WO2010011947A2 - AMYLOID ß PEPTIDE ANALOGUES, OLIGOMERS THEREOF, PROCESSES FOR PREPARING AND COMPOSITIONS COMPRISING SAID ANALOGUES OR OLIGOMERS, AND THEIR USES - Google Patents
AMYLOID ß PEPTIDE ANALOGUES, OLIGOMERS THEREOF, PROCESSES FOR PREPARING AND COMPOSITIONS COMPRISING SAID ANALOGUES OR OLIGOMERS, AND THEIR USES Download PDFInfo
- Publication number
- WO2010011947A2 WO2010011947A2 PCT/US2009/051721 US2009051721W WO2010011947A2 WO 2010011947 A2 WO2010011947 A2 WO 2010011947A2 US 2009051721 W US2009051721 W US 2009051721W WO 2010011947 A2 WO2010011947 A2 WO 2010011947A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- acid residue
- sequence
- amyloid
- covalently linked
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4711—Alzheimer's disease; Amyloid plaque core protein
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/46—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from vertebrates
- G01N2333/47—Assays involving proteins of known structure or function as defined in the subgroups
- G01N2333/4701—Details
- G01N2333/4709—Amyloid plaque core protein
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
- G01N2500/04—Screening involving studying the effect of compounds C directly on molecule A (e.g. C are potential ligands for a receptor A, or potential substrates for an enzyme A)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/28—Neurological disorders
- G01N2800/2814—Dementia; Cognitive disorders
- G01N2800/2821—Alzheimer
Definitions
- the subject invention relates to amyloid ⁇ peptide analogues, oligomers comprising a plurality of said amyloid ⁇ peptide analogues, processes for preparing the amyloid ⁇ peptide analogues or oligomers, compositions comprising the amyloid ⁇ peptide analogues or oligomers, and uses of the amyloid ⁇ peptide analogues or oligomers such as their use for treating or preventing an amyloidosis (e.g. by active immunization), for diagnosing an amyloidosis, and for providing agents that are capable of binding to the amyloid ⁇ peptide analogues or oligomers.
- an amyloidosis e.g. by active immunization
- the subject invention also describes agents that are capable of binding to the amyloid ⁇ peptide analogues or oligomers, e.g. antibodies, compositions comprising the agents, and uses of the agents such as their use for treating or preventing an amyloidosis (e.g. by passive immunization) and for diagnosing an amyloidosis.
- agents that are capable of binding to the amyloid ⁇ peptide analogues or oligomers e.g. antibodies, compositions comprising the agents, and uses of the agents such as their use for treating or preventing an amyloidosis (e.g. by passive immunization) and for diagnosing an amyloidosis.
- AD Alzheimer's disease
- AD Alzheimer's disease
- extracellular amyloid plaques these deposits consist mostly of amyloid- ⁇ -peptide filaments, and in the case of the intracellular neurofibrillary tangles (NFTs), mostly of the tau protein.
- NFTs neurofibrillary tangles
- the amyloid ⁇ (A ⁇ ) peptide arises from the ⁇ - amyloid precursor protein by proteolytic cleavage. This cleavage is effected by the cooperative activity of several proteases named o, ⁇ - and ⁇ -secretase. Cleavage leads to a number of specific fragments of differing length.
- amyloid plaques consist mostly of peptides with a length of 40 or 42 amino acids (A ⁇ 40, A ⁇ 42).
- the dominant cleavage product is A ⁇ 40; however, A ⁇ 42 has a much stronger toxic effect.
- Cerebral amyloid deposits and cognitive impairments very similar to those observed in Alzheimer's disease are also hallmarks of Down's syndrome (trisomy 21 ), which occurs at a frequency of about 1 in 800 births.
- the amyloid cascade hypothesis of Hardy and Higgins postulated that increased production of A ⁇ (1-42) would lead to the formation of protofibrils and fibrils (i.e., the principal components of A ⁇ plaques), these fibrils being responsible for the symptoms of Alzheimer's disease.
- this hypothesis was favored until recently.
- US 7,342,091 describes soluble cyclic analogues of amyloid ⁇ peptide having an intra- peptide bridge in the region between between residues Gln15 and Val24 (686 and 695 in APP), with the two amino acids that participate in the bridge formnation being arranged at relative separations of i+3, i+4, i+5, i+6 or i+7.
- the side chains of Asp17 and Lys21 of the A ⁇ peptide are connected via a co- valent bridge.
- the soluble cyclic analogues of amyloid ⁇ peptide described in US 7,342,091 are designed to inhibit amyloidogenesis or amyloid formation by endogenous A ⁇ peptide. That is, the soluble cyclic analogues are supposed to physically interact with the A ⁇ peptide and block amyloid from forming.
- AD brains which correlates better with AD symptoms than plaque load does, has, however, led to a revised amyloid-cascade-hypothesis.
- WO 2004/067561 relates to globular oligomers ("globulomers") of A ⁇ (1- 42) peptide and a process for preparing them.
- the data suggest the existence of an amyloid fibril independent pathway of A ⁇ folding and assembly into A ⁇ oligomers which display one or more unique epitopes (hereinafter referred to as the globulomer epitopes). Since globu- lomer epitopes were detected in the brain of AD patients and APP transgenic mice and the globulomers specifically bind to neurons and blocks LTP, the globulomers represent a pathologically relevant A ⁇ conformer.
- WO 2004/067561 further describes that limited proteolysis of the globulomers yields truncated versions of said globulomers such as A ⁇ (20-42) or A ⁇ (12-42) globulomers. These A ⁇ (20-42) and A ⁇ (12-42) globulomers have been used to generate globulomer-specific antibodies. For instance, WO 2007/062852 describes several monoclonal antibodies which specifically recognize A ⁇ (20-42) globulomer.
- WO 2006/094724 relates to non-diffusible globular A ⁇ (X - 38 .. 43) oligomers wherein X is selected from the group consisting of numbers 1 .. 24.
- These globulomers are said to be obtainable by same processes as described in WO 2004/067561 , i.e. SDS- or fatty acid- induced oligomerization of A ⁇ (1 - 38 .. 43) peptide to generate A ⁇ (1 - 38 .. 43) globulomers, and limited proteolysis of A ⁇ (1 - 38 .. 43) globulomers to generate truncated versions thereof, i.e., A ⁇ (X - 38 .. 43) globulomers wherein X is selected from the group consisting of numbers 2 .. 24.
- Both, WO 2004/067561 and WO 2006/094724 also describe cross-linked globulomers obtained by reacting a globulomer with cross-linking agents such as glutardialdehyde.
- Cross- linking was observed to occur only between amino groups of the N-termini and Lys-16, while sparing Lys-28 which must therefore be hidden in the interior of the A ⁇ (1 - 42) globulomer.
- the resultant cross-link is primarily inter-molecular rather than intra-molecular.
- WO 2007/064917 describes the cloning, expression and isolation of recombinant forms of amyloid ⁇ peptide.
- the peptide expressed in E. coli completely retains its N-terminal methionine residue and represents the native sequence of amyloid beta from positions 0 to po- sition 42 (referred to hereafter as N-Met A ⁇ (1-42)).
- N-Met A ⁇ (1-42) pre-globulomer a small soluble aggregate
- N-Met A ⁇ (1-42) globulomer a higher MW soluble aggregate
- the N-Met A ⁇ (1-42) pre-globulomer has a MW of 16 kDa (corresponding to ⁇ 4 pep- tides/soluble aggregate) while the N-Met A ⁇ (1-42) globulomer has a MW of -64 kDa (corresponding to - 14-16 peptides/soluble aggregate).
- N-Met A ⁇ (1-42) pre-globulomer contains mixed intermolecular parallel / intramolecular anti-parallel ⁇ -sheets that are distinct from the all-parallel amyloid ⁇ -peptides found in structural studies of fibrils.
- Said methods of globulomer formation represent a huge step in the ability to form homogeneous A ⁇ oligomer preparations in high yields.
- this methodology can result in preparations showing some degree of heterogeneity, as sodium dodecyl sulfate (SDS) is removed, and over time.
- SDS sodium dodecyl sulfate
- amyloid ⁇ peptide analogues which display the relevant conformation or epitope, be it as a monomer or an oligomer.
- an amyloid ⁇ peptide analogue or oligomer thereof shows better phys- ico/chemical properties than the known globulomers, e.g. a smaller size, enhanced homogeneity, enhanced stability, increased lifetime, and/or greater resistance to proteases in vivo.
- a better reproducibility would be a further advantage.
- the present invention provides a stabilized conformation of the A ⁇ peptide, or portions thereof, that displays an epitope important for: 1 ) the toxic response involved in progression of Alzheimer's disease (the "toxic principle" embodied in the A ⁇ misfolded peptide), 2) the generation of therapeutically relevant antibodies which are specific for this conformation and do not cross-react with endogenous physiological monomeric A ⁇ peptide as it is detectable in CSF and plasma, and/or 3) the engendering of an immune response by active immunization eliciting an antibody response which is polyclonal but mono-specific for this toxic conformation and does not cross-react with endogenous physiological monomer A ⁇ peptide as it is detectable in CSF and plasma.
