  • the present invention employs the knowledge of cancer stem cell markers to treat and diagnose cancer.
  • the cancer stem cell markers of the present invention relate to human discoidin domain receptor 1 (DDRl) and human discoidin domain receptor 2 (DDR2).
  • the invention is based in part on the discovery of a correlation between the expression of DDRl and Hesl in a variety of tissue samples, as well as of a correlation between the expression of DDRl and LGR5 (see Examples 10 and 11, below) in a variety of tissue samples.
  • Expression of Hesl is an indicator of Notch pathway activation, activity that may play an important role in tumorigenesis in certain tumors.
  • LGR5 has previously been identified as both a stem cell marker (Barker et al., 2007, Nature 449:1003-7) and as a cancer stem cell marker (U.S. Patent Application No. 12/167,176, incorporated by reference herein in its entirety).
  • the identification of DDRl as a marker of cancer stem cells suggests that targeting this receptor may prove therapeutically effective in treating human cancers.
  • DDR2 has previously been identified as a cancer stem cell marker (U.S.
  • DDRl as a cancer stem cell marker suggests the desirability of therapeutics, including, but not limited to, antibodies, that target both DDRl and DDR2.
  • the discoidin domain receptors DDRl and DDR2 form a subfamily of receptor tyrosine kinases based on the presence of an extracellular discoidin domain, a domain first identified in the slime mold Dictyostelium discoideum that functions in cell aggregation.
  • Collagen serves as the physiological ligand for DDR2, and this interaction both inhibits fibrillogenesis of collagen and regulates expression of matrix-metalloproteases (MMP), enzymes that cleave native fibrillar collagen (Vogel, 1999, FASEB 13:S77-S82; Xu et al., 2005, J. Biol. Chem. 280:548-55; Mihai et al., 2006, J.
  • MMP matrix-metalloproteases
  • DDR2 is also activated by collagen, including all types tested (types I-VI and VIII) (Vogel, 1999, FASEB 13:S77-S82; Curat et al., 2001, J. Biol. Chem. 276:45952-45958).
  • DDR2 signaling regulates proliferation of various cell populations including chondrocytes and fibroblasts (Labrador et al., 2001, EMBO Rep. 2:446-52).
  • DDR2 is induced in hepatic stellate cells in response to collagen during liver injury, and over-expression of DDR enhanced hepatic stellate cell proliferation, activated expression of MMP-2, and enhanced cellular invasion through MatrigelTM (Olaso et al., 2001 , J. CHn. Invest. 108: 1369-78).
  • DDR activation and adhesion in response to collagen may require Wnt and G-protein signaling (Dejmek et al., 2003, Int. J. Cancer 103:344-51).
  • DDR receptors are implicated in cancer. DDRl is over-expressed in numerous human tumors including breast, ovarian, esophageal, and brain cancers (Barker et al., 1995, Oncogene 11 :569-75; Laval et al., 1994, Cell Growth Diff. 5:1173-83; Nemoto et al., 1997, Pathobiol. 65:165-203; Weiner et al., 1996, Pediatr. Neurosurg. 25:64-72; Weiner et al., 2000, Neurosurgery 47:1400-9; Heinzelmann et al., 2004, 10:4427-36).
  • DDRl and DDR2 have mutually exclusive expression in ovarian and lung tumors, with transcripts for DDRl in highly invasive tumor cells and transcripts for DDR2 detected in the surrounding stromal cells (Alves et al., 1995, Oncogene 10:609-18). DDR2 expression is also associated with invasive mammary carcinomas (Evitmova et al., 2003, Tumour Biol. 24:189-98).
  • the invention provides agents (e.g., antibodies) that bind to and/or modulate the activity of DDRl and compositions, such as pharmaceutical compositions, comprising those agents.
  • the invention also provides methods of targeting cancer stem cells with the agents and/or reducing the tumorigenicity of tumors comprising cancer stem cells.
  • the invention further provides methods of using the agents in the treatment of cancer and in the inhibition of the growth of tumors comprising cancer stem cells.
  • the invention provides a method of inhibiting the growth of a tumor in a subject, wherein the tumor comprises cancer stem cells, comprising administering to the subject a therapeutically effective amount of an agent that modulates the activity of DDRl.
  • the agent reduces tumorigenicity of the tumor by reducing the number or frequency of cancer stem cells in the tumor.
  • the agent is an antibody, such as an antibody that specifically binds to DDRl .
  • the tumor is selected from the group consisting of a breast tumor, colorectal tumor, hepatic tumor, renal tumor, lung tumor, pancreatic tumor, ovarian tumor, prostate tumor, and head and neck tumor.
  • the tumor expresses LGR5.
  • the tumor expresses LGR5 and the tumor is a colorectal tumor, hepatic tumor, ovarian tumor, or pancreatic tumor.
  • the cancer stem cells express LGR5.
  • the cancer stem cells express LGR5 and the tumor is a colorectal tumor, hepatic tumor, ovarian tumor, or pancreatic tumor.
  • the tumor expresses Hesl .
  • the tumor expresses Hesl and the tumor is a breast tumor, colorectal tumor, renal tumor, lung tumor, pancreatic tumor, or prostate tumor.
  • the cancer stem cells express Hesl .
  • the cancer stem cells express Hesl and the tumor is a breast tumor, colorectal tumor, renal tumor, lung tumor, pancreatic tumor, or prostate tumor.
  • the subject is a human.
  • the invention provides a method of inhibiting growth of a tumor in a subject, comprising administering to the subject a therapeutically effective amount of an agent or antibody that competes with an antibody that binds to at least one amino acid in the sequence SASSSWSDSTAAR (SEQ ID NO:30) within DDRl .
  • the agent or antibody specifically binds to at least one amino acid in the sequence SASSSWSDSTAAR (SEQ ID NO: 30) within DDRl .
  • the antibody further binds to additional amino acid residues within DDRl .
  • the invention provides a method of reducing the tumorigenicity of a tumor comprising cancer stem cells by reducing the number or frequency of cancer stem cells in the tumor, wherein the method comprises contacting the tumor with an effective amount of an agent that modulates the activity of DDRl.
  • the agent is an antibody, including, but not limited to, an antibody that specifically binds to DDRl .
  • the tumor is a tumor selected from the group consisting of breast tumor, colorectal tumor, hepatic tumor, renal tumor, lung tumor, pancreatic tumor, ovarian tumor, prostate tumor, and head and neck tumor.
  • the tumor expresses LGR5.
  • the cancer stem cells express LGR5.
  • the cancer stem cells express LGR5 and the tumor is colorectal tumor, hepatic tumor, ovarian tumor, or pancreatic tumor.
  • the tumor expresses Hesl.
  • the cancer stem cells express Hesl.
  • the cancer stem cells express Hesl and the tumor is breast tumor, colorectal tumor, renal tumor, lung tumor, pancreatic tumor, or prostate tumor.
  • the method is an in vivo method.
  • the invention provides an antibody that modulates the activity of
  • the antibody specifically binds to DDRl . In some embodiments, the antibody binds the extracellular domain of DDRl. In certain embodiments, the antibody binds the discoidin domain of DDRl . In certain embodiments, the antibody binds a region of DDRl comprising amino acids 21 to 241 of SEQ ID NO:2. In certain embodiments, the antibody preferentially binds a human DDRl relative to one or more mutants or variants of the human DDRl .
  • the antibody preferentially binds human DDRl (for example, the DDRl in SEQ ID NO:37) as compared to a W53A variant of DDRl (for example, the variant DDRl of SEQ ID NO:39).
  • the antibody binds to at least one amino acid in the sequence SASSSWSDSTAAR (SEQ NO ID:30).
  • the agent or antibody competes with an antibody that binds to at least one amino acid in the sequence SASSSWSDSTAAR (SEQ NO ID:30).
  • the antibody has reduced binding to a variant of DDRl in which the sequence SASSSWSDSTAAR (SEQ NO H):30) has been replaced with the sequence SASSSASDSTAAR (SEQ IS NO:31).
  • the antibody reduces the tumorigenicity of a tumor that comprises cancer stem cells.
  • the antibody that modulates DDRl inhibits growth of a tumor comprising cancer stem cells.
  • the tumor cells express LGR5 and/or Hesl.
  • the cancer stem cells express LGR5 and/or Hesl.
  • the agent or antibody is capable of reducing the tumorigenicity of a tumor comprising cancer stem cells in an animal model, such as a mouse xenograft model.
  • the number or frequency of cancer stem cells in the tumor is reduced by at least about two-fold, about three-fold, about five-fold, about ten-fold, about 50-fold, about 100-fold, or about 1000-fold.
  • the reduction in the number or frequency of cancer stem cells is determined by limiting dilution assay using an animal model. An example of a limiting dilution assay used to test the efficacy of an anti-DDRl antibody is provided in Example 12, below.
  • the agent or antibody is an antagonist of DDRl .
  • the term "antagonist” includes any molecule that partially or fully blocks, inhibits, or neutralizes a biological activity of a DDRl and/or DDR2 protein or fragment thereof.
  • the antagonist molecules specifically include antagonist antibodies.
  • the term "antagonist” includes any molecule that partially or fully blocks, inhibits, or neutralizes the expression of DDRl, and/or DDR2 protein or fragment thereof.
  • the agent or antibody inhibits the binding of a ligand to DDRl .
  • the agent or antibody inhibits the binding of collagen to DDRl. Ln certain embodiments, the agent or antibody inhibits or blocks collagen-induced tyrosine phosphorylation of
  • the agent or antibody binds to at least one amino acid in the sequence
  • the collagen is selected from the group consisting of collagen type I, collagen type
  • DDRl is human DDRl.
  • DDRl is selected from the group consisting of DDRIa, DDRIb, DDRIc, DDRId, and DDRIe.
  • DDRl is SEQ ID NO:2, 9, 12, 14, or 37.
  • the antibody specifically binds to the extracellular domain of
  • the antibody binds the discoidin domain of DDRl (SEQ ID NO:41).
  • the discoidin domain is from about amino acid residue 30 to about amino acid residue 185 of DDRl .
  • the antibody that specifically binds to and/or modulates the activity of DDRl further specifically binds to and/or modulates the activity of DDR2.
  • the antibody binds the extracellular domain of DDR2.
  • the antibody binds the discoidin domain of DDR2.
  • the antibody binds a region of
  • the antibody preferentially binds a human DDR2 (e.g., SEQ ED NO:3) relative to one or more mutants of the human
  • DDR2 selected from the group consisting of W52A, D69A, and Rl 05 A.
  • the antibody preferentially binds human DDR2 of SEQ ID NO:3 relative to the W52A mutant or the D69A mutant of DDR2.
  • the antibody is an antagonist of DDR2 and/or inhibits the binding of collagen to DDR2.
  • the antibodies are isolated, hi certain embodiments, the antibodies are substantially purified.
  • the antibody is an IgGl antibody or an IgG2 antibody. In certain embodiments, the antibody is an IgGl antibody. In certain embodiments, the antibody is an IgG2 antibody.
  • the antibody does not have one or more effector functions.
  • the antibody has no antibody-dependent cellular cytotoxicity (ADCC) activity, and/or no complement-dependent cytotoxicity (CDC) activity.
  • ADCC antibody-dependent cellular cytotoxicity
  • CDC complement-dependent cytotoxicity
  • the antibody does not bind to an Fc receptor and/or complement factors.
  • the antibody has no effector function.
  • the antibody is a monoclonal antibody, a chimeric antibody, a humanized antibody, or a human antibody. In certain embodiments, the antibody is an antibody fragment.
  • the antibody is conjugated to a cytotoxic agent.
  • the treatment methods further comprise administering at least one additional therapeutic agent appropriate for effecting combination therapy (e.g., a chemotherapeutic agent or other anticancer agent if cancer is to be treated).
  • the additional therapeutic agent is irinotecan or gemcitabine.
  • the additional therapeutic agent is irinotecan.
  • the additional therapeutic agent is gemcitabine.
  • the present invention further provides methods of identifying and/or isolating cancer stem cells (e.g., based on expression of DDRl), screening for anti-cancer agents, and screening patients for suitability for treatment with the agents described herein.
  • Expression of DDRl can be used to identify subjects having cancers suitable for treatment with the compositions of the invention.
  • expression of a cancer stem cell marker is determined by polynucleotide expression such as, for example, mRNA encoding the cancer stem cell marker.
  • the polynucleotide can be detected and quantified by any of a number of means well known to those of skill in the art.
  • mRNA encoding a cancer stem cell marker is detected by in situ hybridization of tissue sections from, for example, a patient biopsy.
  • RNA is isolated from a tissue and detected by, for example, Northern blot, quantitative RT-
  • RNA can be extracted from a tissue sample and primers that specifically hybridize and amplify a cancer stem cell marker can be used to detect expression of a cancer stem cell marker polynucleotide using RT-PCR.
  • expression of a cancer stem cell marker can be determined by detection of the corresponding polypeptide.
  • the polypeptide can be detected and quantified by any of a number of means well known to those of skill in the art.
  • a cancer stem cell marker polypeptide is detected using analytic biochemical methods such as, for example, electrophoresis, capillary electrophoresis, high performance liquid chromatography (HPLC) or thin layer chromatography
  • a cancer stem cell marker protein is detected with antibodies raised against the protein using, for example, immunofluorescence or immunohistochemistry on tissue sections.
  • antibodies against a cancer stem cell marker can detect expression using, for example, ELISA, FACS, Western blot analysis, immunoprecipitation or protein microarrays.
  • cancer stem cells can be isolated from a patient biopsy and expression of a cancer stem cell marker protein detected with fluorescently labeled antibodies using FACS.
  • the cells expressing a cancer stem cell marker can be detected in vivo using labeled antibodies m a typical imaging system.
  • a diagnostic assay comp ⁇ ses determining the expression or not of a cancer stem cell marker using, for example, immunohistochemistry, in situ hybridization, or RT-PCR. In other embodiments, a diagnostic assay comp ⁇ ses determining expression levels of a cancer stem cell marker using, for example, quantitative RT-PCR. In some embodiments, a diagnostic assay further comp ⁇ ses determining expression levels of a cancer stem cell marker compared to a control tissue such as, for example, normal epithelium.
  • Detection of a cancer stem cell marker expression can then be used to select a therapy.
  • a prognosis can be based on any known ⁇ sk expression of a cancer stem cell marker indicates.
  • detection of a cancer stem cell marker can be used to select an approp ⁇ ate therapy including, for example, treatment with antibodies against the detected cancer stem cell marker protein.
  • the antibody specifically binds to the cancer stem cell marker protein human DDRl. In certain embodiments, the antibody further specifically binds to the extracellular domain of DDR2.
  • a suitable antibody or agent is one that can have one or more of the following effects, for example: interfere with the expression of a cancer stem cell marker; interfere with activation of a cancer stem cell signal transduction pathway by, for example, ste ⁇ cally inhibiting interactions between a cancer stem cell marker and its hgand, receptor or co-receptors; activate a cancer stem cell signal transduction pathway by, for example, acting as a hgand or promoting the binding of an endogenous hgand; or bind to a cancer stem cell marker and inhibit tumor cell proliferation [0093] hi certain embodiments, antibodies against a cancer stem cell marker act extracellularly to modulate the function of a cancer stem cell marker protein.
  • extracellular binding of an antibody against a cancer stem cell marker can inhibit the signaling of a cancer stem cell marker protein by, for example, inhibiting intrinsic activation (e.g. kinase activity) of a cancer stem cell marker and/or by ste ⁇ cally inhibiting the interaction, for example, of a cancer stem cell marker with its hgand, with its receptor, with a co-receptor, or with the extracellular matrix, hi some embodiments, extracellular binding of an antibody against a cancer stem cell marker can down-regulate cell-surface expression of a cancer stem cell marker such as, for example, by internalization of a cancer stem cell marker protein or decreasing cell surface trafficking of a cancer stem cell marker.
  • intrinsic activation e.g. kinase activity
  • extracellular binding of an antibody against a cancer stem cell marker can down-regulate cell-surface expression of a cancer stem cell marker such as, for example, by internalization of a cancer stem cell marker protein or decreasing cell surface trafficking of a cancer stem cell marker.
  • extracellular binding of an antibody against a cancer stem cell marker can promote the signaling of a cancer stem cell marker protein by, for example, acting as a decoy ligand or increasing ligand binding.
  • antibodies against a cancer stem cell marker bind to a cancer stem cell marker protein and have one or more of the following effects: inhibit proliferation, trigger cell death, or prevent metastasis.
  • antibodies against a cancer stem cell marker trigger cell death via a conjugated toxin, chemotherapeutic agent, radioisotope, or other such agent.
  • an antibody against a cancer stem cell marker is conjugated to a toxin that is activated in cells expressing the cancer stem cell marker by protein internalization.
  • antibodies against a cancer stem cell marker mediate cell death of a cell expressing the cancer stem cell marker protein via antibody-dependent cellular cytotoxicity (ADCC).
  • ADCC involves cell lysis by effector cells that recognize the Fc portion of an antibody.
  • antibodies against a cancer stem cell marker trigger cell death of a cell expressing a cancer stem cell marker protein by activating complement-dependent cytotoxicity (CDC).
  • CDC involves binding of serum complement to the Fc portion of an antibody and subsequent activation of the complement protein cascade, resulting in cell membrane damage and eventual cell death.
  • Biological activity of antibodies is known to be determined, to a large extent, by the constant domains or Fc region of the antibody molecule (Uananue and Benacerraf, Textbook of Immunology, 2nd Edition, Williams & Wilkins, p. 218 (1984)).
  • Antibodies of different classes and subclasses differ in this respect, as do antibodies of the same subclass but from different species.
  • IgM is the most efficient class of antibodies to bind complement, followed by IgGl, IgG3, and IgG2 whereas IgG4 appears quite deficient in activating the complement cascade (Dillman, 1994, J. CHn. Oncol. 12:1497; Jefferis et al., 1998, Immunol. Rev. 163:59-76).
  • antibodies of those classes having the desired biological activity are prepared.
  • any particular antibody against a cancer stem cell to mediate lysis of the target cell by complement activation and/or ADCC can be assayed.
  • the cells of interest are grown and labeled in vitro; the antibody is added to the cell culture in combination with either serum complement or immune cells which can be activated by the antigen antibody complexes. Cytolysis of the target cells is detected, for example, by the release of label from the lysed cells.
  • antibodies can be screened using the patient's own serum as a source of complement and/or immune cells. The antibody that is capable of activating complement or mediating ADCC in the in vitro test can then be used therapeutically in that particular patient.
  • antibodies against a cancer stem cell marker can trigger cell death inhibiting angiogenesis.
  • Angiogenesis is the process by which new blood vessels form from pre- existing vessels and is a fundamental process required for normal growth, for example, during embryonic development, wound healing, and in response to ovulation. Solid tumor growth larger than 1-2 mm 2 also requires angiogenesis to supply nutrients and oxygen without which tumor cells die.
  • an antibody against a cancer stem cell marker targets vascular cells that express the cancer stem cell marker including, for example, endothelial cells, smooth muscle cells, or components of the extracellular matrix required for vascular assembly.
  • an antibody against a cancer stem cell marker inhibits growth factor signaling required by vascular cell recruitment, assembly, maintenance, or survival.
  • the antibodies against a cancer stem cell marker find use in the diagnostic and therapeutic methods described herein.
  • the antibodies of the present invention are used to detect the expression of a cancer stem cell marker protein in biological samples such as, for example, a patient tissue biopsy, pleural effusion, or blood sample. Tissue biopsies can be sectioned and protein detected using, for example, immunofluorescence or immunohistochemistry.
  • individual cells from a sample can be isolated, and protein expression detected on fixed or live cells by FACS analysis.
  • antibodies can be used on protein arrays to detect expression of a cancer stem cell marker, for example, on tumor cells, in cell lysates, or in other protein samples.
  • the antibodies of the present invention are used to inhibit the growth of tumor cells by contacting the antibodies with tumor cells in in vitro cell based assays, in vivo animal models, etc. In certain embodiments, the antibodies are used to treat cancer in a patient by administering a therapeutically effective amount of an antibody against a cancer stem cell marker.
  • the antibodies of the present invention can be prepared by any conventional means known in the art.
  • polyclonal antibodies can be prepared by immunizing an animal (e.g., a rabbit, rat, mouse, goat, donkey, etc.) by multiple subcutaneous or intraperitoneal injections of the relevant antigen (a purified peptide fragment, full-length recombinant protein, fusion protein, etc) optionally conjugated to keyhole limpet hemocyanin (KLH), serum albumin, etc. diluted in sterile saline and combined with an adjuvant (e.g., Complete or Incomplete Freund's Adjuvant) to form a stable emulsion.
  • an adjuvant e.g., Complete or Incomplete Freund's Adjuvant
  • the polyclonal antibody is then recovered from blood, ascites and the like, of an animal so immunized. Collected blood is clotted, and the serum decanted, clarified by centrifugation, and assayed for antibody titer.
  • the polyclonal antibodies can be purified from serum or ascites according to standard methods in the art including affinity chromatography, ion-exchange chromatography, gel electrophoresis, dialysis, etc.
  • Monoclonal antibodies can be prepared using hybridoma methods, such as those described by Kohler and Milstein,1975, Nature 256:495.
  • hybridoma methods such as those described by Kohler and Milstein,1975, Nature 256:495.
  • a mouse, hamster, or other appropriate host animal is immunized as described above to elicit the production by lymphocytes of antibodies that will specifically bind to an immunizing antigen.
  • Lymphocytes can also be immunized in vitro. Following immunization, the lymphocytes are isolated and fused with a suitable myeloma cell line using, for example, polyethylene glycol, to form hyb ⁇ doma cells that can then be selected away from unfused lymphocytes and myeloma cells.
  • Hyb ⁇ domas that produce monoclonal antibodies directed specifically against a chosen antigen as determined by lmmunoprecipitation, lmmunoblottmg, or by an in vitro binding assay e.g. radioimmunoassay (RIA); enzyme-linked immunosorbent assay (ELISA)
  • an in vitro binding assay e.g. radioimmunoassay (RIA); enzyme-linked immunosorbent assay (ELISA)
  • RIA radioimmunoassay
  • ELISA enzyme-linked immunosorbent assay
  • the antibody is an antibody which specifically binds to an extracellular domain of human DDRl .
  • the antibody comp ⁇ ses a heavy chain va ⁇ able region having at least 90% sequence identity to SEQ ID NO: 33; and/or a light chain va ⁇ able region having at least 90% sequence identity to SEQ ID NO:35.
  • the antibody comp ⁇ ses a heavy chain vanable region having at least 95% sequence identity to SEQ ID NO:33, and/or a light chain va ⁇ able region having at least 95% sequence identity to SEQ ID NO:35.
  • the antibody comp ⁇ ses a heavy chain va ⁇ able region comp ⁇ sing the sequence of SEQ ID NO:33, and/or a light chain va ⁇ able region comp ⁇ sing the sequence of SEQ ID NO:35 Ia some embodiments, the antibody is a monoclonal antibody or antibody fragment. [00102] In other embodiments, the antibody comp ⁇ ses a heavy chain CDRl comp ⁇ smg
  • the antibody further comp ⁇ ses a light chain CDRl comp ⁇ sing KSSQSLLYSNGKTYLN (SEQ ED NO:27), a light chain CDR2 comp ⁇ sing QVSKLDS (SEQ ED NO:28), and/or a light chain CDR3 comp ⁇ sing VQGTDFPQT (SEQ ED NO:29).
  • the antibody comp ⁇ ses a light chain CDRl comp ⁇ sing KSSQSLLYSNGKTYLN (SEQ ED NO:27), a light chain CDR2 comp ⁇ sing QVSKLDS (SEQ ED NO:28), and/or a light chain CDR3 comp ⁇ sing VQGTDFPQT (SEQ ED NO:29). [00103] Ln other embodiments, the antibody comp ⁇ ses (a) a heavy chain CDRl comp ⁇ sing
  • GYTFTDYFMK (SEQ ED NO:22), a heavy chain CDR2 comp ⁇ smg DINPNNGDTFYIQKFKG (SEQ ED NO:23), and a heavy chain CDR3 comp ⁇ sing SRDLAY (SEQ ED NO.24); and/or (b) a light chain CDRl comp ⁇ sing KSSQSLLYSNGKTYLN (SEQ LD NO:27), a light chain CDR2 comp ⁇ smg QVSKLDS (SEQ LD NO:28), and a light chain CDR3 comp ⁇ sing VQGTDFPQT (SEQ LD NO.29).
  • the antibody comp ⁇ ses a heavy chain va ⁇ able region comp ⁇ sing (a) a heavy chain CDRl comp ⁇ smg GYTFTDYFMK (SEQ LD NO:22), or a va ⁇ ant thereof comp ⁇ sing 1, 2, 3 or 4 amino acid substitutions; (b) a heavy chain CDR2 comp ⁇ sing DINPNNGDTFYIQKFKG (SEQ ED NO:23), or a va ⁇ ant thereof comp ⁇ sing 1, 2, 3 or 4 ammo acid substitutions; and/or (c) a heavy chain CDR3 comprising SRDLAY (SEQ ID NO:24), or a variant thereof comprising 1, 2, 3 or 4 amino acid substitutions.
  • the antibody further comprises a light chain variable region comprising (a) a light chain CDRl comprising KSSQSLLYSNGKTYLN (SEQ ID NO:27), or a variant thereof comprising 1, 2, 3 or 4 amino acid substitutions; (b) a light chain CDR2 comprising QVSKLDS (SEQ ID NO:28), or a variant thereof comprising 1, 2, 3 or 4 amino acid substitutions; and/or (c) a light chain CDR3 comprising VQGTDFPQT (SEQ ID NO:29), or a variant thereof comprising 1, 2, 3 or 4 amino acid substitutions.
  • the amino acid substitutions are conservative amino acid substitutions.
  • the invention provides a monoclonal antibody, 20M102, produced by the hybridoma cell line deposited as ATCC deposit number PTA-10051. In some embodiments, the invention provides an antibody comprising the same heavy and light chain variable regions as the antibody 2OM 102. In some embodiments, the invention provides an antibody that is a humanized version of 2OM 102. In some embodiments, the invention provides an antibody which specifically binds to the same DDRl epitope as the epitope to which antibody 20M102 binds. In certain embodiments, the invention provides an antibody which specifically competes with any antibody that binds to at least one amino acid in the sequence SASSSWSDSTAAR (SEQ ID NO:30) within DDRl.
  • SASSSWSDSTAAR SEQ ID NO:30
  • the invention provides an antibody which specifically competes with any of the antibodies as described in the aforementioned aspects and embodiments, as well as other embodiments herein.
  • monoclonal antibodies can also be made using recombinant DNA methods as described in U.S. Patent 4,816,567.
  • the polynucleotides encoding a monoclonal antibody are isolated from mature B-cells or hybridoma cells, such as by RT-PCR using oligonucleotide primers that specifically amplify the genes encoding the heavy and light chains of the antibody, and their sequence is determined using conventional procedures.
  • the isolated polynucleotides encoding the heavy and light chains are then cloned into suitable expression vectors, which when transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, monoclonal antibodies are generated by the host cells.
  • host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, monoclonal antibodies are generated by the host cells.
  • recombinant monoclonal antibodies or fragments thereof of the desired species can be isolated from phage display libraries expressing CDRs of the desired species as described (McCafferty et al., 1990, Nature 348:552-554; Clackson et al., 1991, Nature 352:624-628; and Marks et al., 1991, J. MoI. Biol. 222:581- 597).
  • the polynucleotide(s) encoding a monoclonal antibody can further be modified in a number of different manners using recombinant DNA technology to generate alternative antibodies.
  • the constant domains of the light and heavy chains of, for example, a mouse monoclonal antibody can be substituted 1) for those regions of, for example, a human antibody to generate a chimeric antibody, or 2) for a non-immunoglobulin polypeptide to generate a fusion antibody.
  • the constant regions are truncated or removed to generate the desired antibody fragment of a monoclonal antibody. Site-directed or high-density mutagenesis of the variable region can be used to optimize specificity, affinity, etc. of a monoclonal antibody.
  • the monoclonal antibody against a cancer stem cell marker is a humanized antibody.
  • Humanized antibodies are antibodies that contain minimal sequences from non-human (e.g., murine) antibodies within the variable regions. Such antibodies are used therapeutically to reduce antigenicity and HAMA (human anti-mouse antibody) responses when administered to a human subject.
  • humanized antibodies are typically human antibodies with minimum to no non-human sequences.
  • a human antibody is an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human.
  • Humanized antibodies can be produced using various techniques known in the art.
  • An antibody can be humanized by substituting the CDR of a human antibody with that of a non-human antibody (e.g., mouse, rat, rabbit, hamster, etc.) having the desired specificity, affinity, and/or capability (Jones et al., 1986, Nature 321:522-525; Riechmann et al., 1988, Nature 332:323-327; Verhoeyen et al., 1988, Science 239:1534-1536).
  • the humanized antibody can be further modified by the substitution of additional residues either in the Fv framework region and/or within the replaced non-human residues to refine and optimize antibody specificity, affinity, and/or capability.
  • Fully human antibodies can be directly prepared using various techniques known in the art. Immortalized human B lymphocytes immunized in vitro or isolated from an immunized individual that produce an antibody directed against a target antigen can be generated ⁇ See, e.g., Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boemer et al., 1991, J. Immunol. 147 (l):86-95; and U.S. Patent 5,750,373). Also, the human antibody can be selected from a phage library, where that phage library expresses human antibodies (Vaughan et al., 1996, Nat. Biotech.
  • Human antibodies can also be made in transgenic mice containing human immunoglobulin loci that are capable upon immunization of producing the full repertoire of human antibodies in the absence of endogenous immunoglobulin production. This approach is described in U.S. Patents 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; and 5,661,016.
  • Bispecific antibodies are antibodies that are capable of specifically recognizing and binding at least two different epitopes.
  • the different epitopes can either be within the same molecule (e.g., the same cancer stem cell marker polypeptide) or on different molecules such that both, for example, the antibodies can specifically recognize and bind a cancer stem cell marker as well as, for example, 1) an effector molecule on a leukocyte such as a T-cell receptor (e.g., CD3) or Fc receptor (e.g., CD64, CD32, or CD 16) or 2) a cytotoxic agent as described in detail below.
  • Bispecific antibodies can be intact antibodies or antibody fragments.
  • Exemplary bispecific antibodies can bind to two different epitopes, at least one of which originates in DDRl .
  • an anti-antigenic arm of an immunoglobulin molecule can be combined with an arm which binds to a triggering molecule on a leukocyte such as a T cell receptor molecule (e.g., CD2, CD3, CD28, or B7), or Fc receptors for IgG so as to focus cellular defense mechanisms to the cell expressing the particular antigen.
  • Bispecific antibodies can also be used to direct cytotoxic agents to cells which express a particular antigen.
  • bispecific antibodies possess an antigen-binding arm and an arm which binds a cytotoxic agent or a radionuclide chelator, such as EOTUBE, DPTA, DOTA, or TETA.
  • a cytotoxic agent or a radionuclide chelator such as EOTUBE, DPTA, DOTA, or TETA.
  • Techniques for making bispecific antibodies are common in the art (Millstein et al., 1983, Nature 305:537-539; Brennan et al., 1985, Science 229:81; Suresh et al, 1986, Methods in Enzymol. 121:120; Traunecker et al., ⁇ 99 ⁇ , EMBO J. 10:3655-3659; Shalaby et al., 1992, J. Exp. Med.
  • an antibody fragment to, for example, increase tumor penetration.
  • Various techniques are known for the production of antibody fragments. Traditionally, these fragments are derived via proteolytic digestion of intact antibodies (for example Morimoto et al., 1993, Journal of Biochemical and Biophysical Methods, 24:107-117; Brennan et al., 1985, Science 229:81).
  • antibody fragments are produced recombinantly. Fab, Fv, and scFv antibody fragments can all be expressed in and secreted from E. coli or other host cells, thus allowing the production of large amounts of these fragments.
  • Such antibody fragments can also be isolated from the antibody phage libraries discussed above.
  • the antibody fragment can also be linear antibodies as described in U.S. Patent 5,641,870, for example, and can be monospecific or bispecific. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner. [00113] According to the present invention, techniques can be adapted for the production of single-chain antibodies specific to DDRl (see U.S. Pat. No. 4,946,778). In addition, methods can be adapted for the construction of Fab expression libraries (Huse, et al., 1989, Science 246:1275-1281) to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for DDRl, or derivatives, fragments, or homologs thereof.
  • Antibody fragments that contain the idiotypes to a polypeptide of the invention may be produced by techniques in the art including, but not limited to: (a) an F(ab')2 fragment produced by pepsin digestion of an antibody molecule; (b) an Fab fragment generated by reducing the disulfide bridges of an F(ab')2 fragment, (c) an Fab fragment generated by the treatment of the antibody molecule with papain and a reducing agent, and (d) Fv fragments. [00114] It can further be desirable, especially m the case of antibody fragments, to modify an antibody m order to increase its serum half-life.
  • Heteroconjugate antibodies are also within the scope of the present invention.
  • Heteroconjugate antbodies are composed of two covalentlyjomed antibodies. Such antibodies have, for example, been proposed to target immune cells to unwanted cells (U.S. Pat. No. 4,676,980). It is contemplated that the antibodies can be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents. For example, lmmunotoxins can be constructed using a disulfide exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include immothiolate and methyl-4-mercaptobuty ⁇ midate.
  • modified antibodies can comp ⁇ se any type of va ⁇ able region that provides for the association of the antibody with the polypeptides of DDRl (and/or DDR2).
  • the va ⁇ able region may comp ⁇ se or be de ⁇ ved from any type of mammal that can be induced to mount a humoral response and generate immunoglobulins against the desired tumor associated antigen.
  • the va ⁇ able region of the modified antibodies can be, for example, of human, mu ⁇ ne, non-human p ⁇ mate (e.g., cynomolgus monkeys, macaques, etc.) or lupine origin, hi some embodiments both the va ⁇ able and constant regions of the modified immunoglobulins are human.
  • the va ⁇ able regions of compatible antibodies can be engineered or specifically tailored to improve the binding properties or reduce the immunogenicity of the molecule.
  • va ⁇ able regions useful in the present invention can be humanized or otherwise altered through the inclusion of imported amino acid sequences.
  • the va ⁇ able domains in both the heavy and light chains are altered by at least partial replacement of one or more CDRs and, if necessary, by partial framework region replacement and sequence changing.
  • the CDRs may be de ⁇ ved from an antibody of the same class or even subclass as the antibody from which the framework regions are de ⁇ ved, it is envisaged that the CDRs will be de ⁇ ved from an antibody of different class and preferably from an antibody from a different species. It may not be necessary to replace all of the CDRs with the complete CDRs from the donor va ⁇ able region to transfer the antigen binding capacity of one va ⁇ able domain to another. Rather, it may only be necessary to transfer those residues that are necessary to maintain the activity of the antigen binding site.
  • modified antibodies of this invention will comprise antibodies, or immunoreactive fragments thereof, in which at least a fraction of one or more of the constant region domains has been deleted or otherwise altered so as to provide desired biochemical characteristics such as increased tumor localization or reduced serum half-life when compared with an antibody of approximately the same immunogenicity comprising a native or unaltered constant region.
  • the constant region of the modified antibodies will comprise a human constant region.
  • Modifications to the constant region compatible with this invention comprise additions, deletions or substitutions of one or more amino acids in one or more domains. That is, the modified antibodies disclosed herein may comprise alterations or modifications to one or more of the three heavy chain constant domains (CHl, CH2 or CH3) and/or to the light chain constant domain (CL).
  • modified constant regions wherein one or more domains are partially or entirely deleted are contemplated.
  • the modified antibodies will comprise domain deleted constructs or variants wherein the entire CH2 domain has been removed ( ⁇ CH2 constructs).
  • the omitted constant region domain will be replaced by a short amino acid spacer (e.g. 10 residues) that provides some of the molecular flexibility typically imparted by the absent constant region.
  • the constant region mediates several effector functions.
  • binding of the Cl component of complement to antibodies activates the complement system.
  • Activation of complement is important in the opsonization and lysis of cell pathogens.
  • the activation of complement also stimulates the inflammatory response and can also be involved in autoimmune hypersensitivity.
  • antibodies bind to cells via the Fc region, with a Fc receptor site on the antibody Fc region binding to a Fc receptor (FcR) on a cell.
  • FcR Fc receptor
  • Fc receptors which are specific for different classes of antibody, including IgG (gamma receptors), IgE (epsilon receptors), IgA (alpha receptors) and IgM (mu receptors). Binding of antibody to Fc receptors on cell surfaces triggers a number of important and diverse biological responses including engulfment and destruction of antibody-coated particles, clearance of immune complexes, lysis of antibody-coated target cells by killer cells (called antibody-dependent cell-mediated cytotoxicity, or ADCC), release of inflammatory mediators, placental transfer and control of immunoglobulin production.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • antibodies comprising constant regions modified as described herein provide for altered effector functions that, in turn, affect the biological profile of the administered antibody.
  • the deletion or inactivation (through point mutations or other means) of a constant region domain may reduce Fc receptor binding of the circulating modified antibody thereby increasing tumor localization.
  • constant region modifications consistent with this invention, moderate complement binding and thus reduce the serum half life and nonspecific association of a conjugated cytotoxin.
  • Yet other modifications of the constant region may be used to eliminate disulfide linkages or oligosaccharide moieties that allow for enhanced localization due to increased antigen specificity or antibody flexibility.
  • modified antibodies may be engineered to fuse the CH3 domain directly to the hinge region of the respective modified antibodies.
  • compatible constructs could be expressed wherein the CH2 domain has been deleted and the remaining CH3 domain (modified or unmodified) is joined to the hinge region with a 5-20 amino acid spacer.
  • spacer may be added, for instance, to ensure that the regulatory elements of the constant domain remain free and accessible or that the hinge region remains flexible.
  • amino acid spacers can, in some cases, prove to be immunogenic and elicit an unwanted immune response against the construct. Accordingly, any spacer added to the construct should be relatively non- immunogenic or, even omitted altogether if the desired biochemical qualities of the modified antibodies may be maintained.
  • the antibodies of the present invention may be provided by the partial deletion or substitution of a few or even a single amino acid.
  • the mutation of a single amino acid in selected areas of the CH2 domain may be enough to substantially reduce Fc binding and thereby increase tumor localization.
  • Such partial deletions of the constant regions may improve selected characteristics of the antibody (serum half-life) while leaving other desirable functions associated with the subject constant region domain intact.
  • the constant regions of the disclosed antibodies may be modified through the mutation or substitution of one or more amino acids that enhances the profile of the resulting construct.
  • a conserved binding site e.g. Fc binding
  • Certain embodiments can comprise the addition of one or more amino acids to the constant region to enhance desirable characteristics such as effector function or provide for more cytotoxin or carbohydrate attachment. In such embodiments it can be desirable to insert or replicate specific sequences derived from selected constant region domains.
  • the present invention further embraces variants and equivalents which are substantially homologous to the chimeric, humanized and human antibodies, or antibody fragments thereof, set forth herein.
  • These can contain, for example, conservative substitution mutations, i.e. the substitution of one or more amino acids by similar amino acids.
  • conservative substitution refers to the substitution of an amino acid with another within the same general class such as, for example, one acidic amino acid with another acidic amino acid, one basic amino acid with another basic amino acid or one neutral amino acid by another neutral amino acid. What is intended by a conservative amino acid substitution is well known in the art.
  • the invention also pertains to immunoconjugates comprising an antibody conjugated to a cytotoxic agent.
  • Cytotoxic agents include chemotherapeutic agents, growth inhibitory agents, toxins (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), radioactive isotopes (i.e., a radioconjugate), etc.
  • Chemotherapeutic agents useful in the generation of such immunoconjugates include, for example, methotrexate, adriamicin, doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents.
  • Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain, ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
  • the antibodies can be conjugated to radioisotopes, such as 90 Y, 125 1, 131 1, 123 1, 111 In, 105 Rh, 153 Sm, 67 Cu, 67 Ga, 166 Ho, 177 Lu, 186 Re and 188 Re using any one of a number of well known chelators or direct labeling.
  • the disclosed compositions can comprise antibodies coupled to drugs, prodrugs or lymphokines such as interferon.
  • Conjugates of the antibody and cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyidithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis(p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro- 2,4-dinitrobenzene).
  • SPDP N-succinimidyl-3-
  • Conjugates of an antibody and one or more small molecule toxins such as a calicheamicin, maytansinoids, a trichothene, and CC 1065, and the derivatives of these toxins that have toxin activity, can also be used.
  • the modified antibodies can be complexed with other immunologically active ligands (e.g. antibodies or fragments thereof) wherein the resulting molecule binds to both the neoplastic cell and an effector cell such as a T cell.
  • Conjugate antibodies are composed of two covalently joined antibodies. Such antibodies have, for example, been proposed to target immune cells to unwanted cells (U.S. Pat. No. 4,676,980). It is contemplated that the antibodies can be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents. For example, immunotoxins can be constructed using a disulfide exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include iminothiolate and methyl-4-mercaptobutyrimidate.
  • the antibodies of the present invention can be used in any one of a number of conjugated (i.e. an immunoconjugate) or unconjugated forms.
  • the antibodies of this invention can be used in a nonconjugated or "naked” form to harness the subject's natural defense mechanisms including complement-dependent cytotoxicity (CDC) and antibody dependent cellular toxicity (ADCC) to eliminate the malignant cells.
  • CDC complement-dependent cytotoxicity
  • ADCC antibody dependent cellular toxicity
  • the selection of which conjugated or unconjugated modified antibody to use will depend on the type and stage of cancer, use of adjunct treatment (e.g., chemotherapy or external radiation) and patient condition. It will be appreciated that one skilled in the art could readily make such a selection in view of the teachings herein.
  • Competition assays can be used to determine whether two antibodies bind the same epitope by recognizing identical or sterically overlapping epitopes. Any method known in the art for determining competitive binding (such as e.g., the immunoassays described elsewhere herein) may be used.
  • the antibodies of the present invention can be assayed for immunospecific binding by any method known in the art.
  • the immunoassays which can be used include, but are not limited to, competitive and non-competitive assay systems using techniques such as Biacore analysis, FACS analysis, immunofluorescence, immunocytochemistry, Western blots, radioimmunoassays, ELISA, "sandwich” immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, and protein A immunoassays.
  • the immunospecificity of an antibody against a cancer stem cell marker is determined using ELISA.
  • An ELISA assay comprises preparing antigen, coating wells of a 96 well microtiter plate with antigen, adding the antibody against a cancer stem cell marker conjugated to a detectable compound such as an enzymatic substrate (e.g.
  • the antibody against a cancer stem cell marker is not conjugated to a detectable compound, but instead a second conjugated antibody that recognizes the antibody against a cancer stem cell marker is added to the well.
  • the antibody against a cancer stem cell marker instead of coating the well with the antigen, can be coated to the well and a second antibody conjugated to a detectable compound can be added following the addition of the antigen to the coated well.
  • the binding affinity of an antibody to a cancer stem cell marker antigen and the off-rate of an antibody-antigen interaction can be determined by competitive binding assays.
  • a competitive binding assay is a radioimmunoassay comprising the incubation of labeled antigen (e.g.
  • Biacore kinetic analysis is used to determine the binding on and off rates of antibodies against a cancer stem cell marker. Biacore kinetic analysis comprises analyzing the binding and dissociation of antibodies from chips with immobilized cancer stem cell marker antigens on their surface.
  • the invention encompasses isolated polynucleotides that encode a polypeptide comprising an antibody, or fragment thereof, against human DDRl.
  • polynucleotide encoding a polypeptide encompasses a polynucleotide which includes only coding sequences for the polypeptide as well as a polynucleotide which includes additional coding and/or non- coding sequences.
  • the polynucleotides of the invention can be in the form of RNA or in the form of DNA.
  • DNA includes cDNA, genomic DNA, and synthetic DNA; and can be double-stranded or single- stranded, and if single stranded can be the coding strand or non-coding (anti-sense) strand.
  • the present invention further relates to variants of the hereinabove described polynucleotides encoding, for example, fragments, analogs, and derivatives.
  • the variant of the polynucleotide can be a naturally occurring allelic variant of the polynucleotide or a non-naturally occurring variant of the polynucleotide.
  • the polynucleotide can have a coding sequence which is a naturally occurring allelic variant of the coding sequence of the disclosed polypeptides.
  • allelic variant is an alternate form of a polynucleotide sequence that has, for example, a substitution, deletion, or addition of one or more nucleotides, which does not substantially alter the function of the encoded polypeptide.
  • the polynucleotides comprise the coding sequence for the mature polypeptide fused in the same reading frame to a polynucleotide which aids, for example, in expression and secretion of a polypeptide from a host cell (e.g. a leader sequence which functions as a secretory sequence for controlling transport of a polypeptide from the cell).
  • a polypeptide having a leader sequence is a preprotein and can have the leader sequence cleaved by the host cell to form the mature form of the polypeptide.
  • the polynucleotides can also encode for a proprotein which is the mature protein plus additional 5' amino acid residues.
  • a mature protein having a prosequence is a proprotein and is an inactive form of the protein. Once the prosequence is cleaved an active mature protein remains. [0117]
  • the polynucleotides comprise the coding sequence for the mature polypeptide fused in the same reading frame to a marker sequence that allows, for example, for purification of the encoded polypeptide.
  • the marker sequence can be a hexa-histidine tag supplied by a pQE-9 vector to provide for purification of the mature polypeptide fused to the marker in the case of a bacterial host, or the marker sequence can be a hemagglutinin (HA) tag derived from the influenza hemagglutinin protein when a mammalian host (e.g. COS-7 cells) is used.
  • a mammalian host e.g. COS-7 cells
  • the present invention provides isolated nucleic acid molecules having a nucleotide sequence at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, and in some embodiments, at least 96%, 97%, 98% or 99% identical to a polynucleotide encoding a polypeptide comprising an antibody, or fragment thereof, against DDRl (e.g., human DDRl).
  • DDRl e.g., human DDRl
  • nucleotide sequence at least, for example, 95% “identical” to a reference nucleotide sequence is intended that the nucleotide sequence of the polynucleotide is identical to the reference sequence except that the polynucleotide sequence can include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence.
  • a polynucleotide having a nucleotide sequence at least 95% identical to a reference nucleotide sequence up to 5% of the nucleotides in the reference sequence can be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence can be inserted into the reference sequence.
  • These mutations of the reference sequence can occur at the amino- or carboxy- terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either individually among nucleotides in the reference sequence or in one or more contiguous groups within the reference sequence.
  • nucleic acid molecule is at least 80% identical, at least 85% identical, at least 90% identical, and in some embodiments, at least 95%, 96%, 97%, 98%, or 99% identical to a reference sequence can be determined conventionally using known computer programs such as the Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, WI 53711). Bestfit uses the local homology algorithm of Smith and Waterman, 1981, Advances in Applied Mathematics 2: 482 489 to find the best segment of homology between two sequences.
  • Bestfit program Wiconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, WI 53711. Bestfit uses the local homology algorithm of Smith and Waterman, 1981, Advances in Applied Mathematics 2: 482 489 to find the best segment of homology between two sequences.
  • the parameters are set such that the percentage of identity is calculated over the full length of the reference nucleotide sequence and that gaps in homology of up to 5% of the total number of nucleotides in the reference sequence are allowed.
  • the polynucleotide variants can contain alterations in the coding regions, non-coding regions, or both. In some embodiments the polynucleotide variants contain alterations which produce silent substitutions, additions, or deletions, but do not alter the properties or activities of the encoded polypeptide. In some embodiments, nucleotide variants are produced by silent substitutions due to the degeneracy of the genetic code. Polynucleotide variants can be produced for a variety of reasons, e.g., to optimize codon expression for a particular host (change codons in the human mRNA to those preferred by a bacterial host such as E. col ⁇ ).
  • polypeptides of the present invention can be recombinant polypeptides, natural polypeptides, or synthetic polypeptides comprising an antibody, or fragment thereof, against a DDRl protein, such as human DDRl . It will be recognized in the art that some amino acid sequences of the invention can be varied without significant effect of the structure or function of the protein. Thus, the invention further includes variations of the polypeptides which show substantial activity or which include regions of an antibody, or fragment thereof, against human DDRl protein. Such mutants include deletions, insertions, inversions, repeats, and type substitutions.
  • the polypeptides and analogs can be further modified to contain additional chemical moieties not normally part of the protein.
  • the derivatized moieties can improve the solubility, the biological half life or absorption of the protein.
  • the moieties can also reduce or eliminate any undesirable side effects of the proteins and the like. An overview for such moieties can be found in Remington's Pharmaceutical Sciences, 20th ed., Mack Publishing Co., Easton, PA (2000).
  • the isolated polypeptides described herein can be produced by any suitable method known in the art. Such methods range from direct protein synthesis methods to constructing a DNA sequence encoding isolated polypeptide sequences and expressing those sequences in a suitable transformed host.