- This stabilization is achieved by an intra-molecular cova- lent bond that locks the peptide or a peptidomimetic thereof into a conformation that both is more stable and displays the needed epitope.
- the desired potency of these stabilized peptides or peptidomimetics can easily be measured by cross-reaction with available globulomer selective antibodies as described in WO 2007/064972 and WO 2007/062852 in standard immunoassays (e.g., immunoprecipitation, ELISA, dot blot), or in standard cellular assays used to assess toxicity of A ⁇ peptides.
- the present invention relates to amyloid ⁇ peptide analogues comprising an amino acid sequence, wherein the sequence (i) forms a loop, (ii) has at least 66 % identity to the amino acid sequence of native A ⁇ peptide or a portion thereof, (iii) com- prises at least 6 contiguous amino acid residues and (iv) has at least 2 non-contiguous amino acid residues which are covalently linked with each other.
- the present invention also relates to amyloid ⁇ peptide analogues which comprise a peptidomimetic of said amino acid sequence as defined herein.
- amyloid ⁇ peptide analogues include the following: the amyloid ⁇ peptide analogues, wherein the loop is a ⁇ -hairpin loop; the amyloid ⁇ peptide analogues of any one of the preceding embodiments, wherein native
- a ⁇ human peptide or the portion thereof is A ⁇ (X .. Y), X being selected from the group con- sisting of the numbers 1 .. 23 and Y being selected from the group consisting of the numbers 28 .. 43; the amyloid ⁇ peptide analogues of the preceding embodiment, wherein X is selected from the group consisting of the numbers 15 .. 23; the amyloid ⁇ peptide analogues of the preceding embodiment, wherein X is selected from the group consisting of the numbers 18 .. 22; the amyloid ⁇ peptide analogues of the preceding embodiment, wherein Y is selected from the group consisting of the numbers 28 ..
- amyloid ⁇ peptide analogues of any one of the preceding embodiments wherein native A ⁇ peptide or the portion thereof has a sequence selected from the group consisting of SEQ ID NO:1-368; the amyloid ⁇ peptide analogues of any one of the preceding embodiments, wherein the 6 contiguous amino acid residues comprise the sequence VGSN or DVGSNK; the amyloid ⁇ peptide analogues of any one of the preceding embodiments, wherein the 6 contiguous amino acid residues comprise the sequence AED; the amyloid ⁇ peptide analogues of any one of the preceding embodiments, wherein the amino acid sequence of the amyloid ⁇ peptide analogue comprises the sequence X19X20X21X22X23-VGSN-X28X29X30X31X32!
- X 32 independently representing an amino acid which may be covalently linked with another amino acid; the amyloid ⁇ peptide analogues of the preceding embodiment, wherein the amino acid sequences X19X20X21 and X 30 X3iX32 are in anti-parallel orientation; the amyloid ⁇ peptide analogues of the preceding embodiments, wherein X-ig is an amino acid residue selected from the group consisting of phenylalanine, tyrosine, valine, leucine, isoleucine, and methionine; the amyloid ⁇ peptide analogues of any one of the preceding embodiments, wherein X 20 is an amino acid residue selected from the group consisting of phenylalanine, tyrosine, valine, leucine, isoleucine, and methionine; the
- X 12 is valine, leucine, isoleucine, alanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 13 is histidine, tyrosine, serine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 14 is histidine, tyrosine, serine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X 15 is glutamine, asparagine, methionine, serine, or an amino acid which is covalently linked to another amino acid residue of the sequence;
- X 16 is lysine, arginine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X 17 is leucine, isoleucine, valine, phenylalanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 18 is valine, leucine, isoleucine, alanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 19 is phenylalanine, tyrosine, valine, leucine, isoleucine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 20 is phenylalanine, tyrosine, valine, leucine, isoleucine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 21 is alanine, valine, glycine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 22 is glutamic acid, aspartic acid, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 29 is glycine, alanine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 30 is alanine, valine, glycine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X3 1 is isoleucine, leucine, valine, phenylalanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 32 is isoleucine, leucine, valine, phenylalanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 33 is glycine, alanine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X 34 is leucine, isoleucine, valine, phenylalanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 35 is methionine, valine, leucine, isoleucine, alanine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 36 is valine, leucine, isoleucine, alanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X 37 is glycine, alanine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 3 8 is glycine, alanine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 3 9 is valine, leucine, isoleucine, alanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence, at least one amino acid residue selected from the group consisting of Xi 2 , Xi 3 , Xi 4 , X 1 5, X 1 6, Xi 7 , X18, Xi9, X 2 o, X21 and X 22 and at least one amino acid residue selected from the group consisting Of X 29 , X 30 , X 3 i, X 3 2, X33, X34, X35, X36, X37, X38, X39 being covalently linked with each other; the amyloid ⁇ peptide analogues of the preceding embodiment, wherein at least one amino acid residue selected from the group consisting of Xi 2 , Xi 3 , Xi 4 and at least one amino acid residue selected from the group consisting of X 37 ,
- X- I 3 is histidine, tyrosine, serine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X- I4 is histidine, tyrosine, serine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X- I 5 is glutamine, asparagine, methionine, serine, or an amino acid which is covalently linked to another amino acid residue of the sequence;
- X 16 is lysine, arginine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 17 is leucine, isoleucine, valine, phenylalanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 18 is valine, leucine, isoleucine, alanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X 19 is phenylalanine, tyrosine, valine, leucine, isoleucine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X 2 0 is phenylalanine, tyrosine, valine, leucine, isoleucine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X 24 is valine, leucine, isoleucine, alanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X 2 5 is glycine, alanine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X 26 is serine, glycine, alanine, threonine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X 27 is asparagine, glutamine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X 28 is lysine, arginine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X 29 is glycine, alanine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X30 is alanine, valine, glycine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 3 i is isoleucine, leucine, valine, phenylalanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 32 is isoleucine, leucine, valine, phenylalanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 33 is glycine, alanine, serine, or an amino acid residue which is covalently linked to an- other amino acid residue of the sequence
- X 34 is leucine, isoleucine, valine, phenylalanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 35 is methionine, valine, leucine, isoleucine, alanine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 36 is valine, leucine, isoleucine, alanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 37 is glycine, alanine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 38 is glycine, alanine, serine, or an amino acid residue which is covalently linked to an- other amino acid residue of the sequence
- X 39 is valine, leucine, isoleucine, alanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence, at least one amino acid residue selected from the group consisting of X 12 , Xi 3 , Xi 4 , X 1 5, X 16 , X 17 , X 18 , X 19 , X 20 , and at least one amino acid residue selected from the group consisting of X 29 , X 30 , X 31 , X 32 , X 33 , X 34 , X35, X36, X37, X38, X39 being covalently linked with each other; the amyloid ⁇ peptide analogues of the preceding embodiment, wherein at least one amino acid residue selected from the group consisting Of X 12 , X- 1 3, X 14 , and at least one amino acid residue selected from the group consisting of X 37 , X 38 , X 39
- the oligomers include the following: the oligomers, wherein the plurality is 2 to 28 amyloid ⁇ peptide analogues; the oligomers of the preceding embodiments, wherein the amino acid sequence of each amyloid ⁇ peptide analogue comprises the sequence L34M35V36G37G38, with the sequence L A 34M A 3 5 V A 36G A 37G A 38 of one amyloid ⁇ peptide analogue being in parallel orientation to the sequence L B 34M B 35V B 36G B 37G B 38 of another amyloid ⁇ peptide analogue; the oligomers of the preceding embodiment, wherein the interproton distance for at least one atom pair selected from the group consisting of IVf 35 (NH)-V 6 S6 (NH), G A 37 (NH)-G B 38 (NH), L A 34 (N H)-L 6 S 4 (C 5 H 3 ), M A 35(NH)-V 6 36(C ⁇ H 3 ) is 1.8 to
- a further particular embodiment includes the amyloid ⁇ peptide analogues or oligomers of any one of the preceding embodiments, which comprise an epitope recognized by a monoclonal antibody selected from the group consisting of the monoclonal antibody 5F7 obtain- able from a hybridoma designated by American Type Culture Collection deposit number
- the monoclonal antibody 7C6 obtainable from a hybridoma designated by Ameri- can Type Culture Collection deposit number PTA-7240, the monoclonal antibody 4D10 obtainable from a hybridoma designated by American Type Culture Collection deposit number PTA-7405, or the monoclonal antibody 7E5 obtainable from a hybridoma designated by American Type Culture Collection deposit number PTA-7809.
- the present invention also relates to a process for preparing an amyloid ⁇ peptide analogue as defined herein, which process comprises (i) providing a peptide or peptidomimetic thereof; (ii) subjecting the peptide or peptidomimetic to conditions sufficient for the formation of the linkage.
- the present invention also relates to a process for preparing an oligomer as defined herein, which process comprises
- Particular embodiments of the processes include processes, wherein the oligomer formation precedes that linkage formation.
- compositions comprising an amyloid ⁇ peptide analogue or oligomer as defined herein.
- compositions wherein the composition is a vaccine and further comprises a pharmaceutical acceptable carrier.