  • a DNA sequence is constructed using recombinant technology by isolating or synthesizing a DNA sequence encoding a wild-type protein of interest.
  • the sequence can be mutagenized by site-specific mutagenesis to provide functional analogs thereof. ⁇ See, e.g., Zoeller et al., Proc. Nat'l. Acad. Sci. USA 81:5662-5066 (1984) and U.S. Pat. No. 4,588,585).
  • a DNA sequence encoding a polypeptide of interest would be constructed by chemical synthesis using an oligonucleotide synthesizer.
  • Such oligonucleotides can be designed based on the amino acid sequence of the desired polypeptide and selecting those codons that are favored in the host cell in which the recombinant polypeptide of interest will be produced. Standard methods can be applied to synthesize an isolated polynucleotide sequence encoding an isolated polypeptide of interest. For example, a complete amino acid sequence can be used to construct a back- translated gene. Further, a DNA oligomer containing a nucleotide sequence coding for the particular isolated polypeptide can be synthesized. For example, several small oligonucleotides coding for portions of the desired polypeptide can be synthesized and then ligated.
  • the individual oligonucleotides typically contain 5 ' or 3' overhangs for complementary assembly.
  • the polynucleotide sequences encoding a particular isolated polypeptide of interest will be inserted into an expression vector and operatively linked to an expression control sequence appropnate for expression of the protein in a desired host. Proper assembly can be confirmed by nucleotide sequencing, restriction mapping, and expression of a biologically active polypeptide in a suitable host.
  • the gene must be operatively linked to transcriptional and translational expression control sequences that are functional in the chosen expression host.
  • Recombinant expression vectors are used to amplify and express DNA encoding cancer stem cell marker polypeptide fusions.
  • Recombinant expression vectors are rephcable DNA constructs which have synthetic or cDNA-denved DNA fragments encoding a cancer stem cell marker polypeptide fusion or a bioequivalent analog operatively linked to suitable transcriptional or translational regulatory elements de ⁇ ved from mammalian, microbial, viral or insect genes.
  • a transcriptional unit generally comp ⁇ ses an assembly of (1) a genetic element or elements having a regulatory role in gene expression, for example, transcriptional promoters or enhancers, (2) a structural or coding sequence which is transcribed into mRNA and translated into protein, and (3) appropnate transcription and translation initiation and termination sequences, as desc ⁇ bed in detail below.
  • Such regulatory elements can include an operator sequence to control transcription.
  • the ability to replicate in a host, usually conferred by an origin of replication, and a select on gene to facilitate recognition of transformants can additionally be incorporated.
  • DNA regions are operatively linked when they are functionally related to each other.
  • DNA for a signal peptide is operatively linked to DNA for a polypeptide if it is expressed as a precursor which participates in the secretion of the polypeptide; a promoter is operatively linked to a coding sequence if it controls the transcription of the sequence; or a ⁇ bosome binding site is operatively linked to a coding sequence if it is positioned so as to permit translation.
  • operatively linked means contiguous and, m the case of secretory leaders, means contiguous and in reading frame.
  • Structural elements intended for use in yeast expression systems include a leader sequence enabling extracellular secretion of translated protein by a host cell.
  • recombinant protein is expressed without a leader or transport sequence, it can include an N-termmal methionine residue. This residue can optionally be subsequently cleaved from the expressed recombinant protein to provide a final product.
  • Useful expression vectors for eukaryotic hosts include, for example, vectors comprising expression control sequences from SV40, bovine papilloma virus, adenovirus and cytomegalovirus.
  • Useful expression vectors for bacte ⁇ al hosts include known bacte ⁇ al plasmids, such as plasmids from Eshenchia coh, including pCR 1, pBR322, pMB9 and their derivatives and wider host range plasmids, such as M 13 and filamentous single-stranded DNA phages.
  • Suitable host cells for expression of a cancer stem cell marker protein include prokaryotes, yeast, insect or higher eukaryotic cells.
  • Prokaryotes include gram negative or gram positive organisms, for example E. coli or bacilli.
  • Higher eukaryotic cells include established cell lines of mammalian origin as described below. Cell-free translation systems could also be employed.
  • Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are described by Pouwels et al. (Cloning Vectors: A Laboratory Manual, Elsevier, N.Y., 1985), the relevant disclosure of which is hereby incorporated by reference.
  • Suitable mammalian host cell lines include the COS-7 lines of monkey kidney cells, described by Gluzman (1981 Cell 23:175), and other cell lines capable of expressing an appropriate vector including, for example, L cells, C127, 3T3, Chinese hamster ovary (CHO), HeLa and BHK cell lines.
  • Mammalian expression vectors can comprise non-transcribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5 1 or 3' flanking non- transcribed sequences, and 5 ' or 3' non-translated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences.
  • non-transcribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5 1 or 3' flanking non- transcribed sequences, and 5 ' or 3' non-translated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences.
  • the proteins produced by a transformed host can be purified according to any suitable method.
  • standard methods include chromatography (e.g., ion exchange, affinity and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for protein purification.
  • Affinity tags such as hexa-histidine, maltose binding domain, influenza coat sequence and glutathione-S-transferase can be attached to the protein to allow easy purification by passage over an appropriate affinity column.
  • Isolated proteins can also be physically characterized using such techniques as proteolysis, nuclear magnetic resonance and x-ray crystallography.
  • supernatants from systems which secrete recombinant protein into culture media can be first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit. Following the concentration step, the concentrate can be applied to a suitable purification matrix.
  • a suitable purification matrix for example, an anion exchange resin can be employed, for example, a matrix or substrate having pendant diethylaminoethyl (DEAE) groups.
  • the matrices can be acrylamide, agarose, dextran, cellulose or other types commonly employed in protein purification.
  • a cation exchange step can be employed. Suitable cation exchangers include various insoluble matrices comprising sulfopropyl or carboxymethyl groups.
  • Recombinant protein produced in bacterial culture can be isolated, for example, by initial extraction from cell pellets, followed by one or more concentration, salting-out, aqueous ion exchange or size exclusion chromatography steps.
  • High performance liquid chromatography can be employed for final purification steps.
  • Microbial cells employed in expression of a recombinant protein can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents.
  • the present invention provides methods for inhibiting the growth of tumorigenic cells expressing a cancer stem cell marker using the antibodies against a cancer stem cell marker described herein.
  • the method of inhibiting the growth of tumorigenic cells expressing a cancer stem cell marker comprises contacting the cell with an antibody against a cancer stem cell marker in vitro.
  • an immortalized cell line or a cancer cell line that expresses a cancer stem cell marker is cultured in medium to which is added an antibody against the expressed cancer stem cell marker to inhibit cell growth.
  • tumor cells comprising tumor stem cells are isolated from a patient sample such as, for example, a tissue biopsy, pleural effusion, or blood sample and cultured in medium to which is added an antibody against a cancer stem cell marker to inhibit cell growth.
  • the method of inhibiting the growth of tumorigenic cells expressing a cancer stem cell marker comprises contacting the cell with an antibody against a cancer stem cell marker in vivo.
  • the method of inhibiting growth of tumorigenic cells expressing DDRl comprises contacting the cell with an antibody that specifically binds the extracellular domain of DDRl.
  • the anti-DDRl antibody inhibits growth of tumorigenic cells by inhibiting the activity of DDRl.
  • the anti-DDRl antibody inhibits growth of tumorigenic cells by reducing the frequency of or the number of cancer stem cells in the tumor.
  • DDRl on a cell comprising contacting the cell with an effective amount of an antibody that specifically binds the extracellular domain of DDRl.
  • the cell is a tumor cell.
  • contacting a tumorigenic cell with an antibody against a cancer stem cell marker is undertaken in an animal model.
  • xenografts expressing a cancer stem cell marker are grown in immunocompromised mice (e.g. NOD/SCID mice) that are administered an antibody against a cancer stem cell marker to inhibit tumor growth.
  • cancer stem cells that express a cancer stem cell marker are isolated from a patient sample such as, for example, a tissue biopsy, pleural effusion, or blood sample and injected into immunocompromised mice that are then administered an antibody against the cancer stem cell marker to inhibit growth of a solid tumor.
  • the antibody against a cancer stem cell marker is administered at the same time or shortly after introduction of tumorigenic cells into the animal to prevent tumor growth.
  • the antibody against a cancer stem cell marker is administered as a therapeutic after the tumorigenic cells have grown to a specified size.
  • the present invention further provides pharmaceutical compositions comprising antibodies, polypeptides or other agents that target a cancer stem cell marker. These pharmaceutical compositions find use in inhibiting growth of a solid tumor and treating cancer in human patients.
  • Formulations are prepared for storage and use by combining a purified agent or antibody of the present invention with a pharmaceutically acceptable vehicle (e.g., carrier, excipient) (Remington, The Science and Practice of Pharmacy 20th Edition Mack Publishing, 2000).
  • Suitable pharmaceutically acceptable vehicles include, but are not limited to, nontoxic buffers such as phosphate, citrate, and other organic acids; salts such as sodium chloride; antioxidants including ascorbic acid and methionine; preservatives (e.g.
  • octadecyldimethylbenzyl ammonium chloride hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens, such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight polypeptides (e.g.
  • proteins such as serum albumin, gelatin, or immunoglobulins
  • hydrophilic polymers such as polyvinylpyrrolidone
  • amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine
  • carbohydrates such as monosaccharides, disaccharides, glucose, mannose, or dextrins
  • chelating agents such as EDTA
  • sugars such as sucrose, mannitol, trehalose or sorbitol
  • salt-forming counter-ions such as sodium
  • metal complexes e.g. Zn- protein complexes
  • non-ionic surfactants such as TWEEN or polyethylene glycol (PEG).
  • the pharmaceutical composition of the present invention can be administered in any number of ways for either local or systemic treatment.
  • Administration can be topical (such as to mucous membranes including vaginal and rectal delivery) such as transdermal patches, ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powders; pulmonary (e.g., by inhalation or insufflation of powders or aerosols, including by nebulizer; intratracheal, intranasal, epidermal and transdermal); oral; or parenteral including intravenous, intraarterial, subcutaneous, intraperitoneal or intramuscular injection or infusion; intratumoral, or intracranial (e.g., intrathecal or intraventricular) administration.
  • topical such as to mucous membranes including vaginal and rectal delivery
  • transdermal patches such as transdermal patches, ointments, lotions, creams, gels, drops, suppositories, sprays
  • the therapeutic formulation can be in unit dosage form.
  • Such formulations include tablets, pills, capsules, powders, granules, solutions or suspensions in water or non-aqueous media, or suppositories for oral, parenteral, or rectal administration or for administration by inhalation.
  • solid compositions such as tablets the principal active ingredient is mixed with a pharmaceutical carrier.
  • Conventional tableting ingredients include corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other diluents (e.g.
  • a solid preformulation composition containing a homogeneous mixture of a compound of the present invention, or a non-toxic pharmaceutically acceptable salt thereof.
  • the solid preformulation composition is then subdivided into unit dosage forms of the type described above.
  • the tablets, pills, etc. of the novel composition can be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged action.
  • the tablet or pill can comprise an inner composition covered by an outer component.
  • the two components can be separated by an enteric layer that serves to resist disintegration and permits the inner component to pass intact through the stomach or to be delayed in release.
  • enteric layers or coatings such materials including a number of polymeric acids and mixtures of polymeric acids with such materials as shellac, cetyl alcohol and cellulose acetate.
  • compositions include antibodies of the present invention complexed with liposomes (Epstein, et al., 1985, Proc. Natl. Acad. ScL USA 82:3688; Hwang, et al., 1980, Proc. Natl. Acad. ScL USA 77:4030; and U.S. Patents 4,485,045 and 4,544,545).
  • Liposomes with enhanced circulation time are disclosed in U.S. Patent 5,013,556.
  • Some liposomes can be generated by the reverse phase evaporation with a lipid composition comprising phosphatidylcholine, cholesterol, and PEG- derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
  • the antibodies can also be entrapped in microcapsules.
  • microcapsules are prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions as described in Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing (2000).
  • colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
  • macroemulsions as described in Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing (2000).
  • sustained-release preparations can be prepared. Suitable examples of sustained-release preparations include semi-permeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles (e.g. films or microcapsules). Examples of sustained-release matrices include polyesters, hydrogels such as poly(2-hydroxyethyl-methacrylate) or poly(vinylalcohol), polylactides (U.S.
  • the treatment involves the combined administration of an antibody or other agent of the present invention and a chemotherapeutic agent or cocktail of multiple different chemotherapeutic agents. Combination therapy often uses agents that work by different mechanisms of action.
  • Combination therapy using agents with different mechanisms of action often results in additive or synergetic effects.
  • Combination therapy may allow for lower doses of each agent than is used in monotherapy thereby reducing toxic side effects.
  • Combination therapy may decrease the likelihood that resistant cancer cells will develop.
  • the combination therapy comprises an antibody that binds to DDRl and a chemotherapeutic agent.
  • Chemotherapies contemplated by the invention include chemical substances or drugs which are known in the art and are commercially available, such as doxorubicin, 5-fluorouracil, cytosine arabinoside ("Ara-C"), cyclophosphamide, thiotepa, busulfan, cytoxin, taxol (paclitaxel), methotrexate, cisplatin, melphalan, vinblastine, leucovorin, streptozocin, oxaliplatin and carboplatin.
  • chemical substances or drugs which are known in the art and are commercially available, such as doxorubicin, 5-fluorouracil, cytosine arabinoside ("Ara-C”), cyclophosphamide, thiotepa, busulfan, cytoxin, taxol (paclitaxel), methotrexate, cisplatin, melphalan, vinblastine, leucovorin, streptozo
  • Combined administration can include co-administration, either in a single pharmaceutical formulation or using separate formulations, or consecutive administration in either order but generally within a time period such that all active agents can exert their biological activities simultaneously.
  • Preparation and dosing schedules for such chemotherapeutic agents can be used according to manufacturers' instructions or as determined empirically by the skilled practitioner. Preparation and dosing schedules for such chemotherapy are also described in Chemotherapy Service Ed., M. C. Perry, Williams & Wilkins, Baltimore, Md. (1992).
  • Chemotherapeutic agents useful in the instant invention also include, but are not limited to, alkylating agents such as thiotepa and cyclosphosphamide (CYTOXAN); alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethylenethiophosphaoramide and trimethylolomelamime nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil
  • Chemotherapeutic agents also include anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens including for example tamoxifen, raloxifene, aromatase inhibiting 4(5)-imidazoles, 4-hydroxytamoxifen, t ⁇ oxifene, keoxifene, LYl 17018, onap ⁇ stone, and toremifene (Fareston); and antiandrogens such as flutamide, mlutamide, bicalutamide, leuprohde, and goserelm; and pharmaceutically acceptable salts, acids or de ⁇ vatives of any of the above [0148]
  • the chemotherapeutic agent is a topoisomerase inhibitor.
  • Topoisomerase inhibitors are chemotherapy agents that interfere with the action of a topoisomerase enzyme (e g., topoisomerase I or II).
  • Topoisomerase inhibitors include, but are not limited to, doxorubicin HCL, daunorubicin citrate, mitoxantrone HCL, actmomycin D, etoposide, topotecan HCl, temposide (VM-26), and innotecan.
  • the chemotherapeutic agent is an anti-metabolite.
  • An antimetabolite is a chemical with a structure that is similar to a metabolite required for normal biochemical reactions, yet different enough to interfere with one or more normal functions of cells, such as cell division.
  • Anti-metabolites include, but are not limited to, gemcitabine, fluorouracil, capecitabme, methotrexate sodium, rahtrexed, Pemetrexed, tegafur, cytosine arabmoside, THIOGUANINE (GlaxoSmithKlme), 5-azacytidme, 6-mercaptopu ⁇ ne, azathiop ⁇ ne, 6-thioguanme, pentostatin, fludarabine phosphate, and clad ⁇ bme, as well as pharmaceutically acceptable salts, acids, or de ⁇ vatives of any of these.
  • the treatment involves the combined administration of an antibody or other agent of the present invention and radiation therapy.
  • Treatment with the antibody can occur p ⁇ or to, concurrently with, or subsequent to administration of radiation therapy. Any dosmg schedules for such radiation therapy can be used as determined by the skilled practitioner.
  • the treatment can involve the combined administration of antibodies of the present invention with other antibodies against additional tumor-associated antigens including, but not limited to, antibodies that bind to the EGF receptor (EGFR) (Erbitux® Bristol-Myers Squibb Company, P ⁇ nceton, NJ), the erbB2 receptor (HER2) (Herceptin® Genentech, Inc., South San Francisco, CA), and vascular endothelial growth factor (VEGF) (Avastin® Genentech, Inc., South San Francisco, CA).
  • EGF receptor EGF receptor
  • HER2 erbB2 receptor
  • VEGF vascular endothelial growth factor
  • Treatment can include administration of one or more cytokines; can be accompanied by surgical removal of cancer cells; or any other therapy deemed necessary by a treating physician.
  • the approp ⁇ ate dosage of an agent or antibody of the present invention depends on the type of disease to be treated, the seventy and course of the disease, the responsiveness of the disease, whether the antibody is administered for therapeutic or preventative purposes, previous therapy, patient's clinical history, and so on, all at the discretion of the treating physician.
  • the agent or antibody can be administered one time or over a se ⁇ es of treatments lasting from several days to several months, or until a cure is effected or a diminution of the disease state is achieved (e.g., reduction in tumor size).
  • Optimal dosmg schedules can be calculated from measurements of drug accumulation in the body of the patient and will vary depending on the relative potency of an individual antibody.
  • the administering physician can easily determine optimum dosages, dosmg methodologies and repetition rates.
  • dosage is from 0.01 ⁇ g to 100 mg per kg of body weight, and can be given once or more daily, weekly, monthly or yearly.
  • the treating physician can estimate repetition rates for dosmg based on measured residence times and concentrations of the drug in bodily fluids or tissues.
  • kits comprising the antibodies desc ⁇ bed herein and that can be used to perform the methods desc ⁇ bed herein.
  • kits comprises at least one purified antibody against a cancer stem cell marker in one or more containers
  • the kits contain all of the components necessary and/or sufficient to perform a detection assay, including all controls, directions for performing assays, and any necessary software for analysis and presentation of results.
  • the disclosed antibodies of the present invention can be readily incorporated into one of the established kit formats which are well known in the art [0154] Embodiments of the present disclosure can be further defined by reference to the following examples, which desc ⁇ be in detail preparation of antibodies of the present disclosure and methods for using antibodies of the present disclosure.
  • a recombinant polypeptide fragment of the extracellular domain of human DDRl is generated as an antigen for antibody production.
  • Standard recombinant DNA technology is used to isolate a polynucleotide encoding ammo acids 1-417 of DDRl (for example, nucleotide SEQ ID NO4; ammo acid SEQ ID NO: 1).
  • This polynucleotide is ligated in-frame N-terminal to either a human Fc-tag or histidme-tag and cloned into a transfer plasmid vector for baculovirus mediated expression in insect cells.
  • Standard transfection, infection, and cell culture protocols are used to produce recombinant insect cells expressing the corresponding DDRl polypeptide (O'Reilly et al., Baculovirus expression vectors. A Laboratory Manual, Oxford. Oxford University Press (1994)).
  • Cleavage of the endogenous signal sequence of human DDRl is approximated using cleavage prediction software SignalP 3.0, however the actual in vivo cleavage point can differ by a couple of ammo acids either direction.
  • the predicated cleavage of DDRl is between ammo acids 1 and 20, thus DDRl antigen protein comp ⁇ ses approximately ammo acid 21 through ammo acid 417.
  • mice are immunized with purified DDRl antigen protein using standard techniques.
  • Blood from individual mice is screened approximately 70 days after initial immunization for antigen recognition using FACS analysis (described below).
  • the animal with the highest antibody titer is selected for final antigen boost after which spleen cells are isolated for hybridoma production.
  • Hybridoma cells are plated at 1 cell per well in 96 well plates, and the supernatant from each well screened by FACS analysis against antigen protein.
  • Hybridomas with high antibody titer are selected and scaled up in static flask culture.
  • Antibodies are purified from the hybridoma supernatant using protein A or protein G agarose chromatography. Purified monoclonal antibodies are again tested by FACS and are isotyped to select for IgG antibodies.
  • FACs analysis can be used.
  • HEK293 cells are co-transfected with expression vectors encoding a full-length cDNA clone of DDRl and the transfection marker GFP. Twenty-four to forty-eight hours post-transfection, cells are collected in suspension and incubated on ice with anti-DDRl antibodies or control IgG to detect background antibody binding. The cells are washed and primary antibodies detected with anti-mouse secondary antibodies conjugated to a fluorescent chromophore. Labeled cells are then sorted by FACS to identify anti-DDRl antibodies that specifically recognize cell surface expression of native cell-surface DDRl protein.
  • Mammalian expression plasmid vectors comprising a CMV promoter upstream of polynucleotides encoding a series of deletion fragments of the extracellular domain of DDRl fused to Fc protein can be generated using standard recombinant DNA technology. These recombinant fusion proteins can be expressed in transiently transfected HEK 293 cells from which conditioned medium is collected twenty-four to forty-eight hours post-transfection for ELISA.
  • the Fc fusion proteins in the conditioned media are bound to an ELISA plate coated with anti-human Fc (gamma chain specific), which are then incubated with a DDRl antibody or a control monoclonal antibody. After washing, the bound antibodies are probed with HRP conjugated anti-mouse antibody. To verify equivalent binding of the various DDRl Fc fusion proteins, the ELISA plate are also probed with HRP conjugated anti-human Fc antibodies. Bound HRP concentrations are determined at A 450 Hm using an ELISA substrate. [0161] The SPOTs system (Sigma Genosys, The Woodlands, TX) can also be used to identify specific epitopes within the extracellular domains recognized by an antibody against DDRl .
  • a series of 10-residue linear peptides overlapping by one amino acid and covering the entire DDRl extracellular domain are synthesized and covalently bound to a cellulose membrane by the SPOT synthesis technique.
  • the membrane is pre-incubated for 8 hours at room temperature with blocking buffer and hybridized with antibody overnight at 4 0 C.
  • the membrane is then washed, incubated with a secondary antibody conjugated to horseradish peroxidase (HRP) (GE Healthcare Life Sciences/ Amersham Bioscience, Piscataway, NJ), re-washed, and visualized with signal development solution containing 3- amino-9-ethylcarbazole. Specific epitopes recognized by an antibody are thus determined.
  • HRP horseradish peroxidase
  • variable regions of the heavy-chain and light-chain of the selected monoclonal antibody are isolated by RT-PCR from hybridoma cells and ligated in-frame to human IgGi heavy-chain and kappa light chain constant regions, respectively, in mammalian expression vectors.
  • a human Ig expression vector such as TCAE 5.3 is used that contains the human IgGi heavy-chain and kappa light-chain constant region genes on the same plasmid (Preston et al., 1998, Infection & Immunity 66:4137-42).
  • Expression vectors encoding chimeric heavy- and light-chains are then co-transfected into Chinese hamster ovary (CHO) cells for chimeric antibody production. Immunoreactivity and affinity of chimeric antibodies are compared to parental murine antibodies by ELISA and FACS.
  • chimeric antibodies against DDRl can undergo further humanization.
  • key aspects of the specificity determining motifs of the antibody, potentially including elements from both the three short hypervariable sequences, or complementary determining regions (CDRs), and/or the framework regions required to correctly position the CDR regions of the antibody heavy- and light-chain variable domains described above are engineered using recombinant DNA technology into the germline DNA sequences of human heavy- and light-chain antibody genes, respectively, and then cloned into a mammalian expression vector for expression in CHO cells.
  • the immunoreactivity and affinity of the humanized antibodies are compared to parental chimeric antibodies by ELISA and FACS. Additionally, site-directed or high-density mutagenesis of the variable region can be used to optimize specificity, affinity, etc. of the humanized antibody.
  • human antibodies that specifically recognize the extracellular domain of DDRl can be isolated using phage display technology.
  • a phage display antibody library containing human antibody variable domains displayed as single chain Fv or as Fab domains is screened for specific and high affinity recognition of the DDRl antigen described above or, for example, the DDRl-Fc fusion of SEQ ID NO:8.
  • the identified variable domain antibody sequences are then reformatted into an Ig expression vector containing human IgG 1 heavy-chain and kappa light-chain for expression of human antibodies in CHO cells.
  • This example describes representative in vitro assays to test the activity of antibodies generated against DDRl on cytotoxicity.
  • cancer cell lines expressing DDRl or cancer stem cells isolated from a patient sample passaged as a xenograft in immunocompromised mice can be used to measure complement-dependent cytotoxicity (CDC) mediated by an antibody against DDRl.
  • Cells (10 6 cells/ml) are suspended in 200 ⁇ l RPMI 1640 culture medium supplemented with antibiotics and 5% FBS. Suspended cells are mixed with antibodies against DDRl or control antibodies in triplicate and incubated for 1 to 4 hours at 37 0 C in 5% CO 2 .
  • Treated cells are then collected, resuspended in 100 ⁇ l FITC -labeled annexin V diluted in culture medium, and incubated at room temperature for 10 minutes.
  • One hundred microliters of propidium iodide solution (25 ⁇ g/ml) diluted in HBSS is added and incubated for 5 minutes at room temperature.
  • Cells are collected, resuspended in culture medium, and analyzed by flow cytometry.
  • Flow cytometry of FITC stained cells provides total cell counts, and propidium iodide uptake by dead cells as a percentage of total cell numbers is used to measure cell death in the presence of antibodies against DDRl compared to control antibodies. The ability of anti-DDRl antibodies to mediate complement-dependent cytotoxicity is thus determined.
  • cancer cell lines expressing DDRl or cancer stem cells isolated from a patient's sample passaged as a xenograft in immunocompromised mice can be used to measure antibody-dependent cellular cytotoxicity (ADCC) mediated by an antibody against DDRl.
  • ADCC antibody-dependent cellular cytotoxicity
  • Cells (10 6 cells/ml) are suspended in 200 ⁇ l phenol red-free RPMI 1640 culture medium supplemented with antibiotics and 5% FBS.
  • Peripheral blood mononuclear cells are isolated from heparinized peripheral blood by Ficoll-PaqueTM density gradient centrifugation for use as effector cells.
  • Target cells are then mixed with PBMCeffector cells (E) at E/T ratios of 25 : 1 , 10: 1 , and 5 : 1 in 96-well plates in the presence of DDRl antibody or a control antibody.
  • Controls include incubation of target cells alone and effector cells alone in the presence of antibody.
  • Cell mixtures are incubated for 1 to 6 hours at 37 0 C in 5% CO 2 .
  • Released lactate dehydrogenase (LDH) a stable cytosolic enzyme released upon cell lysis, is then measured by a colorimetric assay (CytoTox96 Non-radioactive Cytotoxicity Assay; Promega; Madison, WI).
  • % cytotoxicity 100 x (experimental LDH release - effector spontaneous LDH release - target spontaneous LDH release) / (target maximal LDH release - target spontaneous LDH release). The ability of antibodies against DDRl receptor to mediated antibody-dependent cellular cytotoxicity is thus determined.
  • Example 3 In Vivo Prevention of Tumor Growth Using Anti-DDRl Antibodies
  • This example describes the use of anti-DDRl antibodies to prevent tumor growth in a xenograft model.
  • Tumor cells from a patient sample solid tumor biopsy or pleural effusion
  • Tumor tissue is removed under sterile conditions, cut up into small pieces, minced completely using sterile blades, and single cell suspensions are obtained by enzymatic digestion and mechanical disruption.
  • pleural effusion cells or the resulting tumor pieces are mixed with ultra-pure collagenase III in culture medium (200-250 units of collagenase per mL) and incubated at 37 0 C for 3-4 hours with pipetting up and down through a 10-mL pipette every 15-20 minutes.
  • Digested cells are filtered through a 45 ⁇ M nylon mesh, washed with RPMI/20% FBS, and washed twice with HBSS.
  • Dissociated tumor cells are then injected subcutaneously either into the mammary fat pads, for breast tumors, or into the flank, for non-breast tumors, of NOD/SCID mice to elicit tumor growth.
  • dissociated tumor cells are first sorted into tumorigenic and non-tumorigenic cells based on cell surface markers before injection into experimental animals. Specifically, tumor cells dissociated as described above are washed twice with HEPES-buffered saline solution (HBSS) containing 2% heat-inactivated calf serum (HICS) and resuspended at 10 6 cells per 100 ⁇ l. Antibodies are added and the cells incubated for 20 minutes on ice followed by two washes with HBSS/2% HICS.
  • HBSS HEPES-buffered saline solution
  • HICS heat-inactivated calf serum
  • Antibodies include anti-ESA (Biomeda, Foster City, CA), anti-CD44, anti-CD24, and Lineage markers anti-CD2, -CD3, -CDlO, -CD16, -CD18, -CD31, -CD64, and -CD140b (collectively referred to as Lin; PharMingen, San Jose, CA). Antibodies are directly conjugated to fluorochromes to positively or negatively select cells expressing these markers. Mouse cells are eliminated by selecting against H2Kd+ cells, and dead cells are eliminated by using the viability dye 7AAD. Flow cytometry is performed on a FACSVantage (Becton Dickinson, Franklin Lakes, NJ). Side scatter and forward scatter profiles are used to eliminate cell clumps.
  • FACSVantage Becton Dickinson, Franklin Lakes, NJ.
  • Isolated ESA+, CD44+, CD24-/low, Lin- tumorigenic cells are then injected subcutaneously into NOD/SCID mice to elicit tumor growth.
  • anti-DDRl antibodies are analyzed for their ability to reduce the growth of PE 13 breast tumor cells.
  • Dissociated PEl 3 cells comprising both tumorigenic and non-tumorigenic tumor cells (10,000 per animal) are injected subcutaneously into the mammary fat pads or the flank region of 6-8 week old NOD/SCID mice.
  • Two days after tumor cell injection animals are injected intraperitoneal (i.p.) with 10 mg/kg anti-DDRl antibodies two times per week. Tumor growth is monitored weekly until growth is detected, after which point tumor growth is measured twice weekly.
  • anti-DDRl antibodies are also analyzed for their ability to reduce the growth of C9 colon tumor cells.
  • Dissociated C9 cells comprising both tumorigenic and non-tumorigenic tumor cells (10,000 per animal) are injected subcutaneously into the flank region of 6-8 week old NOD/SCID mice. Two days after tumor cell injection, animals are injected intraperitoneal (i.p.) with 10 mg/kg anti-DDRl antibodies two times per week. Tumor growth is monitored weekly until growth is detected, after which point tumor growth is measured twice weekly.
  • Example 4 In Vivo Prevention of Tumor Growth Using Anti-DDRl Antibodies in Combination Therapy [0172]
  • This example describes the use of anti-DDRl antibodies to prevent tumor growth in a xenograft model in combination with chemotherapy. Tumor cells from a patient solid tumor biopsy passaged as a xenograft in mice are prepared for repassaging into experimental animals as described in detail above.
  • anti-DDRl antibodies are analyzed for their ability to affect breast tumor recurrence after combination therapy with a chemotherapeutic agent.
  • Dissociated PE 13 cells (10,000 per animal) are injected subcutaneously into the mammary fat pads or the flank region of 6-8 week old NOD/SCID mice and animals are monitored for tumor growth. Once tumors reach an average size of approximately 100 mm 3 , treatment begins: animals are treated i.p. with 10 mg/kg of anti-DDRl antibodies or control antibodies in combination with 15 mg/kg taxol administered two times per week for a total of four weeks. Tumor growth is monitored weekly as tumor volume decreases in response to the combination therapy. After four weeks, taxol administration may be ceased while antibody treatment is maintained.
  • tumor cells from a patient sample that have been passaged as a xenograft in mice can be prepared for repassaging into experimental animals. Tumor tissue is removed, cut up into small pieces, minced completely using sterile blades, and single cell suspensions obtained by enzymatic digestion and mechanical disruption. Dissociated tumor cells comprising both tumorigenic and non-tumorigenic tumor cells are then injected subcutaneously either into the mammary fat pads, for breast tumors, or into the flank, for non-breast tumors, of NOD/SCID mice to elicit tumor growth.
  • ESA+, CD44+, CD24-/low, Lin- tumorigenic tumor cells are isolated as described in detail above and injected.
  • tumor growth Following tumor cell injection, animals are monitored for tumor growth. Once tumors reach an average size of approximately 150 to 200 mm 3 , antibody treatment begins. Each animal receives 100 ⁇ g of DDRl antibodies or control antibodies i.p. two to five times per week for a total of 6 weeks. Tumor size is assessed twice a week during these 6 weeks. The ability of DDRl antibodies to prevent further tumor growth or to reduce tumor size compared to control antibodies is thus determined. [0176] At the end point of antibody treatment, tumors are harvested for further analysis. In some embodiments a portion of the tumor is analyzed by immunofluorescence to assess antibody penetration into the tumor and tumor response.
  • a portion of each harvested tumor from anti-DDRl treated and control antibody treated mice is flash-frozen in liquid nitrogen, embedded in O.C.T., and cut on a cryostat as 10 ⁇ m sections onto glass slides.
  • a portion of each tumor is formalin-fixed, paraffin-embedded, and cut on a microtome as 10 ⁇ m section onto glass slides. Sections are post-fixed and incubated with chromophore-labeled antibodies that specifically recognize injected antibodies to detect anti-DDRl or control antibodies present in the tumor biopsy.
  • antibodies that detect different tumor and tumor-recruited cell types such as, for example, anti-VE cadherin (CD144) or anti- PECAM-I (CD31) antibodies to detect vascular endothelial cells, anti-smooth muscle alpha-actin antibodies to detect vascular smooth muscle cells, anti-Ki67 antibodies to detect proliferating cells, TUNEL assays (Negoescu et al., 1996, E. J. Histochem Cytochem. 44(9):959-68; Negoescu et al., 1998, Biomed Pharmacother.
  • CD144 anti-VE cadherin
  • CD31 anti-PECAM-I
  • Notch fragment antibodies to detect Notch signaling can be used to assess the effects of antibody treatment on, for example, angiogenesis, tumor growth, and tumor morphology.
  • the effect of anti-DDRl antibody treatment on tumor cell gene expression is also assessed.
  • Total RNA is extracted from a portion of each harvested tumor from DDRl antibody treated and control antibody treated mice and used for quantitative RT-PCR.
  • Expression levels of DDRl as well as additional cancer stem cell markers previously identified are analyzed relative to the house-keeping gene GAPDH as an internal control. Changes in tumor cell gene expression upon DDRl antibody treatment are thus determined.
  • tumor samples from DDRl antibody treated versus control antibody treated mice are cut up into small pieces, minced completely using sterile blades, and single cell suspensions obtained by enzymatic digestion and mechanical disruption. Dissociated tumor cells are then analyzed by FACS analysis for the presence of tumorigenic cancer stem cells based on ESA+, CD44+, CD24-/low, Lin- surface cell marker expression as described in detail above.
  • the tumo ⁇ genicity of cells isolated based on ESA+, CD44+, CD24-/low, Lin- expression following anti-DDRl antibody treatment can then be assessed.
  • ESA+, CD44+, CD24-/low, Lm- cancer stem cells isolated from DDRl antibody treated versus control antibody treated mice are re-injected subcutaneously into the mammary fat pads or flank regions of NOD/SCID mice.
  • the tumo ⁇ genicity of cancer stem cells based on the number of injected cells required for consistent tumor formation is then determined.
  • This example desc ⁇ bes methods of treating metastasis using antibodies against DDRl .
  • DDRl m regulation of the extracellular matrix is well-established and suggests that antibodies directed agamst DDRl may inhibit invasion and metastasis of tumor cells.
  • Primary tumor cells or cells from a primary tumor cell line can be transplanted into NOD/SCID mice as desc ⁇ bed, for example, in Wang et al., 2005, Lab. Investigation 85: 1395-1404.
  • antibody treatment commences following detection of tumor growth of transplanted cells withm the original transplant site. Injection of 10 mg/kg anti-DDRl antibodies intraperitoneal (i.p.) two times per week continues for up to 54 weeks. The spread of tumor cells to organ systems beyond the original transplant site is monitored compared to PBS injected control animals.
  • This example desc ⁇ bes methods for treating cancer using antibodies agamst DDRl to target tumors compnsmg cancer stem cells and/or other tumor cells in which DDRl expression has been detected.
  • the presence of cancer stem cell marker expression can first be determined from a tumor biopsy. Tumor cells from a biopsy from a patient diagnosed with cancer are removed under ste ⁇ le conditions. In some embodiments the tissue biopsy is flash-frozen m liquid nitrogen, embedded in O.C.T., and cut on a cryostat as 10 ⁇ m sections onto glass slides.
  • the tissue biopsy is formalm-fixed, paraffin-embedded, and cut on a microtome as 10 ⁇ m section onto glass slides Sections are incubated with antibodies agamst DDRl to detect protein expression.
  • the presence of cancer stem cells can also be determined. Tissue biopsy samples are cut up into small pieces, mmced completely using ste ⁇ le blades, and cells subject to enzymatic digestion and mechanical disruption to obtain a single cell suspension.
  • Dissociated tumor cells are then incubated with anti-ESA, -CD44, -CD24, -Lm, and -DDRl antibodies to detect cancer stem cells, and the presence of ESA+, CD44+, CD24-/low, Lm-, DDRl + tumor stem cells is determined by flow cytometry as desc ⁇ bed in detail above.
  • cancer patients whose tumors are diagnosed as expressing DDRl are treated with anti-DDRl antibodies.
  • humanized or human monoclonal anti- DDRl antibodies generated as described above are purified and formulated with a suitable pharmaceutical vehicle for injection.
  • patients are treated with the DDRl antibodies at least once a month for at least 10 weeks.
  • patients are treated with the DDRl antibodies at least once a week for at least about 14 weeks.
  • Each administration of the antibody should be a pharmaceutically effective dose. In some embodiments, between about 2 to about 100 mg/ml of an anti- DDRl antibody is administered. Ln some embodiments, between about 5 to about 40 mg/ml of an anti- DDRl antibody is administered.
  • the antibody can be administered prior to, concurrently with, or after standard radiotherapy regimens or chemotherapy regimens using one or more chemotherapeutic agent, such as oxaliplatin, fluorouracil, leucovorin, or streptozocin.
  • chemotherapeutic agent such as oxaliplatin, fluorouracil, leucovorin, or streptozocin.
  • Patients are monitored to determine whether such treatment has resulted in an anti-tumor response, for example, based on tumor regression, reduction in the incidences of new tumors, lower tumor antigen expression, decreased numbers of cancer stem cells, or other means of evaluating disease prognosis
  • Example 8 Cell-Based Assay for Identification of Anti-DDRl Antibodies with Agonist or Antagonist
  • This example describes exemplary cell-based assays for identification of DDRl antibodies with agonist or antagonist properties.
  • K562 cells are transfected with pcDNA3.1 FLAG-DDRl using standard procedures.
  • Stable lines expressing FLAG tagged DDRl are selected with neomycin and one stable line expressing
  • FLAG-DDRl (SEQ ID NO:37) is selected for analyzing collagen-induced phosphorylation.
  • Cells are starved in serum-free medium for 36 hours. Cells are then treated with collagen to stimulate phosphorylation of DDRl. To test the antagonist properties of anti-DDRl antibodies, cells are pretreated with 5 or 50 ⁇ g/ml of the indicated antibodies, subsequently stimulated with rat tail collagen
  • Antibodies (anti-phosphotyrosine, 4G10 clone; and anti-Flag epitope, M2 clone) are incubated for 1 h at room temperature in PBS-T with 0.5% milk. Bound primary antibodies are detected with appropriate secondary antibodies conjugated with HRP and ECL plus.
  • K562 cells expressing FLAG tagged DDRl are treated for 4 hours with candidate antibodies to DDRl in the absence of exogenous collagen. Treatment with antibodies that increase tyrosine phosphorylation of DDRl indicates that the antibodies have agonist properties. Stimulation of the cells with collagen type I causes an increase in tyrosine phosphorylation of DDRl. An ability of an antibody to block the stimulation of DDRl on the K562 cells in response to collagen indicates that the antibody being tested is an antagonist of DDRl .
  • the assay is not limited to any one particular tumor cell line or type (for example, K562 cells as described above), as would be known to those skilled in the art.
  • DDRl protein was detected on the cell surface of human tumor cells. Specifically example images of cryosections of a colon tumor model (OMP-C27) and a lung tumor model (OMP-Lu4) are shown, wherein DDRl protein could be detected (Fig. 1), whereas control antibody did not stain tumor cells in both OMP-C27 and OMP-Lu4 tumors.
  • Correlation value > 0 signifies positive correlation
  • Example 11 Correlation of DDRl Expression with Activation of Notch Signaling [0192]
  • DDRl m stem cells To study the potential function of DDRl m stem cells, we compared the expression pattern of DDRl to Hesl expression, a marker of Notch pathway activation, using standard Pearson correlation. Within a large set of expression data from normal/malignant samples, we performed correlation analysis of expression values between DDRl and Hesl in colon/mtestine (446), breast (163), kidney (153), liver (107), lung (217), ovary (145), pancreas (85) and prostate (128) samples. The results of the expression correlation study are shown below m Table 3. The expression patterns of DDRl and Hesl showed statistically significant positive correlation m the colon, breast, renal, lung, prostate, and pancreas samples (in bold).
  • Example 12 Limiting Dilution Assays to Assess the Reduction of the Number of Cancer Stem Cells
  • Limiting dilution assays can be used to assess the effect of a DDRl -modulating agent or antibody on solid tumor cancer stem cells and on the tumo ⁇ genicity of a tumor comprising the cancer stem cells.
  • the assays can be used to determine the frequency of cancer stem cells m tumors from animals treated with the DDRl -modulating antibody or other agent and to compare that frequency to the frequency of cancer stem cells in tumors from control animals.
  • mice that have been treated with either control or a candidate anti-DDRl antibody at 10 mg/kg twice per week are isolated after 38 days of treatment Isolated tumors are dissociated and FACS analyzed to determine the ratio of mouse to human cells. Human cells in increasingly lower numbers are then reinjected into immunocompromised mice. For example, mice may be injected with 1000, 333, 111, or 37 isolated human tumor cells (composing both tumo ⁇ genic and non-tumongenic tumor cells) m the ⁇ ght flank region. Tumor volume is assessed twice per week.
  • the percentage of mice with detectable tumors is determined in all groups injected with anti-DDRl antibody treated tumor cells and compared to the percentage of mice with detectable tumors m the controls. For example, the number of mice injected with 1000 control-treated tumor cells that have detectable tumors is determined and compared to the number of mice injected with 1000 DDRl-antibody treated tumor cells that have detectable tumors.
  • the stem cell frequency can be calculated using L-CaIcTM software (downloadable from www. followed by stemcell.com/search/default.asp). Briefly, based on Poisson statistics, exactly one stem cell exists among the known number of injected cells if 37% of the animals fail to develop tumors.
  • a recombinant polypeptide fragment of the extracellular domain of human DDRl was generated as an antigen for antibody production as described herein. Briefly, standard recombinant DNA technology was used to isolate a polynucleotide encoding amino acids 1-417 of DDRl (nucleotide SEQ ID NO:4; amino acid SEQ ID NO: 1). The polynucleotide was ligated in-frame N-terminal to either a human Fc-tag or histidine-tag and cloned into a transfer plasmid vector for baculovirus-mediated expression in insect cells.
  • DDRl protein was purified from insect cell conditioned medium using Protein A and
  • mice were immunized with purified DDRl protein using standard techniques known to one skilled in the art. Blood from individual mice was screened approximately 70 days after initial immunization for antigen recognition using FACS analysis (as described herein). The animal with the highest antibody titer was selected for final antigen boost after which spleen cells were isolated for hybridoma production. Hybridoma cells were plated at 1 cell per well in 96 well plates, and the supernatant from each well screened by FACS analysis against antigen protein. Several hybridomas with high antibody titer were selected and scaled up in static flask culture. Antibodies were purified from the hybridoma supernatant using protein A or protein G agarose chromatography.
  • HEK293 cells were co-transfected with expression vectors encoding a full-length cDNA clone of DDRl and the transfection marker GFP. Twenty-four to forty-eight hours post-transfection, cells were collected in suspension and incubated on ice with anti- DDRl antibodies or control IgGl to detect background antibody binding.
  • the cells were washed and primary antibodies bound to the DDRl -expressing cells were detected with anti-mouse secondary antibodies conjugated to a fluorescent chromophore. Labeled cells were then sorted by FACS to identify anti-DDRl antibodies that specifically recognize cell surface expression of native cell-surface DDRl protein. Two monoclonal antibodies that recognize and bind to DDRl were identified, antibodies 20M102 and 20M104 (Fig. 2). A hybridoma expressing antibody 20M102, was deposited with American Type Culture Collection (ATCC), 10801 University Boulevard., Manassas, VA, USA, under the conditions of the Budapest Treaty on May 21, 2009, and assigned deposit number PTA- 10051.
  • ATCC American Type Culture Collection
  • DDRl variants containing point mutations in the extracellular domain were produced by methods known to one of skill in the art.
  • site-directed mutagenesis of DDR2 has been done to study collagen binding sites (Ichikawa et al., 2007, EMBOJ. 26:4168-4176). Briefly, site-directed mutagenesis was performed following the Stratagene QuikChange protocol and using pcDNA DDRl- FLAG as the wild-type template plasmid DNA. Specifically, the following mutations were generated in the extracellular domain of DDRl: W53A, D68A, R105A, Ll 1OA, El 13Q, and S175A (using numbering based upon SEQ ID NO:2).
  • Clones expressing FLAG-tagged DDRl were identified and expanded for use in assays.
  • HEK293-DDR1 expressing cells were plated in 12 well plates, grown for 48 hours in
  • DMEM fetal calf serum
  • DMEM fetal calf serum
  • rat tail collagen type I 30 ⁇ g/ml
  • agarose beads conjugated to anti- FLAG M2 antibody were mixed with supernatants and incubated for 2 hours on a rotator.
  • the agarose beads were washed twice with lysis buffer, followed by resuspension in denaturing sample buffer. Proteins were separated by SDS-polyacrylamide gel electrophoresis (SDS-PAGE) and transferred to nitrocelluose membranes. Membranes were blocked in TBS-T (Tris-Buffered Saline plus 0.1% Tween 20) containing 5% nonfat milk for approximately 1 hour.
  • TBS-T Tris-Buffered Saline plus 0.1% Tween 20
  • the membranes were washed, and then incubated with primary antibodies (anti-phosphotyrosine, 4G10 clone, and anti-FLAG epitope, M2 clone) for 1 hour at room temperature in PBS-T with 0.5% milk. Bound primary antibodies were detected with appropriate secondary antibodies conjugated with HRP and visualized using an ECL Plus Western Blotting Detection System (GE Healthcare Life Sciences/Amersham Bioscience, Piscataway, NJ). [0206] It is known that DDRl -expressing cells respond to treatment with collagen by increased phosphorylation of DDRl on tyrosine residues.
  • antibodies 2OM 102 or 2OM 104 in the absence of collagen did not alter the phosphorylation of DDRl demonstrating that neither antibody displayed agonist properties in the HEK293 cells (see lanes 4-6, 20M102 and lanes 10-12, 20M104).
  • the antagonist/agonist properties of antibodies 20M102 and 2OM 104 may be cell type dependent.
  • 2OM 102 demonstrated different properties in a phosphorylation assay in a different cell line.
  • OMP-C37 xenografts were embedded in OCT compound and frozen. 5 ⁇ m cryosections were incubated with blocking solution (PBS with 2% bovine serum albumin). The cryosections were then incubated with primary anti-DDRl antibody 20M102 or an anti-trinitrophenol (hapten) antibody as control antibody. Both antibodies were diluted in PBS with 2% bovine serum albumin to a concentration of 5 ⁇ g/ml. After multiple wash steps, bound antibodies were detected with Alexa 594-labeled goat anti-mouse secondary antibody. Nuclei were stained with DAPI by standard methods.
  • FIG. 5 shows representative images of cryosections of colon tumor OMP-C37, demonstrating that the DDRl protein was detected with 2OM 102 antibody.
  • Immunofluorescence (light gray in image) showed the localization of DDRl protein in the OMP-037 colon tumor (Fig. 5A), while there was no detectable immunofluorescence in the sample stained with control antibody (Fig. 5B).
  • Fig. 5C and 5D are representative images of nuclear staining of cryosections stained with DAPI.
  • Anti-DDRl antibodies were analyzed in combination with chemotherapy for the ability to reduce growth of OMP-C37 colon tumor cells in vivo.
  • Dissociated human OMP-C37 cells (10,000 per animal) were injected subcutaneously into the right flank region of 6-8 week old NOD/SCID mice. Tumor growth was monitored and tumor measurements were initiated once tumors were palpable. 46 days after cell injection, tumors were measured to be an average volume of 139 mm 3 , and treatments were commenced. Animals were treated with anti-DDRl 20M102 antibody with or without concurrent treatment with chemotherapy agent irinotecan.
  • mice with established OMP-C37 tumors were treated with either control antibody, 2OM 102 antibody, irinotecan, or a combination of 2OM 102 and irinotecan. As shown in Figure 6, treatment with 2OM 102 antibody (squares) alone did not significantly reduce tumor volume as compared to control treated animals (diamonds).
  • DDRl transcript A full length amino acid sequence (SEQ DD NO: 2)
  • DDRl transcript A nucleotide sequence (SEQ ID NO:5)

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biomedical Technology (AREA)
  • Oncology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)

Abstract

Disclosed are DDR1 binding agents and methods of using the agents for treating diseases such as cancer. The disclosure provides antibodies that specifically bind to an extracellular domain of DDR1 and modulate DDR1 activity. The disclosure further provides methods of using agents that modulate the activity ofDDRI, such as antibodies that specifically bind DDR1, to reduce the tumorigenicity of tumors comprising cancer stem cells by reducing the frequency or number of cancer stem cells in the tumor. Also described are methods of treating cancer comprising administering a therapeutically effect amount of an agent or antibody of the present invention to a patient having a tumor or cancer.

Description

DDRl -BINDING AGENTS AND METHODS OF USE THEREOF
BACKGROUND OF THE INVENTION Field of the Invention
[0001] The present invention relates to the field of oncology and provides novel compositions and methods for treating and diagnosing cancer. In particular, the present invention provides antibodies against DDRl for the treatment and diagnosis of solid tumors.
Background Art
[0002] Cancer is one of the leading causes of death in the developed world, with over one million people diagnosed with cancer and 500,000 deaths per year in the United States alone. Overall it is estimated that more than 1 in 3 people will develop some form of cancer during their lifetime. There are more than 200 different types of cancer, four of which — breast, lung, colorectal, and prostate — account for over half of all new cases (Jemal et al., 2003, Cancer J. Clin. 53:5-26).
[0003] Cancer of the breast, lung, colorectal, and prostate, as well as many other cancers, present as solid tumors that are composed of heterogeneous cell populations. For example, breast cancers are a mixture of cancer cells and normal cells, including mesenchymal (stromal) cells, inflammatory cells, and endothelial cells. Several models of cancer provide different explanations for the presence of this heterogeneity. One model, the classic model of cancer, holds that phenotypically distinct cancer cell populations all have the capacity to proliferate and give rise to a new tumor. In the classical model, tumor cell heterogeneity results from environmental factors as well as ongoing mutations within cancer cells resulting in a diverse population of tumorigenic cells. This model rests on the idea that all populations of tumor cells have some degree of tumorigenic potential. (Pandis et al., 1998, Genes, Chromosomes & Cancer 12: 122-129; Kuukasjrvi et al., 1997, Cancer Res. 57: 1597-1604; Bonsing et al., 1993, Cancer 71:382-391; Bonsmg et al., 2000, Genes Chromosomes & Cancer 82: 173-183; Beerman H et al., 1991, Cytometry 12:147-54; Aubele M & Werner M, 1999, Analyt. Cell. Path. 19:53; Shen L et al., 2000, Cancer Res. 60:3884).
[0004] An alternative model for the observed solid tumor cell heterogeneity derives from the impact of stem cells on tumor development. According to this model cancer arises from dysregulation of the mechanisms that control normal tissue development and maintenance. (Beachy et al., 2004, Nature 432:324). During normal animal development, cells of most or all tissues are derived from normal precursors, called stem cells (Morrison et al., 1997, Cell 88:287-98; Morrison et al., 1997, Curr. Opin. Immunol. 9:216-21; Morrison et al., 1995, Annu. Rev. Cell. Dev. Biol. 11:35-71). Stem cells are cells that: (1) have extensive proliferative capacity; 2) are capable of asymmetric cell division to generate one or more kinds of progeny with reduced proliferative and/or developmental potential; and (3) are capable of symmetric cell divisions for self-renewal or self-maintenance. The best-studied example of adult cell renewal by the differentiation of stem cells is the hematopoietic system where developmentally immature precursors (hematopoietic stem and progenitor cells) respond to molecular signals to form the varied blood and lymphoid cell types. Other cells, including cells of the gut, breast ductal system, and skin are constantly replenished from a small population of stem cells in each tissue, and recent studies suggest that most other adult tissues also harbor stem cells, including the brain. Tumors derived from a "solid tumor stem cell" (or "cancer stem cell" from a solid tumor) subsequently undergo chaotic development through both symmetric and asymmetric rounds of cell divisions. In this stem cell model, solid tumors contain a distinct and limited (possibly even rare) subset of cells that share the properties of normal "stem cells", in that they extensively proliferate and efficiently give rise both to additional solid tumor stem cells (self- renewal) and to the majority of tumor cells of a solid tumor that lack tumorigenic potential. Indeed, mutations within a long-lived stem cell population may initiate the formation of cancer stem cells that underlie the growth and maintenance of tumors and whose presence contributes to the failure of current therapeutic approaches.
[0005] The stem cell nature of cancer was first revealed in the blood cancer, acute myeloid leukemia (AML) (Lapidot et al., 1994, Nature 17:645-8). More recently it has been demonstrated that malignant human breast tumors similarly harbor a small, distinct population of cancer stem cells enriched for the ability to form tumors in immunodeficient mice. An ESA+, CD44+, CD24-/low, Lin- cell population was found to be 50-fold enriched for tumorigenic cells compared to unfractionated tumor cells (Al-Hajj et al., 2003, Proc. Natl Acad. ScL 100:3983-8). The ability to prospectively isolate the tumorigenic cancer cells has permitted investigation of critical biological pathways that underlie tumorigenicity in these cells, and thus promises the development of better diagnostic assays and therapeutics for cancer patients.
[0006] All publications, patents, patent applications, internet sites, and accession numbers/database sequences including both polynucleotide and polypeptide sequences cited herein are hereby incorporated by reference herein in their entirety for all purposes to the same extent as if each individual publication, patent, patent application, internet site, or accession number/database sequence were specifically and individually indicated to be so incorporated by reference.
BRIEF SUMMARY OF THE INVENTION
[0007] The invention provides agents which bind to and/or modulate the activity of the discoidin domain receptor 1 (DDRl) and compositions, such as pharmaceutical compositions, comprising those agents. In certain embodiments, the agents are antibodies. In certain embodiments, the agents are antibodies that specifically bind to DDRl (e.g., human DDRl). In certain embodiments, the agents that specifically bind to and/or modulate the activity of DDRl further specifically bind to and/or modulate the activity of the discoidin domain receptor 2 (DDR2). The invention further provides methods of targeting cancer stem cells with the agents. In certain embodiments, the methods comprise reducing the frequency of cancer stem cells in a tumor, reducing the number of cancer stem cells in a tumor, reducing the tumorigenicity of a tumor, and/or reducing the tumorigenicity of a tumor by reducing the number or frequency of cancer stem cells in the tumor. The invention also provides methods of using the agents in the treatment of cancer and/or in the inhibition of the growth of tumors comprising cancer stem cells. [0008] In one aspect, the invention provides a method of inhibiting the growth of a tumor in a subject, comprising administering to the subject a therapeutically effective amount of an agent that modulates the activity of DDRl . In certain embodiments the tumor comprises cancer stem cells. In certain embodiments, the agent reduces tumorigenicity of the tumor by reducing the number and/or frequency of cancer stem cells in the tumor. In certain embodiments, the agent is an antibody, such as an antibody that specifically binds to DDRl . In certain embodiments, the agent reduces the frequency of cancer stem cells in the tumor.
[0009] In another aspect, the invention provides a method of reducing the tumorigenicity of a tumor comprising cancer stem cells by reducing the number and/or frequency of cancer stem cells in the tumor, wherein the method comprises contacting the tumor with an effective amount of an agent that modulates the activity of DDRl . In certain embodiments, the agent is an antibody, such as an antibody that specifically binds to DDRl .
[0010] In another aspect, the invention provides an antibody that modulates the activity of
DDRl . In certain embodiments, the antibody reduces the frequency of cancer stem cells in a tumor, reduces the number of cancer stem cells in a tumor, reduces the tumorigenicity of a tumor, and/or reduces the tumorigenicity of a tumor by reducing the number and/or frequency of cancer stem cells in the tumor. In certain embodiments, the antibody specifically binds to DDRl . Pharmaceutical compositions comprising both the antibody and a pharmaceutically acceptable vehicle are further provided, as are cell lines that produce the antibody. Methods of treating cancer and/or inhibiting tumor growth in a subject (e.g., a human) comprising administering to the subject an effective amount of a composition comprising the antibody are also provided. Methods of inhibiting inflammation and/or fibrosis in a subject comprising administering to the subject an effective amount of a composition comprising the antibody are further provided.
[0011] In certain embodiments of each of the aforementioned aspects, as well as other aspects described elsewhere herein, the agent or antibody specifically binds to the extracellular domain of DDRl. In certain embodiments, the agent or antibody binds the discoidin domain of DDRl . In certain embodiments, the agent or antibody binds to at least one amino acid in the sequence SASSSWSDSTAAR (SEQ ID NO:30) within human DDRl . In some embodiments, the agent or antibody further binds to additional amino acid residues within DDRl . In certain embodiments, the agent or antibody competes with an antibody that binds to at least one ammo acid m the sequence SASSSWSDSTAAR (SEQ ID NO:30) within human DDRl .
[0012] In another aspect, the invention provides an antibody that specifically binds to an extracellular domain of human DDRl . Li certain embodiments, the antibody compπses a heavy chain vaπable region having at least 90% sequence identity to SEQ ID NO:33, and/or a light chain vaπable region having at least 90% sequence identity to SEQ ID NO:35. In some embodiments, the antibody compπses a heavy chain vaπable region having at least 95% sequence identity to SEQ ID NO:33, and/or a light chain vaπable region having at least 95% sequence identity to SEQ ID NO:35. In some embodiments, the antibody compπses a heavy chain vaπable region compπsing the sequence of SEQ ID NO:33, and/or a light chain vaπable region compπsmg the sequence of SEQ ID NO:35. In certain embodiments, the antibody compπses a heavy chain CDRl compπsing GYTFTD YFMK (SEQ ID NO:22), a heavy chain CDR2 compπsing DINPNNGDTFYIQKFKG (SEQ ID NO:23), and/or a heavy chain CDR3 comprising SRDLAY (SEQ ID NO:24), and/or the antibody compπses a light chain CDRl compπsing KSSQSLLYSNGKTYLN (SEQ ID NO:27), a- light chain CDR2 compπsmg QVSKLDS (SEQ ID NO:28), and/or a light chain CDR3 compπsmg VQGTDFPQT (SEQ ID NO:29). In certain embodiments, the antibody compnses a heavy chain vaπable region compπsmg (a) a heavy chain CDRl compπsing GYTFTD YFMK (SEQ ID NO:22), or a vaπant thereof compπsing 1, 2, 3 or 4 ammo acid substitutions; (b) a heavy chain CDR2 compπsmg DINPNNGDTFYIQKFKG (SEQ ID NO:23), or a vaπant thereof compπsing 1, 2, 3 or 4 ammo acid substitutions; and/or (c) a heavy chain CDR3 compπsmg SRDLAY (SEQ ID NO:24), or a vaπant thereof compπsing 1, 2, 3 or 4 amino acid substitutions. In other embodiments, the antibody further compπses a light chain vaπable region compπsmg (a) a light chain CDRl compπsmg KSSQSLLYSNGKTYLN (SEQ ID NO:27), or a vaπant thereof compπsing 1, 2, 3 or 4 amino acid substitutions; (b) a light chain CDR2 compπsing QVSKLDS (SEQ ID NO:28), or a vaπant thereof compπsmg 1, 2, 3 or 4 ammo acid substitutions; and/or (c) a light chain CDR3 compπsing VQGTDFPQT (SEQ ID NO:29), or a vaπant thereof compπsmg 1, 2, 3 or 4 ammo acid substitutions. In some embodiments, the ammo acid substitutions are conservative ammo acid substitutions.
[0013] In another aspect, the invention provides an antibody, 20M102, produced by the hybπdoma cell line deposited as ATCC deposit number PTA- 10051. In some embodiments, the antibody is a humanized version of 20M102. In some embodiments, the invention provides an antibody which specifically binds to the same DDRl epitope as the epitope to which antibody 2OM 102 binds. In other embodiments, the invention provides an antibody which competes with any of the antibodies as descπbed in the aforementioned embodiments and/or aspects, as well as other aspects/embodiments descπbed elsewhere herein, for specific binding to DDRl . [0014] In certain embodiments of each of the aforementioned aspects, as well as other aspects descπbed elsewhere herein, the agent or antibody that specifically binds to and/or modulates the activity of DDRl further specifically binds to and/or modulates the activity of DDR2. In certain embodiments, the antibody binds the discoidin domain of DDR2.
[0015] Ln certain embodiments of each of the aforementioned aspects, as well as other aspects descπbed elsewhere herein, the agent or antibody is an antagonist of DDRl . In some embodiments, the agent or antibody is also an antagonist of DDR2.
[0016] In certain embodiments of each of the aforementioned aspects, as well as other aspects descπbed elsewhere herein, the agent or antibody inhibits the binding of a hgand to DDRl . In some embodiments, the agent or antibody inhibits the binding of collagen to DDRl . In some embodiments, the agent or antibody inhibits or blocks the activation of DDRl . In some embodiments, the agent or antibody inhibits or blocks phosphorylation of DDRl. In some embodiments, the agent or antibody inhibits or blocks collagen-mduced phosphorylation of DDRl . In some embodiments, the agent or antibody also inhibits the binding of collagen to DDR2.
[0017] In certain embodiments of each of the aforementioned aspects or embodiments, as well as other aspects and/or embodiments descπbed elsewhere herein, the antibody is a recombinant antibody. In certain embodiments, the antibody is a monoclonal antibody, a chimeπc antibody, a humanized antibody, or a human antibody. In some embodiments, the antibody is an antibody fragment. In certain embodiments, the antibody or antibody fragment is monovalent, monospecific, bivalent, bispecific, or multispecific. In certain embodiments, the antibody is conjugated to a cytotoxic moiety. In certain embodiments, the antibody is isolated. In still further embodiments, the antibody is substantially pure. [0018] In another aspect, the invention provides a polypeptide. In some embodiments, the polypeptide is an antibody and/or a fragment of an antibody. In some embodiments, the polypeptide is isolated. In certain embodiments, the polypeptide is substantially pure. In some embodiments, the polypeptide compnses the amino acid sequence of SEQ ID NO:33, and/or the ammo acid sequence of SEQ DD NO:35. In some embodiments, the polypeptide compnses at least a portion of the ammo acid sequence of SEQ ID NO:33, and/or at least a portion of the ammo acid sequence of SEQ ID NO: 35. Pharmaceutical compositions compπsmg both the polypeptide and a pharmaceutically acceptable vehicle are further provided, as are cell lines that produce the polypeptide.
[0019] In another aspect, the invention provides a polynucleotide molecule encoding any of the antibodies and/or polypeptides of the aforementoned aspects, as well as other aspects as descπbed herein In some embodiments, an expression vector compnses the polynucleotide molecule. In other embodiments, a host cell compnses the expression vector. In some embodiments, the host cell is a hybndoma cell line. In certain embodiments of each of the aforementioned aspects, as well as other aspects described elsewhere herein, DDRl is human DDRl. Likewise, in some embodiments, DDR2 is human DDR2.
[0020] In certain embodiments of each of the aforementioned aspects, as well as other aspects described elsewhere herein, the treatment methods further comprise administering at least one additional therapeutic agent appropriate for effecting combination therapy (e.g., a chemotherapeutic agent or other anticancer agent, if cancer is to be treated).
[0021] In certain embodiments of each of the aforementioned aspects, as well as other aspects described elsewhere herein, the tumors which are targeted comprise cells which are Hesl -expressing cells and/or which are LGR5 -expressing cells. In some embodiments, the Hesl -expressing cells and/or LGR5- expressing cells are cancer stem cells.
[0022] In certain embodiments of each of the aforementioned aspects, as well as other aspects described elsewhere herein, the tumors which are targeted are breast, colorectal, hepatic, renal, lung, pancreatic, ovarian, prostate, or head and neck tumors.
[0023] The present invention further provides methods of treating cancer in a subject. In some embodiments, the method comprises administering to a subject a therapeutically effective amount of any of the antibodies or polypeptides described in the aforementioned aspects, as well as other aspects and embodiments described elsewhere herein. In some embodiments, the cancer to be treated is breast cancer, colorectal cancer, hepatic cancer, kidney cancer, liver cancer, lung cancer, pancreatic cancer, gastrointestinal cancer, melanoma, ovarian cancer, prostate cancer, cervical cancer, bladder cancer, glioblastoma, and head and neck cancer. In some embodiments, the methods further comprise administering to the subject at least one additional anti-cancer agent.
[0024] The present invention further provides methods of identifying and/or isolating cancer stem cells (e.g., based on expression of DDRl), screening for anti-cancer agents, and screening patients for suitability for treatment with the agents described herein.
[0025] The present invention further provides methods of identifying an antibody that inhibits activity of DDRl, wherein the method comprises assaying antibodies for specific binding to DDRl and for specific binding to a variant of DDRl . A reduction in binding by an antibody to the variant DDRl as compared to native/wildtype DDRl identifies an antibody that inhibits activity of DDRl. In some embodiments, the variant of DDRl comprises a sequence in which the sequence SASSSWSDSTAAR
(SEQ ID NO:30) has been replaced by sequence SASSSASDSTAAR (SEQ ID NO:31).
[0026] Where aspects or embodiments of the invention are described in terms of a Markush group or other grouping of alternatives, the present invention encompasses not only the entire group listed as a whole, but also each member of the group individually and all possible subgroups of the main group, and also the main group absent one or more of the group members. The present invention also envisages the explicit exclusion of one or more of any of the group members in the claimed invention. BRIEF DESCRIPTION OF THE DRAWINGS/FIGURES
[0027] Figure 1. Detection of DDRl protein expression by tumors.
[0028] Figure 2. FACS analysis of monoclonal antibodies for binding to DDRl on the surface of
HEK293 cells.
[0029] Figure 3. FACS analysis of antibody binding to DDRl vaπants. Figure 3 A shows antibody binding to DDRl wildtype, DDRl W53A, DDRl D68A and DDRl Rl 05 A vaπants. Figure 3B shows antibody binding to DDRl Ll 1OA, DDRl El 13Q and DDRl S175A vaπants and DDR2. [0030] Figure 4. Tyrosine phosphorylation assay with antibodies 2OM 102 and 2OM 104.
[0031] Figure 5. Detection of DDRl protein expression m OMP-C37 tumor cells. Cryosections of OMP-C37 colon tumor were stained with 2OM 102 (panels A and C) or control antibody (panels B and D). Immunofluorescence shows the localization of DDRl protein in panel A, and panel C represents an image of nuclear DAPI staining for the cryosection. Shown in panel B is immunofluorescence associated with a control antibody, and panel D is the nuclear DAPI stam.
[0032] Figure 6. Tumor xenograft efficacy study. SCID mice were injected with dissociated
OMP-C37 cells and treated with anti-DDRl antibody or control antibody in the presence or absence of mnotecan. Mice with established tumors were treated with control antibody, 2OM 102, innotecan or combination of 20M 102 and mnotecan. The combined treatment with 2OM 102 and mnotecan (circles) reduced tumor volume (y-axis mm3) as compared to animals treated with either control antibody (diamonds) or 20M102 (squares) or mnotecan alone (mangles).
DETAILED DESCRIPTION OF THE INVENTION
[0033] The term "discoidin domain receptor 1" or "DDRl" as used herein refers to all isoforms and vaπants of the DDRl protein, including DDRIa, DDRIb, DDRIc, DDRId and DDRIe. [0034] The term "antibody" is used to mean an immunoglobulin molecule that recognizes and specifically binds to a target, such as a protein, polypeptide, peptide, carbohydrate, polynucleotide, lipid, or combinations of the foregoing through at least one antigen recognition site within the vaπable region of the immunoglobulin molecule. In certain embodiments, antibodies of the present invention include antagonist antibodies that specifically bind to a cancer stem cell marker protein and interfere with, for example, hgand binding, receptor dimeπzation, expression of a cancer stem cell marker protein, and/or downstream signaling of a cancer stem cell marker protein. In certain embodiments, disclosed antibodies include agonist antibodies that specifically bind to a cancer stem cell marker protein and promote, for example, hgand binding, receptor dimeπzation, and/or signaling by a cancer stem cell marker protein. In certain embodiments, disclosed antibodies do not interfere with or promote the biological activity of a cancer stem cell marker protein but inhibit tumor growth by, for example, antibody internalization and/or recognition by the immune system. As used herein, the term "antibody" encompasses intact polyclonal antibodies, mtact monoclonal antibodies, antibody fragments (such as Fab, Fab', F(ab')2, and Fv fragments), single chain Fv (scFv) mutants, multispecific antibodies such as bispecifϊc antibodies generated from at least two intact antibodies, monovalent or monospecific antibodies, chimeπc antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antigen determination portion of an antibody, and any other modified immunoglobulin molecule comprising an antigen recognition site so long as the antibodies exhibit the desired biological activity. An antibody can be any of the five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, or subclasses (lsotypes) thereof (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2), based on the identity of their heavy-chain constant domains referred to as alpha, delta, epsilon, gamma, and mu, respectively. The different classes of immunoglobulins have different and well known subunit structures and three-dimensional configurations. Antibodies can be naked or conjugated to other molecules such as toxins, radioisotopes, etc.
[0035] As used herein, the term "antibody fragment" refers to a portion of an intact antibody and refers to the antigenic determining vaπable regions of an intact antibody. Examples of antibody fragments include, but are not limited to, Fab, Fab1, F(ab')2, and Fv fragments, linear antibodies, single chain antibodies, and multispecific antibodies formed from antibody fragments. [0036] An "Fv antibody" refers to the minimal antibody fragment that contains a complete antigen-recognition and -binding site either as two-chams, in which one heavy and one light chain vaπable domain form a non-covalent dimer, or as a smgle-chain (scFv), in which one heavy and one light chain vaπable domain are covalently linked by a flexible peptide linker so that the two chains associate in a similar dimeπc structure. In this configuration the complementary determining regions (CDRs) of each vaπable domain interact to define the antigen-bmdmg specificity of the Fv dimer. Alternatively a single vaπable domain (or half of an Fv) can be used to recognize and bmd antigen, although generally with lower affinity.
[0037] A "monoclonal antibody" as used herein refers to a homogenous antibody population involved in the highly specific recognition and binding of a single antigenic determinant, or epitope. This is in contrast to polyclonal antibodies that typically include different antibodies directed against different antigenic determinants. The term "monoclonal antibody" encompasses both intact and full-length monoclonal antibodies as well as antibody fragments (such as Fab, Fab', F(ab')2, Fv), single chain (scFv) mutants, fusion proteins comprising an antibody portion, and any other modified immunoglobulin molecule comprising an antigen recognition site. Furthermore, "monoclonal antibody" refers to such antibodies made m any number of manners including, but not limited to, by hybπdoma, phage selection, recombinant expression, and transgenic animals.
[0038] As used herein, the term "humanized antibody" refers to forms of non-human (e.g., muπne) antibodies that are specific immunoglobulin chains, chimeπc immunoglobulins, or fragments thereof that contain minimal non-human sequences. Typically, humanized antibodies are human immunoglobulins in which residues from the complementary determining region (CDR) are replaced by residues from the CDR of a non-human species (e.g., mouse, rat, rabbit, hamster) that have the desired specificity, affinity, and/or capability. In some instances, the Fv framework region (FR) residues of a human immunoglobulin are replaced with the corresponding residues in an antibody from a non-human species that has the desired specificity, affinity, and/or capability. The humanized antibody can be further modified by the substitution of additional residues either in the Fv framework region and/or withm the replaced non-human residues to refine and optimize antibody specificity, affinity, and/or capability. In general, the humanized antibody will compnse substantially all of at least one, and typically two or three, vaπable domains containing all, or substantially all, of the CDR regions that correspond to the non-human immunoglobulin; whereas all, or substantially all, of the FR regions are those of a human immunoglobulin consensus sequence. The humanized antibody can also compnse at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin. Examples of methods used to generate humanized antibodies are descπbed in U.S. Pat. 5,225,539.
[0039] The term "human antibody" as used herein means an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human made using any technique known in the art. This definition of a human antibody includes intact or full-length antibodies, fragments thereof, and/or antibodies comprising at least one human heavy and/or light chain polypeptide such as, for example, an antibody comprising muπne light chain and human heavy chain polypeptides. The term "chimeric antibodies" refers to antibodies wherein the amino acid sequence of the immunoglobulin molecule is deπved from two or more species. Typically, the vaπable region of both light and heavy chains corresponds to the vaπable region of antibodies deπved from one species of mammals (e.g. mouse, rat, rabbit, etc.) with the desired specificity, affinity, and capability, while the constant regions are homologous to the sequences in antibodies deπved from another species (usually human) to avoid eliciting an immune response m that species. The term chimeπc antibody includes monovalent, divalent and polyvalent antibodies. The terms "epitope" and "antigenic determinant" are used interchangeably herein and refer to that portion of an antigen capable of being recognized and specifically bound by a particular antibody. When the antigen is a polypeptide, epitopes can be formed both from contiguous ammo acids and noncontiguous ammo acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids (often referred to as "linear epitopes") are typically retained upon protein denaruπng, whereas epitopes formed by tertiary folding (often referred to as "conformational epitopes") are typically lost upon protein denatuπng. An epitope typically includes at least 3, and more usually, at least 5 or 8-10 ammo acids in a unique spatial conformation. [0040] That an antibody "selectively binds" or "specifically binds" means that the antibody reacts or associates more frequently, more rapidly, with greater duration, with greater affinity, or with some combination of the above to an epitope than with alternative substances, including unrelated proteins. "Selectively binds" or "specifically binds" means at times that an antibody binds to a protein with a K0 of about 0.1 mM or less, at times about 1 μM or less, at times about 0.1 μM or less, at times about 0.01 μM or less, and at times about 1 nM or less. Because of the sequence identity between homologous proteins in different species, specific binding can include an antibody that recognizes a cancer stem cell marker protein in more than one species. It is understood that an antibody or binding moiety that specifically binds to a first target may or may not specifically bind to a second target. As such, "specific binding" does not necessarily require (although it can include) exclusive binding, i.e. binding to a single target. Generally, but not necessarily, reference to binding means specific binding. [0041] The terms "isolated" or "purified" refer to material that is substantially or essentially free from components that normally accompany it in its native state. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. A protein (e.g., an antibody) or nucleic acid of the present disclosure that is the predominant species present in a preparation is substantially purified. In particular, in some embodiments, an isolated nucleic acid is separated from open reading frames that naturally flank the gene and encode proteins other than the protein encoded by the gene. In some embodiments, an isolated antibody is separated from other non-immunoglobulin proteins and from other immunoglobulin proteins with different antigen binding specificities. It can also mean that the nucleic acid or protein is in some embodiments at least 80% pure, in some embodiments at least 85% pure, in some embodiments at least 90% pure, in some embodiments at least 95% pure, and in some embodiments at least 99% pure. [0042] As used herein, the terms "cancer" and "cancerous" refer to or describe the physiological condition in mammals in which a population of cells are characterized by unregulated cell growth. Examples of cancer include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular examples of such cancers include squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma and various types of head and neck cancers. [0043] "Tumor" and "neoplasm" as used herein refer to any mass of tissue that results from excessive cell growth or proliferation, either benign (noncancerous) or malignant (cancerous), including pre-cancerous lesions.
[0044] "Metastasis" as used herein refers to the process by which a cancer spreads or transfers from the site of origin to other regions of the body with the development of a similar cancerous lesion at the new location. A "metastatic" or "metastasizing" cell is one that loses adhesive contacts with neighboring cells and migrates via the bloodstream or lymph from the primary site of disease to invade neighboring body structures.
[0045] The terms "cancer stem cell", "tumor stem cell", or "solid tumor stem cell" are used interchangeably herein and refer to a population of cells from a solid tumor that: (1) have extensive proliferative capacity; 2) are capable of asymmetric cell division to generate one or more kinds of differentiated progeny with reduced proliferative or developmental potential; and (3) are capable of symmetric cell divisions for self-renewal or self-maintenance. These properties of "cancer stem cells", "tumor stem cells" or "solid tumor stem cells" confer on those cancer stem cells the ability to form palpable tumors upon serial transplantation into an immunocompromised mouse compared to the majority of tumor cells that fail to form tumors. Cancer stem cells undergo self-renewal versus differentiation in a chaotic manner to form tumors with abnormal cell types that can change over time as mutations occur. Solid tumor stem cells differ from the "cancer stem line" provided by U.S. Pat. No. 6,004,528. In that patent, the "cancer stem line" is defined as a slow growing progenitor cell type that itself has few mutations but which undergoes symmetric rather than asymmetric cell divisions as a result of tumorigenic changes that occur in the cell's environment. This "cancer stem line" hypothesis thus proposes that highly mutated, rapidly proliferating tumor cells arise largely as a result of an abnormal environment, which causes relatively normal stem cells to accumulate and then undergo mutations that cause them to become tumor cells. U.S. Pat. No. 6,004,528 proposes that such a model can be used to enhance the diagnosis of cancer. The solid tumor stem cell model is fundamentally different from the "cancer stem line" model and as a result exhibits utilities not offered by the "cancer stem line" model. First, solid tumor stem cells are not "mutationally spared". The "mutationally spared cancer stem line" described by U.S. Pat. No. 6,004,528 can be considered a pre-cancerous lesion, while solid tumor stem cells are cancer cells that may themselves contain the mutations that are responsible for tumorigenesis starting at the pre-cancerous stage through later stage cancer. That is, solid tumor stem cells ("cancer stem cells") would be included among the highly mutated cells that are distinguished from the "cancer stem line" in U.S. Pat. No. 6,004,528. Second, the genetic mutations that lead to cancer can be largely intrinsic within the solid tumor stem cells as well as being environmental. The solid tumor stem cell model predicts that isolated solid tumor stem cells can give rise to additional tumors upon transplantation (thus explaining metastasis) while the "cancer stem line" model would predict that transplanted "cancer stem line" cells would not be able to give rise to a new tumor, since it was their abnormal environment that was tumorigenic. Indeed, the ability to transplant dissociated, and phenotypically isolated human solid tumor stem cells to mice (into an environment that is very different from the normal tumor environment) where they still form new tumors is distinguished from the "cancer stem line" model. Third, solid tumor stem cells likely divide both symmetrically and asymmetrically, such that symmetric cell division is not an obligate property. Fourth, solid tumor stem cells can divide rapidly or slowly, depending on many variables, such that a slow proliferation rate is not a defining characteπstic.
[0046] The terms "cancer cell," "tumor cell," and grammatical equivalents refer to the total population of cells deπved from a tumor or a pre-cancerous lesion, including both non-tumoπgemc cells, which compose the bulk of the tumor cell population, and tumoπgenic stem cells (cancer stem cells). As used herein, the term "tumor cell" will be modified by the term "non-tumorigenic" when referring solely to those tumor cells lacking the capacity to renew and differentiate to distinguish those tumor cells from cancer stem cells.
[0047] As used herein "tumorigenic" refers to the functional features of a solid tumor stem cell including the properties of self-renewal (giving πse to additional tumongemc cancer stem cells) and proliferation to generate all other tumor cells (giving πse to differentiated and thus non-tumoπgemc tumor cells) that allow solid tumor stem cells to form a tumor. These properties of self-renewal and proliferation to generate all other tumor cells confer on cancer stem cells the ability to form palpable tumors upon serial transplantation into an immunocompromised mouse compared to non-tumoπgemc tumor cells, which are unable to form tumors upon serial transplantation. It has been observed that non-tumoπgemc tumor cells may form a tumor upon primary transplantation into an immunocompromised mouse after obtaining the tumor cells from a solid tumor, but those non-tumoπgemc tumor cells do not give πse to a tumor upon seπal transplantation.
[0048] As used herein, the terms "stem cell cancer marker(s)", "cancer stem cell marker(s)",
"tumor stem cell marker(s)", or "solid tumor stem cell marker(s)" refer to a gene or genes or a protein, polypeptide, or peptide expressed by the gene or genes whose expression level, alone or in combination with other genes, is correlated with the presence of tumongemc cancer cells compared to non-tumoπgemc cells. The correlation can relate to either an increased or decreased expression of the gene (e.g. increased or decreased levels of mRNA or the peptide encoded by the gene).
[0049] As used herein, the terms "biopsy" and "biopsy tissue" refer to a sample of tissue or fluid that is removed from a subject for the purpose of determining if the sample contains cancerous tissue. In some embodiments, biopsy tissue or fluid is obtained because a subject is suspected of having cancer, and the biopsy tissue or fluid is then examined for the presence or absence of cancer.
[0050] As used herein, the term "subject" refers to any animal (e.g., a mammal), including, but not limited to humans, non-human pπmates, rodents, and the like, which is to be the recipient of a particular treatment. Typically, the terms "subject" and "patient" are used interchangeably herein m reference to a human subject.
[0051] "Pharmaceutically acceptable" refers to approved or appro vable by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, including humans. [0052] "Pharmaceutically acceptable salt" refers to a salt of a compound that is pharmaceutically acceptable and that possesses the desired pharmacological activity of the parent compound. [0053] "Pharmaceutically acceptable excipient, carrier or adjuvant" refers to an excipient, carrier or adjuvant that can be administered to a subject, together with at least one antibody of the present disclosure, and which does not destroy the pharmacological activity thereof and is nontoxic when administered in doses sufficient to deliver a therapeutic amount of the antibody. [0054] "Pharmaceutically acceptable vehicle" refers to a diluent, adjuvant, excipient, or carrier with which at least one antibody of the present disclosure is administered.
[0055] The term "effective amount," "therapeutically effective amount" or "therapeutic effect" refers to an amount of an antibody, polypeptide, polynucleotide, small organic molecule, or other drug effective to "treat" a disease or disorder in a subject or mammal. In the case of cancer, the therapeutically effective amount of the drug has a therapeutic effect and as such can reduce the number of cancer cells; decrease tumorigenicity, tumorigenic frequency or tumorigenic capacity; reduce the number or frequency of cancer stem cells; reduce the tumor size; inhibit or stop cancer cell infiltration into peripheral organs including, for example, the spread of cancer into soft tissue and bone; inhibit and stop tumor metastasis; inhibit and stop tumor growth; relieve to some extent one or more of the symptoms associated with the cancer; reduce morbidity and mortality; improve quality of life; or a combination of such effects. Methods to determine tumorigenicity or tumorigenic frequency or capacity are demonstrated in copending application U.S. 11/776,935, incorporated by reference herein in its entirety. To the extent the drug prevents growth and/or kills existing cancer cells, it can be referred to as cytostatic and/or cytotoxic. [0056] Terms such as "treating" or "treatment" or "to treat" or "alleviating" or "to alleviate" refer to both 1) therapeutic measures that cure, slow down, lessen symptoms of, and/or halt progression of a diagnosed pathologic condition or disorder and 2) prophylactic or preventative measures that prevent and/or slow the development of a targeted pathologic condition or disorder. Thus those in need of treatment include those already with the disorder; those prone to have the disorder; and those in whom the disorder is to be prevented. In certain embodiments, a subject is successfully "treated" according to the methods of the present invention if the patient shows one or more of the following: a reduction in the number of or complete absence of cancer cells; a reduction in the tumor size; inhibition of or an absence of cancer cell infiltration into peripheral organs including, for example, the spread of cancer into soft tissue and bone; inhibition of or an absence of tumor metastasis; inhibition or an absence of tumor growth; relief of one or more symptoms associated with the specific cancer; reduced morbidity and mortality; improvement in quality of life; reduction in tumorigenicity; reduction in the number or frequency of cancer stem cells; or some combination of effects.
[0057] As used herein, the terms "polynucleotide" or "nucleic acid" refer to a polymer composed of a multiplicity of nucleotide units (ribonucleotide or deoxyribonucleotide or related structural variants) linked via phosphodiester bonds, including but not limited to, DNA or RNA. The term encompasses sequences that include any of the known base analogs of DNA and RNA. The term "gene" refers to a nucleic acid (e.g., DNA) sequence that comprises coding sequences necessary for the production of a polypeptide, precursor, or RNA (e.g., rRNA, tRNA). The polypeptide can be encoded by a full length coding sequence or by any portion of the coding sequence so long as the desired activity or functional properties (e.g., enzymatic activity, ligand binding, signal transduction, immunogenicity, etc.) of the full- length polypeptide or fragment are retained. The term also encompasses the coding region of a structural gene and the sequences located adjacent to the coding region on both the 5' and 3' ends for a distance of about 1 kb or more on either end such that the gene corresponds to the length of the full-length mRNA. The term "gene" encompasses both cDNA and genomic forms of a gene. [0058] The terms "polypeptide", "peptide", "protein", and "protein fragment" are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers.
[0059] The term "amino acid" refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function similarly to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma-carboxyglutamate, and O-phosphoserine. "Amino acid analogs" refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., an alpha carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs can have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. "Amino acid mimetics" refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions similarly to a naturally occurring amino acid.