- the present invention also relates to the use of an amyloid ⁇ peptide analogue or oligomer as defined herein for preparing a pharmaceutical composition for treating or preventing an amyloidosis and to corresponding methods of treating or preventing an amyloidosis in a subject in need thereof, which comprises administering an amyloid ⁇ peptide analogue or oli- gomer as defined herein to the subject.
- Particular embodiments of the use and methods include the following: the use and methods, wherein the pharmaceutical composition is for active immunization; the use and methods of the preceding embodiments, wherein the amyloidosis is Alzheimer's disease or wherein the amyloidosis is the amyloidosis of Down's syndrome.
- the present invention also relates to the use of an amyloid ⁇ peptide analogue or oligomer as defined herein for preparing a composition for diagnosing an amyloidosis and to corresponding methods of diagnosing an amyloidosis which comprises providing a sample from the subject suspected of having the amyloidosis, contacting the sample with an amyloid ⁇ peptide analogue or oligomer as defined herein for a time and under conditions sufficient for the formation of a complex comprising the amyloid ⁇ peptide analogue or oligomer and an antibody, the presence of the complex indicating the subject has the amyloidosis.
- Particular embodiments of the use and methods include the use and methods, wherein the amyloidosis is Alzheimer's disease or wherein the amyloidosis is the amyloidosis of Down's syndrome.
- the present invention relates to a method of enriching an agent capable of binding to an amyloid ⁇ peptide analogue or oligomer as defined herein in a preparation comprising said agent, which method comprises the steps of: a) exposing to the amyloid ⁇ peptide ana- logue or oligomer the preparation comprising the agent for a time and under conditions sufficient for the agent to bind to amyloid ⁇ peptide analogue or oligomer; and b) obtaining the agent in enriched form.
- Particular embodiments of the use and methods include the use and methods, wherein the agent is an antibody, an aptamer or a small molecular weight compound.
- the present invention relates to the use of an amyloid ⁇ peptide analogue or oligomer as defined herein for providing an agent that is capable of binding to the amyloid ⁇ peptide analogue or oligomer and to corresponding methods, e.g. a method of providing an antibody capable of binding to an amyloid ⁇ peptide analogue or oligomer as defined herein, which comprises i) providing an antigen comprising the amyloid ⁇ peptide analogue or oligomer; ii) exposing an antibody repertoire to said antigen; and iii) selecting from said repertoire an antibody which binds to the amyloid ⁇ peptide ana- logue or oligomer.
- the use and methods include the use and methods, wherein the agent is an antibody, a non-antibody binding molecule, an aptamer or a small molecular weight compound.
- Antibodies which are obtainable by said process are also described as well as agents capable of binding to an amyloid ⁇ peptide analogue or oligomer of the invention.
- compositions comprising an agent capable of binding to an amyloid ⁇ peptide analogue or oligomer of the invention; the use of an agent capa- ble of binding to an amyloid ⁇ peptide analogue or oligomer of the invention for preparing a pharmaceutical composition for treating or preventing an amyloidosis and corresponding methods of treating or preventing an amyloidosis in a subject in need thereof, which comprises administering an agent capable of binding to an amyloid ⁇ peptide analogue or oligomer of the invention to the subject; the use of an agent capable of binding to an amyloid ⁇ peptide analogue or oligomer of the invention for preparing a composition for diagnosing an amyloidosis and corresponding methods of diagnosing an amyloidosis which comprises providing a sample from the subject suspected of having the amyloidosis, contacting the sample with an agent capable of binding to an amyloid ⁇ peptide analogue or oligomer of
- Figure 1 shows (A) a diagram of the NMR derived structure of A ⁇ pre-globulomer, depicting the inter-residue NOE's used to define the the three-dimensional fold; dashed lines indicate observed NOEs and circles the backbone amides that exhibit slow exchange in the NH/ND exchange experiments; (B) a ribbon diagram depicting NMR derived structure of A ⁇ pre- globulomer in SDS; residues with defined structure are high-lighted in bold text; (C) a diagram of one monomer observed in the NMR A ⁇ pre-globulomer structure, showing the Leu to Cys mutations; (D) a diagram of one monomer observed in the NMR A ⁇ pre-globulomer structure, showing the Leu to Cys mutations and the resulting disulfide cross-link structure.
- Figure 2 shows (A) an SDS-PAGE gel with typical A ⁇ globulomer banding pattern formed from globulomers made with S#6046: wt N-Met A ⁇ (1-42) peptide, Mut Pre: (17C, 34C) N- Met A ⁇ (1-42) mutant peptide in 0.2 % SDS, Mut Post: (L17C,L34C) N-Met A ⁇ (1-42) mutant peptide in 0.05 % SDS; (B) an SDS-PAGE of 1 ) marker proteins, 2) (14C, 37C) N-Met A ⁇ (1- 42) oligomer, 3) (14C, 37C) N-Met A ⁇ (1-42) oligomer after thermolysin digestion, 4) (15C, 36C) N-Met A ⁇ (1 -42) oligomer, 5) (15C, 36C) N-Met A ⁇ (1 -42) oligomer after thermolysin digestion, 6) (16C, 35C) N-Met A ⁇ (1-42) oligomer
- Standards (lanes 1 and 5 of (A) and marker proteins of (B) and (C)) are: myosin (21OkDa), phosphorylase (98kDa), BSA (78kDa), glutamic dehydrogenase (55kDa), alcohol dehydrogenase (45kDa), carbonic anhydrase (34kDa), myoglobin red (17kDa), lysozyme (16kDa), aprotinin (7kDa) and insulin (4kDa).
- the attributes of the banding pattern are: a cluster of bands -40-5OkDa, a cluster of bands ⁇ 15kDa, and a band at ⁇ 5kDa (monomer).
- Figure 3 shows (A) a comparison of direct Elisa response of N-Met A ⁇ (1-42) globulomer and (L17C, L34C) N-Met A ⁇ (1-42) mutant globulomer to the globulomer-specific monoclonal antibody 5F7;
- thermolysin truncated disulfide stabilized (17C, 34C) A ⁇ (16-42), (17C, 34C) A ⁇ (16-35) and (17C, 34C) N-Met A ⁇ (1-42) oligomer (all cyclised after oligomer formation);
- T a comparison of direct ELISA results comparing the apparent binding affinity of the globulomer-specific mAb 7C6 to disulfide stabilized (17C, 34C) A ⁇ (16-42) oligomer vs. the same oligomer truncated at residue 20 by enzymatic cleavage with thermolysin
- U a comparison of direct ELISA results comparing the apparent binding affinity of the globulomer-specific rabbit polyclonal antiserum 5599 to disulfide stabilized (17C, 34C) A ⁇ (16-42) oligomer vs. the same oligomer truncated at residue 20 by enzymatic cleavage with thermolysin;
- Figure 4 shows mass spectra obtained from A ⁇ globulomers formed with the (L17C, L34C) N-Met A ⁇ (1-42) mutant peptide under (A) disulfide bond forming conditions and (B) after reduction with DTT; mass spectra obtained from (17C, 34C) A ⁇ (16-35) oligomer under (C) disulfide bond forming conditions and (D) after reduction with DTT; mass spectra obtained from (17C, 34C) A ⁇ (16-42) oligomer under (E) disulfide bond forming conditions and (F) after reduction with DTT; mass spectra obtained from (17C, 42C) A ⁇ (12-42) oligomer under (G) disulfide bond forming conditions and (H) after reduction with DTT; mass spectra obtained from (17KC, 42C) A ⁇ (13-42) oligomer under (I) disulfide bond forming conditions and (J) after reduction with DTT; complete isotopic deconvolution is shown.
- Figure 5 shows (A) a sedimentation velocity analysis of heterogeneity of N-Met A ⁇ (1-42) globulomer (dashed line) and disulfide stabilized (L17C, L34C) N-Met A ⁇ (1-42) mutant globulomer (solid line) in 5mM NaPO 4 , 35 mM NaCI, pH 7.4; (B) a sedimentation velocity analysis of heterogeneity N-Met A ⁇ (1-42) globulomer (dashed line) and disulfide stabilized (L17C, L34C) N-Met A ⁇ (1-42) mutant globulomer truncated at residue 20 by enzymatic cleavage with thermolysin (solid line) in 5 mM NaPO 4 , 35 mM NaCI, pH 7.4 supplemented with 0.05 % SDS; (C) a sedimentation velocity analysis of heterogeneity of disulfide stabilized (L17C, L34C) N-Met A ⁇ (1 -42) mutant glob
- Figure 6 is a table indicating the peptide masses of the (xC, yC) N-Met A ⁇ (1-42) oligomers before and after thermolysin digestion detected by SELDI-MS.
- Figure 7 is a table indicating peptide mass peaks of iodoacetamide treated thermolysin truncated (xC, yC) N-Met A ⁇ (1-42) oligomers or thermolysin truncated A ⁇ (1-42) globulomer detected by SELDI-MS.
- Figure 8 shows dot blot analyses of the reactivity
- Figure 9 is a table indicating peptide mass peaks of iodoacetamide treated thermolysin truncated (17C, 34C) N-Met A ⁇ (16-35) oligomers detected by SELDI-MS.