[0060] "Conservatively modified variants" applies to both amino acid and nucleic acid sequences. "Amino acid variants" refers to amino acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical or associated (e.g., naturally contiguous) sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode most proteins. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to another of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are "silent variations", which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also descπbes silent vaπations of the nucleic acid. One of skill will recognize that in certain contexts each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan) can be modified to yield a functionally identical molecule. Accordingly, silent vaπations of a nucleic acid which encodes a polypeptide is implicit in a descπbed sequence with respect to the expression product, but not with respect to actual probe sequences.
[0061] As to ammo acid sequences, one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single ammo acid or a small percentage of ammo acids in the encoded sequence is a "conservatively modified variant", including where the alteration results in the substitution of an ammo acid with a chemically similar ammo acid. Conservative substitution tables providing functionally similar ammo acids are well known in the art (See, for example, Table 1). Guidance concerning which amino acid changes are likely to be phenotypically silent can also be found in Bowie et al., 1990, Science 247:1306 1310. Such conservatively modified vanants are in addition to and do not exclude polymorphic vaπants, interspecies homologs, and alleles. Typical conservative substitutions include: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagme (N), Glutamme (Q); 4) Argimne (R), Lysine (K); 5) Isoleucme (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Seπne (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins (1984)). As indicated, changes are typically of a minor nature, such as conservative ammo acid substitutions that do not significantly affect the folding or activity of the protein.
Table 1. Conservative Ammo Acid Substitutions
Figure imgf000016_0001
Figure imgf000017_0001
[0062] Like the tissues in which they originate, solid tumors consist of a heterogeneous population of cells. That the majority of these cells lack tumorigenicity suggested that the development and maintenance of solid tumors also relies on a small population of stem cells (i.e., tumorigenic cancer cells) with the capacity to proliferate and efficiently give rise both to additional tumor stem cells (self- renewal) and to the majority of more differentiated tumor cells that lack tumorigenic potential (i.e., non- tumorigenic cancer cells). The concept of cancer stem cells was first introduced soon after the discovery of hematopoietic stem cells (HSC) and was established experimentally in acute myelogenous leukemia (AML) (Park et al., 1971, J. Natl. Cancer Inst. 46:411-22; Lapidot et al., 1994, Nature 367:645-8; Bonnet & Dick, 1997, Nat. Med. 3:730-7; Hope et al., 2004, Nat. Immunol. 5:738-43). Stem cells from solid tumors have more recently been isolated based on their expression of a unique pattern of cell-surface receptors and on the assessment of their properties of self-renewal and proliferation in culture and in xenograft animal models. An ESA+ CD44+ CD24-/low Lineage- population greater than 50-fold enriched for the ability to form tumors relative to unfractionated tumor cells was discovered (Al-Hajj et al., 2003, Proc. Nat 'I. Acad. Sci. 100:3983-8). The ability to isolate tumorigenic cancer stem cells from the bulk of non-tumorigenic tumor cells has led to the identification of cancer stem cell markers, genes with differential expression in cancer stem cells compared to non-tumorigenic tumor cells or normal epithelium, using microarray analysis. The present invention employs the knowledge of cancer stem cell markers to treat and diagnose cancer.
[0063] The cancer stem cell markers of the present invention relate to human discoidin domain receptor 1 (DDRl) and human discoidin domain receptor 2 (DDR2). The invention is based in part on the discovery of a correlation between the expression of DDRl and Hesl in a variety of tissue samples, as well as of a correlation between the expression of DDRl and LGR5 (see Examples 10 and 11, below) in a variety of tissue samples. Expression of Hesl is an indicator of Notch pathway activation, activity that may play an important role in tumorigenesis in certain tumors. LGR5 has previously been identified as both a stem cell marker (Barker et al., 2007, Nature 449:1003-7) and as a cancer stem cell marker (U.S. Patent Application No. 12/167,176, incorporated by reference herein in its entirety). The identification of DDRl as a marker of cancer stem cells suggests that targeting this receptor may prove therapeutically effective in treating human cancers.
[0064] Furthermore, DDR2 has previously been identified as a cancer stem cell marker (U.S.
Patent Publication No. 2008/0171045, incorporated by reference herein in its entirety). Thus, the present identification of DDRl as a cancer stem cell marker suggests the desirability of therapeutics, including, but not limited to, antibodies, that target both DDRl and DDR2.
[0065] The discoidin domain receptors DDRl and DDR2 form a subfamily of receptor tyrosine kinases based on the presence of an extracellular discoidin domain, a domain first identified in the slime mold Dictyostelium discoideum that functions in cell aggregation. Collagen serves as the physiological ligand for DDR2, and this interaction both inhibits fibrillogenesis of collagen and regulates expression of matrix-metalloproteases (MMP), enzymes that cleave native fibrillar collagen (Vogel, 1999, FASEB 13:S77-S82; Xu et al., 2005, J. Biol. Chem. 280:548-55; Mihai et al., 2006, J. MoI. Biol. 361:864-76). The role of DDR2 in regulation of the extracellular matrix suggests that dysregulation of DDR signaling may contribute to human carcinogenesis, including invasion and metastasis. DDRl is also activated by collagen, including all types tested (types I-VI and VIII) (Vogel, 1999, FASEB 13:S77-S82; Curat et al., 2001, J. Biol. Chem. 276:45952-45958).
[0066] DDR2 signaling regulates proliferation of various cell populations including chondrocytes and fibroblasts (Labrador et al., 2001, EMBO Rep. 2:446-52). DDR2 is induced in hepatic stellate cells in response to collagen during liver injury, and over-expression of DDR enhanced hepatic stellate cell proliferation, activated expression of MMP-2, and enhanced cellular invasion through Matrigel™ (Olaso et al., 2001 , J. CHn. Invest. 108: 1369-78). DDR activation and adhesion in response to collagen may require Wnt and G-protein signaling (Dejmek et al., 2003, Int. J. Cancer 103:344-51). [0067] DDR receptors are implicated in cancer. DDRl is over-expressed in numerous human tumors including breast, ovarian, esophageal, and brain cancers (Barker et al., 1995, Oncogene 11 :569-75; Laval et al., 1994, Cell Growth Diff. 5:1173-83; Nemoto et al., 1997, Pathobiol. 65:165-203; Weiner et al., 1996, Pediatr. Neurosurg. 25:64-72; Weiner et al., 2000, Neurosurgery 47:1400-9; Heinzelmann et al., 2004, 10:4427-36). DDRl and DDR2 have mutually exclusive expression in ovarian and lung tumors, with transcripts for DDRl in highly invasive tumor cells and transcripts for DDR2 detected in the surrounding stromal cells (Alves et al., 1995, Oncogene 10:609-18). DDR2 expression is also associated with invasive mammary carcinomas (Evitmova et al., 2003, Tumour Biol. 24:189-98). [0068] In some aspects, the invention provides agents (e.g., antibodies) that bind to and/or modulate the activity of DDRl and compositions, such as pharmaceutical compositions, comprising those agents. The invention also provides methods of targeting cancer stem cells with the agents and/or reducing the tumorigenicity of tumors comprising cancer stem cells. The invention further provides methods of using the agents in the treatment of cancer and in the inhibition of the growth of tumors comprising cancer stem cells.
[0069] In one aspect, the invention provides a method of inhibiting the growth of a tumor in a subject, wherein the tumor comprises cancer stem cells, comprising administering to the subject a therapeutically effective amount of an agent that modulates the activity of DDRl. In certain embodiments, the agent reduces tumorigenicity of the tumor by reducing the number or frequency of cancer stem cells in the tumor. In certain embodiments, the agent is an antibody, such as an antibody that specifically binds to DDRl . In certain embodiments, the tumor is selected from the group consisting of a breast tumor, colorectal tumor, hepatic tumor, renal tumor, lung tumor, pancreatic tumor, ovarian tumor, prostate tumor, and head and neck tumor. In certain embodiments, the tumor expresses LGR5. In certain embodiments, the tumor expresses LGR5 and the tumor is a colorectal tumor, hepatic tumor, ovarian tumor, or pancreatic tumor. In certain embodiments, the cancer stem cells express LGR5. In certain embodiments, the cancer stem cells express LGR5 and the tumor is a colorectal tumor, hepatic tumor, ovarian tumor, or pancreatic tumor. In certain embodiments, the tumor expresses Hesl . In certain embodiments, the tumor expresses Hesl and the tumor is a breast tumor, colorectal tumor, renal tumor, lung tumor, pancreatic tumor, or prostate tumor. In certain embodiments, the cancer stem cells express Hesl . In certain embodiments, the cancer stem cells express Hesl and the tumor is a breast tumor, colorectal tumor, renal tumor, lung tumor, pancreatic tumor, or prostate tumor. In certain embodiments, the subject is a human.
[0070] In certain embodiments, the invention provides a method of inhibiting growth of a tumor in a subject, comprising administering to the subject a therapeutically effective amount of an agent or antibody that competes with an antibody that binds to at least one amino acid in the sequence SASSSWSDSTAAR (SEQ ID NO:30) within DDRl . In some embodiments the agent or antibody specifically binds to at least one amino acid in the sequence SASSSWSDSTAAR (SEQ ID NO: 30) within DDRl . In some embodiments, the antibody further binds to additional amino acid residues within DDRl . [0071] In another aspect, the invention provides a method of reducing the tumorigenicity of a tumor comprising cancer stem cells by reducing the number or frequency of cancer stem cells in the tumor, wherein the method comprises contacting the tumor with an effective amount of an agent that modulates the activity of DDRl. In certain embodiments, the agent is an antibody, including, but not limited to, an antibody that specifically binds to DDRl . In certain embodiments, the tumor is a tumor selected from the group consisting of breast tumor, colorectal tumor, hepatic tumor, renal tumor, lung tumor, pancreatic tumor, ovarian tumor, prostate tumor, and head and neck tumor. In certain embodiments, the tumor expresses LGR5. In certain embodiments, the cancer stem cells express LGR5. In certain embodiments, the cancer stem cells express LGR5 and the tumor is colorectal tumor, hepatic tumor, ovarian tumor, or pancreatic tumor. In certain embodiments, the tumor expresses Hesl. In certain embodiments, the cancer stem cells express Hesl. In certain embodiments, the cancer stem cells express Hesl and the tumor is breast tumor, colorectal tumor, renal tumor, lung tumor, pancreatic tumor, or prostate tumor. In some embodiments, the method is an in vivo method.
[0072] In another aspect, the invention provides an antibody that modulates the activity of
DDRl . In certain embodiments, the antibody specifically binds to DDRl . In some embodiments, the antibody binds the extracellular domain of DDRl. In certain embodiments, the antibody binds the discoidin domain of DDRl . In certain embodiments, the antibody binds a region of DDRl comprising amino acids 21 to 241 of SEQ ID NO:2. In certain embodiments, the antibody preferentially binds a human DDRl relative to one or more mutants or variants of the human DDRl . For example, in certain embodiments, the antibody preferentially binds human DDRl (for example, the DDRl in SEQ ID NO:37) as compared to a W53A variant of DDRl (for example, the variant DDRl of SEQ ID NO:39). In some embodiments, the antibody binds to at least one amino acid in the sequence SASSSWSDSTAAR (SEQ NO ID:30). In some embodiments, the agent or antibody competes with an antibody that binds to at least one amino acid in the sequence SASSSWSDSTAAR (SEQ NO ID:30). In some embodiments, the antibody has reduced binding to a variant of DDRl in which the sequence SASSSWSDSTAAR (SEQ NO H):30) has been replaced with the sequence SASSSASDSTAAR (SEQ IS NO:31). [0073] In certain embodiments, the antibody reduces the tumorigenicity of a tumor that comprises cancer stem cells. In certain embodiments, the antibody that modulates DDRl inhibits growth of a tumor comprising cancer stem cells. In certain embodiments, the tumor cells express LGR5 and/or Hesl. In certain embodiments, the cancer stem cells express LGR5 and/or Hesl. [0074] In certain embodiments, the agent or antibody is capable of reducing the tumorigenicity of a tumor comprising cancer stem cells in an animal model, such as a mouse xenograft model. [0075] In certain embodiments, the number or frequency of cancer stem cells in the tumor is reduced by at least about two-fold, about three-fold, about five-fold, about ten-fold, about 50-fold, about 100-fold, or about 1000-fold. In certain embodiments, the reduction in the number or frequency of cancer stem cells is determined by limiting dilution assay using an animal model. An example of a limiting dilution assay used to test the efficacy of an anti-DDRl antibody is provided in Example 12, below. Additional examples and guidance regarding the use of limiting dilution assays to determine a reduction in the number or frequency of cancer stem cells in a tumor can be found, e.g., in International Publication Number WO 2008/042236, U.S. Patent Application Publication No. 2008/0064049, and U.S. Patent Application Publication No. 2008/0178305, each of which is incorporated by reference herein in its entirety.
[0076] In certain embodiments, the agent or antibody is an antagonist of DDRl . In some embodiments, the term "antagonist" includes any molecule that partially or fully blocks, inhibits, or neutralizes a biological activity of a DDRl and/or DDR2 protein or fragment thereof. In some embodiments, the antagonist molecules specifically include antagonist antibodies. In some embodiments, the term "antagonist" includes any molecule that partially or fully blocks, inhibits, or neutralizes the expression of DDRl, and/or DDR2 protein or fragment thereof.
[0077] In certain embodiments, the agent or antibody inhibits the binding of a ligand to DDRl .
In some embodiments, the agent or antibody inhibits the binding of collagen to DDRl. Ln certain embodiments, the agent or antibody inhibits or blocks collagen-induced tyrosine phosphorylation of
DDRl . In certain embodiments, the agent or antibody binds to at least one amino acid in the sequence
SASSSWSDSTAAR (SEQ ID NO:30) within DDRl and inhibits tyrosine phosphorylation of DDRl. In certain embodiments, the collagen is selected from the group consisting of collagen type I, collagen type
II, collagen type III, collagen type IV and collagen type V.
[0078] In certain embodiments, DDRl is human DDRl. In certain embodiments, DDRl is selected from the group consisting of DDRIa, DDRIb, DDRIc, DDRId, and DDRIe. In certain embodiments, DDRl is SEQ ID NO:2, 9, 12, 14, or 37.
[0079] Ln certain embodiments, the antibody specifically binds to the extracellular domain of
DDRl. In certain embodiments, the antibody binds the discoidin domain of DDRl (SEQ ID NO:41). The discoidin domain is from about amino acid residue 30 to about amino acid residue 185 of DDRl .
[0080] In certain embodiments, the antibody that specifically binds to and/or modulates the activity of DDRl, further specifically binds to and/or modulates the activity of DDR2. In some embodiments, the antibody binds the extracellular domain of DDR2. In certain embodiments, the antibody binds the discoidin domain of DDR2. In certain embodiments, the antibody binds a region of
DDR2 comprising amino acids 24 to 241 of SEQ ID NO:3. In certain embodiments, the antibody preferentially binds a human DDR2 (e.g., SEQ ED NO:3) relative to one or more mutants of the human
DDR2 selected from the group consisting of W52A, D69A, and Rl 05 A. For instance, in certain embodiments, the antibody preferentially binds human DDR2 of SEQ ID NO:3 relative to the W52A mutant or the D69A mutant of DDR2.
[0081] In certain embodiments, the antibody is an antagonist of DDR2 and/or inhibits the binding of collagen to DDR2.
[0082] hi certain embodiments, the antibodies are isolated, hi certain embodiments, the antibodies are substantially purified. [0083] In certain embodiments, the antibody is an IgGl antibody or an IgG2 antibody. In certain embodiments, the antibody is an IgGl antibody. In certain embodiments, the antibody is an IgG2 antibody.
[0084] In certain embodiments, the antibody does not have one or more effector functions. For instance, in some embodiments, the antibody has no antibody-dependent cellular cytotoxicity (ADCC) activity, and/or no complement-dependent cytotoxicity (CDC) activity. In certain embodiments, the antibody does not bind to an Fc receptor and/or complement factors. In certain embodiments, the antibody has no effector function.
[0085] In certain embodiments, the antibody is a monoclonal antibody, a chimeric antibody, a humanized antibody, or a human antibody. In certain embodiments, the antibody is an antibody fragment.
In certain embodiments, the antibody is conjugated to a cytotoxic agent.
[0086] In certain embodiments, the treatment methods further comprise administering at least one additional therapeutic agent appropriate for effecting combination therapy (e.g., a chemotherapeutic agent or other anticancer agent if cancer is to be treated). In certain embodiments, the additional therapeutic agent is irinotecan or gemcitabine. In certain embodiments, the additional therapeutic agent is irinotecan. In certain embodiments, the additional therapeutic agent is gemcitabine.
[0087] The present invention further provides methods of identifying and/or isolating cancer stem cells (e.g., based on expression of DDRl), screening for anti-cancer agents, and screening patients for suitability for treatment with the agents described herein.
[0088] Expression of DDRl can be used to identify subjects having cancers suitable for treatment with the compositions of the invention. In some embodiments, expression of a cancer stem cell marker is determined by polynucleotide expression such as, for example, mRNA encoding the cancer stem cell marker. The polynucleotide can be detected and quantified by any of a number of means well known to those of skill in the art. In some embodiments, mRNA encoding a cancer stem cell marker is detected by in situ hybridization of tissue sections from, for example, a patient biopsy. In some embodiments, RNA is isolated from a tissue and detected by, for example, Northern blot, quantitative RT-
PCR, or microarrays. For example, total RNA can be extracted from a tissue sample and primers that specifically hybridize and amplify a cancer stem cell marker can be used to detect expression of a cancer stem cell marker polynucleotide using RT-PCR.
[0089] In certain embodiments, expression of a cancer stem cell marker can be determined by detection of the corresponding polypeptide. The polypeptide can be detected and quantified by any of a number of means well known to those of skill in the art. In some embodiments, a cancer stem cell marker polypeptide is detected using analytic biochemical methods such as, for example, electrophoresis, capillary electrophoresis, high performance liquid chromatography (HPLC) or thin layer chromatography
(TLC). The isolated polypeptide can also be sequenced according to standard techniques. In some embodiments, a cancer stem cell marker protein is detected with antibodies raised against the protein using, for example, immunofluorescence or immunohistochemistry on tissue sections. Alternatively antibodies against a cancer stem cell marker can detect expression using, for example, ELISA, FACS, Western blot analysis, immunoprecipitation or protein microarrays. For example, cancer stem cells can be isolated from a patient biopsy and expression of a cancer stem cell marker protein detected with fluorescently labeled antibodies using FACS. In another method, the cells expressing a cancer stem cell marker can be detected in vivo using labeled antibodies m a typical imaging system. For example, antibodies labeled with paramagnetic isotopes can be used for magnetic resonance imaging (MRI). [0090] In some embodiments of the present invention, a diagnostic assay compπses determining the expression or not of a cancer stem cell marker using, for example, immunohistochemistry, in situ hybridization, or RT-PCR. In other embodiments, a diagnostic assay compπses determining expression levels of a cancer stem cell marker using, for example, quantitative RT-PCR. In some embodiments, a diagnostic assay further compπses determining expression levels of a cancer stem cell marker compared to a control tissue such as, for example, normal epithelium.
[0091] Detection of a cancer stem cell marker expression can then be used to select a therapy. A prognosis can be based on any known πsk expression of a cancer stem cell marker indicates. Furthermore, detection of a cancer stem cell marker can be used to select an appropπate therapy including, for example, treatment with antibodies against the detected cancer stem cell marker protein. In certain embodiments, the antibody specifically binds to the cancer stem cell marker protein human DDRl. In certain embodiments, the antibody further specifically binds to the extracellular domain of DDR2. [0092] In some embodiments, a suitable antibody or agent is one that can have one or more of the following effects, for example: interfere with the expression of a cancer stem cell marker; interfere with activation of a cancer stem cell signal transduction pathway by, for example, steπcally inhibiting interactions between a cancer stem cell marker and its hgand, receptor or co-receptors; activate a cancer stem cell signal transduction pathway by, for example, acting as a hgand or promoting the binding of an endogenous hgand; or bind to a cancer stem cell marker and inhibit tumor cell proliferation [0093] hi certain embodiments, antibodies against a cancer stem cell marker act extracellularly to modulate the function of a cancer stem cell marker protein. In some embodiments, extracellular binding of an antibody against a cancer stem cell marker can inhibit the signaling of a cancer stem cell marker protein by, for example, inhibiting intrinsic activation (e.g. kinase activity) of a cancer stem cell marker and/or by steπcally inhibiting the interaction, for example, of a cancer stem cell marker with its hgand, with its receptor, with a co-receptor, or with the extracellular matrix, hi some embodiments, extracellular binding of an antibody against a cancer stem cell marker can down-regulate cell-surface expression of a cancer stem cell marker such as, for example, by internalization of a cancer stem cell marker protein or decreasing cell surface trafficking of a cancer stem cell marker. In some embodiments, extracellular binding of an antibody against a cancer stem cell marker can promote the signaling of a cancer stem cell marker protein by, for example, acting as a decoy ligand or increasing ligand binding. [0094] In certain embodiments, antibodies against a cancer stem cell marker bind to a cancer stem cell marker protein and have one or more of the following effects: inhibit proliferation, trigger cell death, or prevent metastasis. In certain embodiments, antibodies against a cancer stem cell marker trigger cell death via a conjugated toxin, chemotherapeutic agent, radioisotope, or other such agent. For example, an antibody against a cancer stem cell marker is conjugated to a toxin that is activated in cells expressing the cancer stem cell marker by protein internalization. In certain embodiments, antibodies against a cancer stem cell marker mediate cell death of a cell expressing the cancer stem cell marker protein via antibody-dependent cellular cytotoxicity (ADCC). ADCC involves cell lysis by effector cells that recognize the Fc portion of an antibody. Many lymphocytes, monocytes, tissue macrophages, granulocytes and eosinophils, for example, have Fc receptors and can mediate cytolysis (Dillman, 1994, J. Clin. Oncol. 12:1497).
[0095] In certain embodiments, antibodies against a cancer stem cell marker trigger cell death of a cell expressing a cancer stem cell marker protein by activating complement-dependent cytotoxicity (CDC). CDC involves binding of serum complement to the Fc portion of an antibody and subsequent activation of the complement protein cascade, resulting in cell membrane damage and eventual cell death. Biological activity of antibodies is known to be determined, to a large extent, by the constant domains or Fc region of the antibody molecule (Uananue and Benacerraf, Textbook of Immunology, 2nd Edition, Williams & Wilkins, p. 218 (1984)). Antibodies of different classes and subclasses differ in this respect, as do antibodies of the same subclass but from different species. Of human antibodies, IgM is the most efficient class of antibodies to bind complement, followed by IgGl, IgG3, and IgG2 whereas IgG4 appears quite deficient in activating the complement cascade (Dillman, 1994, J. CHn. Oncol. 12:1497; Jefferis et al., 1998, Immunol. Rev. 163:59-76). According to the present invention, antibodies of those classes having the desired biological activity are prepared.
[0096] The ability of any particular antibody against a cancer stem cell to mediate lysis of the target cell by complement activation and/or ADCC can be assayed. The cells of interest are grown and labeled in vitro; the antibody is added to the cell culture in combination with either serum complement or immune cells which can be activated by the antigen antibody complexes. Cytolysis of the target cells is detected, for example, by the release of label from the lysed cells. In fact, antibodies can be screened using the patient's own serum as a source of complement and/or immune cells. The antibody that is capable of activating complement or mediating ADCC in the in vitro test can then be used therapeutically in that particular patient.
[0097] In certain embodiments, antibodies against a cancer stem cell marker can trigger cell death inhibiting angiogenesis. Angiogenesis is the process by which new blood vessels form from pre- existing vessels and is a fundamental process required for normal growth, for example, during embryonic development, wound healing, and in response to ovulation. Solid tumor growth larger than 1-2 mm2 also requires angiogenesis to supply nutrients and oxygen without which tumor cells die. In certain embodiments, an antibody against a cancer stem cell marker targets vascular cells that express the cancer stem cell marker including, for example, endothelial cells, smooth muscle cells, or components of the extracellular matrix required for vascular assembly. In certain embodiments, an antibody against a cancer stem cell marker inhibits growth factor signaling required by vascular cell recruitment, assembly, maintenance, or survival.
[0098] The antibodies against a cancer stem cell marker find use in the diagnostic and therapeutic methods described herein. In certain embodiments, the antibodies of the present invention are used to detect the expression of a cancer stem cell marker protein in biological samples such as, for example, a patient tissue biopsy, pleural effusion, or blood sample. Tissue biopsies can be sectioned and protein detected using, for example, immunofluorescence or immunohistochemistry. In addition, individual cells from a sample can be isolated, and protein expression detected on fixed or live cells by FACS analysis. In certain embodiments, antibodies can be used on protein arrays to detect expression of a cancer stem cell marker, for example, on tumor cells, in cell lysates, or in other protein samples. In certain embodiments, the antibodies of the present invention are used to inhibit the growth of tumor cells by contacting the antibodies with tumor cells in in vitro cell based assays, in vivo animal models, etc. In certain embodiments, the antibodies are used to treat cancer in a patient by administering a therapeutically effective amount of an antibody against a cancer stem cell marker.
[0099] The antibodies of the present invention can be prepared by any conventional means known in the art. For example, polyclonal antibodies can be prepared by immunizing an animal (e.g., a rabbit, rat, mouse, goat, donkey, etc.) by multiple subcutaneous or intraperitoneal injections of the relevant antigen (a purified peptide fragment, full-length recombinant protein, fusion protein, etc) optionally conjugated to keyhole limpet hemocyanin (KLH), serum albumin, etc. diluted in sterile saline and combined with an adjuvant (e.g., Complete or Incomplete Freund's Adjuvant) to form a stable emulsion. The polyclonal antibody is then recovered from blood, ascites and the like, of an animal so immunized. Collected blood is clotted, and the serum decanted, clarified by centrifugation, and assayed for antibody titer. The polyclonal antibodies can be purified from serum or ascites according to standard methods in the art including affinity chromatography, ion-exchange chromatography, gel electrophoresis, dialysis, etc.
[00100] Monoclonal antibodies can be prepared using hybridoma methods, such as those described by Kohler and Milstein,1975, Nature 256:495. Using the hybridoma method, a mouse, hamster, or other appropriate host animal, is immunized as described above to elicit the production by lymphocytes of antibodies that will specifically bind to an immunizing antigen. Lymphocytes can also be immunized in vitro. Following immunization, the lymphocytes are isolated and fused with a suitable myeloma cell line using, for example, polyethylene glycol, to form hybπdoma cells that can then be selected away from unfused lymphocytes and myeloma cells. Hybπdomas that produce monoclonal antibodies directed specifically against a chosen antigen as determined by lmmunoprecipitation, lmmunoblottmg, or by an in vitro binding assay (e.g. radioimmunoassay (RIA); enzyme-linked immunosorbent assay (ELISA)) can then be propagated either in vitro culture using standard methods (Godmg, Monoclonal Antibodies: Principles and Practice, Academic Press, 1986) or in vivo as ascites tumors in an animal. The monoclonal antbodies can then be purified from the culture medium or ascites fluid as descπbed for polyclonal antibodies above.
[00101] In some embodiments of the present invention, the antibody is an antibody which specifically binds to an extracellular domain of human DDRl . In some embodiments, the antibody compπses a heavy chain vaπable region having at least 90% sequence identity to SEQ ID NO: 33; and/or a light chain vaπable region having at least 90% sequence identity to SEQ ID NO:35. In some embodiments, the antibody compπses a heavy chain vanable region having at least 95% sequence identity to SEQ ID NO:33, and/or a light chain vaπable region having at least 95% sequence identity to SEQ ID NO:35. In some embodiments, the antibody compπses a heavy chain vaπable region compπsing the sequence of SEQ ID NO:33, and/or a light chain vaπable region compπsing the sequence of SEQ ID NO:35 Ia some embodiments, the antibody is a monoclonal antibody or antibody fragment. [00102] In other embodiments, the antibody compπses a heavy chain CDRl compπsmg
GYTFTDYFMK (SEQ ID NO:22), a heavy chain CDR2 compπsing DINPNNGDTFYIQKFKG (SEQ ED NO:23), and/or a heavy chain CDR3 compπsing SRDLAY (SEQ ED NO:24). In some embodiments, the antibody further compπses a light chain CDRl compπsing KSSQSLLYSNGKTYLN (SEQ ED NO:27), a light chain CDR2 compπsing QVSKLDS (SEQ ED NO:28), and/or a light chain CDR3 compπsing VQGTDFPQT (SEQ ED NO:29). Ln other embodiments, the antibody compπses a light chain CDRl compπsing KSSQSLLYSNGKTYLN (SEQ ED NO:27), a light chain CDR2 compπsing QVSKLDS (SEQ ED NO:28), and/or a light chain CDR3 compπsing VQGTDFPQT (SEQ ED NO:29). [00103] Ln other embodiments, the antibody compπses (a) a heavy chain CDRl compπsing
GYTFTDYFMK (SEQ ED NO:22), a heavy chain CDR2 compπsmg DINPNNGDTFYIQKFKG (SEQ ED NO:23), and a heavy chain CDR3 compπsing SRDLAY (SEQ ED NO.24); and/or (b) a light chain CDRl compπsing KSSQSLLYSNGKTYLN (SEQ LD NO:27), a light chain CDR2 compπsmg QVSKLDS (SEQ LD NO:28), and a light chain CDR3 compπsing VQGTDFPQT (SEQ LD NO.29). [00104] Ln certain embodiments of the invention, the antibody compπses a heavy chain vaπable region compπsing (a) a heavy chain CDRl compπsmg GYTFTDYFMK (SEQ LD NO:22), or a vaπant thereof compπsing 1, 2, 3 or 4 amino acid substitutions; (b) a heavy chain CDR2 compπsing DINPNNGDTFYIQKFKG (SEQ ED NO:23), or a vaπant thereof compπsing 1, 2, 3 or 4 ammo acid substitutions; and/or (c) a heavy chain CDR3 comprising SRDLAY (SEQ ID NO:24), or a variant thereof comprising 1, 2, 3 or 4 amino acid substitutions. In other embodiments, the antibody further comprises a light chain variable region comprising (a) a light chain CDRl comprising KSSQSLLYSNGKTYLN (SEQ ID NO:27), or a variant thereof comprising 1, 2, 3 or 4 amino acid substitutions; (b) a light chain CDR2 comprising QVSKLDS (SEQ ID NO:28), or a variant thereof comprising 1, 2, 3 or 4 amino acid substitutions; and/or (c) a light chain CDR3 comprising VQGTDFPQT (SEQ ID NO:29), or a variant thereof comprising 1, 2, 3 or 4 amino acid substitutions. In some embodiments, the amino acid substitutions are conservative amino acid substitutions.
[00105] In some embodiments, the invention provides a monoclonal antibody, 20M102, produced by the hybridoma cell line deposited as ATCC deposit number PTA-10051. In some embodiments, the invention provides an antibody comprising the same heavy and light chain variable regions as the antibody 2OM 102. In some embodiments, the invention provides an antibody that is a humanized version of 2OM 102. In some embodiments, the invention provides an antibody which specifically binds to the same DDRl epitope as the epitope to which antibody 20M102 binds. In certain embodiments, the invention provides an antibody which specifically competes with any antibody that binds to at least one amino acid in the sequence SASSSWSDSTAAR (SEQ ID NO:30) within DDRl. In other embodiments, the invention provides an antibody which specifically competes with any of the antibodies as described in the aforementioned aspects and embodiments, as well as other embodiments herein. [00106] Alternatively monoclonal antibodies can also be made using recombinant DNA methods as described in U.S. Patent 4,816,567. The polynucleotides encoding a monoclonal antibody are isolated from mature B-cells or hybridoma cells, such as by RT-PCR using oligonucleotide primers that specifically amplify the genes encoding the heavy and light chains of the antibody, and their sequence is determined using conventional procedures. The isolated polynucleotides encoding the heavy and light chains are then cloned into suitable expression vectors, which when transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, monoclonal antibodies are generated by the host cells. Also, recombinant monoclonal antibodies or fragments thereof of the desired species can be isolated from phage display libraries expressing CDRs of the desired species as described (McCafferty et al., 1990, Nature 348:552-554; Clackson et al., 1991, Nature 352:624-628; and Marks et al., 1991, J. MoI. Biol. 222:581- 597). The polynucleotide(s) encoding a monoclonal antibody can further be modified in a number of different manners using recombinant DNA technology to generate alternative antibodies. In some embodiments, the constant domains of the light and heavy chains of, for example, a mouse monoclonal antibody, can be substituted 1) for those regions of, for example, a human antibody to generate a chimeric antibody, or 2) for a non-immunoglobulin polypeptide to generate a fusion antibody. In some embodiments, the constant regions are truncated or removed to generate the desired antibody fragment of a monoclonal antibody. Site-directed or high-density mutagenesis of the variable region can be used to optimize specificity, affinity, etc. of a monoclonal antibody.
[00107] In some embodiments of the present invention, the monoclonal antibody against a cancer stem cell marker is a humanized antibody. Humanized antibodies are antibodies that contain minimal sequences from non-human (e.g., murine) antibodies within the variable regions. Such antibodies are used therapeutically to reduce antigenicity and HAMA (human anti-mouse antibody) responses when administered to a human subject. In practice, humanized antibodies are typically human antibodies with minimum to no non-human sequences. A human antibody is an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human. [00108] Humanized antibodies can be produced using various techniques known in the art. An antibody can be humanized by substituting the CDR of a human antibody with that of a non-human antibody (e.g., mouse, rat, rabbit, hamster, etc.) having the desired specificity, affinity, and/or capability (Jones et al., 1986, Nature 321:522-525; Riechmann et al., 1988, Nature 332:323-327; Verhoeyen et al., 1988, Science 239:1534-1536). The humanized antibody can be further modified by the substitution of additional residues either in the Fv framework region and/or within the replaced non-human residues to refine and optimize antibody specificity, affinity, and/or capability.
[00109] In addition, fully human antibodies can be directly prepared using various techniques known in the art. Immortalized human B lymphocytes immunized in vitro or isolated from an immunized individual that produce an antibody directed against a target antigen can be generated {See, e.g., Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boemer et al., 1991, J. Immunol. 147 (l):86-95; and U.S. Patent 5,750,373). Also, the human antibody can be selected from a phage library, where that phage library expresses human antibodies (Vaughan et al., 1996, Nat. Biotech. 14:309-314; Sheets et al., 1998, Proc. Natl. Acad. Sci. 95:6157-6162; Hoogenboom and Winter, 1991, J. MoI. Biol. 227:381; Marks et al., 1991, J. MoI. Biol. 222:581). Human antibodies can also be made in transgenic mice containing human immunoglobulin loci that are capable upon immunization of producing the full repertoire of human antibodies in the absence of endogenous immunoglobulin production. This approach is described in U.S. Patents 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; and 5,661,016.
[00110] This invention also encompasses bispecific antibodies that specifically recognize a cancer stem cell marker. Bispecific antibodies are antibodies that are capable of specifically recognizing and binding at least two different epitopes. The different epitopes can either be within the same molecule (e.g., the same cancer stem cell marker polypeptide) or on different molecules such that both, for example, the antibodies can specifically recognize and bind a cancer stem cell marker as well as, for example, 1) an effector molecule on a leukocyte such as a T-cell receptor (e.g., CD3) or Fc receptor (e.g., CD64, CD32, or CD 16) or 2) a cytotoxic agent as described in detail below. Bispecific antibodies can be intact antibodies or antibody fragments.
[00111] Exemplary bispecific antibodies can bind to two different epitopes, at least one of which originates in DDRl . Alternatively, an anti-antigenic arm of an immunoglobulin molecule can be combined with an arm which binds to a triggering molecule on a leukocyte such as a T cell receptor molecule (e.g., CD2, CD3, CD28, or B7), or Fc receptors for IgG so as to focus cellular defense mechanisms to the cell expressing the particular antigen. Bispecific antibodies can also be used to direct cytotoxic agents to cells which express a particular antigen. These antibodies possess an antigen-binding arm and an arm which binds a cytotoxic agent or a radionuclide chelator, such as EOTUBE, DPTA, DOTA, or TETA. Techniques for making bispecific antibodies are common in the art (Millstein et al., 1983, Nature 305:537-539; Brennan et al., 1985, Science 229:81; Suresh et al, 1986, Methods in Enzymol. 121:120; Traunecker et al., \99\, EMBO J. 10:3655-3659; Shalaby et al., 1992, J. Exp. Med. 175:217- 225; Kostelny et al., 1992, J. Immunol. 148:1547-1553; Gruber et al., 1994, J. Immunol. 152:5368; and U.S. Patent 5,731,168). Antibodies with more than two valencies are also contemplated. For example, trispecifϊc antibodies can be prepared (Tutt et al., 1991, J. Immunol. 147:60)
[00112] In certain embodiments is provided an antibody fragment to, for example, increase tumor penetration. Various techniques are known for the production of antibody fragments. Traditionally, these fragments are derived via proteolytic digestion of intact antibodies (for example Morimoto et al., 1993, Journal of Biochemical and Biophysical Methods, 24:107-117; Brennan et al., 1985, Science 229:81). In certain embodiments, antibody fragments are produced recombinantly. Fab, Fv, and scFv antibody fragments can all be expressed in and secreted from E. coli or other host cells, thus allowing the production of large amounts of these fragments. Such antibody fragments can also be isolated from the antibody phage libraries discussed above. The antibody fragment can also be linear antibodies as described in U.S. Patent 5,641,870, for example, and can be monospecific or bispecific. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner. [00113] According to the present invention, techniques can be adapted for the production of single-chain antibodies specific to DDRl (see U.S. Pat. No. 4,946,778). In addition, methods can be adapted for the construction of Fab expression libraries (Huse, et al., 1989, Science 246:1275-1281) to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for DDRl, or derivatives, fragments, or homologs thereof. Antibody fragments that contain the idiotypes to a polypeptide of the invention may be produced by techniques in the art including, but not limited to: (a) an F(ab')2 fragment produced by pepsin digestion of an antibody molecule; (b) an Fab fragment generated by reducing the disulfide bridges of an F(ab')2 fragment, (c) an Fab fragment generated by the treatment of the antibody molecule with papain and a reducing agent, and (d) Fv fragments. [00114] It can further be desirable, especially m the case of antibody fragments, to modify an antibody m order to increase its serum half-life. This can be achieved, for example, by incorporation of a salvage receptor binding epitope into the antibody fragment by mutation of the appropπate region m the antibody fragment or by incorporating the epitope into a peptide tag that is then fused to the antibody fragment at either end or in the middle (e.g., by DNA or peptide synthesis). [00115] Heteroconjugate antibodies are also within the scope of the present invention.