- Figure 10 is a table indicating amounts of immunoprecipitated (17C, 34C) A ⁇ (16-35) oligomer (A) without prior iodoacetamide alkylation and (B) after iodoacetamide alkylation in the presence of DTT.
- Figure 11 shows a schematic diagram indicating the position of cross-links of (17K, 34C) N- Met A ⁇ (1-42) upon treatment with (A) sulfo-SMCC, (B) sulfo-MBS or (C) sulfo-SIAB at either K16 or K17; and (D) a schematic diagram indicating the position of potential cross links of (17K, 34E) N-Met A ⁇ (1-42) upon treatment with EDAC/NHS.
- Figure 12 shows (A) the mass spectrum (ESI) of oligomers made with (17K, 34C) N-Met A ⁇ (1-42) peptide after cross-linking reaction with the heterobifunctional cross-linking reagent sulfo-SMCC; (B) the mass spectrum (MALDI) of globulomers made with (17K, 34C) N-Met A ⁇ (1-42) peptide after cross-linking reaction with the heterobifunctional cross-linking reagent sulfo-MBS; (C) the mass spectrum (ESI) of globulomers made with (17K, 34C) N-Met A ⁇ (1- 42) peptide after cross-linking reaction with the heterobifunctional cross-linking reagent sulfo-SIAB; and (D) the mass spectrum (MALDI) of globulomers made with (17K, 34E) N- Met A ⁇ (1-42) peptide after cross-linking reaction with the heterobifunctional cross-linking reagent EDC and NHS
- Figure 13 shows (A) a comparison of direct Elisa response of (17K, 34C) N-Met A ⁇ (1 -42) oligomer without cross-link with disulfide-stabilized (17C, 34C) N-Met A ⁇ (1 -42) oligomer to (A) the globulomer-specific monoclonal antibody 5F7; (B) the globulomer-specific monoclonal antibody 7C6; and (C) the globulomer-specific rabbit polyclonal antiserum 5599.
- Figure 14 shows (A) a comparison of direct Elisa response of (17K, 34C) N-Met A ⁇ (1-42) oligomer without cross-link with (17K, 34C) N-Met A ⁇ (1 -42) oligomer cross-linked with SMCC before and after thermolysin truncation to (A) the globulomer-specific monoclonal antibody 5F7; (B) the globulomer-specific monoclonal antibody 7C6; and (C) the globulomer- specific rabbit polyclonal antiserum 5599.
- Figure 15 shows (A) a comparison of direct Elisa response of (17K, 34C) N-Met A ⁇ (1 -42) oligomer without cross-link with (17K, 34C) N-Met A ⁇ (1 -42) oligomer cross-linked with MBS before and after thermolysin truncation to (A) the globulomer-specific monoclonal antibody 5F7; (B) the globulomer-specific monoclonal antibody 7C6; and (C) the globulomer-specific rabbit polyclonal antiserum 5599.
- Figure 16 shows (A) a comparison of direct Elisa response of (17K, 34C) N-Met A ⁇ (1 -42) oligomer without cross-link with (17K, 34C) N-Met A ⁇ (1 -42) oligomer cross-linked with SIAB before and after thermolysin truncation to (A) the globulomer-specific monoclonal antibody 5F7; (B) the globulomer-specific monoclonal antibody 7C6; and (C) the globulomer-specific rabbit polyclonal antiserum 5599.
- Figure 17 shows (A) a comparison of direct Elisa response of (17C, 34E) N-Met A ⁇ (1 -42) oligomer without cross-link with disulfide-stabilized (17C, 34C) N-Met A ⁇ (1 -42) oligomer to (A) the globulomer-specific monoclonal antibody 5F7; (B) the globulomer-specific monoclonal antibody 7C6; and (C) the globulomer-specific rabbit polyclonal antiserum 5599.
- Figure 18 shows (A) a comparison of direct Elisa response of (17K, 34C) N-Met A ⁇ (1 -42) oligomer without cross-link with (17K, 34C) N-Met A ⁇ (1 -42) oligomer cross-linked with EDC/NHS before and after thermolysin truncation to (A) the globulomer-specific monoclonal antibody 5F7; (B) the globulomer-specific monoclonal antibody 7C6; and (C) the globulomer- specific rabbit polyclonal antiserum 5599.
- amyloid ⁇ peptide analogues of the present invention comprise an amino acid sequence (peptide) or a peptidomimetic of an amino acid sequence.
- the amyloid ⁇ peptide analogues of the present invention do not comprise any further amino acid or any further peptidomimetic of an amino acid than said amino acid sequence or said peptidomimetic of the amino acid sequence (but the amyloid ⁇ peptide analogues of the present invention may comprise further chemical groups or moieties which are attached said amino acid sequence or peptidomimetic).
- the amino acid sequence consists of up to 45, 44, 43, 42, 41 , 40, 39, 34, 33, 32, 31 , 30, 29, 28, 27, 26, 25, 24, 23, 20, 16 amino acids (or a corresponding peptidomimetic).
- the amino acid sequence consists of at least 10, 11 , 12, 13, 14, 15, 16 amino acids (or a corresponding peptidomimetic).
- amino acid as employed herein, alone or as part of another group, includes, without limitation, an amino group and a carboxyl group linked to the same carbon, referred to as " ⁇ " carbon -CRR'-, where R and/or R' can be a natural or an un-natural side chain, including hydrogen.
- the absolute "S" configuration at the " ⁇ ” carbon is commonly referred to as the “L” or “natural” configuration.
- the amino acid is glycine and is not chiral.
- Amino acids include the genetically encoded L-enantiomeric amino acids (such as alanine (A Ala), arginine (R; Arg), asparagine (N; Asn), aspartic acid (D; Asp), cysteine (C; Cys), gluta- mine (Q; GIn), glutamic acid (E; GIu), glycine (G; GIy), histidine (H; His), isoleucine (I; lie), leucine (L; Leu), lysine (K; Lys), phenylalanine (F; Phe), proline (P; Pro), serine (S; Ser), threonine (T; Thr), tryptophan (W; Trp), tyrosine (Y; Tyr), valine (V; VaI)), the corresponding D-amino acids, as well as a number of genetically non-encoded amino acids which include, but are not limited to, ⁇ -alanine ( ⁇ -Ala) and other omega
- the amino acids can be conveniently classified into two main categories - hydrophilic and hydrophobic - depending primarily on the physical-chemical characteristics of the amino acid side chain. These two main categories can be further classified into subcategories that more distinctly define the characteristics of the amino acid side chains.
- the class of hydrophilic amino acids can be further subdivided into acidic, basic and polar amino acids.
- the class of hydro- phobic amino acids can be further subdivided into nonpolar and aromatic amino acids.
- hydrophilic amino acid refers to an amino acid exhibiting a hydrophobicity of less than zero according to the normalized consensus hydrophobicity scale of Eisenberg et al., 1984, J. MoI. Biol. 179:125-142. Genetically encoded hydrophilic amino acids include Thr (T), Ser (S), His (H), GIu (E), Asn (N), GIn (Q), Asp (D), Lys (K) and Arg (R).
- hydrophobic amino acid refers to an amino acid exhibiting a hydrophobicity of greater than zero according to the normalized consensus hydrophobicity scale of Eisenberg, 1984, J. MoI. Biol. 179: 1.25-142. Genetically encoded hydrophobic amino acids include Pro (P), He (I), Phe (F), VaI (V), Leu (L), Trp (W), Met (M), Ala (A), GIy (G) and Tyr (Y).
- acidic amino acid refers to a hydrophilic amino acid having a side chain pK value of less than 7. Acidic amino acids typically have negatively charged side chains at physiological pH due to loss of a hydrogen ion. Genetically encoded acidic amino acids include GIu (E) and Asp (D).
- basic amino acid refers to a hydrophilic amino acid having a side chain pK value of greater than 7.
- Basic amino acids typically have positively charged side chains at physiological pH due to association with hydronium ion.
- Genetically encoded basic amino acids include His (H), Arg (R) and Lys (K).
- polar amino acid refers to a hydrophilic amino acid having a side chain that is uncharged at physiological pH, but which has at least one bond in which the pair of electrons shared in common by two atoms is held more closely by one of the atoms.
- Genetically encoded polar amino acids include Asn (N), GIn (Q) Ser (S) and Thr (T).
- nonpolar amino acid refers to a hydrophobic amino acid having a side chain that is uncharged at physiological pH and which has bonds in which the pair of electrons shared in common by two atoms is generally held equally by each of the two atoms (i.e., the side chain is not polar).
- Genetically encoded nonpolar amino acids include Leu (L), VaI (V), Ne (I), Met (M), GIy (G) and Ala (A).
- aromatic amino acid refers to a hydrophobic amino acid with a side chain having at least one aromatic or heteroaromatic ring.