Heteroconjugate antbodies are composed of two covalentlyjomed antibodies. Such antibodies have, for example, been proposed to target immune cells to unwanted cells (U.S. Pat. No. 4,676,980). It is contemplated that the antibodies can be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents. For example, lmmunotoxins can be constructed using a disulfide exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include immothiolate and methyl-4-mercaptobutyπmidate.
[00116] For the purposes of the present invention, it should be appreciated that modified antibodies can compπse any type of vaπable region that provides for the association of the antibody with the polypeptides of DDRl (and/or DDR2). In this regard, the vaπable region may compπse or be deπved from any type of mammal that can be induced to mount a humoral response and generate immunoglobulins against the desired tumor associated antigen. As such, the vaπable region of the modified antibodies can be, for example, of human, muπne, non-human pπmate (e.g., cynomolgus monkeys, macaques, etc.) or lupine origin, hi some embodiments both the vaπable and constant regions of the modified immunoglobulins are human. In other embodiments the vaπable regions of compatible antibodies (usually deπved from a non-human source) can be engineered or specifically tailored to improve the binding properties or reduce the immunogenicity of the molecule. In this respect, vaπable regions useful in the present invention can be humanized or otherwise altered through the inclusion of imported amino acid sequences.
[0100] The vaπable domains in both the heavy and light chains are altered by at least partial replacement of one or more CDRs and, if necessary, by partial framework region replacement and sequence changing. Although the CDRs may be deπved from an antibody of the same class or even subclass as the antibody from which the framework regions are deπved, it is envisaged that the CDRs will be deπved from an antibody of different class and preferably from an antibody from a different species. It may not be necessary to replace all of the CDRs with the complete CDRs from the donor vaπable region to transfer the antigen binding capacity of one vaπable domain to another. Rather, it may only be necessary to transfer those residues that are necessary to maintain the activity of the antigen binding site. Given the explanations set forth in U.S. Pat. Nos. 5,585,089, 5,693,761 and 5,693,762, it will be well within the competence of those skilled in the art, either by carrying out routne expeπmentation or by trial and error testing to obtain a functional antibody with reduced immunogenicity. [0101] Alterations to the variable region notwithstanding, those skilled in the art will appreciate that the modified antibodies of this invention will comprise antibodies, or immunoreactive fragments thereof, in which at least a fraction of one or more of the constant region domains has been deleted or otherwise altered so as to provide desired biochemical characteristics such as increased tumor localization or reduced serum half-life when compared with an antibody of approximately the same immunogenicity comprising a native or unaltered constant region. In some embodiments, the constant region of the modified antibodies will comprise a human constant region. Modifications to the constant region compatible with this invention comprise additions, deletions or substitutions of one or more amino acids in one or more domains. That is, the modified antibodies disclosed herein may comprise alterations or modifications to one or more of the three heavy chain constant domains (CHl, CH2 or CH3) and/or to the light chain constant domain (CL). In some embodiments of the invention modified constant regions wherein one or more domains are partially or entirely deleted are contemplated. In some embodiments the modified antibodies will comprise domain deleted constructs or variants wherein the entire CH2 domain has been removed (ΔCH2 constructs). In some embodiments the omitted constant region domain will be replaced by a short amino acid spacer (e.g. 10 residues) that provides some of the molecular flexibility typically imparted by the absent constant region.
[0102] Besides their configuration, it is known in the art that the constant region mediates several effector functions. For example, binding of the Cl component of complement to antibodies activates the complement system. Activation of complement is important in the opsonization and lysis of cell pathogens. The activation of complement also stimulates the inflammatory response and can also be involved in autoimmune hypersensitivity. Further, antibodies bind to cells via the Fc region, with a Fc receptor site on the antibody Fc region binding to a Fc receptor (FcR) on a cell. There are a number of Fc receptors which are specific for different classes of antibody, including IgG (gamma receptors), IgE (epsilon receptors), IgA (alpha receptors) and IgM (mu receptors). Binding of antibody to Fc receptors on cell surfaces triggers a number of important and diverse biological responses including engulfment and destruction of antibody-coated particles, clearance of immune complexes, lysis of antibody-coated target cells by killer cells (called antibody-dependent cell-mediated cytotoxicity, or ADCC), release of inflammatory mediators, placental transfer and control of immunoglobulin production. Although various Fc receptors and receptor sites have been studied to a certain extent, there is still much which is unknown about their location, structure and functioning.
[0103] While not limiting the scope of the present invention, it is believed that antibodies comprising constant regions modified as described herein provide for altered effector functions that, in turn, affect the biological profile of the administered antibody. For example, the deletion or inactivation (through point mutations or other means) of a constant region domain may reduce Fc receptor binding of the circulating modified antibody thereby increasing tumor localization. In other cases it may be that constant region modifications, consistent with this invention, moderate complement binding and thus reduce the serum half life and nonspecific association of a conjugated cytotoxin. Yet other modifications of the constant region may be used to eliminate disulfide linkages or oligosaccharide moieties that allow for enhanced localization due to increased antigen specificity or antibody flexibility. Similarly, modifications to the constant region in accordance with this invention may easily be made using well known biochemical or molecular engineering techniques well within the purview of the skilled artisan. [0104] It will be noted that the modified antibodies may be engineered to fuse the CH3 domain directly to the hinge region of the respective modified antibodies. In other constructs it may be desirable to provide a peptide spacer between the hinge region and the modified CH2 and/or CH3 domains. For example, compatible constructs could be expressed wherein the CH2 domain has been deleted and the remaining CH3 domain (modified or unmodified) is joined to the hinge region with a 5-20 amino acid spacer. Such a spacer may be added, for instance, to ensure that the regulatory elements of the constant domain remain free and accessible or that the hinge region remains flexible. However, it should be noted that amino acid spacers can, in some cases, prove to be immunogenic and elicit an unwanted immune response against the construct. Accordingly, any spacer added to the construct should be relatively non- immunogenic or, even omitted altogether if the desired biochemical qualities of the modified antibodies may be maintained.
[0105] Besides the deletion of whole constant region domains, it will be appreciated that the antibodies of the present invention may be provided by the partial deletion or substitution of a few or even a single amino acid. For example, the mutation of a single amino acid in selected areas of the CH2 domain may be enough to substantially reduce Fc binding and thereby increase tumor localization. Similarly, it may be desirable to simply delete that part of one or more constant region domains that control the effector function (e.g. complement CLQ binding) to be modulated. Such partial deletions of the constant regions may improve selected characteristics of the antibody (serum half-life) while leaving other desirable functions associated with the subject constant region domain intact. Moreover, as alluded to above, the constant regions of the disclosed antibodies may be modified through the mutation or substitution of one or more amino acids that enhances the profile of the resulting construct. In this respect it may be possible to disrupt the activity provided by a conserved binding site (e.g. Fc binding) while substantially maintaining the configuration and immunogenic profile of the modified antibody. Certain embodiments can comprise the addition of one or more amino acids to the constant region to enhance desirable characteristics such as effector function or provide for more cytotoxin or carbohydrate attachment. In such embodiments it can be desirable to insert or replicate specific sequences derived from selected constant region domains.
[0106] The present invention further embraces variants and equivalents which are substantially homologous to the chimeric, humanized and human antibodies, or antibody fragments thereof, set forth herein. These can contain, for example, conservative substitution mutations, i.e. the substitution of one or more amino acids by similar amino acids. For example, conservative substitution refers to the substitution of an amino acid with another within the same general class such as, for example, one acidic amino acid with another acidic amino acid, one basic amino acid with another basic amino acid or one neutral amino acid by another neutral amino acid. What is intended by a conservative amino acid substitution is well known in the art.
[0107] The invention also pertains to immunoconjugates comprising an antibody conjugated to a cytotoxic agent. Cytotoxic agents include chemotherapeutic agents, growth inhibitory agents, toxins (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), radioactive isotopes (i.e., a radioconjugate), etc. Chemotherapeutic agents useful in the generation of such immunoconjugates include, for example, methotrexate, adriamicin, doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents. Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain, ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes. In some embodiments, the antibodies can be conjugated to radioisotopes, such as 90Y, 1251, 1311, 1231, 111In, 105Rh, 153Sm, 67Cu, 67Ga, 166Ho, 177Lu, 186Re and 188Re using any one of a number of well known chelators or direct labeling. In other embodiments, the disclosed compositions can comprise antibodies coupled to drugs, prodrugs or lymphokines such as interferon. Conjugates of the antibody and cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyidithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis(p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro- 2,4-dinitrobenzene). Conjugates of an antibody and one or more small molecule toxins, such as a calicheamicin, maytansinoids, a trichothene, and CC 1065, and the derivatives of these toxins that have toxin activity, can also be used. In some embodiments, the modified antibodies can be complexed with other immunologically active ligands (e.g. antibodies or fragments thereof) wherein the resulting molecule binds to both the neoplastic cell and an effector cell such as a T cell.
[0108] Conjugate antibodies are composed of two covalently joined antibodies. Such antibodies have, for example, been proposed to target immune cells to unwanted cells (U.S. Pat. No. 4,676,980). It is contemplated that the antibodies can be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents. For example, immunotoxins can be constructed using a disulfide exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include iminothiolate and methyl-4-mercaptobutyrimidate.
[0109] Regardless of how useful quantities are obtained, the antibodies of the present invention can be used in any one of a number of conjugated (i.e. an immunoconjugate) or unconjugated forms. Alternatively, the antibodies of this invention can be used in a nonconjugated or "naked" form to harness the subject's natural defense mechanisms including complement-dependent cytotoxicity (CDC) and antibody dependent cellular toxicity (ADCC) to eliminate the malignant cells. The selection of which conjugated or unconjugated modified antibody to use will depend on the type and stage of cancer, use of adjunct treatment (e.g., chemotherapy or external radiation) and patient condition. It will be appreciated that one skilled in the art could readily make such a selection in view of the teachings herein. [0110] Competition assays can be used to determine whether two antibodies bind the same epitope by recognizing identical or sterically overlapping epitopes. Any method known in the art for determining competitive binding (such as e.g., the immunoassays described elsewhere herein) may be used.
[0111] The antibodies of the present invention can be assayed for immunospecific binding by any method known in the art. The immunoassays which can be used include, but are not limited to, competitive and non-competitive assay systems using techniques such as Biacore analysis, FACS analysis, immunofluorescence, immunocytochemistry, Western blots, radioimmunoassays, ELISA, "sandwich" immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, and protein A immunoassays. Such assays are routine and well known in the art (see, e.g., Ausubel et al., eds., 1994, Current Protocols in Molecular Biology, Vol. 1, John Wiley & Sons, Inc., New York, which is incorporated by reference herein in its entirety). [0112] In some embodiments, the immunospecificity of an antibody against a cancer stem cell marker is determined using ELISA. An ELISA assay comprises preparing antigen, coating wells of a 96 well microtiter plate with antigen, adding the antibody against a cancer stem cell marker conjugated to a detectable compound such as an enzymatic substrate (e.g. horseradish peroxidase or alkaline phosphatase) to the well, incubating for a period of time and detecting the presence of the antigen. In some embodiments, the antibody against a cancer stem cell marker is not conjugated to a detectable compound, but instead a second conjugated antibody that recognizes the antibody against a cancer stem cell marker is added to the well. In some embodiments, instead of coating the well with the antigen, the antibody against a cancer stem cell marker can be coated to the well and a second antibody conjugated to a detectable compound can be added following the addition of the antigen to the coated well. One of skill in the art would be knowledgeable as to the parameters that can be modified to increase the signal detected as well as other variations of ELISAs known in the art (see e.g., Ausubel et al., eds., 1994, Current Protocols in Molecular Biology, Vol. 1, John Wiley & Sons, Inc., New York at 11.2.1). [0113] The binding affinity of an antibody to a cancer stem cell marker antigen and the off-rate of an antibody-antigen interaction can be determined by competitive binding assays. One example of a competitive binding assay is a radioimmunoassay comprising the incubation of labeled antigen (e.g. 3H or 125I), or fragment or variant thereof, with the antibody of interest in the presence of increasing amounts of unlabeled antigen followed by the detection of the antibody bound to the labeled antigen. The affinity of the antibody against a cancer stem cell marker and the binding off-rates can be determined from the data by Scatchard plot analysis. In some embodiments, Biacore kinetic analysis is used to determine the binding on and off rates of antibodies against a cancer stem cell marker. Biacore kinetic analysis comprises analyzing the binding and dissociation of antibodies from chips with immobilized cancer stem cell marker antigens on their surface.
[0114] In certain embodiments, the invention encompasses isolated polynucleotides that encode a polypeptide comprising an antibody, or fragment thereof, against human DDRl. Thus, the term "polynucleotide encoding a polypeptide" encompasses a polynucleotide which includes only coding sequences for the polypeptide as well as a polynucleotide which includes additional coding and/or non- coding sequences. The polynucleotides of the invention can be in the form of RNA or in the form of DNA. DNA includes cDNA, genomic DNA, and synthetic DNA; and can be double-stranded or single- stranded, and if single stranded can be the coding strand or non-coding (anti-sense) strand. [0115] The present invention further relates to variants of the hereinabove described polynucleotides encoding, for example, fragments, analogs, and derivatives. The variant of the polynucleotide can be a naturally occurring allelic variant of the polynucleotide or a non-naturally occurring variant of the polynucleotide. In certain embodiments, the polynucleotide can have a coding sequence which is a naturally occurring allelic variant of the coding sequence of the disclosed polypeptides. As known in the art, an allelic variant is an alternate form of a polynucleotide sequence that has, for example, a substitution, deletion, or addition of one or more nucleotides, which does not substantially alter the function of the encoded polypeptide.
[0116] In certain embodiments the polynucleotides comprise the coding sequence for the mature polypeptide fused in the same reading frame to a polynucleotide which aids, for example, in expression and secretion of a polypeptide from a host cell (e.g. a leader sequence which functions as a secretory sequence for controlling transport of a polypeptide from the cell). The polypeptide having a leader sequence is a preprotein and can have the leader sequence cleaved by the host cell to form the mature form of the polypeptide. The polynucleotides can also encode for a proprotein which is the mature protein plus additional 5' amino acid residues. A mature protein having a prosequence is a proprotein and is an inactive form of the protein. Once the prosequence is cleaved an active mature protein remains. [0117] In certain embodiments the polynucleotides comprise the coding sequence for the mature polypeptide fused in the same reading frame to a marker sequence that allows, for example, for purification of the encoded polypeptide. For example, the marker sequence can be a hexa-histidine tag supplied by a pQE-9 vector to provide for purification of the mature polypeptide fused to the marker in the case of a bacterial host, or the marker sequence can be a hemagglutinin (HA) tag derived from the influenza hemagglutinin protein when a mammalian host (e.g. COS-7 cells) is used. [0118] In certain embodiments, the present invention provides isolated nucleic acid molecules having a nucleotide sequence at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, and in some embodiments, at least 96%, 97%, 98% or 99% identical to a polynucleotide encoding a polypeptide comprising an antibody, or fragment thereof, against DDRl (e.g., human DDRl). [0119] By a polynucleotide having a nucleotide sequence at least, for example, 95% "identical" to a reference nucleotide sequence is intended that the nucleotide sequence of the polynucleotide is identical to the reference sequence except that the polynucleotide sequence can include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence. In other words, to obtain a polynucleotide having a nucleotide sequence at least 95% identical to a reference nucleotide sequence, up to 5% of the nucleotides in the reference sequence can be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence can be inserted into the reference sequence. These mutations of the reference sequence can occur at the amino- or carboxy- terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either individually among nucleotides in the reference sequence or in one or more contiguous groups within the reference sequence.
[0120] As a practical matter, whether any particular nucleic acid molecule is at least 80% identical, at least 85% identical, at least 90% identical, and in some embodiments, at least 95%, 96%, 97%, 98%, or 99% identical to a reference sequence can be determined conventionally using known computer programs such as the Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, WI 53711). Bestfit uses the local homology algorithm of Smith and Waterman, 1981, Advances in Applied Mathematics 2: 482 489 to find the best segment of homology between two sequences. When using Bestfit or any other sequence alignment program to determine whether a particular sequence is, for instance, 95% identical to a reference sequence according to the present invention, the parameters are set such that the percentage of identity is calculated over the full length of the reference nucleotide sequence and that gaps in homology of up to 5% of the total number of nucleotides in the reference sequence are allowed.
[0121] The polynucleotide variants can contain alterations in the coding regions, non-coding regions, or both. In some embodiments the polynucleotide variants contain alterations which produce silent substitutions, additions, or deletions, but do not alter the properties or activities of the encoded polypeptide. In some embodiments, nucleotide variants are produced by silent substitutions due to the degeneracy of the genetic code. Polynucleotide variants can be produced for a variety of reasons, e.g., to optimize codon expression for a particular host (change codons in the human mRNA to those preferred by a bacterial host such as E. colϊ).
[0122] The polypeptides of the present invention can be recombinant polypeptides, natural polypeptides, or synthetic polypeptides comprising an antibody, or fragment thereof, against a DDRl protein, such as human DDRl . It will be recognized in the art that some amino acid sequences of the invention can be varied without significant effect of the structure or function of the protein. Thus, the invention further includes variations of the polypeptides which show substantial activity or which include regions of an antibody, or fragment thereof, against human DDRl protein. Such mutants include deletions, insertions, inversions, repeats, and type substitutions.
[0123] The polypeptides and analogs can be further modified to contain additional chemical moieties not normally part of the protein. The derivatized moieties can improve the solubility, the biological half life or absorption of the protein. The moieties can also reduce or eliminate any undesirable side effects of the proteins and the like. An overview for such moieties can be found in Remington's Pharmaceutical Sciences, 20th ed., Mack Publishing Co., Easton, PA (2000). [0124] The isolated polypeptides described herein can be produced by any suitable method known in the art. Such methods range from direct protein synthesis methods to constructing a DNA sequence encoding isolated polypeptide sequences and expressing those sequences in a suitable transformed host. In some embodiments, a DNA sequence is constructed using recombinant technology by isolating or synthesizing a DNA sequence encoding a wild-type protein of interest. Optionally, the sequence can be mutagenized by site-specific mutagenesis to provide functional analogs thereof. {See, e.g., Zoeller et al., Proc. Nat'l. Acad. Sci. USA 81:5662-5066 (1984) and U.S. Pat. No. 4,588,585). [0125] In some embodiments a DNA sequence encoding a polypeptide of interest would be constructed by chemical synthesis using an oligonucleotide synthesizer. Such oligonucleotides can be designed based on the amino acid sequence of the desired polypeptide and selecting those codons that are favored in the host cell in which the recombinant polypeptide of interest will be produced. Standard methods can be applied to synthesize an isolated polynucleotide sequence encoding an isolated polypeptide of interest. For example, a complete amino acid sequence can be used to construct a back- translated gene. Further, a DNA oligomer containing a nucleotide sequence coding for the particular isolated polypeptide can be synthesized. For example, several small oligonucleotides coding for portions of the desired polypeptide can be synthesized and then ligated. The individual oligonucleotides typically contain 5 ' or 3' overhangs for complementary assembly. [0126] Once assembled (by synthesis, site-directed mutagenesis or another method), the polynucleotide sequences encoding a particular isolated polypeptide of interest will be inserted into an expression vector and operatively linked to an expression control sequence appropnate for expression of the protein in a desired host. Proper assembly can be confirmed by nucleotide sequencing, restriction mapping, and expression of a biologically active polypeptide in a suitable host. As is well known in the art, m order to obtain high expression levels of a transfected gene in a host, the gene must be operatively linked to transcriptional and translational expression control sequences that are functional in the chosen expression host.
[0127] Recombinant expression vectors are used to amplify and express DNA encoding cancer stem cell marker polypeptide fusions. Recombinant expression vectors are rephcable DNA constructs which have synthetic or cDNA-denved DNA fragments encoding a cancer stem cell marker polypeptide fusion or a bioequivalent analog operatively linked to suitable transcriptional or translational regulatory elements deπved from mammalian, microbial, viral or insect genes. A transcriptional unit generally compπses an assembly of (1) a genetic element or elements having a regulatory role in gene expression, for example, transcriptional promoters or enhancers, (2) a structural or coding sequence which is transcribed into mRNA and translated into protein, and (3) appropnate transcription and translation initiation and termination sequences, as descπbed in detail below. Such regulatory elements can include an operator sequence to control transcription. The ability to replicate in a host, usually conferred by an origin of replication, and a select on gene to facilitate recognition of transformants can additionally be incorporated. DNA regions are operatively linked when they are functionally related to each other. For example, DNA for a signal peptide (secretory leader) is operatively linked to DNA for a polypeptide if it is expressed as a precursor which participates in the secretion of the polypeptide; a promoter is operatively linked to a coding sequence if it controls the transcription of the sequence; or a πbosome binding site is operatively linked to a coding sequence if it is positioned so as to permit translation. Generally, operatively linked means contiguous and, m the case of secretory leaders, means contiguous and in reading frame. Structural elements intended for use in yeast expression systems include a leader sequence enabling extracellular secretion of translated protein by a host cell. Alternatively, where recombinant protein is expressed without a leader or transport sequence, it can include an N-termmal methionine residue. This residue can optionally be subsequently cleaved from the expressed recombinant protein to provide a final product.
[0128] The choice of expression control sequence and expression vector will depend upon the choice of host. A wide variety of expression host/vector combinations can be employed. Useful expression vectors for eukaryotic hosts, include, for example, vectors comprising expression control sequences from SV40, bovine papilloma virus, adenovirus and cytomegalovirus. Useful expression vectors for bacteπal hosts include known bacteπal plasmids, such as plasmids from Eshenchia coh, including pCR 1, pBR322, pMB9 and their derivatives and wider host range plasmids, such as M 13 and filamentous single-stranded DNA phages.
[0129] Suitable host cells for expression of a cancer stem cell marker protein include prokaryotes, yeast, insect or higher eukaryotic cells. Prokaryotes include gram negative or gram positive organisms, for example E. coli or bacilli. Higher eukaryotic cells include established cell lines of mammalian origin as described below. Cell-free translation systems could also be employed. Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are described by Pouwels et al. (Cloning Vectors: A Laboratory Manual, Elsevier, N.Y., 1985), the relevant disclosure of which is hereby incorporated by reference.
[0130] Various mammalian or insect cell culture systems are also advantageously employed to express recombinant protein. Expression of recombinant proteins in mammalian cells can be performed because such proteins are generally correctly folded, appropriately modified and completely functional. Examples of suitable mammalian host cell lines include the COS-7 lines of monkey kidney cells, described by Gluzman (1981 Cell 23:175), and other cell lines capable of expressing an appropriate vector including, for example, L cells, C127, 3T3, Chinese hamster ovary (CHO), HeLa and BHK cell lines. Mammalian expression vectors can comprise non-transcribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 51 or 3' flanking non- transcribed sequences, and 5 ' or 3' non-translated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences. Baculo virus systems for production of heterologous proteins in insect cells are reviewed by Luckow and Summers, 1988, Bio/Technology, 6:47.
[0131] The proteins produced by a transformed host can be purified according to any suitable method. Such standard methods include chromatography (e.g., ion exchange, affinity and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for protein purification. Affinity tags such as hexa-histidine, maltose binding domain, influenza coat sequence and glutathione-S-transferase can be attached to the protein to allow easy purification by passage over an appropriate affinity column. Isolated proteins can also be physically characterized using such techniques as proteolysis, nuclear magnetic resonance and x-ray crystallography.
[0132] For example, supernatants from systems which secrete recombinant protein into culture media can be first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit. Following the concentration step, the concentrate can be applied to a suitable purification matrix. Alternatively, an anion exchange resin can be employed, for example, a matrix or substrate having pendant diethylaminoethyl (DEAE) groups. The matrices can be acrylamide, agarose, dextran, cellulose or other types commonly employed in protein purification. Alternatively, a cation exchange step can be employed. Suitable cation exchangers include various insoluble matrices comprising sulfopropyl or carboxymethyl groups. Finally, one or more reversed-phase high performance liquid chromatography (RP-HPLC) steps employing hydrophobic RP-HPLC media, e.g., silica gel having pendant methyl or other aliphatic groups, can be employed to further purify a recombinant protein or cancer stem cell protein-Fc composition. Some or all of the foregoing purification steps, in various combinations, can also be employed to provide a homogeneous recombinant protein. [0133] Recombinant protein produced in bacterial culture can be isolated, for example, by initial extraction from cell pellets, followed by one or more concentration, salting-out, aqueous ion exchange or size exclusion chromatography steps. High performance liquid chromatography (HPLC) can be employed for final purification steps. Microbial cells employed in expression of a recombinant protein can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents.
[0134] The present invention provides methods for inhibiting the growth of tumorigenic cells expressing a cancer stem cell marker using the antibodies against a cancer stem cell marker described herein. In certain embodiments, the method of inhibiting the growth of tumorigenic cells expressing a cancer stem cell marker comprises contacting the cell with an antibody against a cancer stem cell marker in vitro. For example, an immortalized cell line or a cancer cell line that expresses a cancer stem cell marker is cultured in medium to which is added an antibody against the expressed cancer stem cell marker to inhibit cell growth. In some embodiments, tumor cells comprising tumor stem cells are isolated from a patient sample such as, for example, a tissue biopsy, pleural effusion, or blood sample and cultured in medium to which is added an antibody against a cancer stem cell marker to inhibit cell growth. [0135] In some embodiments, the method of inhibiting the growth of tumorigenic cells expressing a cancer stem cell marker comprises contacting the cell with an antibody against a cancer stem cell marker in vivo. In some embodiments, the method of inhibiting growth of tumorigenic cells expressing DDRl comprises contacting the cell with an antibody that specifically binds the extracellular domain of DDRl. In some embodiments, the anti-DDRl antibody inhibits growth of tumorigenic cells by inhibiting the activity of DDRl. In some embodiments, the anti-DDRl antibody inhibits growth of tumorigenic cells by reducing the frequency of or the number of cancer stem cells in the tumor. [0136] Li some embodiments, the present invention provides methods of inhibiting activity of
DDRl on a cell comprising contacting the cell with an effective amount of an antibody that specifically binds the extracellular domain of DDRl. In certain embodiments, the cell is a tumor cell. [0137] In certain embodiments, contacting a tumorigenic cell with an antibody against a cancer stem cell marker is undertaken in an animal model. For example, xenografts expressing a cancer stem cell marker are grown in immunocompromised mice (e.g. NOD/SCID mice) that are administered an antibody against a cancer stem cell marker to inhibit tumor growth. In some embodiments, cancer stem cells that express a cancer stem cell marker are isolated from a patient sample such as, for example, a tissue biopsy, pleural effusion, or blood sample and injected into immunocompromised mice that are then administered an antibody against the cancer stem cell marker to inhibit growth of a solid tumor. In some embodiments, the antibody against a cancer stem cell marker is administered at the same time or shortly after introduction of tumorigenic cells into the animal to prevent tumor growth. In some embodiments, the antibody against a cancer stem cell marker is administered as a therapeutic after the tumorigenic cells have grown to a specified size.
[0138] The present invention further provides pharmaceutical compositions comprising antibodies, polypeptides or other agents that target a cancer stem cell marker. These pharmaceutical compositions find use in inhibiting growth of a solid tumor and treating cancer in human patients. [0139] Formulations are prepared for storage and use by combining a purified agent or antibody of the present invention with a pharmaceutically acceptable vehicle (e.g., carrier, excipient) (Remington, The Science and Practice of Pharmacy 20th Edition Mack Publishing, 2000). Suitable pharmaceutically acceptable vehicles include, but are not limited to, nontoxic buffers such as phosphate, citrate, and other organic acids; salts such as sodium chloride; antioxidants including ascorbic acid and methionine; preservatives (e.g. octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens, such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight polypeptides (e.g. less than about 10 amino acid residues); proteins such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; carbohydrates such as monosaccharides, disaccharides, glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn- protein complexes); and non-ionic surfactants such as TWEEN or polyethylene glycol (PEG). [0140] The pharmaceutical composition of the present invention can be administered in any number of ways for either local or systemic treatment. Administration can be topical (such as to mucous membranes including vaginal and rectal delivery) such as transdermal patches, ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powders; pulmonary (e.g., by inhalation or insufflation of powders or aerosols, including by nebulizer; intratracheal, intranasal, epidermal and transdermal); oral; or parenteral including intravenous, intraarterial, subcutaneous, intraperitoneal or intramuscular injection or infusion; intratumoral, or intracranial (e.g., intrathecal or intraventricular) administration. [0141] The therapeutic formulation can be in unit dosage form. Such formulations include tablets, pills, capsules, powders, granules, solutions or suspensions in water or non-aqueous media, or suppositories for oral, parenteral, or rectal administration or for administration by inhalation. In solid compositions such as tablets the principal active ingredient is mixed with a pharmaceutical carrier. Conventional tableting ingredients include corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other diluents (e.g. water) to form a solid preformulation composition containing a homogeneous mixture of a compound of the present invention, or a non-toxic pharmaceutically acceptable salt thereof. The solid preformulation composition is then subdivided into unit dosage forms of the type described above. The tablets, pills, etc. of the novel composition can be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged action. For example, the tablet or pill can comprise an inner composition covered by an outer component. Furthermore, the two components can be separated by an enteric layer that serves to resist disintegration and permits the inner component to pass intact through the stomach or to be delayed in release. A variety of materials can be used for such enteric layers or coatings, such materials including a number of polymeric acids and mixtures of polymeric acids with such materials as shellac, cetyl alcohol and cellulose acetate.
[0142] Pharmaceutical formulations include antibodies of the present invention complexed with liposomes (Epstein, et al., 1985, Proc. Natl. Acad. ScL USA 82:3688; Hwang, et al., 1980, Proc. Natl. Acad. ScL USA 77:4030; and U.S. Patents 4,485,045 and 4,544,545). Liposomes with enhanced circulation time are disclosed in U.S. Patent 5,013,556. Some liposomes can be generated by the reverse phase evaporation with a lipid composition comprising phosphatidylcholine, cholesterol, and PEG- derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
[0143] The antibodies can also be entrapped in microcapsules. Such microcapsules are prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions as described in Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing (2000).
[0144] In addition sustained-release preparations can be prepared. Suitable examples of sustained-release preparations include semi-permeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles (e.g. films or microcapsules). Examples of sustained-release matrices include polyesters, hydrogels such as poly(2-hydroxyethyl-methacrylate) or poly(vinylalcohol), polylactides (U.S. Patent 3,773,919), copolymers of L-glutamic acid and 7 ethyl-L- glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT TM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), sucrose acetate isobutyrate, and poly-D-(-)-3-hydroxybutyric acid. [0145] In some embodiments, the treatment involves the combined administration of an antibody or other agent of the present invention and a chemotherapeutic agent or cocktail of multiple different chemotherapeutic agents. Combination therapy often uses agents that work by different mechanisms of action. Combination therapy using agents with different mechanisms of action often results in additive or synergetic effects. Combination therapy may allow for lower doses of each agent than is used in monotherapy thereby reducing toxic side effects. Combination therapy may decrease the likelihood that resistant cancer cells will develop. In some embodiments, the combination therapy comprises an antibody that binds to DDRl and a chemotherapeutic agent.
[0146] In combination therapy, treatment with an antibody can occur prior to, concurrently with, or subsequent to administration of chemotherapies. Chemotherapies contemplated by the invention include chemical substances or drugs which are known in the art and are commercially available, such as doxorubicin, 5-fluorouracil, cytosine arabinoside ("Ara-C"), cyclophosphamide, thiotepa, busulfan, cytoxin, taxol (paclitaxel), methotrexate, cisplatin, melphalan, vinblastine, leucovorin, streptozocin, oxaliplatin and carboplatin. Combined administration can include co-administration, either in a single pharmaceutical formulation or using separate formulations, or consecutive administration in either order but generally within a time period such that all active agents can exert their biological activities simultaneously. Preparation and dosing schedules for such chemotherapeutic agents can be used according to manufacturers' instructions or as determined empirically by the skilled practitioner. Preparation and dosing schedules for such chemotherapy are also described in Chemotherapy Service Ed., M. C. Perry, Williams & Wilkins, Baltimore, Md. (1992).
[0147] Chemotherapeutic agents useful in the instant invention also include, but are not limited to, alkylating agents such as thiotepa and cyclosphosphamide (CYTOXAN); alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethylenethiophosphaoramide and trimethylolomelamime nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, ranimustme; antibiotics such as aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, calicheamicin, carabicin, caminomycin, carzinophilin, chromomycins, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin, epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine, 5- FU; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as ammoglutethmude, πutotane, tπlostane; folic acid replemsher such as frohnic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; amsacrme, bestrabucil, bisantrene; edatraxate; defofamme; demecolcme; diaziquone; elformithine; elhptmium acetate; etoglucid; gallium nitrate; hydroxyurea; lentman; lonidamine; mitoguazone; mitoxantrone; mopidamol; nitracrme; pentostatin; phenamet; pirarubicin; podophyllmic acid; 2-ethylhydrazide; procarbazine; PSK.; razoxane; sizofuran; spirogermamum; tenuazomc acid; tπaziquone; 2,2',2"-tπchlorotπethylamme; urethan; vmdesme; dacarbazine; mannomustme; mitobronitol; mitolactol; pipobroman; gacytosme; arabmoside ("Ara-C"); cyclophosphamide; thiotepa; taxoids, e.g., paclitaxel (TAXOL, Bπstol-Myers Squibb Oncology, Pπnceton, NJ.) and doxetaxel (TAXOTERE, Rhone-Poulenc Rorer, Antony, France); chlorambucil; gemcitabme; 6-thioguanme; mercaptopuπne; methotrexate; platinum analogs such as cisplatin and carboplatm; vinblastine; platinum; etoposide (VP-16); lfosfamide; mitomycin C; mitoxantrone; vmcπstme; vmorelbme; navelbme; novantrone; temposide; daunomycm; aminopteπn; xeloda; ibandronate; CPTI l; topoisomerase inhibitor RFS 2000; difluoromethylornithme (DMFO); retmoic acid; esperamicms; capecitabme; and pharmaceutically acceptable salts, acids or deπvatives of any of the above. Chemotherapeutic agents also include anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens including for example tamoxifen, raloxifene, aromatase inhibiting 4(5)-imidazoles, 4-hydroxytamoxifen, tπoxifene, keoxifene, LYl 17018, onapπstone, and toremifene (Fareston); and antiandrogens such as flutamide, mlutamide, bicalutamide, leuprohde, and goserelm; and pharmaceutically acceptable salts, acids or deπvatives of any of the above [0148] In certain embodiments, the chemotherapeutic agent is a topoisomerase inhibitor.
Topoisomerase inhibitors are chemotherapy agents that interfere with the action of a topoisomerase enzyme (e g., topoisomerase I or II). Topoisomerase inhibitors include, but are not limited to, doxorubicin HCL, daunorubicin citrate, mitoxantrone HCL, actmomycin D, etoposide, topotecan HCl, temposide (VM-26), and innotecan.
[0149] In certain embodiments, the chemotherapeutic agent is an anti-metabolite. An antimetabolite is a chemical with a structure that is similar to a metabolite required for normal biochemical reactions, yet different enough to interfere with one or more normal functions of cells, such as cell division. Anti-metabolites include, but are not limited to, gemcitabine, fluorouracil, capecitabme, methotrexate sodium, rahtrexed, Pemetrexed, tegafur, cytosine arabmoside, THIOGUANINE (GlaxoSmithKlme), 5-azacytidme, 6-mercaptopuπne, azathiopπne, 6-thioguanme, pentostatin, fludarabine phosphate, and cladπbme, as well as pharmaceutically acceptable salts, acids, or deπvatives of any of these.
[0150] In other embodiments, the treatment involves the combined administration of an antibody or other agent of the present invention and radiation therapy. Treatment with the antibody can occur pπor to, concurrently with, or subsequent to administration of radiation therapy. Any dosmg schedules for such radiation therapy can be used as determined by the skilled practitioner.
[0151] In other embodiments, the treatment can involve the combined administration of antibodies of the present invention with other antibodies against additional tumor-associated antigens including, but not limited to, antibodies that bind to the EGF receptor (EGFR) (Erbitux® Bristol-Myers Squibb Company, Pπnceton, NJ), the erbB2 receptor (HER2) (Herceptin® Genentech, Inc., South San Francisco, CA), and vascular endothelial growth factor (VEGF) (Avastin® Genentech, Inc., South San Francisco, CA). Furthermore, treatment can include administration of one or more cytokines; can be accompanied by surgical removal of cancer cells; or any other therapy deemed necessary by a treating physician.
[0152] For the treatment of the disease, the appropπate dosage of an agent or antibody of the present invention depends on the type of disease to be treated, the seventy and course of the disease, the responsiveness of the disease, whether the antibody is administered for therapeutic or preventative purposes, previous therapy, patient's clinical history, and so on, all at the discretion of the treating physician. The agent or antibody can be administered one time or over a seπes of treatments lasting from several days to several months, or until a cure is effected or a diminution of the disease state is achieved (e.g., reduction in tumor size). Optimal dosmg schedules can be calculated from measurements of drug accumulation in the body of the patient and will vary depending on the relative potency of an individual antibody. The administering physician can easily determine optimum dosages, dosmg methodologies and repetition rates. In general, dosage is from 0.01 μg to 100 mg per kg of body weight, and can be given once or more daily, weekly, monthly or yearly. The treating physician can estimate repetition rates for dosmg based on measured residence times and concentrations of the drug in bodily fluids or tissues. [0153] The present invention provides kits comprising the antibodies descπbed herein and that can be used to perform the methods descπbed herein. In certain embodiments, a kit comprises at least one purified antibody against a cancer stem cell marker in one or more containers In some embodiments, the kits contain all of the components necessary and/or sufficient to perform a detection assay, including all controls, directions for performing assays, and any necessary software for analysis and presentation of results. One skilled in the art will readily recognize that the disclosed antibodies of the present invention can be readily incorporated into one of the established kit formats which are well known in the art [0154] Embodiments of the present disclosure can be further defined by reference to the following examples, which descπbe in detail preparation of antibodies of the present disclosure and methods for using antibodies of the present disclosure. It will be apparent to those skilled in the art that many modifications, both to mateπals and methods, may be practiced without departing from the scope of the present disclosure. Wherever possible, the same reference numbers will be used throughout the drawings to refer to the same or like parts. As used herein and m the appended claims, the singular forms "a", "or", and "the" include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to "an antibody" includes a plurality of such antibodies or one or more antibodies and equivalents thereof known to those skilled m the art. Furthermore, all numbers expressing quantities of ingredients, reaction conditions, purity, polypeptide and polynucleotide lengths, and so forth, used in the specification, are modified by the term "about", unless otherwise indicated. Accordingly, the numeπcal parameters set forth in the specification and claims are approximations that may vary depending upon the desired properties of the present invention.
[0155] All publications, patents, patent applications, internet sites, and accession numbers/database sequences including both polynucleotide and polypeptide sequences cited herein are hereby incorporated by reference herein in their entirety for all purposes to the same extent as if each individual publication, patent, patent application, internet site, or accession number/database sequence were specifically and individually indicated to be so incorporated by reference.
EXAMPLES
Example 1: Production of DDRl Antibodies Antigen Production
[0156] A recombinant polypeptide fragment of the extracellular domain of human DDRl is generated as an antigen for antibody production. Standard recombinant DNA technology is used to isolate a polynucleotide encoding ammo acids 1-417 of DDRl (for example, nucleotide SEQ ID NO4; ammo acid SEQ ID NO: 1). This polynucleotide is ligated in-frame N-terminal to either a human Fc-tag or histidme-tag and cloned into a transfer plasmid vector for baculovirus mediated expression in insect cells. Standard transfection, infection, and cell culture protocols are used to produce recombinant insect cells expressing the corresponding DDRl polypeptide (O'Reilly et al., Baculovirus expression vectors. A Laboratory Manual, Oxford. Oxford University Press (1994)).
[0157] Cleavage of the endogenous signal sequence of human DDRl is approximated using cleavage prediction software SignalP 3.0, however the actual in vivo cleavage point can differ by a couple of ammo acids either direction. The predicated cleavage of DDRl is between ammo acids 1 and 20, thus DDRl antigen protein compπses approximately ammo acid 21 through ammo acid 417. Antigen protein is purified from insect cell conditioned medium using Protein A and Ni++-chelate affinity chromatography. Purified antigen protein is then dialyzed against PBS (pH=7), concentrated to approximately 1 mg/ml, and steπle filtered in preparation for immunization.
Immunization
[0158] Mice are immunized with purified DDRl antigen protein using standard techniques.
Blood from individual mice is screened approximately 70 days after initial immunization for antigen recognition using FACS analysis (described below). The animal with the highest antibody titer is selected for final antigen boost after which spleen cells are isolated for hybridoma production. Hybridoma cells are plated at 1 cell per well in 96 well plates, and the supernatant from each well screened by FACS analysis against antigen protein. Hybridomas with high antibody titer are selected and scaled up in static flask culture. Antibodies are purified from the hybridoma supernatant using protein A or protein G agarose chromatography. Purified monoclonal antibodies are again tested by FACS and are isotyped to select for IgG antibodies.
FACS Analysis
[0159] To select monoclonal antibodies produced by hybridoma clones that recognize native cell-surface DDRl protein, FACs analysis can be used. HEK293 cells are co-transfected with expression vectors encoding a full-length cDNA clone of DDRl and the transfection marker GFP. Twenty-four to forty-eight hours post-transfection, cells are collected in suspension and incubated on ice with anti-DDRl antibodies or control IgG to detect background antibody binding. The cells are washed and primary antibodies detected with anti-mouse secondary antibodies conjugated to a fluorescent chromophore. Labeled cells are then sorted by FACS to identify anti-DDRl antibodies that specifically recognize cell surface expression of native cell-surface DDRl protein.
Epitope Mapping
[0160] To identify antibodies that recognize specific regions of the DDRl extracellular domain, epitope mapping can be performed. Mammalian expression plasmid vectors comprising a CMV promoter upstream of polynucleotides encoding a series of deletion fragments of the extracellular domain of DDRl fused to Fc protein can be generated using standard recombinant DNA technology. These recombinant fusion proteins can be expressed in transiently transfected HEK 293 cells from which conditioned medium is collected twenty-four to forty-eight hours post-transfection for ELISA. The Fc fusion proteins in the conditioned media are bound to an ELISA plate coated with anti-human Fc (gamma chain specific), which are then incubated with a DDRl antibody or a control monoclonal antibody. After washing, the bound antibodies are probed with HRP conjugated anti-mouse antibody. To verify equivalent binding of the various DDRl Fc fusion proteins, the ELISA plate are also probed with HRP conjugated anti-human Fc antibodies. Bound HRP concentrations are determined at A450Hm using an ELISA substrate. [0161] The SPOTs system (Sigma Genosys, The Woodlands, TX) can also be used to identify specific epitopes within the extracellular domains recognized by an antibody against DDRl . In this method, a series of 10-residue linear peptides overlapping by one amino acid and covering the entire DDRl extracellular domain are synthesized and covalently bound to a cellulose membrane by the SPOT synthesis technique. The membrane is pre-incubated for 8 hours at room temperature with blocking buffer and hybridized with antibody overnight at 40C. The membrane is then washed, incubated with a secondary antibody conjugated to horseradish peroxidase (HRP) (GE Healthcare Life Sciences/ Amersham Bioscience, Piscataway, NJ), re-washed, and visualized with signal development solution containing 3- amino-9-ethylcarbazole. Specific epitopes recognized by an antibody are thus determined.
Chimeric Antibodies
[0162] After monoclonal antibodies that specifically recognize human DDRl are identified, these antibodies can be modified to overcome the human anti-mouse antibody (HAMA) immune response when rodent antibodies are used as therapeutic agents. The variable regions of the heavy-chain and light-chain of the selected monoclonal antibody are isolated by RT-PCR from hybridoma cells and ligated in-frame to human IgGi heavy-chain and kappa light chain constant regions, respectively, in mammalian expression vectors. Alternatively a human Ig expression vector such as TCAE 5.3 is used that contains the human IgGi heavy-chain and kappa light-chain constant region genes on the same plasmid (Preston et al., 1998, Infection & Immunity 66:4137-42). Expression vectors encoding chimeric heavy- and light-chains are then co-transfected into Chinese hamster ovary (CHO) cells for chimeric antibody production. Immunoreactivity and affinity of chimeric antibodies are compared to parental murine antibodies by ELISA and FACS.
Humanized Antibodies
[0163] As chimeric antibody therapeutics are still frequently antigenic, producing a human anti- chimeric antibody (HACA) immune response, chimeric antibodies against DDRl can undergo further humanization. To generate humanized antibodies, key aspects of the specificity determining motifs of the antibody, potentially including elements from both the three short hypervariable sequences, or complementary determining regions (CDRs), and/or the framework regions required to correctly position the CDR regions of the antibody heavy- and light-chain variable domains described above are engineered using recombinant DNA technology into the germline DNA sequences of human heavy- and light-chain antibody genes, respectively, and then cloned into a mammalian expression vector for expression in CHO cells. The immunoreactivity and affinity of the humanized antibodies are compared to parental chimeric antibodies by ELISA and FACS. Additionally, site-directed or high-density mutagenesis of the variable region can be used to optimize specificity, affinity, etc. of the humanized antibody.
Human Antibodies
[0164] In some embodiments, human antibodies that specifically recognize the extracellular domain of DDRl can be isolated using phage display technology. A phage display antibody library containing human antibody variable domains displayed as single chain Fv or as Fab domains is screened for specific and high affinity recognition of the DDRl antigen described above or, for example, the DDRl-Fc fusion of SEQ ID NO:8. The identified variable domain antibody sequences are then reformatted into an Ig expression vector containing human IgG1 heavy-chain and kappa light-chain for expression of human antibodies in CHO cells.
Example 2: In Vitro Cytotoxicity Assays to Evaluate Antibodies against DDRl
[0165] This example describes representative in vitro assays to test the activity of antibodies generated against DDRl on cytotoxicity.
Complement-dependent Cytotoxicity Assay
[0166] In certain embodiments, cancer cell lines expressing DDRl or cancer stem cells isolated from a patient sample passaged as a xenograft in immunocompromised mice (described in detail below) can be used to measure complement-dependent cytotoxicity (CDC) mediated by an antibody against DDRl. Cells (106 cells/ml) are suspended in 200 μl RPMI 1640 culture medium supplemented with antibiotics and 5% FBS. Suspended cells are mixed with antibodies against DDRl or control antibodies in triplicate and incubated for 1 to 4 hours at 370C in 5% CO2. Treated cells are then collected, resuspended in 100 μl FITC -labeled annexin V diluted in culture medium, and incubated at room temperature for 10 minutes. One hundred microliters of propidium iodide solution (25 μg/ml) diluted in HBSS is added and incubated for 5 minutes at room temperature. Cells are collected, resuspended in culture medium, and analyzed by flow cytometry. Flow cytometry of FITC stained cells provides total cell counts, and propidium iodide uptake by dead cells as a percentage of total cell numbers is used to measure cell death in the presence of antibodies against DDRl compared to control antibodies. The ability of anti-DDRl antibodies to mediate complement-dependent cytotoxicity is thus determined.
Antibody-dependent Cellular Cytotoxicity Assay
[0167] In certain embodiments, cancer cell lines expressing DDRl or cancer stem cells isolated from a patient's sample passaged as a xenograft in immunocompromised mice (described in detail below) can be used to measure antibody-dependent cellular cytotoxicity (ADCC) mediated by an antibody against DDRl. Cells (106 cells/ml) are suspended in 200 μl phenol red-free RPMI 1640 culture medium supplemented with antibiotics and 5% FBS. Peripheral blood mononuclear cells (PBMCs) are isolated from heparinized peripheral blood by Ficoll-Paque™ density gradient centrifugation for use as effector cells. Target cells (T) are then mixed with PBMCeffector cells (E) at E/T ratios of 25 : 1 , 10: 1 , and 5 : 1 in 96-well plates in the presence of DDRl antibody or a control antibody. Controls include incubation of target cells alone and effector cells alone in the presence of antibody. Cell mixtures are incubated for 1 to 6 hours at 370C in 5% CO2. Released lactate dehydrogenase (LDH), a stable cytosolic enzyme released upon cell lysis, is then measured by a colorimetric assay (CytoTox96 Non-radioactive Cytotoxicity Assay; Promega; Madison, WI). Absorbance data at 490 nm are collected with a standard 96-well plate reader and background corrected. The percentage of specific cytotoxicity is calculated according to the formula: % cytotoxicity = 100 x (experimental LDH release - effector spontaneous LDH release - target spontaneous LDH release) / (target maximal LDH release - target spontaneous LDH release). The ability of antibodies against DDRl receptor to mediated antibody-dependent cellular cytotoxicity is thus determined.
Example 3: In Vivo Prevention of Tumor Growth Using Anti-DDRl Antibodies [0168] This example describes the use of anti-DDRl antibodies to prevent tumor growth in a xenograft model. Tumor cells from a patient sample (solid tumor biopsy or pleural effusion) that have been passaged as a xenograft in mice are prepared for repassaging into experimental animals. Tumor tissue is removed under sterile conditions, cut up into small pieces, minced completely using sterile blades, and single cell suspensions are obtained by enzymatic digestion and mechanical disruption. Specifically, pleural effusion cells or the resulting tumor pieces are mixed with ultra-pure collagenase III in culture medium (200-250 units of collagenase per mL) and incubated at 370C for 3-4 hours with pipetting up and down through a 10-mL pipette every 15-20 minutes. Digested cells are filtered through a 45 μM nylon mesh, washed with RPMI/20% FBS, and washed twice with HBSS. Dissociated tumor cells are then injected subcutaneously either into the mammary fat pads, for breast tumors, or into the flank, for non-breast tumors, of NOD/SCID mice to elicit tumor growth.
[0169] In certain in vivo experiments, dissociated tumor cells are first sorted into tumorigenic and non-tumorigenic cells based on cell surface markers before injection into experimental animals. Specifically, tumor cells dissociated as described above are washed twice with HEPES-buffered saline solution (HBSS) containing 2% heat-inactivated calf serum (HICS) and resuspended at 106 cells per 100 μl. Antibodies are added and the cells incubated for 20 minutes on ice followed by two washes with HBSS/2% HICS. Antibodies include anti-ESA (Biomeda, Foster City, CA), anti-CD44, anti-CD24, and Lineage markers anti-CD2, -CD3, -CDlO, -CD16, -CD18, -CD31, -CD64, and -CD140b (collectively referred to as Lin; PharMingen, San Jose, CA). Antibodies are directly conjugated to fluorochromes to positively or negatively select cells expressing these markers. Mouse cells are eliminated by selecting against H2Kd+ cells, and dead cells are eliminated by using the viability dye 7AAD. Flow cytometry is performed on a FACSVantage (Becton Dickinson, Franklin Lakes, NJ). Side scatter and forward scatter profiles are used to eliminate cell clumps. Isolated ESA+, CD44+, CD24-/low, Lin- tumorigenic cells are then injected subcutaneously into NOD/SCID mice to elicit tumor growth. [0170] In one, non-limiting example of an in vivo experiment, anti-DDRl antibodies are analyzed for their ability to reduce the growth of PE 13 breast tumor cells. Dissociated PEl 3 cells comprising both tumorigenic and non-tumorigenic tumor cells (10,000 per animal) are injected subcutaneously into the mammary fat pads or the flank region of 6-8 week old NOD/SCID mice. Two days after tumor cell injection, animals are injected intraperitoneal (i.p.) with 10 mg/kg anti-DDRl antibodies two times per week. Tumor growth is monitored weekly until growth is detected, after which point tumor growth is measured twice weekly.
[0171] In another example, anti-DDRl antibodies are also analyzed for their ability to reduce the growth of C9 colon tumor cells. Dissociated C9 cells comprising both tumorigenic and non-tumorigenic tumor cells (10,000 per animal) are injected subcutaneously into the flank region of 6-8 week old NOD/SCID mice. Two days after tumor cell injection, animals are injected intraperitoneal (i.p.) with 10 mg/kg anti-DDRl antibodies two times per week. Tumor growth is monitored weekly until growth is detected, after which point tumor growth is measured twice weekly.
Example 4: In Vivo Prevention of Tumor Growth Using Anti-DDRl Antibodies in Combination Therapy [0172] This example describes the use of anti-DDRl antibodies to prevent tumor growth in a xenograft model in combination with chemotherapy. Tumor cells from a patient solid tumor biopsy passaged as a xenograft in mice are prepared for repassaging into experimental animals as described in detail above.
[0173] In certain embodiments, anti-DDRl antibodies are analyzed for their ability to affect breast tumor recurrence after combination therapy with a chemotherapeutic agent. Dissociated PE 13 cells (10,000 per animal) are injected subcutaneously into the mammary fat pads or the flank region of 6-8 week old NOD/SCID mice and animals are monitored for tumor growth. Once tumors reach an average size of approximately 100 mm3, treatment begins: animals are treated i.p. with 10 mg/kg of anti-DDRl antibodies or control antibodies in combination with 15 mg/kg taxol administered two times per week for a total of four weeks. Tumor growth is monitored weekly as tumor volume decreases in response to the combination therapy. After four weeks, taxol administration may be ceased while antibody treatment is maintained.
Example 5: In Vivo Treatment of Tumors Using Anti-DDRl Antibodies
[0174] This example describes the use of anti-DDRl antibodies to treat cancer in a xenograft model. In certain embodiments, tumor cells from a patient sample (solid tumor biopsy or pleural effusion) that have been passaged as a xenograft in mice can be prepared for repassaging into experimental animals. Tumor tissue is removed, cut up into small pieces, minced completely using sterile blades, and single cell suspensions obtained by enzymatic digestion and mechanical disruption. Dissociated tumor cells comprising both tumorigenic and non-tumorigenic tumor cells are then injected subcutaneously either into the mammary fat pads, for breast tumors, or into the flank, for non-breast tumors, of NOD/SCID mice to elicit tumor growth. Alternatively, ESA+, CD44+, CD24-/low, Lin- tumorigenic tumor cells are isolated as described in detail above and injected.
[0175] Following tumor cell injection, animals are monitored for tumor growth. Once tumors reach an average size of approximately 150 to 200 mm3, antibody treatment begins. Each animal receives 100 μg of DDRl antibodies or control antibodies i.p. two to five times per week for a total of 6 weeks. Tumor size is assessed twice a week during these 6 weeks. The ability of DDRl antibodies to prevent further tumor growth or to reduce tumor size compared to control antibodies is thus determined. [0176] At the end point of antibody treatment, tumors are harvested for further analysis. In some embodiments a portion of the tumor is analyzed by immunofluorescence to assess antibody penetration into the tumor and tumor response. A portion of each harvested tumor from anti-DDRl treated and control antibody treated mice is flash-frozen in liquid nitrogen, embedded in O.C.T., and cut on a cryostat as 10 μm sections onto glass slides. In some embodiments, a portion of each tumor is formalin-fixed, paraffin-embedded, and cut on a microtome as 10 μm section onto glass slides. Sections are post-fixed and incubated with chromophore-labeled antibodies that specifically recognize injected antibodies to detect anti-DDRl or control antibodies present in the tumor biopsy. Furthermore antibodies that detect different tumor and tumor-recruited cell types such as, for example, anti-VE cadherin (CD144) or anti- PECAM-I (CD31) antibodies to detect vascular endothelial cells, anti-smooth muscle alpha-actin antibodies to detect vascular smooth muscle cells, anti-Ki67 antibodies to detect proliferating cells, TUNEL assays (Negoescu et al., 1996, E. J. Histochem Cytochem. 44(9):959-68; Negoescu et al., 1998, Biomed Pharmacother. 52(6):252-8) to detect dying cells, anti-β-catenin antibodies to detect Wnt signaling, and anti-intracellular domain (ICD) Notch fragment antibodies to detect Notch signaling can be used to assess the effects of antibody treatment on, for example, angiogenesis, tumor growth, and tumor morphology.
[0177] In certain embodiments, the effect of anti-DDRl antibody treatment on tumor cell gene expression is also assessed. Total RNA is extracted from a portion of each harvested tumor from DDRl antibody treated and control antibody treated mice and used for quantitative RT-PCR. Expression levels of DDRl as well as additional cancer stem cell markers previously identified (e.g., CD44) are analyzed relative to the house-keeping gene GAPDH as an internal control. Changes in tumor cell gene expression upon DDRl antibody treatment are thus determined.
[0178] In addition, the effect of anti-DDRl antibody treatment on the presence of cancer stem cells in a tumor is assessed. Tumor samples from DDRl antibody treated versus control antibody treated mice are cut up into small pieces, minced completely using sterile blades, and single cell suspensions obtained by enzymatic digestion and mechanical disruption. Dissociated tumor cells are then analyzed by FACS analysis for the presence of tumorigenic cancer stem cells based on ESA+, CD44+, CD24-/low, Lin- surface cell marker expression as described in detail above. [0179] The tumoπgenicity of cells isolated based on ESA+, CD44+, CD24-/low, Lin- expression following anti-DDRl antibody treatment can then be assessed. ESA+, CD44+, CD24-/low, Lm- cancer stem cells isolated from DDRl antibody treated versus control antibody treated mice are re-injected subcutaneously into the mammary fat pads or flank regions of NOD/SCID mice. The tumoπgenicity of cancer stem cells based on the number of injected cells required for consistent tumor formation is then determined.
Example 6: Prevention of Metastasis with Anti-DDRl Antibodies
[0180] This example descπbes methods of treating metastasis using antibodies against DDRl .
The role of DDRl m regulation of the extracellular matrix is well-established and suggests that antibodies directed agamst DDRl may inhibit invasion and metastasis of tumor cells. Primary tumor cells or cells from a primary tumor cell line can be transplanted into NOD/SCID mice as descπbed, for example, in Wang et al., 2005, Lab. Investigation 85: 1395-1404. In certain embodiments, antibody treatment commences following detection of tumor growth of transplanted cells withm the original transplant site. Injection of 10 mg/kg anti-DDRl antibodies intraperitoneal (i.p.) two times per week continues for up to 54 weeks. The spread of tumor cells to organ systems beyond the original transplant site is monitored compared to PBS injected control animals.
Example 7: Treatment of Human Cancer Using Anti-DDRl Antibodies
[0181] This example descπbes methods for treating cancer using antibodies agamst DDRl to target tumors compnsmg cancer stem cells and/or other tumor cells in which DDRl expression has been detected. The presence of cancer stem cell marker expression can first be determined from a tumor biopsy. Tumor cells from a biopsy from a patient diagnosed with cancer are removed under steπle conditions. In some embodiments the tissue biopsy is flash-frozen m liquid nitrogen, embedded in O.C.T., and cut on a cryostat as 10 μm sections onto glass slides. In some embodiments, the tissue biopsy is formalm-fixed, paraffin-embedded, and cut on a microtome as 10 μm section onto glass slides Sections are incubated with antibodies agamst DDRl to detect protein expression. [0182] The presence of cancer stem cells can also be determined. Tissue biopsy samples are cut up into small pieces, mmced completely using steπle blades, and cells subject to enzymatic digestion and mechanical disruption to obtain a single cell suspension. Dissociated tumor cells are then incubated with anti-ESA, -CD44, -CD24, -Lm, and -DDRl antibodies to detect cancer stem cells, and the presence of ESA+, CD44+, CD24-/low, Lm-, DDRl + tumor stem cells is determined by flow cytometry as descπbed in detail above.
[0183] In certain embodiments, cancer patients whose tumors are diagnosed as expressing DDRl are treated with anti-DDRl antibodies. In certain embodiments, humanized or human monoclonal anti- DDRl antibodies generated as described above are purified and formulated with a suitable pharmaceutical vehicle for injection. In some embodiments, patients are treated with the DDRl antibodies at least once a month for at least 10 weeks. In some embodiments, patients are treated with the DDRl antibodies at least once a week for at least about 14 weeks. Each administration of the antibody should be a pharmaceutically effective dose. In some embodiments, between about 2 to about 100 mg/ml of an anti- DDRl antibody is administered. Ln some embodiments, between about 5 to about 40 mg/ml of an anti- DDRl antibody is administered. The antibody can be administered prior to, concurrently with, or after standard radiotherapy regimens or chemotherapy regimens using one or more chemotherapeutic agent, such as oxaliplatin, fluorouracil, leucovorin, or streptozocin. Patients are monitored to determine whether such treatment has resulted in an anti-tumor response, for example, based on tumor regression, reduction in the incidences of new tumors, lower tumor antigen expression, decreased numbers of cancer stem cells, or other means of evaluating disease prognosis
Example 8: Cell-Based Assay for Identification of Anti-DDRl Antibodies with Agonist or Antagonist
Properties
[0184] This example describes exemplary cell-based assays for identification of DDRl antibodies with agonist or antagonist properties.
[0185] K562 cells are transfected with pcDNA3.1 FLAG-DDRl using standard procedures.
Stable lines expressing FLAG tagged DDRl are selected with neomycin and one stable line expressing
FLAG-DDRl (SEQ ID NO:37) is selected for analyzing collagen-induced phosphorylation.
[0186] Cells are starved in serum-free medium for 36 hours. Cells are then treated with collagen to stimulate phosphorylation of DDRl. To test the antagonist properties of anti-DDRl antibodies, cells are pretreated with 5 or 50 μg/ml of the indicated antibodies, subsequently stimulated with rat tail collagen
I at a final concentration of 10 μg/ml and tyrosine phosphorylation of DDRl is assessed. To evaluate the agonist properties of the antibodies, cells are incubated with the antibodies in the absence of collagen and tyrosine phosphorylation of DDRl is assessed. At the indicated time intervals after treatments, cells are lysed in sample buffer. Proteins are separated by SDS-polyacrylamide gel electrophoresis (PAGE) and are transferred to a nitrocellulose membrane. Membranes are blocked in TBS-T (Tris-Buffered Saline plus 0.1% Tween 20) containing 5% nonfat milk. Antibodies (anti-phosphotyrosine, 4G10 clone; and anti-Flag epitope, M2 clone) are incubated for 1 h at room temperature in PBS-T with 0.5% milk. Bound primary antibodies are detected with appropriate secondary antibodies conjugated with HRP and ECL plus.
[0187] K562 cells expressing FLAG tagged DDRl are treated for 4 hours with candidate antibodies to DDRl in the absence of exogenous collagen. Treatment with antibodies that increase tyrosine phosphorylation of DDRl indicates that the antibodies have agonist properties. Stimulation of the cells with collagen type I causes an increase in tyrosine phosphorylation of DDRl. An ability of an antibody to block the stimulation of DDRl on the K562 cells in response to collagen indicates that the antibody being tested is an antagonist of DDRl . The assay is not limited to any one particular tumor cell line or type (for example, K562 cells as described above), as would be known to those skilled in the art.
Example 9: Detection of DDRl Protein Expression by Tumors
[0188] The expression of DDRl in a variety of tumor cell lines has been reported previously.
Therefore, the expression of DDRl on primary human tumor derived xenograft models was analyzed. [0189] OMP-C27 (colon tumor) and OMP-Lu4 (lung tumor) xenograft tumors were embedded in
OCT compound and frozen. 5 μm cryosections were incubated with blocking solution (PBS with 5% horse serum), followed by incubation with polyclonal mouse anti-DDRl serum diluted 1:200 in blocking solution. After multiple wash steps, murine polyclonal anti-DDRl antibodies were detected with Alexa 594 goat anti-mouse antibodies.
[0190] Using murine polyclonal antibodies to human DDRl , DDRl protein was detected on the cell surface of human tumor cells. Specifically example images of cryosections of a colon tumor model (OMP-C27) and a lung tumor model (OMP-Lu4) are shown, wherein DDRl protein could be detected (Fig. 1), whereas control antibody did not stain tumor cells in both OMP-C27 and OMP-Lu4 tumors.
Example 10: Correlation of DDRl Expression with LGR5 Expression
[0191] To study the potential function of DDRl in stem cells, we compared the expression pattern of DDRl to LGR5, a known stem cell marker in colon and intestine, using standard Pearson correlation. Within a large set of expression data from normal/malignant samples, we performed correlation analysis of expression values between DDRl and LGR5 in colon/intestine (446), breast (163), kidney (153), liver (107), lung (217), ovary (145), pancreas (85) and prostate (128) samples. The results of the expression correlation study are shown below in Table 2. The expression patterns of DDRl and LGR5 showed statistically significant positive correlation in the colon, liver, ovary and pancreas samples (in bold).
Table 2. Correlation of DDRl expression with LGR5 expression across normal and cancer samples
Figure imgf000055_0001
Correlation value > 0 signifies positive correlation Example 11: Correlation of DDRl Expression with Activation of Notch Signaling [0192] To study the potential function of DDRl m stem cells, we compared the expression pattern of DDRl to Hesl expression, a marker of Notch pathway activation, using standard Pearson correlation. Within a large set of expression data from normal/malignant samples, we performed correlation analysis of expression values between DDRl and Hesl in colon/mtestine (446), breast (163), kidney (153), liver (107), lung (217), ovary (145), pancreas (85) and prostate (128) samples. The results of the expression correlation study are shown below m Table 3. The expression patterns of DDRl and Hesl showed statistically significant positive correlation m the colon, breast, renal, lung, prostate, and pancreas samples (in bold).
Table 3. Correlation of DDRl expression with Hesl expression across normal and cancer samples
Figure imgf000056_0001
* Correlation value > 0 signifies positive correlation
Example 12: Limiting Dilution Assays to Assess the Reduction of the Number of Cancer Stem Cells [0193] Limiting dilution assays (LDA) can be used to assess the effect of a DDRl -modulating agent or antibody on solid tumor cancer stem cells and on the tumoπgenicity of a tumor comprising the cancer stem cells. The assays can be used to determine the frequency of cancer stem cells m tumors from animals treated with the DDRl -modulating antibody or other agent and to compare that frequency to the frequency of cancer stem cells in tumors from control animals.
[0194] For instance, in one non-hmitmg example of a limiting dilution assay, Cl 7 colon tumors from mice that have been treated with either control or a candidate anti-DDRl antibody at 10 mg/kg twice per week are isolated after 38 days of treatment Isolated tumors are dissociated and FACS analyzed to determine the ratio of mouse to human cells. Human cells in increasingly lower numbers are then reinjected into immunocompromised mice. For example, mice may be injected with 1000, 333, 111, or 37 isolated human tumor cells (composing both tumoπgenic and non-tumongenic tumor cells) m the πght flank region. Tumor volume is assessed twice per week. At the desired time point (e.g , day 28, 34, or 42) the percentage of mice with detectable tumors is determined in all groups injected with anti-DDRl antibody treated tumor cells and compared to the percentage of mice with detectable tumors m the controls. For example, the number of mice injected with 1000 control-treated tumor cells that have detectable tumors is determined and compared to the number of mice injected with 1000 DDRl-antibody treated tumor cells that have detectable tumors.
[0195] The stem cell frequency can be calculated using L-CaIcTM software (downloadable from www. followed by stemcell.com/search/default.asp). Briefly, based on Poisson statistics, exactly one stem cell exists among the known number of injected cells if 37% of the animals fail to develop tumors.
Example 13: Production of Monoclonal DDRl Antibodies
[0196] A recombinant polypeptide fragment of the extracellular domain of human DDRl was generated as an antigen for antibody production as described herein. Briefly, standard recombinant DNA technology was used to isolate a polynucleotide encoding amino acids 1-417 of DDRl (nucleotide SEQ ID NO:4; amino acid SEQ ID NO: 1). The polynucleotide was ligated in-frame N-terminal to either a human Fc-tag or histidine-tag and cloned into a transfer plasmid vector for baculovirus-mediated expression in insect cells. Standard transfection, infection, and cell culture protocols were used to produce recombinant insect cells expressing the corresponding DDRl polypeptide (O'Reilly et al., 1994, Baculovirus expression vectors: A Laboratory Manual, Oxford: Oxford University Press). [0197] DDRl protein was purified from insect cell conditioned medium using Protein A and
Ni++-chelate affinity chromatography as known to one skilled in the art. Purified DDRl protein was dialyzed against PBS (pH=7), concentrated to approximately 1 mg/ml, and sterile filtered in preparation for immunization.
[0198] Mice (n=3) were immunized with purified DDRl protein using standard techniques known to one skilled in the art. Blood from individual mice was screened approximately 70 days after initial immunization for antigen recognition using FACS analysis (as described herein). The animal with the highest antibody titer was selected for final antigen boost after which spleen cells were isolated for hybridoma production. Hybridoma cells were plated at 1 cell per well in 96 well plates, and the supernatant from each well screened by FACS analysis against antigen protein. Several hybridomas with high antibody titer were selected and scaled up in static flask culture. Antibodies were purified from the hybridoma supernatant using protein A or protein G agarose chromatography. Purified monoclonal antibodies were again tested by FACS and were isotyped to select for IgG antibodies. [0199] To select monoclonal antibodies produced by hybridoma clones that recognize native cell-surface DDRl protein, FACS analysis was used. HEK293 cells were co-transfected with expression vectors encoding a full-length cDNA clone of DDRl and the transfection marker GFP. Twenty-four to forty-eight hours post-transfection, cells were collected in suspension and incubated on ice with anti- DDRl antibodies or control IgGl to detect background antibody binding. The cells were washed and primary antibodies bound to the DDRl -expressing cells were detected with anti-mouse secondary antibodies conjugated to a fluorescent chromophore. Labeled cells were then sorted by FACS to identify anti-DDRl antibodies that specifically recognize cell surface expression of native cell-surface DDRl protein. Two monoclonal antibodies that recognize and bind to DDRl were identified, antibodies 20M102 and 20M104 (Fig. 2). A hybridoma expressing antibody 20M102, was deposited with American Type Culture Collection (ATCC), 10801 University Blvd., Manassas, VA, USA, under the conditions of the Budapest Treaty on May 21, 2009, and assigned deposit number PTA- 10051.
Example 14: DDRl Variants for Screening of Antibodies
[0200] DDRl variants containing point mutations in the extracellular domain were produced by methods known to one of skill in the art. For example, site-directed mutagenesis of DDR2 has been done to study collagen binding sites (Ichikawa et al., 2007, EMBOJ. 26:4168-4176). Briefly, site-directed mutagenesis was performed following the Stratagene QuikChange protocol and using pcDNA DDRl- FLAG as the wild-type template plasmid DNA. Specifically, the following mutations were generated in the extracellular domain of DDRl: W53A, D68A, R105A, Ll 1OA, El 13Q, and S175A (using numbering based upon SEQ ID NO:2).
[0201] Full length cDNA encoding FLAG-tagged human DDRl variants were transiently transfected into HEK293 cells using standard procedures as known to one skilled in the art. To determine the capacity of antibodies to bind the DDRl variants, antibodies were incubated with HEK293 cells transfected with plasmid encoding either wild type DDRl or one of the point mutation variants. All cells were co-transfected with plasmid encoding GFP. The cells were analyzed by FACS as described herein for binding of the antibodies to wild type DDRl and to DDRl variants.
[0202] As shown in Figure 3 A, antibodies 2OM 102 and 2OM 104 did not bind, or bound at substantially reduced levels, to the W53 A DDRl variant as compared to wild-type DDRl . There was no apparent reduction in binding to any of the other DDRl mutants (Figure 3 A and 3B). The data demonstrated that the tryptophan (W) residue at position 53 is important for binding of antibodies 20M102 and 20M104 to DDRl .
Example 15: Analysis of Anti-DDRl Antibodies for Agonist or Antagonist Properties
[0203] Full length cDNA encoding FLAG-tagged human DDRl (nucleotide SEQ ID NO:36; amino acid SEQ ID NO:37) in pcDNA3.1 vector was transfected into HEK293 cells using standard procedures as known to one skilled in the art. 48 hours after transfection neomycin was added to the culture medium at a concentration of 2 mg/ml. After 10 days under selection conditions, single cell clones were expanded and assessed for cell surface expression of DDRl by FACS as described herein.
Clones expressing FLAG-tagged DDRl were identified and expanded for use in assays.
[0204] HEK293-DDR1 expressing cells were plated in 12 well plates, grown for 48 hours in
DMEM with 10% serum, then serum starved for 36 hours. Cells were pre-incubated with anti-DDRl antibodies at concentrations of 1, 5 and 50 μg/ml for 15 min, and subsequently incubated in the presence or absence of rat tail collagen type I (30 μg/ml) for 3 hours.