- the aromatic or heteroaromatic ring may contain one or more substituents such as -OH, -SH, -CN, -F, -Cl, -Br, -I, -NO 2 , -NO, -NH 2 , -NHR, -NRR, -C(O)R, -C(O)OH, -C(O)OR, -C(O)NH 2 , -C(O)NHR, -C(O)NRR and the like where each R is independently (Ci - C 6 ) alkyl, substituted (Ci - C 6 ) alkyl, (Ci - C 6 ) alkenyl, substituted (C 1 - C 6 ) alkenyl, (C 1 - C 6 ) alkynyl, substituted (C 1 - C 6 )
- aliphatic amino acid refers to a hydrophobic amino acid having an aliphatic hydrocarbon side chain. Genetically encoded aliphatic amino acids include Ala (A), VaI (V), Leu (L) and Ne (I).
- Cys (C) is unusual in that it can form disulfide bridges with other Cys (C) residues or other sulfanyl-containing amino acids.
- the ability of Cys (C) residues (and other amino acids with -SH containing side chains) to exist in a peptide in either the reduced free -SH or oxidized disulfide-bridged form affects whether Cys (C) residues contribute net hydrophobic or hydrophilic character to a peptide.
- amino acids having side chains exhibiting two or more physical- chemical properties can be included in multiple categories.
- amino acid side chains having aromatic moieties that are further substituted with polar substituents, such as Tyr (Y) may exhibit both aromatic hydrophobic properties and polar or hydrophilic proper- ties, and can therefore be included in both the aromatic and polar categories.
- polar substituents such as Tyr (Y)
- amyloid ⁇ peptide analogues of the in- vention may comprise an analogue of said sequence having properties analogous to those of the template amino acid sequence (peptide).
- peptide mimetics or “peptidomimetics” (Fauchere, J. (1986) Adv. Drug Res. 15: 29; Veber and Freidinger (1985) TINS p. 392; and Evans et al. (1987) J. Med. Chem 30: 1229) and are usually developed with the aid of computerized molecular modeling.
- the peptidomimetics are referred to as being "derivable from” a certain amino acid sequence.
- the peptidomimetic is designed with reference to a defined amino acid sequence, such that it retains the structural features of the amino acid sequence which are essential for its function. This may be the particular side chains of the amino acid sequence, or hydrogen bonding potential of the structure.
- Such features may be provided by non-peptide components or one or more of the amino acid residues or the bonds linking said amino acid residues of the amino acid sequence may be modified so as to improve certain functions of the amino acid sequence such as stability or protease resistance, while retaining the structural features of the amino acid sequence which are essential for its function.
- amyloid ⁇ peptide analogue comprising a peptidomimetic of an amino acid sequence and the amyloid ⁇ peptide analogue comprising the amino acid sequence from which the peptidomimetic is derived have the same functional characteristics with respect to their ability to form the loop and, if applicable, to display the further structural and functional properties of the amyloid ⁇ peptide analogues as defined herein.
- Peptidomimetics are usually structurally similar to the paradigm peptide (i.e., the amino acid sequence comprised by the amyloid ⁇ peptide analogues of the invention), but have one or more peptide linkages optionally replaced by a linkage similar to an amide linkage (e.g. an amide isostere such as an N-methyl amide, thioamide, thioester, phosphonate, ketomethyl- ene, hydroxymethylene, fluorovinyl, (E)-vinyl, methyleneamino, methylenethio or alkane linkage).
- an amide isostere such as an N-methyl amide, thioamide, thioester, phosphonate, ketomethyl- ene, hydroxymethylene, fluorovinyl, (E)-vinyl, methyleneamino, methylenethio or alkane linkage.
- These linkages are well-known in the art and further described in the following references: Spatola, A. F. in "Chemistry and Biochemistry of Amino Acids, Peptides, and Proteins, "B. Weinstein, eds., Marcel Dekker, New York, p. 267 (1983); Szatola, A. F., Vega Data (March 1983), Vol.
- a particularly preferred non-peptide linkage is -CH 2 NH-.
- Such peptide mimetics may have significant advantages over peptide embodiments, including, for example: more economical production, greater chemical stability, enhanced pharmacological properties (half-life, absorption, potency, efficacy, etc.), and others.
- Peptidomimetics also include "reversed” or "retro” amino acid sequences.
- Reversed or retro amino acid sequences comprise covalently-bonded amino acid residues wherein the normal carboxyl-to-amino direction of peptide bond formation in the amino acid backbone is reversed such that, reading in the conventional left-to-right direction, the amino portion of the peptide bond precedes (rather than follows) the carbonyl portion. See, generally, Goodman, M. and Chorev, M. Accounts of Chem. Res. 1979, 12, 423.
- the reversed orientation peptides include (a) those wherein one or more amino-terminal residues are converted to a reversed ("rev") orientation (thus yielding a second "carboxyl terminus” at the left-most portion of the molecule), and (b) those wherein one or more car- boxyl-terminal residues are converted to a reversed ("rev") orientation (yielding a second "amino terminus” at the right-most portion of the molecule).
- a peptide (amide) bond cannot be formed at the interface between a normal orientation residue and a reverse orientation residue.
- certain reversed amino acid sequences of the invention can be formed by utilizing an appropriate amino acid mimetic moiety to link the two adjacent portions of the sequences utilizing a reversed peptide (reversed amide) bond.
- a central residue of a diketo compound may conveniently be utilized to link structures with two amide bonds to achieve a peptidomimetic structure.
- a central residue of a diamino com- pound will likewise be useful to link structures with two amide bonds to form a peptidomimetic structure.
- the reversed direction of bonding in such compounds will generally, in addition, require inversion of the enantiomeric configuration of the reversed amino acid residues in order to maintain a spatial orientation of side chains that is similar to that of the non-reversed amino acid.
- the configuration of amino acids in the reversed portion of the peptides is preferably (D), and the configuration of the non-reversed portion is preferably (L). Opposite or mixed configurations are acceptable when appropriate to optimize a binding activity.
- the amino acid sequence or peptidomimetic comprised by the amyloid ⁇ peptide analogues of the invention is characterized by a particular secondary structure comprising a loop (synonym: turn).
- a loop (or turn) as used herein is meant to define the close approach (usually ⁇ 7 A) of at least two Ca atoms.
- Suitable loops include ⁇ -, ⁇ -, v-, and ⁇ -loops.
- the loop is a ⁇ -loop.
- a ⁇ -loop as used herein is meant to define a loop which is characterized by hydrogen bond(s) in which the donor and acceptor residues are separated by three residues i ⁇ i +/- 3 H-bonding).
- the loop is a ⁇ -hairpin loop.
- a ⁇ - hairpin loop as used herein is meant to define a loop, in which the direction of the peptide or peptidomimetic backbone reverses and the flanking secondary structure elements interact.
- the amyloid ⁇ peptide analogues comprise an amino acid sequence which forms an intra-molecular antiparallel ⁇ - sheet.
- An antiparallel ⁇ -sheet as used herein is meant to define an assembly of at least two ⁇ -strands connected laterally by three or more hydrogen bonds, forming a generally twisted, pleated sheet.
- a ⁇ -strand is a stretch of amino acids comprising typically 3-10 amino acids whose peptide backbones are almost fully extended, or a peptidomimetic thereof.
- amyloid ⁇ peptide analogues of the invention comprise an amino acid sequence in which the ⁇ -strands forming the antiparallel ⁇ -sheet are connected via the loop, preferably the ⁇ -hairpin loop as defined herein.
- amino acid sequence of the amyloid ⁇ peptide analogues of the invention has at least 66 % identity to the amino acid sequence of native human A ⁇ peptide or a portion thereof.
- native human A ⁇ peptide refers to a naturally-occurring A ⁇ (X-Y) peptide of human origin, such as A ⁇ (1-40) or A ⁇ (1-42) peptide.
- naturally-occurring A ⁇ (X-Y) peptide here refers to the amino acid sequence from amino acid position X to amino acid position Y of the human amyloid ⁇ protein including both X and Y, in particular to the amino acid sequence from amino acid position X to amino acid position Y of the amino acid sequence DAEFRHDSGY EVHHQKLVFF AEDVGSNKGA IIGLMVGGW IAT (corresponding to amino acid positions 1 to 43; the human query sequence) or any of its naturally occurring variants, in particular those with at least one mutation selected from the group consisting of A2T, H6R, D7N, A21 G ("Flemish"), E22G (“Arctic”), E22Q (“Dutch”), E22K (“Italian”), D23N (“Iowa”), A42T and A42V wherein the numbers are relative to the start of the A ⁇ peptide, including both position X and position Y.
- the term "naturally-occurring A ⁇ (1-42) peptide” here refers to the amino acid sequence from amino acid position 1 to amino acid position 42 of the human amyloid ⁇ protein including both 1 and 42, in particular to the amino acid sequence DAEFRHDSGY EVHHQKLVFF AEDVGSNKGA IIGLMVGGW IA or any of its naturally occurring variants, in particular those with at least one mutation selected from the group consisting of A21 G ("Flemish”), E22G (“Arctic”), E22Q (“Dutch”), E22K (“Italian”), D23N (“Iowa”), A42T and A42V wherein the numbers are relative to the start of the A ⁇ peptide, including both 1 and 42.