[0205] Western blot analysis was used to evaluate the tyrosine phosphorylation status of DDRl after treatment. Cells were lysed in 1 ml of ice-cold lysis buffer (20 mM Tris-Cl pH7.5, 150 mM NaCl, 1 mM EDTA, 1 mM EGTA, 1% Triton, 2.5 mM sodium pyrophosphate, 1 mM beta-glycerophosphate, 1 mM sodium orthovanadate, 1 μg/ml leupeptin). Lysates were centrifuged for 5 min at 20,00Og to clear cellular debris from the supernatant. For immunoprecipitations, 20 μl of agarose beads conjugated to anti- FLAG M2 antibody were mixed with supernatants and incubated for 2 hours on a rotator. The agarose beads were washed twice with lysis buffer, followed by resuspension in denaturing sample buffer. Proteins were separated by SDS-polyacrylamide gel electrophoresis (SDS-PAGE) and transferred to nitrocelluose membranes. Membranes were blocked in TBS-T (Tris-Buffered Saline plus 0.1% Tween 20) containing 5% nonfat milk for approximately 1 hour. The membranes were washed, and then incubated with primary antibodies (anti-phosphotyrosine, 4G10 clone, and anti-FLAG epitope, M2 clone) for 1 hour at room temperature in PBS-T with 0.5% milk. Bound primary antibodies were detected with appropriate secondary antibodies conjugated with HRP and visualized using an ECL Plus Western Blotting Detection System (GE Healthcare Life Sciences/Amersham Bioscience, Piscataway, NJ). [0206] It is known that DDRl -expressing cells respond to treatment with collagen by increased phosphorylation of DDRl on tyrosine residues. As shown in Figure 4, the addition of antibody 2OM 102 in the presence of collagen inhibited the phosphorylation of DDRl in a dose-dependent manner (see lanes 7-9). In contrast, the addition of 20M104 in the presence of collagen did not block the phosphorylation of DDRl (see lanes 13-15). Detection of total DDRl protein with anti-FLAG antibody revealed equivalent amounts of DDRl protein among various treatment conditions. The data demonstrated that 20M102 acted as an antagonist of collagen-induced phosphorylation of DDRl in HEK293 cells. Finally, the addition of antibodies 2OM 102 or 2OM 104 in the absence of collagen did not alter the phosphorylation of DDRl demonstrating that neither antibody displayed agonist properties in the HEK293 cells (see lanes 4-6, 20M102 and lanes 10-12, 20M104). The antagonist/agonist properties of antibodies 20M102 and 2OM 104 may be cell type dependent. For example, 2OM 102 demonstrated different properties in a phosphorylation assay in a different cell line.
Example 16: Detection of DDRl Protein Expression in OMP-C37 Tumor Cells
[0207] Immunoflouroscence staining was performed on sections of tumor samples. Colon tumor
OMP-C37 xenografts were embedded in OCT compound and frozen. 5 μm cryosections were incubated with blocking solution (PBS with 2% bovine serum albumin). The cryosections were then incubated with primary anti-DDRl antibody 20M102 or an anti-trinitrophenol (hapten) antibody as control antibody. Both antibodies were diluted in PBS with 2% bovine serum albumin to a concentration of 5μg/ml. After multiple wash steps, bound antibodies were detected with Alexa 594-labeled goat anti-mouse secondary antibody. Nuclei were stained with DAPI by standard methods.
[0208] Figure 5 shows representative images of cryosections of colon tumor OMP-C37, demonstrating that the DDRl protein was detected with 2OM 102 antibody. Immunofluorescence (light gray in image) showed the localization of DDRl protein in the OMP-037 colon tumor (Fig. 5A), while there was no detectable immunofluorescence in the sample stained with control antibody (Fig. 5B). Fig. 5C and 5D are representative images of nuclear staining of cryosections stained with DAPI.
Example 17: Inhibition of Tumor Growth in vivo by 2OM 102 Antibody
[0209] Anti-DDRl antibodies were analyzed in combination with chemotherapy for the ability to reduce growth of OMP-C37 colon tumor cells in vivo. Dissociated human OMP-C37 cells (10,000 per animal) were injected subcutaneously into the right flank region of 6-8 week old NOD/SCID mice. Tumor growth was monitored and tumor measurements were initiated once tumors were palpable. 46 days after cell injection, tumors were measured to be an average volume of 139 mm3, and treatments were commenced. Animals were treated with anti-DDRl 20M102 antibody with or without concurrent treatment with chemotherapy agent irinotecan. Groups of 10 animals each were injected intraperitoneally (i.p.) with 10 mg/kg 20M102 antibody or control antibody two times per week for the duration of the experiment. Animals receiving combination therapy were administered irinotecan one time per week (15mg/kg in saline). Tumor growth was monitored weekly for a total of 7 weeks. [0210] NOD/SCID mice with established OMP-C37 tumors were treated with either control antibody, 2OM 102 antibody, irinotecan, or a combination of 2OM 102 and irinotecan. As shown in Figure 6, treatment with 2OM 102 antibody (squares) alone did not significantly reduce tumor volume as compared to control treated animals (diamonds). However, the combination treatment of 2OM 102 and irinotecan (circles) reduced the growth of OMP-C37 colon tumors by 44% as compared to irinotecan treatment alone (p = 0.01). This experiment showed that anti-DDRl antibody, 20M102, has anti-tumor growth activity in OMP-037 colon tumor model in combination with the chemotherapeutic agent irinotecan.
[0211] Other embodiments of the invention will be apparent to those skilled in the art from consideration of the specification and practice of the invention disclosed herein. It is intended that the specification and examples be considered as exemplary only, with a true scope and spirit of the invention being indicated by the following claims.
[0212] All documents, e.g., scientific publications, patents, patent applications and patent publications, recited herein are hereby incorporated by reference in their entirety to the same extent as if each individual document was specifically and individually indicated to be incorporated by reference in its entirety. Where the document cited only provides the first page of the document, the entire document is intended, including the remaining pages of the document.
SEQUENCES
DDRl immunized fragment amino acid sequence (SEQ ED NO:1)
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR HSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRL RYSRDGRRWMGWKDRWGQEVISGNEDPEGWLKDLGPPMVARLVRFYPRADRVMSVCLRV ELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGWGLDD FRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGG VECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFS EISFISDWNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTA
DDRl transcript A full length amino acid sequence (SEQ DD NO: 2)
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR HSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRL RYSRDGRRWMGWKDRWGQEVISGNEDPEGWLKDLGPPMVARLVRFYPRADRVMSVCLRV ELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGWGLDD FRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGG VECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFS EISFISDWNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPRE PPPYQEPRPRGNPPHSAPCVPNGSAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTL QGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVS LDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNI IRLLGVCVQDDPL CMITDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYL ATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILM GKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACP QGLYELMLRCWSRESEQRPPFSQLHRFLAEDALNTV
Human DDR2 full length amino acid sequence (SEQ ED NO:3)
MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKY GRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKI NYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRV ELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDGAVGYSMTEGLGQLTDGVSGLD DFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFK EVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFS EITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRILIGCLVAIIFILLAIIVIIL WRQFWQKMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQGSNSTYDRIFPLRPD YQEPSRLIRKLPEFAPGEEESGCSGWKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSV PAVTMDLLSGKDVAVEEFPRKLLTFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSAN QPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIHLLSVCITDDPLCMITEYMENG DLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGK NYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWET FTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRP SFQEIHLLLLQQGDE
DDRl immunized fragment nucleotide sequence (SEQ ID NO:4)
ATGGGACCAGAGGCCCTGTCATCTTTACTGCTGCTGCTCTTGGTGGCAAGTGGAGATGCT GACATGAAGGGACATTTTGATCCTGCCAAGTGCCGCTATGCCCTGGGCATGCAGGACCGG ACCATCCCAGACAGTGACATCTCTGCTTCCAGCTCCTGGTCAGATTCCACTGCCGCCCGC CACAGCAGGTTGGAGAGCAGTGACGGGGATGGGGCCTGGTGCCCCGCAGGGTCGGTGTTT CCCAAGGAGGAGGAGTACTTGCAGGTGGATCTACAACGACTGCACCTGGTGGCTCTGGTG GGCACCCAGGGACGGCATGCCGGGGGCCTGGGCAAGGAGTTCTCCCGGAGCTACCGGCTG CGTTACTCCCGGGATGGTCGCCGCTGGATGGGCTGGAAGGACCGCTGGGGTCAGGAGGTG ATCTCAGGCAATGAGGACCCTGAGGGAGTGGTGCTGAAGGACCTTGGGCCCCCCATGGTT GCCCGACTGGTTCGCTTCTACCCCCGGGCTGACCGGGTCATGAGCGTCTGTCTGCGGGTA GAGCTCTATGGCTGCCTCTGGAGGGATGGACTCCTGTCTTACACTGCCCCTGTGGGGCAG ACAATGTATTTATCTGAGGCCGTGTACCTCAACGACTCCACCTATGACGGACATACCGTG GGCGGACTGCAGTATGGGGGTCTGGGCCAGCTGGCAGATGGTGTGGTGGGGCTGGATGAC TTTAGGAAGAGTCAGGAGCTGCGGGTCTGGCCAGGCTATGACTATGTGGGATGGAGCAAC CACAGCTTCTCCAGTGGCTATGTGGAGATGGAGTTTGAGTTTGACCGGCTGAGGGCCTTC CAGGCTATGCAGGTCCACTGTAACAACATGCACACGCTGGGAGCCCGTCTGCCTGGCGGG GTGGAATGTCGCTTCCGGCGTGGCCCTGCCATGGCCTGGGAGGGGGAGCCCATGCGCCAC AACCTAGGGGGCAACCTGGGGGACCCCAGAGCCCGGGCTGTCTCAGTGCCCCTTGGCGGC CGTGTGGCTCGCTTTCTGCAGTGCCGCTTCCTCTTTGCGGGGCCCTGGTTACTCTTCAGC GAAATCTCCTTCATCTCTGATGTGGTGAACAATTCCTCTCCGGCACTGGGAGGCACCTTC CCGCCAGCCCCCTGGTGGCCGCCTGGCCCACCTCCCACCAACTTCAGCAGCTTGGAGCTG GAGCCCAGAGGCCAGCAGCCCGTGGCCAAGGCCGAGGGGAGCCCGACCGCCGG
DDRl transcript A nucleotide sequence (SEQ ID NO:5)
ATGGGACCAGAGGCCCTGTCATCTTTACTGCTGCTGCTCTTGGTGGCAAGTGGAGATGCT GACATGAAGGGACATTTTGATCCTGCCAAGTGCCGCTATGCCCTGGGCATGCAGGACCGG ACCATCCCAGACAGTGACATCTCTGCTTCCAGCTCCTGGTCAGATTCCACTGCCGCCCGC CACAGCAGGTTGGAGAGCAGTGACGGGGATGGGGCCTGGTGCCCCGCAGGGTCGGTGTTT
CCCAAGGAGGAGGAGTACTTGCAGGTGGATCTACAACGACTGCACCTGGTGGCTCTGGTG
GGCACCCAGGGACGGCATGCCGGGGGCCTGGGCAAGGAGTTCTCCCGGAGCTACCGGCTG
CGTTACTCCCGGGATGGTCGCCGCTGGATGGGCTGGAAGGACCGCTGGGGTCAGGAGGTG
ATCTCAGGCAATGAGGACCCTGAGGGAGTGGTGCTGAAGGACCTTGGGCCCCCCATGGTT
GCCCGACTGGTTCGCTTCTACCCCCGGGCTGACCGGGTCATGAGCGTCTGTCTGCGGGTA
GAGCTCTATGGCTGCCTCTGGAGGGATGGACTCCTGTCTTACACTGCCCCTGTGGGGCAG
ACAATGTATTTATCTGAGGCCGTGTACCTCAACGACTCCACCTATGACGGACATACCGTG
GGCGGACTGCAGTATGGGGGTCTGGGCCAGCTGGCAGATGGTGTGGTGGGGCTGGATGAC
TTTAGGAAGAGTCAGGAGCTGCGGGTCTGGCCAGGCTATGACTATGTGGGATGGAGCAAC
CACAGCTTCTCCAGTGGCTATGTGGAGATGGAGTTTGAGTTTGACCGGCTGAGGGCCTTC
CAGGCTATGCAGGTCCACTGTAACAACATGCACACGCTGGGAGCCCGTCTGCCTGGCGGG
GTGGAATGTCGCTTCCGGCGTGGCCCTGCCATGGCCTGGGAGGGGGAGCCCATGCGCCAC
AACCTAGGGGGCAACCTGGGGGACCCCAGAGCCCGGGCTGTCTCAGTGCCCCTTGGCGGC
CGTGTGGCTCGCTTTCTGCAGTGCCGCTTCCTCTTTGCGGGGCCCTGGTTACTCTTCAGC
GAAATCTCCTTCATCTCTGATGTGGTGAACAATTCCTCTCCGGCACTGGGAGGCACCTTC
CCGCCAGCCCCCTGGTGGCCGCCTGGCCCACCTCCCACCAACTTCAGCAGCTTGGAGCTG
GAGCCCAGAGGCCAGCAGCCCGTGGCCAAGGCCGAGGGGAGCCCGACCGCCATCCTCATC
GGCTGCCTGGTGGCCATCATCCTGCTCCTGCTGCTCATCATTGCCCTCATGCTCTGGCGG
CTGCACTGGCGCAGGCTCCTCAGCAAGGCTGAACGGAGGGTGTTGGAAGAGGAGCTGACG
GTTCACCTCTCTGTCCCTGGGGACACTATCCTCATCAACAACCGCCCAGGTCCTAGAGAG
CCACCCCCGTACCAGGAGCCCCGGCCTCGTGGGAATCCGCCCCACTCCGCTCCCTGTGTC
CCCAATGGCTCTGCCTACAGTGGGGACTATATGGAGCCTGAGAAGCCAGGCGCCCCGCTT
CTGCCCCCACCTCCCCAGAACAGCGTCCCCCATTATGCCGAGGCTGACATTGTTACCCTG
CAGGGCGTCACCGGGGGCAACACCTATGCTGTGCCTGCACTGCCCCCAGGGGCAGTCGGG
GATGGGCCCCCCAGAGTGGATTTCCCTCGATCTCGACTCCGCTTCAAGGAGAAGCTTGGC
GAGGGCCAGTTTGGGGAGGTGCACCTGTGTGAGGTCGACAGCCCTCAAGATCTGGTTAGT
CTTGATTTCCCCCTTAATGTGCGTAAGGGACACCCTTTGCTGGTAGCTGTCAAGATCTTA
CGGCCAGATGCCACCAAGAATGCCAGGAATGATTTCCTGAAAGAGGTGAAGATCATGTCG
AGGCTCAAGGACCCAAACATCATTCGGCTGCTGGGCGTGTGTGTGCAGGACGACCCCCTC
TGCATGATTACTGACTACATGGAGAACGGCGACCTCAACCAGTTCCTCAGTGCCCACCAG
CTGGAGGACAAGGCAGCCGAGGGGGCCCCTGGGGACGGGCAGGCTGCGCAGGGGCCCACC
ATCAGCTACCCAATGCTGCTGCATGTGGCAGCCCAGATCGCCTCCGGCATGCGCTATCTG
GCCACACTCAACTTTGTACATCGGGACCTGGCCACGCGGAACTGCCTAGTTGGGGAAAAT
TTCACCATCAAAATCGCAGACTTTGGCATGAGCCGGAACCTCTATGCTGGGGACTATTAC
CGTGTGCAGGGCCGGGCAGTGCTGCCCATCCGCTGGATGGCCTGGGAGTGCATCCTCATG GGGAAGTTCACGACTGCGAGTGACGTGTGGGCCTTTGGTGTGACCCTGTGGGAGGTGCTG ATGCTCTGTAGGGCCCAGCCCTTTGGGCAGCTCACCGACGAGCAGGTCATCGAGAACGCG GGGGAGTTCTTCCGGGACCAGGGCCGGCAGGTGTACCTGTCCCGGCCGCCTGCCTGCCCG CAGGGCCTATATGAGCTGATGCTTCGGTGCTGGAGCCGGGAGTCTGAGCAGCGACCACCC TTTTCCCAGCTGCATCGGTTCCTGGCAGAGGATGCACTCAACACGGTGTGA
DDR2 full length nucleotide sequence (SEQ ID NO:6)
ATGATCCTGATTCCCAGAATGCTCTTGGTGCTGTTCCTGCTGCTGCCTATCTTGAGTTCT GCAAAAGCTCAGGTTAATCCAGCTATATGCCGCTATCCTCTGGGCATGTCAGGAGGCCAG ATTCCAGATGAGGACATCACAGCTTCCAGTCAGTGGTCAGAGTCCACAGCTGCCAAATAT GGAAGGCTGGACTCAGAAGAAGGGGATGGAGCCTGGTGCCCTGAGATTCCAGTGGAACCT GATGACCTGAAGGAGTTTCTGCAGATTGACTTGCACACCCTCCATTTTATCACTCTGGTG GGGACCCAGGGGCGCCATGCAGGAGGTCATGGCATCGAGTTTGCCCCCATGTACAAGATC AATTACAGTCGGGATGGCACTCGCTGGATCTCTTGGCGGAACCGTCATGGGAAACAGGTG CTGGATGGAAATAGTAACCCCTATGACATTTTCCTAAAGGACTTGGAGCCGCCCATTGTA GCCAGATTTGTCCGGTTCATTCCAGTCACCGACCACTCCATGAATGTGTGTATGAGAGTG GAGCTTTACGGCTGTGTCTGGCTAGATGGCTTGGTGTCTTACAATGCTCCAGCTGGGCAG CAGTTTGTACTCCCTGGAGGTTCCATCATTTATCTGAATGATTCTGTCTATGATGGAGCT GTTGGATACAGCATGACAGAAGGGCTAGGCCAATTGACCGATGGTGTGTCTGGCCTGGAC GATTTCACCCAGACCCATGAATACCACGTGTGGCCCGGCTATGACTATGTGGGCTGGCGG AACGAGAGTGCCACCAATGGCTACATTGAGATCATGTTTGAATTTGACCGCATCAGGAAT TTCACTACCATGAAGGTCCACTGCAACAACATGTTTGCTAAAGGTGTGAAGATCTTTAAG GAGGTACAGTGCTACTTCCGCTCTGAAGCCAGTGAGTGGGAACCTAATGCCATTTCCTTC CCCCTTGTCCTGGATGACGTCAACCCCAGTGCTCGGTTTGTCACGGTGCCTCTCCACCAC CGAATGGCCAGTGCCATCAAGTGTCAATACCATTTTGCAGATACCTGGATGATGTTCAGT GAGATCACCTTCCAATCAGATGCTGCAATGTACAACAACTCTGAAGCCCTGCCCACCTCT CCTATGGCACCCACAACCTATGATCCAATGCTTAAAGTTGATGACAGCAACACTCGGATC CTGATTGGCTGCTTGGTGGCCATCATCTTTATCCTCCTGGCCATCATTGTCATCATCCTC TGGAGGCAGTTCTGGCAGAAAATGCTGGAGAAGGCTTCTCGGAGGATGCTGGATGATGAA ATGACAGTCAGCCTTTCCCTGCCAAGTGATTCTAGCATGTTCAACAATAACCGCTCCTCA TCACCTAGTGAACAAGGGTCCAACTCGACTTACGATCGCATCTTTCCCCTTCGCCCTGAC TACCAGGAGCCATCCAGGCTGATACGAAAACTCCCAGAATTTGCTCCAGGGGAGGAGGAG TCAGGCTGCAGCGGTGTTGTGAAGCCAGTCCAGCCCAGTGGCCCTGAGGGGGTGCCCCAC TATGCAGAGGCTGACATAGTGAACCTCCAAGGAGTGACAGGAGGCAACACATACTCAGTG CCTGCCGTCACCATGGACCTGCTCTCAGGAAAAGATGTGGCTGTGGAGGAGTTCCCCAGG AAACTCCTAACTTTCAAAGAGAAGCTGGGAGAAGGACAGTTTGGGGAGGTTCATCTCTGT GAAGTGGAGGGAATGGAAAAATTCAAAGACAAAGATTTTGCCCTAGATGTCAGTGCCAAC CAGCCTGTCCTGGTGGCTGTGAAAATGCTCCGAGCAGATGCCAACAAGAATGCCAGGAAT GATTTTCTTAAGGAGATAAAGATCATGTCTCGGCTCAAGGACCCAAACATCATCCATCTA TTATCTGTGTGTATCACTGATGACCCTCTCTGTATGATCACTGAATACATGGAGAATGGA GATCTCAATCAGTTTCTTTCCCGCCACGAGCCCCCTAATTCTTCCTCCAGCGATGTACGC ACTGTCAGTTACACCAATCTGAAGTTTATGGCTACCCAAATTGCCTCTGGCATGAAGTAC CTTTCCTCTCTTAATTTTGTTCACCGAGATCTGGCCACACGAAACTGTTTAGTGGGTAAG AACTACACAATCAAGATAGCTGACTTTGGAATGAGCAGGAACCTGTACAGTGGTGACTAT TACCGGATCCAGGGCCGGGCAGTGCTCCCTATCCGCTGGATGTCTTGGGAGAGTATCTTG CTGGGCAAGTTCACTACAGCAAGTGATGTGTGGGCCTTTGGGGTTACTTTGTGGGAGACT TTCACCTTTTGTCAAGAACAGCCCTATTCCCAGCTGTCAGATGAACAGGTTATTGAGAAT ACTGGAGAGTTCTTCCGAGACCAAGGGAGGCAGACTTACCTCCCTCAACCAGCCATTTGT CCTGACTCTGTGTATAAGCTGATGCTCAGCTGCTGGAGAAGAGATACGAAGAACCGTCCC TCATTCCAAGAAATCCACCTTCTGCTCCTTCAACAAGGCGACGAGTGA
Nucleotide sequence ofDDRl-Fc (SEQ ID NO:7)
ATGGGACCAGAGGCCCTGTCATCTTTACTGCTGCTGCTCTTGGTGGCAAGTGGAGATGCT GACATGAAGGGACATTTTGATCCTGCCAAGTGCCGCTATGCCCTGGGCATGCAGGACCGG ACCATCCCAGACAGTGACATCTCTGCTTCCAGCTCCTGGTCAGATTCCACTGCCGCCCGC CACAGCAGGTTGGAGAGCAGTGACGGGGATGGGGCCTGGTGCCCCGCAGGGTCGGTGTTT CCCAAGGAGGAGGAGTACTTGCAGGTGGATCTACAACGACTGCACCTGGTGGCTCTGGTG GGCACCCAGGGACGGCATGCCGGGGGCCTGGGCAAGGAGTTCTCCCGGAGCTACCGGCTG CGTTACTCCCGGGATGGTCGCCGCTGGATGGGCTGGAAGGACCGCTGGGGTCAGGAGGTG ATCTCAGGCAATGAGGACCCTGAGGGAGTGGTGCTGAAGGACCTTGGGCCCCCCATGGTT GCCCGACTGGTTCGCTTCTACCCCCGGGCTGACCGGGTCATGAGCGTCTGTCTGCGGGTA GAGCTCTATGGCTGCCTCTGGAGGGATGGACTCCTGTCTTACACTGCCCCTGTGGGGCAG ACAATGTATTTATCTGAGGCCGTGTACCTCAACGACTCCACCTATGACGGACATACCGTG GGCGGACTGCAGTATGGGGGTCTGGGCCAGCTGGCAGATGGTGTGGTGGGGCTGGATGAC TTTAGGAAGAGTCAGGAGCTGCGGGTCTGGCCAGGCTATGACTATGTGGGATGGAGCAAC CACAGCTTCTCCAGTGGCTATGTGGAGATGGAGTTTGAGTTTGACCGGCTGAGGGCCTTC CAGGCTATGCAGGTCCACTGTAACAACATGCACACGCTGGGAGCCCGTCTGCCTGGCGGG GTGGAATGTCGCTTCCGGCGTGGCCCTGCCATGGCCTGGGAGGGGGAGCCCATGCGCCAC AACCTAGGGGGCAACCTGGGGGACCCCAGAGCCCGGGCTGTCTCAGTGCCCCTTGGCGGC CGTGTGGCTCGCTTTCTGCAGTGCCGCTTCCTCTTTGCGGGGCCCTGGTTACTCTTCAGC GAAATCTCCTTCATCTCTGATGTGGTGAACAATTCCTCTCCGGCACTGGGAGGCACCTTC CCGCCAGCCCCCTGGTGGCCGCCTGGCCCACCTCCCACCAACTTCAGCAGCTTGGAGCTG GAGCCCAGAGGCCAGCAGCCCGTGGCCAAGGCCGAGGGGAGCCCGACCGCCGGGCGCGCC GACAAAACTCACACATGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTC TTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACA TGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGAC GGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTAC CGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAG TGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAGCCAAA GGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAG AACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAG TGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCC GACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGG AACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACACAGAAGAGC CTCTCCCTGTCTCCGGGTAAA
Protein sequence of DDRl-Fc (SEQ ID NO:8)
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR HSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRL RYSRDGRRWMGWKDRWGQEVISGNEDPEGWLKDLGPPMVARLVRFYPRADRVMSVCLRV ELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGWGLDD FRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGG VECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFS EISFISDWNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAGRA DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Human DDRIa full length amino acid sequence (SEQ ID NO: 9)
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR HSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRL RYSRDGRRWMGWKDRWGQEVISGNEDPEGWLKDLGPPMVARLVRFYPRADRVMSVCLRV ELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGWGLDD FRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGG VECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFS EISFISDWNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPRE PPPYQEPRPRGNPPHSAPCVPNGSAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTL QGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCΞVDSPQDLVS LDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPL CMITDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYL
ATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILM GKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACP QGLYELMLRCWSRESEQRPPFSQLHRFLAEDALNTV
Human DDRIa full length nucleotide sequence (SEQ ID NO: 10)
ATGGGACCAGAGGCCCTGTCATCTTTACTGCTGCTGCTCTTGGTGGCAAGTGGAGATGCT GACATGAAGGGACATTTTGATCCTGCCAAGTGCCGCTATGCCCTGGGCATGCAGGACCGG ACCATCCCAGACAGTGACATCTCTGCTTCCAGCTCCTGGTCAGATTCCACTGCCGCCCGC CACAGCAGGTTGGAGAGCAGTGACGGGGATGGGGCCTGGTGCCCCGCAGGGTCGGTGTTT CCCAAGGAGGAGGAGTACTTGCAGGTGGATCTACAACGACTGCACCTGGTGGCTCTGGTG GGCACCCAGGGACGGCATGCCGGGGGCCTGGGCAAGGAGTTCTCCCGGAGCTACCGGCTG CGTTACTCCCGGGATGGTCGCCGCTGGATGGGCTGGAAGGACCGCTGGGGTCAGGAGGTG ATCTCAGGCAATGAGGACCCTGAGGGAGTGGTGCTGAAGGACCTTGGGCCCCCCATGGTT GCCCGACTGGTTCGCTTCTACCCCCGGGCTGACCGGGTCATGAGCGTCTGTCTGCGGGTA GAGCTCTATGGCTGCCTCTGGAGGGATGGACTCCTGTCTTACACTGCCCCTGTGGGGCAG ACAATGTATTTATCTGAGGCCGTGTACCTCAACGACTCCACCTATGACGGACATACCGTG GGCGGACTGCAGTATGGGGGTCTGGGCCAGCTGGCAGATGGTGTGGTGGGGCTGGATGAC TTTAGGAAGAGTCAGGAGCTGCGGGTCTGGCCAGGCTATGACTATGTGGGATGGAGCAAC CACAGCTTCTCCAGTGGCTATGTGGAGATGGAGTTTGAGTTTGACCGGCTGAGGGCCTTC CAGGCTATGCAGGTCCACTGTAACAACATGCACACGCTGGGAGCCCGTCTGCCTGGCGGG GTGGAATGTCGCTTCCGGCGTGGCCCTGCCATGGCCTGGGAGGGGGAGCCCATGCGCCAC AACCTAGGGGGCAACCTGGGGGACCCCAGAGCCCGGGCTGTCTCAGTGCCCCTTGGCGGC CGTGTGGCTCGCTTTCTGCAGTGCCGCTTCCTCTTTGCGGGGCCCTGGTTACTCTTCAGC GAAATCTCCTTCATCTCTGATGTGGTGAACAATTCCTCTCCGGCACTGGGAGGCACCTTC CCGCCAGCCCCCTGGTGGCCGCCTGGCCCACCTCCCACCAACTTCAGCAGCTTGGAGCTG GAGCCCAGAGGCCAGCAGCCCGTGGCCAAGGCCGAGGGGAGCCCGACCGCCATCCTCATC GGCTGCCTGGTGGCCATCATCCTGCTCCTGCTGCTCATCATTGCCCTCATGCTCTGGCGG CTGCACTGGCGCAGGCTCCTCAGCAAGGCTGAACGGAGGGTGTTGGAAGAGGAGCTGACG GTTCACCTCTCTGTCCCTGGGGACACTATCCTCATCAACAACCGCCCAGGTCCTAGAGAG CCACCCCCGTACCAGGAGCCCCGGCCTCGTGGGAATCCGCCCCACTCCGCTCCCTGTGTC CCCAATGGCTCTGCCTACAGTGGGGACTATATGGAGCCTGAGAAGCCAGGCGCCCCGCTT CTGCCCCCACCTCCCCAGAACAGCGTCCCCCATTATGCCGAGGCTGACATTGTTACCCTG CAGGGCGTCACCGGGGGCAACACCTATGCTGTGCCTGCACTGCCCCCAGGGGCAGTCGGG GATGGGCCCCCCAGAGTGGATTTCCCTCGATCTCGACTCCGCTTCAAGGAGAAGCTTGGC GAGGGCCAGTTTGGGGAGGTGCACCTGTGTGAGGTCGACAGCCCTCAAGATCTGGTTAGT CTTGATTTCCCCCTTAATGTGCGTAAGGGACACCCTTTGCTGGTAGCTGTCAAGATCTTA CGGCCAGATGCCACCAAGAATGCCAGGAATGATTTCCTGAAAGAGGTGAAGATCATGTCG AGGCTCAAGGACCCAAACATCATTCGGCTGCTGGGCGTGTGTGTGCAGGACGACCCCCTC TGCATGATTACTGACTACATGGAGAACGGCGACCTCAACCAGTTCCTCAGTGCCCACCAG CTGGAGGACAAGGCAGCCGAGGGGGCCCCTGGGGACGGGCAGGCTGCGCAGGGGCCCACC ATCAGCTACCCAATGCTGCTGCATGTGGCAGCCCAGATCGCCTCCGGCATGCGCTATCTG GCCACACTCAACTTTGTACATCGGGACCTGGCCACGCGGAACTGCCTAGTTGGGGAAAAT TTCACCATCAAAATCGCAGACTTTGGCATGAGCCGGAACCTCTATGCTGGGGACTATTAC CGTGTGCAGGGCCGGGCAGTGCTGCCCATCCGCTGGATGGCCTGGGAGTGCATCCTCATG GGGAAGTTCACGACTGCGAGTGACGTGTGGGCCTTTGGTGTGACCCTGTGGGAGGTGCTG ATGCTCTGTAGGGCCCAGCCCTTTGGGCAGCTCACCGACGAGCAGGTCATCGAGAACGCG GGGGAGTTCTTCCGGGACCAGGGCCGGCAGGTGTACCTGTCCCGGCCGCCTGCCTGCCCG CAGGGCCTATATGAGCTGATGCTTCGGTGCTGGAGCCGGGAGTCTGAGCAGCGACCACCC TTTTCCCAGCTGCATCGGTTCCTGGCAGAGGATGCACTCAACACGGTGTGA
Human DDRIb full length nucleotide sequence (SEQ ID NO: 11)
ATGGGACCAGAGGCCCTGTCATCTTTACTGCTGCTGCTCTTGGTGGCAAGTGGAGATGCT GACATGAAGGGACATTTTGATCCTGCCAAGTGCCGCTATGCCCTGGGCATGCAGGACCGG ACCATCCCAGACAGTGACATCTCTGCTTCCAGCTCCTGGTCAGATTCCACTGCCGCCCGC CACAGCAGGTTGGAGAGCAGTGACGGGGATGGGGCCTGGTGCCCCGCAGGGTCGGTGTTT CCCAAGGAGGAGGAGTACTTGCAGGTGGATCTACAACGACTGCACCTGGTGGCTCTGGTG GGCACCCAGGGACGGCATGCCGGGGGCCTGGGCAAGGAGTTCTCCCGGAGCTACCGGCTG CGTTACTCCCGGGATGGTCGCCGCTGGATGGGCTGGAAGGACCGCTGGGGTCAGGAGGTG ATCTCAGGCAATGAGGACCCTGAGGGAGTGGTGCTGAAGGACCTTGGGCCCCCCATGGTT GCCCGACTGGTTCGCTTCTACCCCCGGGCTGACCGGGTCATGAGCGTCTGTCTGCGGGTA GAGCTCTATGGCTGCCTCTGGAGGGATGGACTCCTGTCTTACACCGCCCCTGTGGGGCAG ACAATGTATTTATCTGAGGCCGTGTACCTCAACGACTCCACCTATGACGGACATACCGTG GGCGGACTGCAGTATGGGGGTCTGGGCCAGCTGGCAGATGGTGTGGTGGGGCTGGATGAC TTTAGGAAGAGTCAGGAGCTGCGGGTCTGGCCAGGCTATGACTATGTGGGATGGAGCAAC CACAGCTTCTCCAGTGGCTATGTGGAGATGGAGTTTGAGTTTGACCGGCTGAGGGCCTTC CAGGCTATGCAGGTCCACTGTAACAACATGCACACGCTGGGAGCCCGTCTGCCTGGCGGG GTGGAATGTCGCTTCCGGCGTGGCCCTGCCATGGCCTGGGAGGGGGAGCCCATGCGCCAC AACCTAGGGGGCAACCTGGGGGACCCCAGAGCCCGGGCTGTCTCAGTGCCCCTTGGCGGC CGTGTGGCTCGCTTTCTGCAGTGCCGCTTCCTCTTTGCGGGGCCCTGGTTACTCTTCAGC GAAATCTCCTTCATCTCTGATGTGGTGAACAATTCCTCTCCGGCACTGGGAGGCACCTTC CCGCCAGCCCCCTGGTGGCCGCCTGGCCCACCTCCCACCAACTTCAGCAGCTTGGAGCTG GAGCCCAGAGGCCAGCAGCCCGTGGCCAAGGCCGAGGGGAGCCCGACCGCCATCCTCATC GGCTGCCTGGTGGCCATCATCCTGCTCCTGCTGCTCATCATTGCCCTCATGCTCTGGCGG CTGCACTGGCGCAGGCTCCTCAGCAAGGCTGAACGGAGGGTGTTGGAAGAGGAGCTGACG GTTCACCTCTCTGTCCCTGGGGACACTATCCTCATCAACAACCGCCCAGGTCCTAGAGAG CCACCCCCGTACCAGGAGCCCCGGCCTCGTGGGAATCCGCCCCACTCCGCTCCCTGTGTC CCCAATGGCTCTGCGTTGCTGCTCTCCAATCCAGCCTACCGCCTCCTTCTGGCCACTTAC GCCCGTCCCCCTCGAGGCCCGGGCCCCCCCACACCCGCCTGGGCCAAACCCACCAACACC CAGGCCTACAGTGGGGACTATATGGAGCCTGAGAAGCCAGGCGCCCCGCTTCTGCCCCCA CCTCCCCAGAACAGCGTCCCCCATTATGCCGAGGCTGACATTGTTACCCTGCAGGGCGTC ACCGGGGGCAACACCTATGCTGTGCCTGCACTGCCCCCAGGGGCAGTCGGGGATGGGCCC CCCAGAGTGGATTTCCCTCGATCTCGACTCCGCTTCAAGGAGAAGCTTGGCGAGGGCCAG TTTGGGGAGGTGCACCTGTGTGAGGTCGACAGCCCTCAAGATCTGGTTAGTCTTGATTTC CCCCTTAATGTGCGTAAGGGACACCCTTTGCTGGTAGCTGTCAAGATCTTACGGCCAGAT GCCACCAAGAATGCCAGGAATGATTTCCTGAAAGAGGTGAAGATCATGTCGAGGCTCAAG GACCCAAACATCATTCGGCTGCTGGGCGTGTGTGTGCAGGACGACCCCCTCTGCATGATT ACTGACTACATGGAGAACGGCGACCTCAACCAGTTCCTCAGTGCCCACCAGCTGGAGGAC AAGGCAGCCGAGGGGGCCCCTGGGGACGGGCAGGCTGCGCAGGGGCCCACCATCAGCTAC CCAATGCTGCTGCATGTGGCAGCCCAGATCGCCTCCGGCATGCGCTATCTGGCCACACTC AACTTTGTACATCGGGACCTGGCCACGCGGAACTGCCTAGTTGGGGAAAATTTCACCATC AAAATCGCAGACTTTGGCATGAGCCGGAACCTCTATGCTGGGGACTATTACCGTGTGCAG GGCCGGGCAGTGCTGCCCATCCGCTGGATGGCCTGGGAGTGCATCCTCATGGGGAAGTTC ACGACTGCGAGTGACGTGTGGGCCTTTGGTGTGACCCTGTGGGAGGTGCTGATGCTCTGT AGGGCCCAGCCCTTTGGGCAGCTCACCGACGAGCAGGTCATCGAGAACGCGGGGGAGTTC TTCCGGGACCAGGGCCGGCAGGTGTACCTGTCCCGGCCGCCTGCCTGCCCGCAGGGCCTA TATGAGCTGATGCTTCGGTGCTGGAGCCGGGAGTCTGAGCAGCGACCACCCTTTTCCCAG CTGCATCGGTTCCTGGCAGAGGATGCACTCAACACGGTGTGA
Human DDRIb full length amino acid sequence (SEQ ED NO: 12)
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR HSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRL RYSRDGRRWMGWKDRWGQEVISGNEDPEGWLKDLGPPMVARLVRFYPRADRVMSVCLRV ELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGWGLDD FRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGG VECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFS EISFISDWNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPRE PPPYQEPRPRGNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNT QAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGP PRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPD ATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLED KAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTI KIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLC RAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQ LHRFLAEDALNTV
Human DDRIc full length nucleotide sequence (SEQ ID NO: 13)
ATGGGACCAGAGGCCCTGTCATCTTTACTGCTGCTGCTCTTGGTGGCAAGTGGAGATGCT GACATGAAGGGACATTTTGATCCTGCCAAGTGCCGCTATGCCCTGGGCATGCAGGACCGG ACCATCCCAGACAGTGACATCTCTGCTTCCAGCTCCTGGTCAGATTCCACTGCCGCCCGC CACAGCAGGTTGGAGAGCAGTGACGGGGATGGGGCCTGGTGCCCCGCAGGGTCGGTGTTT CCCAAGGAGGAGGAGTACTTGCAGGTGGATCTACAACGACTGCACCTGGTGGCTCTGGTG GGCACCCAGGGACGGCATGCCGGGGGCCTGGGCAAGGAGTTCTCCCGGAGCTACCGGCTG CGTTACTCCCGGGATGGTCGCCGCTGGATGGGCTGGAAGGACCGCTGGGGTCAGGAGGTG ATCTCAGGCAATGAGGACCCTGAGGGAGTGGTGCTGAAGGACCTTGGGCCCCCCATGGTT GCCCGACTGGTTCGCTTCTACCCCCGGGCTGACCGGGTCATGAGCGTCTGTCTGCGGGTA GAGCTCTATGGCTGCCTCTGGAGGGATGGACTCCTGTCTTACACCGCCCCTGTGGGGCAG ACAATGTATTTATCTGAGGCCGTGTACCTCAACGACTCCACCTATGACGGACATACCGTG GGCGGACTGCAGTATGGGGGTCTGGGCCAGCTGGCAGATGGTGTGGTGGGGCTGGATGAC TTTAGGAAGAGTCAGGAGCTGCGGGTCTGGCCAGGCTATGACTATGTGGGATGGAGCAAC CACAGCTTCTCCAGTGGCTATGTGGAGATGGAGTTTGAGTTTGACCGGCTGAGGGCCTTC CAGGCTATGCAGGTCCACTGTAACAACATGCACACGCTGGGAGCCCGTCTGCCTGGCGGG GTGGAATGTCGCTTCCGGCGTGGCCCTGCCATGGCCTGGGAGGGGGAGCCCATGCGCCAC AACCTAGGGGGCAACCTGGGGGACCCCAGAGCCCGGGCTGTCTCAGTGCCCCTTGGCGGC CGTGTGGCTCGCTTTCTGCAGTGCCGCTTCCTCTTTGCGGGGCCCTGGTTACTCTTCAGC GAAATCTCCTTCATCTCTGATGTGGTGAACAATTCCTCTCCGGCACTGGGAGGCACCTTC CCGCCAGCCCCCTGGTGGCCGCCTGGCCCACCTCCCACCAACTTCAGCAGCTTGGAGCTG GAGCCCAGAGGCCAGCAGCCCGTGGCCAAGGCCGAGGGGAGCCCGACCGCCATCCTCATC GGCTGCCTGGTGGCCATCATCCTGCTCCTGCTGCTCATCATTGCCCTCATGCTCTGGCGG CTGCACTGGCGCAGGCTCCTCAGCAAGGCTGAACGGAGGGTGTTGGAAGAGGAGCTGACG GTTCACCTCTCTGTCCCTGGGGACACTATCCTCATCAACAACCGCCCAGGTCCTAGAGAG CCACCCCCGTACCAGGAGCCCCGGCCTCGTGGGAATCCGCCCCACTCCGCTCCCTGTGTC CCCAATGGCTCTGCGTTGCTGCTCTCCAATCCAGCCTACCGCCTCCTTCTGGCCACTTAC GCCCGTCCCCCTCGAGGCCCGGGCCCCCCCACACCCGCCTGGGCCAAACCCACCAACACC CAGGCCTACAGTGGGGACTATATGGAGCCTGAGAAGCCAGGCGCCCCGCTTCTGCCCCCA CCTCCCCAGAACAGCGTCCCCCATTATGCCGAGGCTGACATTGTTACCCTGCAGGGCGTC ACCGGGGGCAACACCTATGCTGTGCCTGCACTGCCCCCAGGGGCAGTCGGGGATGGGCCC CCCAGAGTGGATTTCCCTCGATCTCGACTCCGCTTCAAGGAGAAGCTTGGCGAGGGCCAG TTTGGGGAGGTGCACCTGTGTGAGGTCGACAGCCCTCAAGATCTGGTTAGTCTTGATTTC CCCCTTAATGTGCGTAAGGGACACCCTTTGCTGGTAGCTGTCAAGATCTTACGGCCAGAT GCCACCAAGAATGCCAGCTTCTCCTTGTTCTCCAGGAATGATTTCCTGAAAGAGGTGAAG ATCATGTCGAGGCTCAAGGACCCAAACATCATTCGGCTGCTGGGCGTGTGTGTGCAGGAC GACCCCCTCTGCATGATTACTGACTACATGGAGAACGGCGACCTCAACCAGTTCCTCAGT GCCCACCAGCTGGAGGACAAGGCAGCCGAGGGGGCCCCTGGGGACGGGCAGGCTGCGCAG GGGCCCACCATCAGCTACCCAATGCTGCTGCATGTGGCAGCCCAGATCGCCTCCGGCATG CGCTATCTGGCCACACTCAACTTTGTACATCGGGACCTGGCCACGCGGAACTGCCTAGTT GGGGAAAATTTCACCATCAAAATCGCAGACTTTGGCATGAGCCGGAACCTCTATGCTGGG GACTATTACCGTGTGCAGGGCCGGGCAGTGCTGCCCATCCGCTGGATGGCCTGGGAGTGC ATCCTCATGGGGAAGTTCACGACTGCGAGTGACGTGTGGGCCTTTGGTGTGACCCTGTGG GAGGTGCTGATGCTCTGTAGGGCCCAGCCCTTTGGGCAGCTCACCGACGAGCAGGTCATC GAGAACGCGGGGGAGTTCTTCCGGGACCAGGGCCGGCAGGTGTACCTGTCCCGGCCGCCT GCCTGCCCGCAGGGCCTATATGAGCTGATGCTTCGGTGCTGGAGCCGGGAGTCTGAGCAG CGACCACCCTTTTCCCAGCTGCATCGGTTCCTGGCAGAGGATGCACTCAACACGGTGTGA
Human DDRIc full length amino acid sequence (SEQ ID NO: 14)
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR HSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRL RYSRDGRRWMGWKDRWGQEVISGNEDPEGWLKDLGPPMVARLVRFYPRADRVMSVCLRV ELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGWGLDD FRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGG VECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFS EISFISDWNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPRE PPPYQEPRPRGNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNT QAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGP PRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPD ATKNASFSLFSRNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLS AHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLV GENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLW EVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQ RPPFSQLHRFLAEDALNTV
Human DDRl mature ECD amino acid sequence (SEQ ID NO: 15)
DMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAARHSRLESSDGDGAWCPAGSVF PKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMGWKDRWGQEV ISGNEDPEGWLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQ TMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGWGLDDFRKSQELRVWPGYDYVGWSN HSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRH NLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFISDWNNSSPALGGTF PPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTA
2OM 102 Heavy chain nucleotide sequence (SEQ ID NO: 16) Signal sequence is underlined
ATGAAATGGACCTGGGTCATCCTCTTTCTCTTGTCAGGAACTGGAGGTGTCCTCTCTGAG GTCCAGCTGCAACAGTCTGGATCTGAGCTGGTGAAGCCTGGGGCTTCAGTGAAGATGTCC TGCAAGGCTTCTGGATACACCTTCACTGACTACTTCATGAAGTGGGTGAAGCAGAGCCAT GGAAAGAGCCTTGAATGGATTGGAGATATTAATCCCAACAATGGTGATACTTTCTACATC CAGAAGTTCAAGGGCAAGGCCACTTTGACTGTAGACAAATCCTCCAGTACAGCCTACATG CAGCTCAACAGCCTGACATCTGAGGACTCTGCAGTCTATTACTGTTCAAGAGACCTTGCT TACTGGGGCCAAGGGACTCTGGTCGCTGTCTCCTCAGCCAAAACGACACCCCCATCTGTC TATCCACTGGCCCCTGGATCTGCTGCCCAAACTAACTCCATGGTGACCCTGGGATGCCTG GTCAAGGGCTATTTCCCTGAGCCAGTGACAGTGACCTGGAACTCTGGATCCCTGTCCAGC GGTGTGCACACCTTCCCAGCTGTCCTGCAGTCTGACCTCTACACTCTGAGCAGCTCAGTG ACTGTCCCCTCCAGCACCTGGCCCAGCGAGACCGTCACCTGCAACGTTGCCCACCCGGCC AGCAGCACCAAGGTGGACAAGAAAATTGTGCCCAGGGATTGTGGTTGTAAGCCTTGCATA TGTACAGTCCCAGAAGTATCATCTGTCTTCATCTTCCCCCCAAAGCCCAAGGATGTGCTC ACCATTACTCTGACTCCTAAGGTCACGTGTGTTGTGGTAGACATCAGCAAGGATGATCCC GAGGTCCAGTTCAGCTGGTTTGTAGATGATGTGGAGGTGCACACAGCTCAGACGCAACCC CGGGAGGAGCAGTTCAACAGCACTTTCCGCTCAGTCAGTGAACTTCCCATCATGCACCAG GACTGGCTCAATGGCAAGGAGTTCAAATGCAGGGTCAACAGTGCAGCTTTCCCTGCCCCC ATCGAGAAAACCATCTCCAAAACCAAAGGCAGACCGAAGGCTCCACAGGTGTACACCATT CCACCTCCCAAGGAGCAGATGGCCAAGGATAAAGTCAGTCTGACCTGCATGATAACAGAC TTCTTCCCTGAAGACATTACTGTGGAGTGGCAGTGGAATGGGCAGCCAGCGGAGAACTAC AAGAACACTCAGCCCATCATGGACACAGATGGCTCTTACTTCGTCTACAGCAAGCTCAAT GTGCAGAAGAGCAACTGGGAGGCAGGAAATACTTTCACCTGCTCTGTGTTACATGAGGGC CTGCACAACCACCATACTGAGAAGAGCCTCTCCCACTCTCCTGGTAAATGA
2OM 102 Heavy chain amino acid sequence (SEQ ID NO: 17) Signal sequence is underlined
MKWTWVILFLLSGTGGVLSEVQLQQSGSELVKPGASVKMSCKASGYTFTDYFMKWVKQSH GKSLEWIGDINPNNGDTFYIQKFKGKATLTVDKSSSTAYMQLNSLTSEDSAVYYCSRDLA YWGQGTLVAVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSS GVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCI CTVPEVSSVFIFPPKPKDVLTITLTPKVTCVWDISKDDPEVQFSWFVDDVEVHTAQTQP REEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTI PPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLN VQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK
2OM 102 Light chain nucleotide sequence (SEQ ID NO: 18) Signal sequence is underlined
ATGAAGTTGCCTGTTAGGCTGTTGGTGCTCTGGATTCAGGAAACCAACGGTGATGTTGTG ATGACCCAGACTCCACTCACTTTGTCGGTTAACATTGGACAACCAGCCTCTATCTCTTGC AAGTCAAGTCAGAGCCTCTTATATAGTAATGGGAAAACCTATTTGAATTGGTTATTACAG AGGCCAGGCCAGTCTCCAAGGCGCCTAATCTATCAGGTGTCTAAACTGGACTCTGGAGTC CCTGACAGGTTCACTGGCAGTGGATCAGGAACAGATTTTACATTGAAAATCAGCAGAGTG GAGGCTGAGGATTTGGGAGTTTATTACTGCGTGCAAGGTACAGATTTTCCTCAGACGTTC GGTGGAGGCACCAAGCTGGAAATCAAACGGGCTGATGCTGCACCAACTGTATCCATCTTC CCACCATCCAGTGAGCAGTTAACATCTGGAGGTGCCTCAGTCGTGTGCTTCTTGAACAAC TTCTACCCCAAAGACATCAATGTCAAGTGGAAGATTGATGGCAGTGAACGACAAAATGGC GTCCTGAACAGTTGGACTGATCAGGACAGCAAAGACAGCACCTACAGCATGAGCAGCACC CTCACGTTGACCAAGGACGAGTATGAACGACATAACAGCTATACCTGTGAGGCCACTCAC AAGACATCAACTTCACCCATCGTCAAGAGCTTCAACAGGAATGAGTGTTAG
2OM 102 Light chain amino acid sequence (SEQ ID NO: 19) Signal sequence is underlined
MKLPVRLLVLWIQETNGDWMTQTPLTLSVNIGQPASISCKSSQSLLYSNGKTYLNWLLQ RPGQSPRRLIYQVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCVQGTDFPQTF GGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASWCFLNNFYPKDINVKWKIDGSERQNG VLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 20M102 Heavy chain variable region nucleotide sequence (SEQ ID NO:20) Signal sequence is underlined
ATGAAATGGACCTGGGTCATCCTCTTTCTCTTGTCAGGAACTGGAGGTGTCCTCTCTGAG GTCCAGCTGCAACAGTCTGGATCTGAGCTGGTGAAGCCTGGGGCTTCAGTGAAGATGTCC TGCAAGGCTTCTGGATACACCTTCACTGACTACTTCATGAAGTGGGTGAAGCAGAGCCAT GGAAAGAGCCTTGAATGGATTGGAGATATTAATCCCAACAATGGTGATACTTTCTACATC CAGAAGTTCAAGGGCAAGGCCACTTTGACTGTAGACAAATCCTCCAGTACAGCCTACATG CAGCTCAACAGCCTGACATCTGAGGACTCTGCAGTCTATTACTGTTCAAGAGACCTTGCT TACTGGGGCCAAGGGACTCTGGTCGCTGTC
20M102 Heavy chain variable region amino acid sequence (SEQ ED NO:21) Signal sequence is underlined
MKWTWVILFLLSGTGGVLSEVQLQQSGSELVKPGASVKMSCKASGYTFTDYFMKWVKQSH GKSLEWIGDINPNNGDTFYIQKFKGKATLTVDKSSSTAYMQLNSLTSEDSAVYYCSRDLA YWGQGTLVAV
20M102 Heavy chain CDRl amino acid sequence (SEQ ID NO:22)
GYTFTDYFMK
20M102 Heavy chain CDR2 amino acid sequence (SEQ ID NO:23)
DINPNNGDTFYIQKFKG
20Ml 02 Heavy chain CDR3 amino acid sequence (SEQ EO NO:24)
SRDLAY
2OM 102 Light chain variable region nucleotide sequence (SEQ ED NO:25) Signal sequence is underlined
ATGAAGTTGCCTGTTAGGCTGTTGGTGCTCTGGATTCAGGAAACCAACGGTGATGTTGTG ATGACCCAGACTCCACTCACTTTGTCGGTTAACATTGGACAACCAGCCTCTATCTCTTGC AAGTCAAGTCAGAGCCTCTTATATAGTAATGGGAAAACCTATTTGAATTGGTTATTACAG AGGCCAGGCCAGTCTCCAAGGCGCCTAATCTATCAGGTGTCTAΆACTGGACTCTGGAGTC CCTGACAGGTTCACTGGCAGTGGATCAGGAΆCAGATTTTACATTGAAAATCAGCAGAGTG GAGGCTGAGGATTTGGGAGTTTATTACTGCGTGCAAGGTACAGATTTTCCTCAGACGTTC GGTGGAGGC
20M102 Light chain variable region amino acid sequence (SEQ ED NO:26) Signal sequence is underlined
MKLPVRLLVLWIQETNGDWMTQTPLTLSVNIGQPASISCKSSQSLLYSNGKTYLNWLLQ RPGQSPRRLIYQVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCVQGTDFPQTF GGG
20M102 Light chain CDRl amino acid sequence (SEQ ID NO:27)
KSSQSLLYSNGKTYLN
20M102 Light chain CDR2 amino acid sequence (SEQ ED NO:28)
QVSKLDS
20M102 Light chain CDR3 amino acid sequence (SEQ ID NO:29)
VQGTDFPQT
Partial DDRl amino acid sequence (SEQ ID NO:30)
SASSSWSDSTAAR
Partial DDRl amino acid sequence with substitution (SEQ ID NO:31)
SASSSASDSTAAR
2OM 102 Heavy chain variable region nucleotide sequence without signal sequence (SEQ ID NO: 32)
GAGGTCCAGCTGCAACAGTCTGGATCTGAGCTGGTGAAGCCTGGGGCTTCAGTGAAGATG TCCTGCAAGGCTTCTGGATACACCTTCACTGACTACTTCATGAAGTGGGTGAAGCAGAGC CATGGAAAGAGCCTTGAATGGATTGGAGATATTAATCCCAACAATGGTGATACTTTCTAC ATCCAGAAGTTCAAGGGCAAGGCCACTTTGACTGTAGACAAATCCTCCAGTACAGCCTAC ATGCAGCTCAACAGCCTGACATCTGAGGACTCTGCAGTCTATTACTGTTCAAGAGACCTT GCTTACTGGGGCCAAGGGACTCTGGTCGCTGTC
2OM 102 Heavy chain variable region amino acid sequence without signal sequence (SEQ ID NO:33)
EVQLQQSGSELVKPGASVKMSCKASGYTFTDYFMKWVKQSHGKSLEWIGDINPNNGDTFY IQKFKGKATLTVDKSSSTAYMQLNSLTSEDSAVYYCSRDLAYWGQGTLVAV
20M102 Light chain variable region nucleotide sequence without signal sequence (SEQ ID NO:34)
GATGTTGTGATGACCCAGACTCCACTCACTTTGTCGGTTAACATTGGACAACCAGCCTCT
ATCTCTTGCAAGTCAAGTCAGAGCCTCTTATATAGTAATGGGAAAACCTATTTGAATTGG
TTATTACAGAGGCCAGGCCAGTCTCCAAGGCGCCTAATCTATCAGGTGTCTAΆACTGGAC
TCTGGAGTCCCTGACAGGTTCACTGGCAGTGGATCAGGAACAGATTTTACATTGAAAATC
AGCAGAGTGGAGGCTGAGGATTTGGGAGTTTATTACTGCGTGCAAGGTACAGATTTTCCT
CAGACGTTCGGTGGAGGC 20M102 Light chain variable region amino acid sequence without signal sequence (SEQ ID NO:35)
DWMTQTPLTLSWIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPRRLIYQVSKLD SGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCVQGTDFPQTFGGG
Human DDRl-FLAG construct sequence (SEQ ID NO:36)
ATGTCTGCACTTCTGATCCTAGCTCTTGTTGGAGCTGCAGTTGCTGACTACAAAGACCAT GACGGTGATTATAAAGATCATGACATCGATTACAAGGATGACGATGACAAGGCGATCGCG GACATGAAGGGACATTTTGATCCTGCCAAGTGCCGCTATGCCCTGGGCATGCAGGACCGG ACCATCCCAGACAGTGACATCTCTGCTTCCAGCTCCTGGTCAGATTCCACTGCCGCCCGC CACAGCAGGTTGGAGAGCAGTGACGGGGATGGGGCCTGGTGCCCCGCAGGGTCGGTGTTT CCCAAGGAGGAGGAGTACTTGCAGGTGGATCTACAACGACTGCACCTGGTGGCTCTGGTG GGCACCCAGGGACGGCATGCCGGGGGCCTGGGCAAGGAGTTCTCCCGGAGCTACCGGCTG CGTTACTCCCGGGATGGTCGCCGCTGGATGGGCTGGAAGGACCGCTGGGGTCAGGAGGTG ATCTCAGGCAATGAGGACCCTGAGGGAGTGGTGCTGAAGGACCTTGGGCCCCCCATGGTT GCCCGACTGGTTCGCTTCTACCCCCGGGCTGACCGGGTCATGAGCGTCTGTCTGCGGGTA GAGCTCTATGGCTGCCTCTGGAGGGATGGACTCCTGTCTTACACTGCCCCTGTGGGGCAG ACAATGTATTTATCTGAGGCCGTGTACCTCAACGACTCCACCTATGACGGACATACCGTG GGCGGACTGCAGTATGGGGGTCTGGGCCAGCTGGCAGATGGTGTGGTGGGGCTGGATGAC TTTAGGAAGAGTCAGGAGCTGCGGGTCTGGCCAGGCTATGACTATGTGGGATGGAGCAAC CACAGCTTCTCCAGTGGCTATGTGGAGATGGAGTTTGAGTTTGACCGGCTGAGGGCCTTC CAGGCTATGCAGGTCCACTGTAACAACATGCACACGCTGGGAGCCCGTCTGCCTGGCGGG GTGGAATGTCGCTTCCGGCGTGGCCCTGCCATGGCCTGGGAGGGGGAGCCCATGCGCCAC AACCTAGGGGGCAACCTGGGGGACCCCAGAGCCCGGGCTGTCTCAGTGCCCCTTGGCGGC CGTGTGGCTCGCTTTCTGCAGTGCCGCTTCCTCTTTGCGGGGCCCTGGTTACTCTTCAGC GAAATCTCCTTCATCTCTGATGTGGTGAACAATTCCTCTCCGGCACTGGGAGGCACCTTC CCGCCAGCCCCCTGGTGGCCGCCTGGCCCACCTCCCACCAACTTCAGCAGCTTGGAGCTG GAGCCCAGAGGCCAGCAGCCCGTGGCCAAGGCCGAGGGGAGCCCGACCGCCATCCTCATC GGCTGCCTGGTGGCCATCATCCTGCTCCTGCTGCTCATCATTGCCCTCATGCTCTGGCGG CTGCACTGGCGCAGGCTCCTCAGCAAGGCTGAACGGAGGGTGTTGGAAGAGGAGCTGACG GTTCACCTCTCTGTCCCTGGGGACACTATCCTCATCAACAACCGCCCAGGTCCTAGAGAG CCACCCCCGTACCAGGAGCCCCGGCCTCGTGGGAATCCGCCCCACTCCGCTCCCTGTGTC CCCAATGGCTCTGCCTACAGTGGGGACTATATGGAGCCTGAGAAGCCAGGCGCCCCGCTT CTGCCCCCACCTCCCCAGAACAGCGTCCCCCATTATGCCGAGGCTGACATTGTTACCCTG CAGGGCGTCACCGGGGGCAACACCTATGCTGTGCCTGCACTGCCCCCAGGGGCAGTCGGG GATGGGCCCCCCAGAGTGGATTTCCCTCGATCTCGACTCCGCTTCAAGGAGAAGCTTGGC GAGGGCCAGTTTGGGGAGGTGCACCTGTGTGAGGTCGACAGCCCTCAAGATCTGGTTAGT CTTGATTTCCCCCTTAATGTGCGTAAGGGACACCCTTTGCTGGTAGCTGTCAAGATCTTA CGGCCAGATGCCACCAAGAATGCCAGGAATGATTTCCTGAAAGAGGTGAAGATCATGTCG AGGCTCAAGGACCCAAACATCATTCGGCTGCTGGGCGTGTGTGTGCAGGACGACCCCCTC TGCATGATTACTGACTACATGGAGAACGGCGACCTCAACCAGTTCCTCAGTGCCCACCAG CTGGAGGACAAGGCAGCCGAGGGGGCCCCTGGGGACGGGCAGGCTGCGCAGGGGCCCACC ATCAGCTACCCAATGCTGCTGCATGTGGCAGCCCAGATCGCCTCCGGCATGCGCTATCTG GCCACACTCAACTTTGTACATCGGGACCTGGCCACGCGGAACTGCCTAGTTGGGGAAAAT TTCACCATCAAAATCGCAGACTTTGGCATGAGCCGGAACCTCTATGCTGGGGACTATTAC CGTGTGCAGGGCCGGGCAGTGCTGCCCATCCGCTGGATGGCCTGGGAGTGCATCCTCATG GGGAAGTTCACGACTGCGAGTGACGTGTGGGCCTTTGGTGTGACCCTGTGGGAGGTGCTG ATGCTCTGTAGGGCCCAGCCCTTTGGGCAGCTCACCGACGAGCAGGTCATCGAGAACGCG GGGGAGTTCTTCCGGGACCAGGGCCGGCAGGTGTACCTGTCCCGGCCGCCTGCCTGCCCG CAGGGCCTATATGAGCTGATGCTTCGGTGCTGGAGCCGGGAGTCTGAGCAGCGACCACCC TTTTCCCAGCTGCATCGGTTCCTGGCAGAGGATGCACTCAACACGGTGTGA
Human DDRl-FLAG construct full length amino acid sequence (SEQ ID NO:37)
MSALLILALVGAAVADYKDHDGDYKDHDIDYKDDDDKAIADMKGHFDPAKCRYALGMQDR
TIPDSDISASSSWSDSTAARHSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALV
GTQGRHAGGLGKEFSRSYRLRYSRDGRRWMGWKDRWGQEVISGNEDPEGWLKDLGPPMV
ARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTV
GGLQYGGLGQLADGWGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFΞFDRLRAF
QAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGG
RVARFLQCRFLFAGPWLLFSEISFISDWNNSSPALGGTFPPAPWWPPGPPPTNFSSLEL
EPRGQQPVAKAEGSPTAILIGCLVAI ILLLLLI IALMLWRLHWRRLLSKAERRVLEEELT
VHLSVPGDTILINNRPGPREPPPYQEPRPRGNPPHSAPCVPNGSAYSGDYMEPEKPGAPL
LPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLG
EGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMS
RLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPT
ISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYY
RVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENA
GEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALNTV
Human DDRl W53A Mutant-FLAG construct (SEQ ID NO:38)
ATGTCTGCACTTCTGATCCTAGCTCTTGTTGGAGCTGCAGTTGCTGACTACAAAGACCAT GACGGTGATTATAAAGATCATGACATCGATTACAAGGATGACGATGACAAGGCGATCGCG GACATGAAGGGACATTTTGATCCTGCCAAGTGCCGCTATGCCCTGGGCATGCAGGACCGG ACCATCCCAGACAGTGACATCTCTGCTTCCAGCTCCGCGTCAGATTCCACTGCCGCCCGC CACAGCAGGTTGGAGAGCAGTGACGGGGATGGGGCCTGGTGCCCCGCAGGGTCGGTGTTT CCCAAGGAGGAGGAGTACTTGCAGGTGGATCTACAACGACTGCACCTGGTGGCTCTGGTG GGCACCCAGGGACGGCATGCCGGGGGCCTGGGCAAGGAGTTCTCCCGGAGCTACCGGCTG CGTTACTCCCGGGATGGTCGCCGCTGGATGGGCTGGAAGGACCGCTGGGGTCAGGAGGTG ATCTCAGGCAATGAGGACCCTGAGGGAGTGGTGCTGAAGGACCTTGGGCCCCCCATGGTT GCCCGACTGGTTCGCTTCTACCCCCGGGCTGACCGGGTCATGAGCGTCTGTCTGCGGGTA GAGCTCTATGGCTGCCTCTGGAGGGATGGACTCCTGTCTTACACTGCCCCTGTGGGGCAG ACAATGTATTTATCTGAGGCCGTGTACCTCAACGACTCCACCTATGACGGACATACCGTG GGCGGACTGCAGTATGGGGGTCTGGGCCAGCTGGCAGATGGTGTGGTGGGGCTGGATGAC TTTAGGAAGAGTCAGGAGCTGCGGGTCTGGCCAGGCTATGACTATGTGGGATGGAGCAAC CACAGCTTCTCCAGTGGCTATGTGGAGATGGAGTTTGAGTTTGACCGGCTGAGGGCCTTC CAGGCTATGCAGGTCCACTGTAACAACATGCACACGCTGGGAGCCCGTCTGCCTGGCGGG GTGGAATGTCGCTTCCGGCGTGGCCCTGCCATGGCCTGGGAGGGGGAGCCCATGCGCCAC AACCTAGGGGGCAACCTGGGGGACCCCAGAGCCCGGGCTGTCTCAGTGCCCCTTGGCGGC CGTGTGGCTCGCTTTCTGCAGTGCCGCTTCCTCTTTGCGGGGCCCTGGTTACTCTTCAGC GAAATCTCCTTCATCTCTGATGTGGTGAACAATTCCTCTCCGGCACTGGGAGGCACCTTC CCGCCAGCCCCCTGGTGGCCGCCTGGCCCACCTCCCACCAACTTCAGCAGCTTGGAGCTG GAGCCCAGAGGCCAGCAGCCCGTGGCCAAGGCCGAGGGGAGCCCGACCGCCATCCTCATC GGCTGCCTGGTGGCCATCATCCTGCTCCTGCTGCTCATCATTGCCCTCATGCTCTGGCGG CTGCACTGGCGCAGGCTCCTCAGCAAGGCTGAACGGAGGGTGTTGGAAGAGGAGCTGACG GTTCACCTCTCTGTCCCTGGGGACACTATCCTCATCAACAACCGCCCAGGTCCTAGAGAG CCACCCCCGTACCAGGAGCCCCGGCCTCGTGGGAATCCGCCCCACTCCGCTCCCTGTGTC CCCAATGGCTCTGCCTACAGTGGGGACTATATGGAGCCTGAGAAGCCAGGCGCCCCGCTT CTGCCCCCACCTCCCCAGAACAGCGTCCCCCATTATGCCGAGGCTGACATTGTTACCCTG CAGGGCGTCACCGGGGGCAACACCTATGCTGTGCCTGCACTGCCCCCAGGGGCAGTCGGG GATGGGCCCCCCAGAGTGGATTTCCCTCGATCTCGACTCCGCTTCAAGGAGAAGCTTGGC GAGGGCCAGTTTGGGGAGGTGCACCTGTGTGAGGTCGACAGCCCTCAAGATCTGGTTAGT CTTGATTTCCCCCTTAATGTGCGTAAGGGACACCCTTTGCTGGTAGCTGTCAAGATCTTA CGGCCAGATGCCACCAAGAATGCCAGGAATGATTTCCTGAAAGAGGTGAAGATCATGTCG AGGCTCAAGGACCCAAACATCATTCGGCTGCTGGGCGTGTGTGTGCAGGACGACCCCCTC TGCATGATTACTGACTACATGGAGAACGGCGACCTCAACCAGTTCCTCAGTGCCCACCAG CTGGAGGACAAGGCAGCCGAGGGGGCCCCTGGGGACGGGCAGGCTGCGCAGGGGCCCACC ATCAGCTACCCAATGCTGCTGCATGTGGCAGCCCAGATCGCCTCCGGCATGCGCTATCTG GCCACACTCAACTTTGTACATCGGGACCTGGCCACGCGGAACTGCCTAGTTGGGGAAAAT TTCACCATCAAAATCGCAGACTTTGGCATGAGCCGGAACCTCTATGCTGGGGACTATTAC CGTGTGCAGGGCCGGGCAGTGCTGCCCATCCGCTGGATGGCCTGGGAGTGCATCCTCATG GGGAAGTTCACGACTGCGAGTGACGTGTGGGCCTTTGGTGTGACCCTGTGGGAGGTGCTG ATGCTCTGTAGGGCCCAGCCCTTTGGGCAGCTCACCGACGAGCAGGTCATCGAGAACGCG GGGGAGTTCTTCCGGGACCAGGGCCGGCAGGTGTACCTGTCCCGGCCGCCTGCCTGCCCG CAGGGCCTATATGAGCTGATGCTTCGGTGCTGGAGCCGGGAGTCTGAGCAGCGACCACCC TTTTCCCAGCTGCATCGGTTCCTGGCAGAGGATGCACTCAACACGGTGTGA
Human DDRl W53A Mutant-FLAG construct full length amino acid sequence (SEQ ID NO:39)
MSALLILALVGAAVADYKDHDGDYKDHDIDYKDDDDKAIADMKGHFDPAKCRYALGMQDR TIPDSDISASSSASDSTAARHSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALV GTQGRHAGGLGKEFSRSYRLRYSRDGRRWMGWKDRWGQEVISGNEDPEGWLKDLGPPMV ARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTV GGLQYGGLGQLADGWGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAF QAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGG RVARFLQCRFLFAGPWLLFSEISFISDWNNSSPALGGTFPPAPWWPPGPPPTNFSSLEL EPRGQQPVAKAEGSPTAILIGCLVAI ILLLLLI IALMLWRLHWRRLLSKAERRVLEEELT VHLSVPGDTILINNRPGPREPPPYQEPRPRGNPPHSAPCVPNGSAYSGDYMEPEKPGAPL LPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLG EGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMS RLKDPN11RLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPT ISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYY RVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENA GEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALNTV
FLAG Tag sequence (SEQ E) NO:40)
DYKDDDDK
DDRl Discoidin Domain sequence (SEQ ID NO:41)
CRYALGMQDRTIPDSDISASSSWSDSTAARHSRLESSDGDGAWCPAGSVFPKEEEYLQVD
LQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMGWKDRWGQEVISGNEDPEGV
VLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGC

Claims

CLAIMS WHAT IS CLAIMED IS:
1. An isolated antibody that specifically binds to an extracellular domain of human discoidin domain receptor 1 (DDRl) and modulates the activity of DDRl, wherein the antibody binds to at least one amino acid in the sequence SASSSWSDSTAAR (SEQ ID NO:30) within DDRl .
2. The antibody of claim 1, which inhibits binding of a ligand to DDRl .
3. The antibody of claim 1 or 2, which is an antagonist of DDRl.
4. The antibody according to any one of claims 1-3, which inhibits activation of DDRl.
5. The antibody according to any one of claims 1-4, which blocks collagen-induced tyrosine phosphorylation of DDRl.
6. The antibody according to any one of claims 1-5, which inhibits growth of a tumor.
7. The antibody of claim 6, wherein the tumor is selected from the group consisting of a breast tumor, colorectal tumor, hepatic tumor, renal tumor, lung tumor, pancreatic tumor, ovarian tumor, prostate tumor, and head and neck tumor.
8. The antibody according to any one of claims 1-7, which reduces the frequency of cancer stem cells in a tumor.
9. The antibody according to any one of claims 1-8, which further binds to additional amino acid residues within DDRl .
10. The antibody according to any one of claims 1-9, which further specifically binds DDR2.
11. The antibody according to any one of claims 1-10, which has reduced binding to a variant of human DDRl in which the sequence SASSSWSDSTAAR (SEQ ED NO:30) has been replaced with the sequence SASSSASDSTAAR (SEQ ID NO:31).
12. An isolated antibody that specifically binds to an extracellular domain of human DDRl, wherein the antibody comprises a heavy chain CDRl comprising GYTFTDYFMK (SEQ ID NO:22), a heavy chain CDR2 comprising DINPNNGDTFYIQKFKG (SEQ ID NO:23), and/or a heavy chain CDR3 comprising SRDLAY (SEQ ID NO:24).
13. The antibody of claim 12, which further comprises a light chain CDRl comprising KSSQSLLYSNGKTYLN (SEQ ID NO:27), a light chain CDR2 comprising QVSKLDS (SEQ E) NO:28), and/or a light chain CDR3 comprising VQGTDFPQT (SEQ ID NO:29).
14. An isolated antibody that specifically binds to an extracellular domain of human DDRl, wherein the antibody comprises a light chain CDRl comprising KSSQSLLYSNGKTYLN (SEQ ID NO:27), a light chain CDR2 comprising QVSKLDS (SEQ ID NO:28), and/or a light chain CDR3 comprising VQGTDFPQT (SEQ ID NO:29).
15. An isolated antibody that specifically binds to an extracellular domain of human DDRl, wherein the antibody comprises:
(a) a heavy chain CDRl comprising GYTFTD YFMK (SEQ ID NO:22), a heavy chain CDR2 comprising DINPNNGDTFYIQKFKG (SEQ ID NO:23), and a heavy chain CDR3 comprising SRDLAY (SEQ ID NO:24); and/or
(b) a light chain CDRl comprising KSSQSLLYSNGKTYLN (SEQ ID NO:27), a light chain CDR2 comprising QVSKLDS (SEQ ID NO:28), and a light chain CDR3 comprising VQGTDFPQT (SEQ ID NO:29).
16. An isolated antibody that specifically binds to an extracellular domain of human DDRl, wherein the antibody comprises a heavy chain variable region comprising: (a) a heavy chain CDRl comprising GYTFTDYFMK (SEQ ID NO:22), or a variant thereof comprising 1, 2, 3 or 4 amino acid substitutions; (b) a heavy chain CDR2 comprising DINPNNGDTFYIQKFKG (SEQ ID NO:23), or a variant thereof comprising 1, 2, 3 or 4 amino acid substitutions; and/or (c) a heavy chain CDR3 comprising SRDLAY (SEQ DD NO:24), or a variant thereof comprising 1, 2, 3 or 4 amino acid substitutions.
17. The antibody of claim 16, further comprising a light chain variable region comprising: (a) a light chain CDRl comprising KSSQSLLYSNGKTYLN (SEQ ID NO:27), or a variant thereof comprising 1, 2, 3 or 4 amino acid substitutions; (b) a light chain CDR2 comprising QVSKLDS (SEQ ID NO:28), or a variant thereof comprising 1, 2, 3 or 4 amino acid substitutions; and/or (c) a light chain CDR3 comprising VQGTDFPQT (SEQ ID NO:29), or a variant thereof comprising
1 , 2, 3 or 4 amino acid substitutions.
18. An isolated antibody that specifically binds to an extracellular domain of human DDRl, wherein the antibody comprises a light chain variable region comprising: (a) a light chain CDRl comprising KSSQSLLYSNGKTYLN (SEQ ID NO:27), or a variant thereof comprising 1, 2, 3 or 4 amino acid substitutions; (b) a light chain CDR2 comprising QVSKLDS (SEQ ID NO:28), or a variant thereof comprising 1, 2, 3 or 4 amino acid substitutions; and/or (c) a light chain CDR3 comprising VQGTDFPQT (SEQ ID NO:29), or a variant thereof comprising 1, 2, 3 or 4 amino acid substitutions.
19. The antibody according to any one of claims 16-18, wherein the amino acid substitutions are conservative amino acid substitutions.
20. An isolated antibody that specifically binds to an extracellular domain of human DDRl, wherein the antibody binds to the same DDRl epitope as the epitope to which antibody 2OM 102 binds, wherein the antibody 2OM 102 is produced by the hybridoma cell line deposited as ATCC deposit number PTA-10051.
21. An isolated antibody that competes with the antibody according to any of one of the claims 1-20 for specific binding to the extracellular domain of human DDRl .
22. An isolated antibody that competes with antibody 20M102 for specific binding to the extracellular domain of human DDRl .
23. An isolated antibody that specifically binds to an extracellular domain of human DDRl, wherein the antibody comprises: (a) a heavy chain variable region having at least 90% sequence identity to SEQ ID NO:33; and/or (b) a light chain variable region having at least 90% sequence identity to SEQ ID NO:35.
24. The antibody of claim 23, wherein the heavy chain variable region has at least 95% sequence identity to SEQ ID NO:33, and/or the light chain variable region has at least 95% sequence identity to SEQ ID NO:35.
25. The antibody of claim 23, wherein the heavy chain variable region comprises the sequence of SEQ DD NO:33, and/or the light chain variable region comprises the sequence of SEQ ID NO:35.
26. An isolated antibody which specifically binds to an extracellular domain of human DDRl and modulates the activity of DDRl, wherein the antibody reduces the frequency of cancer stem cells in a tumor.
27. The antibody of claim 26, which further specifically binds DDR2.
28. The antibody according to any one of claims 1-27, which is an IgA, IgD, IgE, IgG or IgM antibody.
29. The antibody according to any one of claims 1-28, which is an IgGl antibody.
30. The antibody according to any one of claims 1-28, which is an IgG2 antibody.
31. The antibody according to any one of claims 1-30, which is a monoclonal antibody.
32. The antibody according to any one of claims 1-31, which is a chimeric antibody.
33. The antibody according to any one of claims 1-32, which is a humanized antibody.
34. The antibody according to any one of claims 1-31, which is a human antibody.
35. The antibody according to any one of claims 1-34, which is an antibody fragment.
36. The antibody according to any one of claims 1-35, which is a monovalent antibody.
37. A pharmaceutical composition comprising the antibody according to any one of claims 1-36 and a pharmaceutically acceptable carrier.
38. A pharmaceutical composition comprising the antibody according to any one of claims 1-36 and at least one additional anti-cancer agent.
39. An isolated polynucleotide molecule encoding the antibody according to any one of claims 1-36.
40. An expression vector comprising the polynucleotide molecule of claim 39.
41. A host cell comprising the expression vector of claim 40.
42. A method of inhibiting activity of DDRl on a cell, comprising contacting the cell with an effective amount of the antibody according to any one of claims 1-36.
43. The method of claim 42, wherein the cell is a tumor cell.
44. A method of inhibiting growth of a tumor in a subject, comprising administering to the subject a therapeutically effective amount of the antibody according to any one of claims 1-36.
45. A method of reducing tumorigenicity of a tumor that comprises cancer stem cells in a subject, said method comprising administering to the subject a therapeutically effective amount of the antibody according to any one of claims 1-36, wherein the frequency of cancer stem cells in the tumor is reduced by administration of the antibody.
46. The method of claim 44 or 45, wherein the tumor is selected from the group consisting of a breast tumor, colorectal tumor, hepatic tumor, renal tumor, lung tumor, pancreatic tumor, ovaπan tumor, prostate tumor, and head and neck tumor.
47. A method of treating cancer in a subject composing administering to the subject a therapeutically effective amount of the antibody according to any one of claims 1-36.
48. The method of claim 47, wherein the cancer is selected from the group consisting of a breast cancer, colorectal cancer, hepatic cancer, kidney cancer, liver cancer, lung cancer, pancreatic cancer, gastrointestinal cancer, melanoma, ovaπan cancer, prostate cancer, cervical cancer, bladder cancer, glioblastoma, and head and neck cancer.
49. The method of any one of claims 44-48, which further comprises administering to the subject at least one additional anti-cancer agent.
50. The method of claim 49, wherein the at least one additional anti-cancer agent is innotecan or gemcitabme.
51. The method of claim 44 or 45, wherein the tumor expresses LGR5.
52. The method of claim 51, wherein the tumor is a colorectal tumor, hepatic tumor, ovaπan tumor, or pancreatic tumor.
53. The method of claim 44 or 45, wherein the tumor expresses Hesl .
54 The method of claim 53, wherein the tumor is a breast tumor, colorectal tumor, renal tumor, lung tumor, pancreatic tumor, or prostate tumor.
55. The method according to any one of claims 44-54, wherein the subject is a human
56. A method of reducing the tumoπgemcity of a tumor that compπses cancer stem cells by reducing the frequency of cancer stem cells in the tumor, said method compπsmg contacting the tumor with an effective amount of an antibody that modulates the activity of DDRl.
57. An isolated polypeptide composing: (a) a polypeptide having the ammo acid sequence of SEQ ID NO.33; and/or (b) a polypeptide having the ammo acid sequence of SEQ ID NO:35.
58. An isolated polypeptide comprising: (a) a polypeptide having at least a portion of the amino acid sequence of SEQ ID NO:33; and/or (b) a polypeptide having at least a portion of the ammo acid sequence of SEQ ID NO:35.
59. An isolated polynucleotide encoding the polypeptide of claim 57 or 58.
60. An expression vector comprising the polynucleotide of claim 59.
61. A host cell comprising the expression vector of claim 60.
62. An antibody produced by the hybridoma cell line deposited as ATCC deposit number PTA- 10051.
63. A hybridoma cell line 2OM 102 on deposit with ATCC as PTA-10051.
64. A method of identifying an antibody that inhibits activity of DDRl, the method comprising: assaying an antibody for specific binding to human DDRl and for specific binding to a variant of human DDRl in which the sequence SASSSWSDSTAAR (SEQ ID NO:30) has been replaced by sequence SASSSASDSTAAR (SEQ ID NO:31), wherein a reduction in binding by the antibody to the variant human DDRl as compared to human DDRl identifies an antibody that inhibits activity of DDRl.
65. The antibody of claim 26, which binds the discoidin domain of DDRl (SEQ ID NO:41).
66. The method of claim 56, wherein the antibody that modulates the activity of DDRl binds the discoidin domain of DDRl (SEQ ID NO:41).
PCT/US2009/053596 2008-08-12 2009-08-12 Ddr1-binding agents and methods of use thereof Ceased WO2010019702A2 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
US13/058,684 US8652843B2 (en) 2008-08-12 2009-08-12 DDR1-binding agents and methods of use thereof
US14/148,669 US9206256B2 (en) 2008-08-12 2014-01-06 DDR1-binding agents and methods of use thereof

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US8828608P 2008-08-12 2008-08-12
US61/088,286 2008-08-12
US21825909P 2009-06-18 2009-06-18
US61/218,259 2009-06-18

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US13/058,684 A-371-Of-International US8652843B2 (en) 2008-08-12 2009-08-12 DDR1-binding agents and methods of use thereof
US14/148,669 Division US9206256B2 (en) 2008-08-12 2014-01-06 DDR1-binding agents and methods of use thereof

Publications (2)

Publication Number Publication Date
WO2010019702A2 true WO2010019702A2 (en) 2010-02-18
WO2010019702A3 WO2010019702A3 (en) 2010-06-10

Family

ID=41669658

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2009/053596 Ceased WO2010019702A2 (en) 2008-08-12 2009-08-12 Ddr1-binding agents and methods of use thereof

Country Status (2)

Country Link
US (2) US8652843B2 (en)
WO (1) WO2010019702A2 (en)

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2518157A1 (en) * 2011-04-26 2012-10-31 Sanofi Test Systems and methods for identifying a compound altering cellular DDR activity
WO2013027802A1 (en) 2011-08-23 2013-02-28 中外製薬株式会社 Novel anti-ddr1 antibody having anti-tumor activity
WO2013034933A1 (en) 2011-09-08 2013-03-14 Imperial Innovations Limited Anti ddr1 antibodies, their uses and methods identifying them
WO2013038191A2 (en) 2011-09-16 2013-03-21 Bioceros B.V. Anti-cd134 (ox40) antibodies and uses thereof
WO2013068836A1 (en) 2011-11-07 2013-05-16 INSERM (Institut National de la Santé et de la Recherche Médicale) A ddr1 antagonist or an inhibitor of ddr1 gene expression for use in the prevention or treatment of crescentic glomerulonephritis
WO2014047624A1 (en) * 2012-09-24 2014-03-27 Gilead Sciences, Inc. Anti-ddr1 antibodies
WO2014148895A1 (en) 2013-03-18 2014-09-25 Biocerox Products B.V. Humanized anti-cd134 (ox40) antibodies and uses thereof
KR20150026612A (en) * 2013-09-03 2015-03-11 삼성전자주식회사 Composition and kit for cancer cell, and method for separating cancer cell using the same
CN111094346A (en) * 2017-07-06 2020-05-01 塔斯克疗法有限公司 Compounds and methods for tumor-specific cell depletion
EP4076526A4 (en) * 2019-12-17 2024-07-03 The Board Of Regents Of The University Of Texas System NOVEL DDR1 ANTIBODIES AND USES THEREOF

Families Citing this family (86)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2227487A1 (en) * 2007-12-28 2010-09-15 Novo Nordisk A/S Ddr1-mediated cell purification of pancreatic endocrine cells through their progenitors
CN101983336A (en) * 2008-04-03 2011-03-02 诺沃-诺迪斯克有限公司 Dner-mediated cell purification of pancreatic endocrine pre-progenitor cells and their progeny
US8652843B2 (en) 2008-08-12 2014-02-18 Oncomed Pharmaceuticals, Inc. DDR1-binding agents and methods of use thereof
US9499856B2 (en) 2012-04-02 2016-11-22 The Board Institute, Inc. DDR2 mutations in squamous cell lung cancer
CA3077539C (en) * 2012-12-27 2023-09-12 Quest Diagnostics Investments Incorporated Ddr2 mutations as targetable features of melanoma or basal cell carcinoma
WO2015081127A2 (en) 2013-11-26 2015-06-04 Gilead Sciences, Inc. Therapies for treating myeloproliferative disorders
CA2937320A1 (en) 2014-01-20 2015-07-23 Gilead Sciences, Inc. Therapies for treating cancers
US20170158762A1 (en) * 2014-01-30 2017-06-08 Anaptysbio, Inc. Antibodies directed against discoidin domain receptor family, member 1 (ddr1)
TW201639573A (en) 2015-02-03 2016-11-16 吉李德科學股份有限公司 Combination therapies for treating cancers
US9670205B2 (en) 2015-03-04 2017-06-06 Gilead Sciences, Inc. Toll like receptor modulator compounds
US20190054090A1 (en) 2015-10-01 2019-02-21 Gilead Sciences, Inc. Combination of a btk inhibitor and a checkpoint inhibitor for treating cancers
CU20180059A7 (en) 2015-12-17 2018-10-04 Gilead Sciences Inc INHIBITING COMPOUNDS OF THE QUINASA DE UNIÓN A TANK
AU2017228371A1 (en) 2016-03-04 2018-09-13 Gilead Sciences, Inc. Compositions and combinations of autotaxin inhibitors
EP3440113A1 (en) 2016-04-08 2019-02-13 Gilead Sciences, Inc. Compositions and methods for treating cancer, inflammatory diseases and autoimmune diseases
UA126905C2 (en) 2016-06-13 2023-02-22 Ай-Маб Байофарма Юес Лімітед Anti-pd-l1 antibodies and uses thereof
CA3032813A1 (en) 2016-08-04 2018-02-08 Gilead Sciences, Inc. Cobicistat for use in cancer treatments
WO2018045150A1 (en) 2016-09-02 2018-03-08 Gilead Sciences, Inc. 4,6-diamino-pyrido[3,2-d]pyrimidine derivaties as toll like receptor modulators
AU2017318601B2 (en) 2016-09-02 2020-09-03 Gilead Sciences, Inc. Toll like receptor modulator compounds
US20180133212A1 (en) 2016-11-03 2018-05-17 Gilead Sciences, Inc. Combination of a bcl-2 inhibitor and a bromodomain inhibitor for treating cancer
WO2018097977A1 (en) 2016-11-22 2018-05-31 Gilead Sciences, Inc. Crystalline forms of a phosphate complex of a bet inhibitor
CA3045376C (en) 2017-01-24 2022-08-30 I-Mab Anti-cd73 antibodies and uses thereof
AU2018224136B2 (en) 2017-02-24 2021-10-21 Gilead Sciences, Inc. Inhibitors of Bruton's Tyrosine Kinase
US10314844B2 (en) 2017-02-24 2019-06-11 Gilead Sciences, Inc. Inhibitors of Bruton's tyrosine kinase
BR102018007822A2 (en) 2017-04-20 2018-11-06 Gilead Sciences, Inc. compound, methods for inhibiting pd-1, pd-11 and / or interaction of pd-1 / pd-11 and for cancer treatment, pharmaceutical composition, and kit for treating or preventing cancer or a disease or condition
WO2019123339A1 (en) 2017-12-20 2019-06-27 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'3' cyclic dinucleotides with phosphonate bond activating the sting adaptor protein
EP3728283B1 (en) 2017-12-20 2023-11-22 Institute of Organic Chemistry and Biochemistry ASCR, V.V.I. 3'3' cyclic dinucleotides with phosphonate bond activating the sting adaptor protein
CR20200347A (en) 2018-02-13 2020-09-23 Gilead Sciences Inc Pd-1/pd-l1 inhibitors
TW202005654A (en) 2018-04-06 2020-02-01 捷克科學院有機化學與生物化學研究所 2'2'-cyclic dinucleotides
TWI833744B (en) 2018-04-06 2024-03-01 捷克科學院有機化學與生物化學研究所 3'3'-cyclic dinucleotides
TWI818007B (en) 2018-04-06 2023-10-11 捷克科學院有機化學與生物化學研究所 2'3'-cyclic dinucleotides
TWI712412B (en) 2018-04-19 2020-12-11 美商基利科學股份有限公司 Pd-1/pd-l1 inhibitors
US20190359645A1 (en) 2018-05-03 2019-11-28 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'3'-cyclic dinucleotides comprising carbocyclic nucleotide
JP2021523151A (en) 2018-05-11 2021-09-02 ホスホレックス、インコーポレイテッド Microparticles and nanoparticles with negative surface charge
KR102551319B1 (en) 2018-05-14 2023-07-05 길리애드 사이언시즈, 인코포레이티드 MCL-1 inhibitor
SG11202012425QA (en) 2018-07-13 2021-01-28 Gilead Sciences Inc Pd-1/pd-l1 inhibitors
EP3860717A1 (en) 2018-10-03 2021-08-11 Gilead Sciences, Inc. Imidozopyrimidine derivatives
WO2020086556A1 (en) 2018-10-24 2020-04-30 Gilead Sciences, Inc. Pd-1/pd-l1 inhibitors
US11203591B2 (en) 2018-10-31 2021-12-21 Gilead Sciences, Inc. Substituted 6-azabenzimidazole compounds
WO2020092528A1 (en) 2018-10-31 2020-05-07 Gilead Sciences, Inc. Substituted 6-azabenzimidazole compounds having hpk1 inhibitory activity
EP3934757B1 (en) 2019-03-07 2023-02-22 Institute of Organic Chemistry and Biochemistry ASCR, V.V.I. 2'3'-cyclic dinucleotides and prodrugs thereof
WO2020178768A1 (en) 2019-03-07 2020-09-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide as sting modulator
WO2020178770A1 (en) 2019-03-07 2020-09-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3'3'-cyclic dinucleotides and prodrugs thereof
TW202212339A (en) 2019-04-17 2022-04-01 美商基利科學股份有限公司 Solid forms of a toll-like receptor modulator
TWI751516B (en) 2019-04-17 2022-01-01 美商基利科學股份有限公司 Solid forms of a toll-like receptor modulator
EP3972695A1 (en) 2019-05-23 2022-03-30 Gilead Sciences, Inc. Substituted exo-methylene-oxindoles which are hpk1/map4k1 inhibitors
CA3140708A1 (en) 2019-06-18 2020-12-24 Helen Horton Combination of hepatitis b virus (hbv) vaccines and pyridopyrimidine derivatives
WO2020263830A1 (en) 2019-06-25 2020-12-30 Gilead Sciences, Inc. Flt3l-fc fusion proteins and methods of use
ES2973832T3 (en) 2019-10-18 2024-06-24 Forty Seven Inc Combination therapies for the treatment of myelodysplastic syndromes and acute myeloid leukemia
JP2022552748A (en) 2019-10-31 2022-12-19 フォーティ セブン, インコーポレイテッド Treatment of hematological cancers with anti-CD47 and anti-CD20
TWI778443B (en) 2019-11-12 2022-09-21 美商基利科學股份有限公司 Mcl1 inhibitors
IL294032A (en) 2019-12-24 2022-08-01 Carna Biosciences Inc Diacylglycerol kinase modulating compounds
TWI890283B (en) 2020-02-14 2025-07-11 美商基利科學股份有限公司 Antibodies and fusion proteins that bind to ccr8 and uses thereof
IL297327B2 (en) 2020-05-01 2026-01-01 Gilead Sciences Inc Cd73 inhibiting 2,4-dioxopyrimidine compounds
TW202302145A (en) 2021-04-14 2023-01-16 美商基利科學股份有限公司 Co-inhibition of cd47/sirpα binding and nedd8-activating enzyme e1 regulatory subunit for the treatment of cancer
WO2022245671A1 (en) 2021-05-18 2022-11-24 Gilead Sciences, Inc. Methods of using flt3l-fc fusion proteins
MX2023014762A (en) 2021-06-23 2024-01-15 Gilead Sciences Inc DIACYL GLYCEROL KINASE MODULATING COMPOUNDS.
JP7651018B2 (en) 2021-06-23 2025-03-25 ギリアード サイエンシーズ, インコーポレイテッド Diacylglycerol kinase modulating compounds
AU2022299051B2 (en) 2021-06-23 2025-03-13 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
JP7686091B2 (en) 2021-06-23 2025-05-30 ギリアード サイエンシーズ, インコーポレイテッド Diacylglycerol kinase modulating compounds
AU2022375782B2 (en) 2021-10-28 2026-02-26 Gilead Sciences, Inc. Pyridizin-3(2h)-one derivatives
JP7787991B2 (en) 2021-10-29 2025-12-17 ギリアード サイエンシーズ, インコーポレイテッド CD73 compound
WO2023107956A1 (en) 2021-12-08 2023-06-15 Dragonfly Therapeutics, Inc. Proteins binding nkg2d, cd16 and 5t4
US20230220106A1 (en) 2021-12-08 2023-07-13 Dragonfly Therapeutics, Inc. Antibodies targeting 5t4 and uses thereof
KR20240123836A (en) 2021-12-22 2024-08-14 길리애드 사이언시즈, 인코포레이티드 Icarus zinc finger family decomposers and their uses
US12122764B2 (en) 2021-12-22 2024-10-22 Gilead Sciences, Inc. IKAROS zinc finger family degraders and uses thereof
TW202340168A (en) 2022-01-28 2023-10-16 美商基利科學股份有限公司 Parp7 inhibitors
WO2023178181A1 (en) 2022-03-17 2023-09-21 Gilead Sciences, Inc. Ikaros zinc finger family degraders and uses thereof
KR20240165995A (en) 2022-03-24 2024-11-25 길리애드 사이언시즈, 인코포레이티드 Combination therapy for the treatment of TROP-2 expressing cancers
TWI876305B (en) 2022-04-05 2025-03-11 美商基利科學股份有限公司 Combination therapy for treating colorectal cancer
CR20240451A (en) 2022-04-21 2024-12-04 Gilead Sciences Inc Kras g12d modulating compounds
KR20250028371A (en) 2022-07-01 2025-02-28 길리애드 사이언시즈, 인코포레이티드 CD73 compound
CN116027038A (en) * 2022-09-16 2023-04-28 菲创生物医学技术(广州)有限公司 Use of discoid domain receptor 2 in the diagnosis of glioma and related computer readable medium
WO2024064668A1 (en) 2022-09-21 2024-03-28 Gilead Sciences, Inc. FOCAL IONIZING RADIATION AND CD47/SIRPα DISRUPTION ANTICANCER COMBINATION THERAPY
AU2023409398A1 (en) 2022-12-22 2025-06-05 Gilead Sciences, Inc. Prmt5 inhibitors and uses thereof
AU2024252725A1 (en) 2023-04-11 2025-11-06 Gilead Sciences, Inc. Kras modulating compounds
CR20250446A (en) 2023-04-21 2025-12-02 Gilead Sciences Inc PRMT5 INHIBITORS AND THEIR USES
AU2024306338A1 (en) 2023-06-30 2026-01-08 Gilead Sciences, Inc. Kras modulating compounds
CN121620513A (en) 2023-07-26 2026-03-06 吉利德科学公司 PARP7 inhibitors
KR20260046403A (en) 2023-07-26 2026-04-07 길리애드 사이언시즈, 인코포레이티드 PARP7 inhibitor
US20250109147A1 (en) 2023-09-08 2025-04-03 Gilead Sciences, Inc. Kras g12d modulating compounds
US20250101042A1 (en) 2023-09-08 2025-03-27 Gilead Sciences, Inc. Kras g12d modulating compounds
US20250154172A1 (en) 2023-11-03 2025-05-15 Gilead Sciences, Inc. Prmt5 inhibitors and uses thereof
WO2025137640A1 (en) 2023-12-22 2025-06-26 Gilead Sciences, Inc. Azaspiro wrn inhibitors
WO2025245003A1 (en) 2024-05-21 2025-11-27 Gilead Sciences, Inc. Prmt5 inhibitors and uses thereof
US20260098049A1 (en) 2024-08-12 2026-04-09 Gilead Sciences, Inc. Kras modulating compounds
CN118909125B (en) * 2024-10-10 2025-01-03 杭州美赛生物医药科技有限公司 Anti-DDR1 antibodies and their applications

Family Cites Families (41)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US4485045A (en) 1981-07-06 1984-11-27 Research Corporation Synthetic phosphatidyl cholines useful in forming liposomes
US4588585A (en) 1982-10-19 1986-05-13 Cetus Corporation Human recombinant cysteine depleted interferon-β muteins
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4544545A (en) 1983-06-20 1985-10-01 Trustees University Of Massachusetts Liposomes containing modified cholesterol for organ targeting
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
GB8823869D0 (en) 1988-10-12 1988-11-16 Medical Res Council Production of antibodies
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5013556A (en) 1989-10-20 1991-05-07 Liposome Technology, Inc. Liposomes with enhanced circulation time
ATE158021T1 (en) 1990-08-29 1997-09-15 Genpharm Int PRODUCTION AND USE OF NON-HUMAN TRANSGENT ANIMALS FOR THE PRODUCTION OF HETEROLOGUE ANTIBODIES
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
CA2095633C (en) 1990-12-03 2003-02-04 Lisa J. Garrard Enrichment method for variant proteins with altered binding properties
CA2175893C (en) * 1993-11-23 2010-06-22 Paul J. Godowski Protein tyrosine kinases named rse
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
ATE299938T1 (en) 1997-05-02 2005-08-15 Genentech Inc A METHOD FOR PRODUCING MULTI-SPECIFIC ANTIBODIES THAT POSSESS HETEROMULTIMER AND COMMON COMPONENTS
US6004528A (en) 1997-09-18 1999-12-21 Bergstein; Ivan Methods of cancer diagnosis and therapy targeted against the cancer stemline
US8044259B2 (en) 2000-08-03 2011-10-25 The Regents Of The University Of Michigan Determining the capability of a test compound to affect solid tumor stem cells
US20040029129A1 (en) * 2001-10-25 2004-02-12 Liangsu Wang Identification of essential genes in microorganisms
US20070031438A1 (en) * 2001-12-10 2007-02-08 Junghans Richard P Antibodies as chimeric effector cell receptors against tumor antigens
US7855076B2 (en) 2002-03-12 2010-12-21 The United States Of America As Represented By The Department Of Health And Human Services Use of discoidin domain receptor 1 (DDR1) and agents that affect the DDR1/collagen pathway
AU2003210060B2 (en) 2002-03-22 2010-02-25 Aprogen, Inc. Humanized antibody and process for preparing same
US20050152899A1 (en) 2002-05-10 2005-07-14 Kinch Michael S. EphA2 agonistic monoclonal antibodies and methods of use thereof
WO2004029094A1 (en) 2002-09-28 2004-04-08 Sj Biomed Inc Monoclonal antibody specific for human mitochondrial adenylate kinase isozyme 3
CN1802388B (en) * 2003-05-09 2011-01-05 杜克大学 CD20 specific antibodies and methods of using the same
CA2565974A1 (en) 2004-05-14 2005-12-01 Receptor Biologix, Inc. Cell surface receptor isoforms and methods of identifying and using the same
CA2628255C (en) 2005-10-31 2016-04-19 The Regents Of The University Of Michigan Compositions and methods for treating and diagnosing cancer
RU2495882C2 (en) * 2006-09-08 2013-10-20 Медиммун, Ллк. Humanised cd19 antibodies and using them for treating transplantation-related oncological and autoimmune disease
DK2066694T3 (en) 2006-09-29 2016-02-08 Oncomed Pharm Inc Compositions and Methods for Diagnosing and Treating Cancer
WO2008070090A2 (en) 2006-12-05 2008-06-12 Oncomed Pharmaceuticals, Inc. Compositions and methods for diagnosing and treating cancer
DE602007000910D1 (en) 2007-01-12 2009-05-28 St Microelectronics Res & Dev Power supply for an image sensor
EP2173379B2 (en) 2007-07-02 2023-07-05 Oncomed Pharmaceuticals, Inc. Compositions and methods for treating and diagnosing cancer
JP6157046B2 (en) 2008-01-07 2017-07-05 アムジェン インコーポレイテッド Method for generating antibody Fc heterodimer molecules using electrostatic steering effect
US8652843B2 (en) 2008-08-12 2014-02-18 Oncomed Pharmaceuticals, Inc. DDR1-binding agents and methods of use thereof
US9550835B2 (en) 2011-08-23 2017-01-24 Chugai Seiyaku Kabushiki Kaisha Anti-DDR1 antibody having anti-tumor activity
US20140086913A1 (en) 2012-09-24 2014-03-27 Gilead Sciences, Inc. Anti-ddr1 antibodies

Cited By (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012146585A1 (en) * 2011-04-26 2012-11-01 Sanofi Test systems and methods for identifying a compound altering cellular ddr activity
EP2518157A1 (en) * 2011-04-26 2012-10-31 Sanofi Test Systems and methods for identifying a compound altering cellular DDR activity
JPWO2013027802A1 (en) * 2011-08-23 2015-03-19 中外製薬株式会社 Novel anti-DDR1 antibody having antitumor activity
WO2013027802A1 (en) 2011-08-23 2013-02-28 中外製薬株式会社 Novel anti-ddr1 antibody having anti-tumor activity
US9550835B2 (en) 2011-08-23 2017-01-24 Chugai Seiyaku Kabushiki Kaisha Anti-DDR1 antibody having anti-tumor activity
EP2749572A4 (en) * 2011-08-23 2015-04-01 Chugai Pharmaceutical Co Ltd NOVEL ANTI-DDR1 ANTIBODY HAVING ANTI-TUMOR ACTIVITY
WO2013034933A1 (en) 2011-09-08 2013-03-14 Imperial Innovations Limited Anti ddr1 antibodies, their uses and methods identifying them
EP3409689A1 (en) 2011-09-16 2018-12-05 BiocerOX Products B.V. Anti-cd134 (ox40) antibodies and uses thereof
WO2013038191A2 (en) 2011-09-16 2013-03-21 Bioceros B.V. Anti-cd134 (ox40) antibodies and uses thereof
US9475880B2 (en) 2011-09-16 2016-10-25 Biocerox Products, B.V. Anti-CD134 (OX40) antibodies and uses thereof
WO2013068836A1 (en) 2011-11-07 2013-05-16 INSERM (Institut National de la Santé et de la Recherche Médicale) A ddr1 antagonist or an inhibitor of ddr1 gene expression for use in the prevention or treatment of crescentic glomerulonephritis
US20140286965A1 (en) * 2011-11-07 2014-09-25 Inserm Ddr1 antagonist or an inhibitor of ddr1 gene expression for use in the prevention or treatment of crescentic glomerulonephritis
WO2014047624A1 (en) * 2012-09-24 2014-03-27 Gilead Sciences, Inc. Anti-ddr1 antibodies
US9790281B2 (en) 2013-03-18 2017-10-17 Biocerox Products, B.V. Humanized anti-CD134 (OX40) antibodies and uses thereof
WO2014148895A1 (en) 2013-03-18 2014-09-25 Biocerox Products B.V. Humanized anti-cd134 (ox40) antibodies and uses thereof
EP3409690A1 (en) 2013-03-18 2018-12-05 BiocerOX Products B.V. Humanized anti-cd134 (ox40) antibodies and uses thereof
US10273307B2 (en) 2013-03-18 2019-04-30 Biocerox Products B.V. Humanized anti-CD134 (OX40) antibodies and uses thereof
KR20150026612A (en) * 2013-09-03 2015-03-11 삼성전자주식회사 Composition and kit for cancer cell, and method for separating cancer cell using the same
KR102113310B1 (en) * 2013-09-03 2020-05-20 아주대학교 산학협력단 Composition and kit for cancer cell, and method for separating cancer cell using the same
CN111094346A (en) * 2017-07-06 2020-05-01 塔斯克疗法有限公司 Compounds and methods for tumor-specific cell depletion
EP4076526A4 (en) * 2019-12-17 2024-07-03 The Board Of Regents Of The University Of Texas System NOVEL DDR1 ANTIBODIES AND USES THEREOF
US12331130B2 (en) 2019-12-17 2025-06-17 The Board Of Regents Of The University Of Texas System DDR1 antibodies and uses thereof

Also Published As

Publication number Publication date
US20140199312A1 (en) 2014-07-17
WO2010019702A3 (en) 2010-06-10
US20110287011A1 (en) 2011-11-24
US8652843B2 (en) 2014-02-18
US9206256B2 (en) 2015-12-08

Similar Documents

Publication Publication Date Title
US9206256B2 (en) DDR1-binding agents and methods of use thereof
EP2307459B1 (en) Notch1 receptor binding agents and methods of use thereof
AU2008209482B2 (en) Compositions and methods for diagnosing and treating cancer
EP2481756B1 (en) Compositions and methods for diagnosing and treating cancer
EP3357932A1 (en) Compositions and methods for diagnosing and treating cancer
US20160243223A1 (en) Methods for treating cancers comprising k-ras mutations
US20150132301A1 (en) Combination Therapy for Treatment of Cancer
US9480744B2 (en) Methods for treating melanoma
WO2009142738A2 (en) Compositions and methods for diagnosing and treating cancer
US20140186342A1 (en) Compositions and Methods for Diagnosing and Treating Cancer
US20090208491A1 (en) Compositions and Methods for Diagnosing and Treating Cancer
AU2009269096B9 (en) Notch1 receptor binding agents and methods of use thereof
HK1151296B (en) Notch1 receptor binding agents and methods of use thereof
HK1174047A (en) Compositions and methods for diagnosing and treating cancer

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 09807247

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 13058684

Country of ref document: US

122 Ep: pct application non-entry in european phase

Ref document number: 09807247

Country of ref document: EP

Kind code of ref document: A2

NENP Non-entry into the national phase

Ref country code: DE