- amyloid ⁇ peptide analogues of the invention comprise an amino acid sequence which corresponds to naturally occuring A ⁇ peptides, functional fragments and variant sequences thereof that are at least about 66 %, 70 %, 75 %, 80 %, 85 %, 90 %, 95 %, 97 %, 99 % or more identical to the human query sequence described above or a portion thereof.
- reference sequence is a defined sequence used as a basis for a sequence comparision; a reference sequence may be a subset of a larger sequence, for example, as a portion of a full-length cDNA, gene sequence or polypeptide sequence, or may comprise a complete cDNA, gene sequence or polypeptide sequence, such as a human A ⁇ peptide sequence described above.
- two sequences may each (1 ) comprise a sequence (i.e., a portion of the complete sequence) that is similar between the two sequences, and (2) may further comprise a sequence that is divergent between the two sequences
- sequence comparisons between two (or more) polynucleotides are typically performed by comparing sequences of the two sequences over a "comparison window" to identify and compare local regions of sequence similarity.
- a “comparison window”, as used herein, refers to a conceptual segment of at least 6 contiguous amino acid or 24 nucleotide positions wherein a sequence may be compared to a reference sequence of at least 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, or 42 contiguous amino acids or 18, 24, 30, 36, 42, 48, 54, 60, 66, 72, 78, 84, 90, 96, 102, 108, 114, 120, or 126 nucleotides and wherein the portion of the sequence in the com- parison window may comprise additions or deletions (i.e., gaps) of 20 percent or less as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences.
- sequence identity means that two sequences are identical (i.e., on a nucleotide-by-nucleotide or amino acid-by-amino acid basis) over the window of comparison.
- percentage of sequence identity is calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical nucleic acid base or amino acid occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparision (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity.
- the window of comparison may include the entire amino acid sequence comprised by the amyloid ⁇ peptide analogue or a portion thereof. If the amino acid sequence comprised by the amyloid ⁇ peptide analogue is shorter than the amino acid sequence of native human A ⁇ peptide, the window of comparison will include only a portion of the native human A ⁇ peptide so that the percentage of sequence identity refers to that portion only.
- the window of comparison will include only a portion of the amino acid sequence comprised by the amyloid ⁇ peptide analogue so that the percentage of sequence identity refers to that portion only.
- the invention relates to amyloid ⁇ peptide analogues wherein the amino acid sequence of the amyloid ⁇ peptide analogues has at least 66 % identity to a native human A ⁇ (X - Y) sequence, X being selected from the group consisting of the numbers 1 .. 23, e.g. 15, 18, 19, 20, 21 , 22, or 23, and Y being selected from the group consisting of the numbers 28 .. 43, e.g. 28, 29, 30, 31 , 34, 37, 40, 42, or 43.
- the ellipsis A .. B denotes the set comprising all natural numbers from A to B, including both, e.g. "17 .. 20” thus denotes the group of the numbers 17, 18, 19 and 20.
- the hyphen denotes a contiguous sequence of amino acids, i.e., "X - Y” comprises the sequence from amino acid X to amino acid Y, including both.
- "A .. B - C .. D" comprises all possible combinations between members of these two sets, e.g. "17 .. 20 - 40 ..
- amino acid sequence of the amyloid ⁇ peptide analogues has at least 66 % identity to a sequence selected from the group consisting of SEQ ID NO: 1-368:
- the amino acid sequence of the amyloid ⁇ peptide analogue of the invention corresponds to a sequence selected from the group consisting of SEQ ID NO: 1-368 wherein at least one amino acid of the selected sequence is substituted by another amino acid.
- the amino acid substitutions are conservative, i.e., the replacing amino acid residue has physical and chemical properties that are similar to the amino acid residue being replaced.
- conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine- tyrosine, lysine-arginine, alanine-valine, and asparagine-glutamine.
- the amino acid substitutions are non-conservative, i.e., the replacing amino acid residue has physical and chemical properties that differ from those of the amino acid residue being replaced.
- This embodiment in particular relates to replacing amino acid residues which are capable of forming linkages. That is, such an amino acid substitution enables the formation of a covalent linkage between the replacing amino acid and another amino acid which, in turn, may or may not be a replacing amino acid, too. This allows the introduction of covalent linkages between amino acids at defined positions within the amino acid sequence.
- the amino acid sequence of the amyloid ⁇ peptide analogues of the invention comprises a sequence selected from the group consisting of SEQ ID NO: 1-368, at least two, e.g. two, amino acid residues of said sequence being modified so as to form the required intra-sequence covalent linkage.
- each of two amino acids my be replaced by a cysteine. This will alllow the formation of a variety of linkages. Particular positions for such amino acid replacements and a variety of appropriate linkages are described herein. Further, one amino acid may be replaced by a cysteine and another amino acid may be replaced by a lysine. This will alllow the formation of a variety of linkages.
- amino acid sequence of the amyloid ⁇ peptide analogues of the invention comprises at least 6, preferably at least 8, 10, 12, 14, 16 or 18, contiguous amino acid residues.
- the amino acid sequence of the amyloid ⁇ peptide analogues of the invention will comprise less that 45, 43, 41 , 39, 37, or 36 contiguous amino acid residues.
- the contiguous amino acid residues comprise the sequence VGSN, DVGSN, or VGSNK.
- the contiguous amino acid residues comprise the sequence AED.
- the contiguous amino acid residues comprise both the sequence AED and one of the sequences VGSN, DVGSN, or VGSNK, in particular the sequence AEDVGSN or AEDVGSNK.
- the amino acid sequence of the amyloid ⁇ peptide analogues of the invention comprises the sequence X 19 X 20 X 2 iX 22 X 23 -VGSN- X28X29X30X31X32, wherein each of X i9 , X20, X21 , X22 X23, X28, X29, X30, X31 , X32 independently represents an amino acid, in particular as defined herein.
- Each of said amino acids may be covalently linked with another amino acid, with the other amino acid being selected among X 19 , X 2 O X21, X22 X23, X28, X29, X30, X31, X32, or representing a different amino acid.
- the amino acid sequences Xi 9 X 2 oX 2 i and X 30 X 3 iX 32 are in anti-parallel orientation.
- amyloid ⁇ peptide analogues of the invention include those wherein
- Xi 9 is an amino acid residue selected from the group consisting of phenylalanine, tyrosine, valine, leucine, isoleucine, and methionine, with phenylalanine being preferred;
- X 2 0 is an amino acid residue selected from the group consisting of phenylalanine, tyrosine, valine, leucine, isoleucine, and methionine, with phenylalanine being preferred;
- X 2 i is an amino acid residue selected from the group consisting of alanine, valine, glycine, and serine, with alanine being preferred;
- X 22 is an amino acid residue selected from the group consisting of glutamic acid and aspartic acid, with glutamic acid being preferred;
- X 23 is an amino acid residue selected from the group consisting of glutamic acid and aspartic acid, with aspartic acid being preferred;
- X 28 is an amino acid residue selected from the group consisting of lysine and arginine, with lysine being preferred;
- X 29 is an amino acid residue selected from the group consisting of glycine, alanine, and serine, with glycine being preferred;
- X 30 is an amino acid residue selected from the group consisting of alanine, valine, glycine, and serine, with alanine being preferred;
- X 3 i is an amino acid residue selected from the group consisting of isoleucine, leucine, valine, phenylalanine, and methionine, with isoleucine being preferred;
- X 32 is an amino acid residue selected from the group consisting of isoleucine, leucine, valine, phenylalanine, and methionine, with isoleucine being preferred; or any combination thereof.
- amyloid ⁇ peptide analogues of the invention include those wherein the amino acid sequence of the amyloid ⁇ peptide analogue comprises the sequence F 19 X 20 A 21 -
- Q-A30I3 1 I3 2 with X 20 representing an amino acid, in particular as defined herein, and Q being an amino acid sequence comprising the sequence VGSN.
- the amino acid sequence Q usually consists of 5, 6, 7, or 8 amino acid residues. According to a particular embodiment, it forms the loop, i.e., some or all amino acids of Q are aranged so as to form the loop.
- Amyloid ⁇ peptide analogues comprising the sequence
- each of X 20 , X 22 , X 29 independently represents an amino acid residue, in particular as defined herein, represent a preferred embodiment of the invention.
- the amino acid sequences F 19 X 20 A 21 and A 30 I 31 I 32 are preferably in anti-parallel orientation.
- the atom pairs F 19 (CO)- I 32 (N), I 32 (CO)-F 19 (N), A 21 (CO)-A 30 (N), and A 30 (CO)-A 21 (N) are at a distance of 3.3 ⁇ 0.5 A, wherein CO indicates the backbone oxygen atom, and the phi ( ⁇ ) angles of the residues range from -180 to -30 and psi ( ⁇ ) angles of the residues range from approximately 60 to 180 or from approximately -180 to -150.
- amino acid sequence of the amyloid ⁇ peptide analogue is a sequence selected from the group consisting of SEQ ID NO: 369-698, wherein
- X 12 is valine, leucine, isoleucine, alanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X 13 is histidine, tyrosine, serine, methionine, or an amino acid residue which is cova- lently linked to another amino acid residue of the sequence
- X 14 is histidine, tyrosine, serine, methionine, or an amino acid residue which is cova- lently linked to another amino acid residue of the sequence
- X 15 is glutamine, asparagine, methionine, serine, or an amino acid residue which is co- valently linked to another amino acid residue of the sequence;
- X 16 is lysine, arginine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X 17 is leucine, isoleucine, valine, phenylalanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 18 is valine, leucine, isoleucine, alanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 19 is phenylalanine, tyrosine, valine, leucine, isoleucine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 2 0 is phenylalanine, tyrosine, valine, leucine, isoleucine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 21 is alanine, valine, glycine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X 22 is glutamic acid, aspartic acid, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 29 is glycine, alanine, and serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X30 is alanine, valine, glycine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X31 is isoleucine, leucine, valine, phenylalanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X32 is isoleucine, leucine, valine, phenylalanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X33 is glycine, alanine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X34 is leucine, isoleucine, valine, phenylalanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X35 is methionine, valine, leucine, isoleucine, alanine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X36 is valine, leucine, isoleucine, alanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X37 is glycine, alanine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 38 is glycine, alanine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 39 is valine, leucine, isoleucine, alanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence, at least one amino acid residue selected from the group consisting of Xi 2 , X13, X14, X15, X16, Xi7, X18, Xi9, X20, X21 and X 22 and at least one amino acid residue selected from the group consisting Of X 29 , X30, X31, X32, X33, X34, X35, X36, X37, X38 and X 39 being covalently linked with each other.
- Said intra-sequence covalent linkage(s) is (are) intended to stabilize the loop and optionally further secondary structure elements of the amyloid ⁇ peptide analogues of the invention, as described. Accordingly, the covalenty linked amino acid residues are expediently separated by at least the loop-forming amino acids, for instance the sequence VGSN, DVGSN, VGSNK, or Q as described herein.
- Particularly preferred positions of the intra-sequence covalent linkages in SEQ ID NO: 369-698 may be described in the form of the following embodiments: At least one amino acid residue selected from the group consisting of X 12 , X 13 , Xi 4 and at least one amino acid residue selected from the group consisting of X 37 , X 38 , X 3 g are cova- lently linked with each other.
- At least one amino acid residue selected from the group consisting of Xi 3 , Xi 4 , X 1 5 and at least one amino acid residue selected from the group consisting of X 36 , X 37 , X38 are cova- lently linked with each other.
- At least one amino acid residue selected from the group consisting of Xi 4 , X 1 5, Xi 6 and at least one amino acid residue selected from the group consisting of X 35 , X 36 , X 37 are cova- lently linked with each other.
- At least one amino acid residue selected from the group consisting of X 1 5, Xi 6 , Xi 7 and at least one amino acid residue selected from the group consisting of X 34 , X 35 , X 36 are cova- lently linked with each other.
- At least one amino acid residue selected from the group consisting of Xi 6 , Xi 7 , Xi 8 and at least one amino acid residue selected from the group consisting of X 33 , X 34 , X 35 are cova- lently linked with each other.
- At least one amino acid residue selected from the group consisting of Xi 7 , Xi 8 , Xi 9 and at least one amino acid residue selected from the group consisting of X 32 , X 33 , X 34 are cova- lently linked with each other.
- At least one amino acid residue selected from the group consisting of Xi 8 , X 1 9, X 20 and at least one amino acid residue selected from the group consisting of X 3 i, X 32 , X 33 are cova- lently linked with each other.
- At least one amino acid residue selected from the group consisting of X 1 9, X 20 , X 2 i and at least one amino acid residue selected from the group consisting of X 30 , X 3 i, X 32 are cova- lently linked with each other.
- At least one amino acid residue selected from the group consisting of X 20 , X 2 i and X 22 and at least one amino acid residue selected from the group consisting of X 29 , X 30 , X 3 i are cova- lently linked with each other. More particularly, the amino acid residues X 12 and X 39 , X 13 and X 38 , X 14 and X 37 , X 15 and X 36 , X 16 and X 35 , X 17 and X 34 , X 18 and X 33 , X 19 and X 32 , X 2 o and X 31 , X 21 and X 30 , or X 22 and X 29 may expediently covalently linked with each other.
- the amino acid sequence of the amyloid ⁇ peptide analogues of the invention comprises the sequence X 20 A 21 E 22 D 23 -
- each of X 20 , X 24 , X 25 , X 26 , X 27 , X 28 , X 29 , X 30 , X 31 independently represents an amino acid, in particular as defined herein.
- Each of said amino acids may be covalently linked with another amino acid, with the other amino acid being selected among X 20 , X 24 , X 25 , X 26 , X 27 , X 28 , X 29 , X 30 , X 31 , or representing a different amino acid.
- the amino acid sequences X 20 A 21 E 22 D 23 and X 28 X 29 X 30 X 31 are in anti-parallel orientation.
- amyloid ⁇ peptide analogues of the invention include those wherein
- X 20 is an amino acid residue selected from the group consisting of phenylalanine, tyrosine, valine, leucine, isoleucine, and methionine, with phenylalanine being preferred;
- X 24 is an amino acid residue selected from the group consisting of valine, leucine, isoleucine, alanine, and methionine, with valine being preferred;
- X 25 is an amino acid residue selected from the group consisting of glycine, alanine, and serine, with glycine being preferred;
- X 26 is an amino acid residue selected from the group consisting of serine, glycine, alanine, and threonine, with serine being preferred;
- X 27 is an amino acid residue selected from the group consisting of asparagine, glutamine, and methionine, with asparagine being preferred;
- X 28 is an amino acid residue selected from the group consisting of lysine and arginine, with lysine being preferred;
- X 29 is an amino acid residue selected from the group consisting of glycine, alanine, and serine, with glycine being preferred;
- X 30 is an amino acid residue selected from the group consisting of alanine, valine, glycine, and serine, with alanine being preferred;
- X 31 is an amino acid residue selected from the group consisting of isoleucine, leucine, valine, phenylalanine, and methionine, with isoleucine being preferred; or any combination thereof.
- amyloid ⁇ peptide analogues of the invention include those wherein the amino acid sequence of the amyloid ⁇ peptide analogue comprises the sequence X 20 -Q- X 24 X 25 X 26 X 27 X 28 X 29 A 30 I 31 , with each of X 20 , X 24 , X 25 , X 26 , X 27 , X 28 , X 29 , independently repre- senting an amino acid, in particular as defined herein, and Q being an amino acid sequence comprising the sequence AED.
- the amino acid sequence Q usually consists of 3, 4, 5, or 6 amino acid residues. According to a particular embodiment, at least part of the amino acid sequence X 24 X 2 5X 2 6X 2 7 forms the loop.
- Amyloid ⁇ peptide analogues comprising the sequence X20A21E22D23X24X25X26X27X28X29A30I31, wherein each of X 2 o, X24, X25, X26, X27, X28, X29, independently represents an amino acid residue, in particular as defined herein, represent a preferred embodiment of the invention.
- at least three contiguous amino acids of the amino acid sequences X2oA 2 iE 2 2D 2 3 and X28X29A30I31 are preferably in anti-parallel orientation.
- the interproton distance for at least one atom pair selected from the group consisting of A 21 (N H)-A 30 (N H), A 2 i(NH)-A 30 (CB), A 2 i(NH)-l 3 i(CD1 ), A 21 (NH)- l 3 i(CG2), and A 30 (NH)-A 2 i(CB) is 1.8 to 6.5 Angstroms.
- the atom pairs A 2 i (CO)-A 30 (N) and A 30 (CO)-A 2 - I (N) are at a distance of 3.3 ⁇ 0.5 A, wherein CO indicates the backbone oxygen atom, and the phi ( ⁇ ) angles of the residues range from -180 to -30 and psi ( ⁇ ) angles of the residues range from approximately 60 to 180 or from approximately -180 to -150.
- amino acid sequence of the amyloid ⁇ peptide analogue is a sequence selected from the group consisting of SEQ ID NO: 699-960, wherein
- X 12 is valine, leucine, isoleucine, alanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- Xi 3 is histidine, tyrosine, serine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X 14 is histidine, tyrosine, serine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X 15 is glutamine, asparagine, methionine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X- I 6 is lysine, arginine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X- 1 7 is leucine, isoleucine, valine, phenylalanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X- I 8 is valine, leucine, isoleucine, alanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 19 is phenylalanine, tyrosine, valine, leucine, isoleucine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 20 is phenylalanine, tyrosine, valine, leucine, isoleucine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 24
- X 2 5 is glycine, alanine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 2 6 is serine, glycine, alanine, threonine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 2 7 is asparagine, glutamine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 2 8 is lysine, arginine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 2 9 is glycine, alanine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X 30 is alanine, valine, glycine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 31 is isoleucine, leucine, valine, phenylalanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 32 is isoleucine, leucine, valine, phenylalanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X33 is glycine, alanine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 34 is leucine, isoleucine, valine, phenylalanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence;
- X 3 5 is methionine, valine, leucine, isoleucine, alanine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 3 6 is valine, leucine, isoleucine, alanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 3 7 is glycine, alanine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X38 is glycine, alanine, serine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence
- X 39 is valine, leucine, isoleucine, alanine, methionine, or an amino acid residue which is covalently linked to another amino acid residue of the sequence, at least one amino acid residue selected from the group consisting of X 12 , X 13 , X 14 , X 15 , X ⁇ , X 17 , X 18 , X 19 , X 20 , and at least one amino acid residue selected from the group consisting of X 29 , X 30 , X 31 , X 32 , X 33 , X 34 , X35, X36, X37, X38 and X 39 being covalently linked with other.
- Said intra-sequence covalent linkage(s) is (are) intended to stabilize the loop and optionally further secondary structure elements of the amyloid ⁇ peptide analogues of the invention, as described. Accordingly, the covalenty linked amino acid residues are expediently separated by at least the loop-forming amino acids, for instance the sequence X24X25X26X27, as de- scribed herein.
- Particularly preferred positions of the intra-sequence covalent linkages in SEQ ID NO: 699-960 may be described in the form of the following embodiments: At least one amino acid residue selected from the group consisting of X 12 , X 13 , Xi 4 , and at least one amino acid residue selected from the group consisting of X 37 , X 38 , X 3 g are cova- lently linked with each other.
- At least one amino acid residue selected from the group consisting of Xi 3 , Xi 4 , X 1 5, and at least one amino acid residue selected from the group consisting of X 36 , X 37 , X38 are cova- lently linked with each other.
- At least one amino acid residue selected from the group consisting of Xi 4 , X 1 5, Xi 6 , and at least one amino acid residue selected from the group consisting of X 35 , X 36 , X 37 are cova- lently linked with each other.
- At least one amino acid residue selected from the group consisting of X 1 5, Xi 6 , Xi 7 , and at least one amino acid residue selected from the group consisting of X 34 , X 35 , X 36 are cova- lently linked with each other.
- At least one amino acid residue selected from the group consisting of Xi 6 , Xi 7 , Xi 8 , and at least one amino acid residue selected from the group consisting of X 33 , X 34 , X 35 are cova- lently linked with each other.
- At least one amino acid residue selected from the group consisting of Xi 7 , Xi 8 , Xi 9 , and at least one amino acid residue selected from the group consisting of X 32 , X 33 , X 34 are cova- lently linked with each other.
- At least one amino acid residue selected from the group consisting of Xi 8 , X 1 9, X 20 , and at least one amino acid residue selected from the group consisting of X 3 i, X 32 , X 33 are cova- lently linked with each other.
- At least one amino acid residue selected from the group consisting of X 1 9, X 20 , and at least one amino acid residue selected from the group consisting of X 30 , X 3 i, X 32 are covalently linked with each other.
- Amino acid residue X 20 and at least one amino acid residue selected from the group consisting of X 29 , X 30 , X 3 i are covalently linked with each other. More particularly, the amino acid residues X 12 and X 39 , X 13 and X 38 , X 14 and X 37 , X 15 and X 36 , X 16 and X 35 , X 17 and X 34 , X 18 and X 33 , X 19 and X 32 , or X 20 and X 31 may expediently covalently linked with each other.
- amino acid sequence of the amyloid ⁇ peptide analogues of the invention may comprise further amino acid residues than those specifically described herein.
- the amino acid sequence of the amyloid ⁇ peptide analogues of the invention may comprise a methionine at the N-terminal position of one of the sequences set forth in SEQ ID NO: 1-960, especially if the peptide corresponding to the amino acid sequence is produced recombinantly in a prokaryotic host.
- one or more than one amino acids may be inserted into the amino acid sequences described herein.
- SEQ ID NO: 1-960 which lack 3, 1 1 , 15 or 19 N-terminal amino acids from either SEQ ID NO:1 , SEQ ID NO:369 or SEQ ID NO:699 represent particular embodiments of the present invention.
- SEQ ID NO:1-960 which lack 1 , 2, 3, 4, 5, 6, 7 or 8 C-terminal amino acids from either SEQ ID NO:1 , SEQ ID NO:369 or SEQ ID NO:699 represent particular embodiments of the present invention.
- amyloid ⁇ peptide analogues as defined herein, wherein the amino acid sequence is A ⁇ (1-42), A ⁇ (12-42), A ⁇ (16-42), A ⁇ (20- 42), or A ⁇ (16-35), with the amino acid at position 14, 15, 16, 17, 18, 19, 20, 21 , or 22 being selected from the group consisting cysteine, lysine, glutamic acid or aspartic acid, in particular cysteine or lysine, and the amino acid at position 37, 36, 35, 34, 33, 32, 31 , 30, or 29 being selected from the group consisting cysteine, lysine, glutamic acid or aspartic acid, in particular cysteine, lysine, or glutamic acid, and the amino acid at position 14 is covalently linked with the amino acid at position 37, the amino acid at position 15 is covalently linked with the amino acid at position 36, the amino acid at position 16 is covalently linked with the amino acid at position 35, the amino acid at position 17 is co
- a covalent linkage between two amino acid residues may be established by a variety of means well known in the art, for instance by disulfide bridge formation or cross-linking techniques.
- the side chains of amino acid residues may be linked with each other.
- side chains with a functional group e.g., a thiol, amino, carboxyl or hydroxyl group, may linked with each other directly, such as two cysteine residues which form a disulfide bridge, or indirectly via a linker.
- the amino acid residue that is covalently linked to the other amino acid residues may in particular be that of an amino acid residue selected from the group consisting of cysteine, lysine, aspartic acid and glutamic acid.
- crosslinking of proteins has a long and exhaustive history, with large amounts of literature precedent. Any methodology known to those familiar with the art that allows for specific covalent cross-links to be made between natural or non-natural amino acid side chains can be used to form the position specific cross-links envisioned in this invention. Some examples of this methodology are listed below.
- the preferred cross-linking agents include homobifunc- tional and heterobifunctional cross-linkers, with heterobifunctional cross-linkers being preferred due to their suitability to link amino acids in a stepwise manner.
- heterobifunctional cross-linkers provide the ability to establish more specific linkages, thereby reducing the occurrences of unwanted side reactions.
- heterobifunctional cross-linkers for forming linkages between two amino (- NH 2 ) groups, one amino and one thiol (or sufhydryl, i.e., -SH) group, or two thiol groups.
- One reactive group useful as part of a heterobifunctional cross-linker is an amine-reactive group.
- Common amine-reactive groups include N-hydroxysuccinimide (NHS) esters.
- NHS esters react specifically with free amines (e.g., lysine residues) in minutes, under slightly acidic to neutral (pH 6.5-7. 5) conditions.
- cross-linking agents having N-hydroxysuccinimide moieties can also be used in the form of their N-hydroxysulfosuccinimide analogs, which generally have greater water solubility.
- Another reactive group useful as part of a heterobifunctional cross-linker is a thiol reactive group.
- Common thiol reactive groups include maleimides, halogens, and pyridyl disulfides. Maleimides react specifically with free thiol groups (e.g., in cysteine residues) in minutes, preferably under slightly acidic to neutral (pH 6.5-7. 5) conditions.
- Halogens iodoacetyl func- tions
- succinimidyl-4-(N-maleimidomethyl)-cyclohexane-1-carboxylate (SMCC) or sulfo-SMCC can be used to form a cross-link between the amine of, e.g., a Lys side chain and the free -SH of, e.g., a Cys side chain.
- the amine-reactive N-hydroxysuccinimide (NHS) ester will react with an amino group (e.g., that of a Lys residue) to form a stable amide bond.
- the resulting maleimide-activated peptide will then react with a sulfhydryl group of the same peptide (e.g., that of a Cys residue) to form a disulfide bond, thereby establishing the cova- lent linkage.
- a sulfhydryl group of the same peptide e.g., that of a Cys residue
- This chemistry is well described in the literature; see for instance: Uto, I., et al. (1991 ). J. Immunol. Methods 138, 87-94; Bieniarz, C, et al. (1996). Extended Length Heterobifunctional Coupling Agents for Protein Conjugations. Bioconjug. Chem. 7, 88-95; Chri- sey, L.A., et al. (1996). Nucleic Acids Res.
- heterobifunctional cross-linkers can be used in a similar fashion, e.g., ([N- ⁇ - maleimidocaproyloxy]succinimide ester, N-[ ⁇ -maleimidobutyryloxy]succinimide ester, N-[ ⁇ - maleimidoundecanoyloxy]sulfosuccinimide ester, m-maleimidobenzoyl-N- hydroxysuccinimide ester (MBS), or their sulfosuccinimide analogs (e.g. sulfo-MBS).
- MBS m-maleimidobenzoyl-N- hydroxysuccinimide ester
- a further example of a heterobifunctional cross-linker that can be used to form a cross-link between the amine of, e.g., a Lys side chain and the free -SH of, e.g., a Cys side chain is succinimidyl-6-[(3-(2-pyridyldithio)-propionate]-hexanoate (LC-SPDP) or sulfo-LC-SPDP.
- the amine-reactive N-hydroxysuccinimide (NHS) ester will react with an amino group (e.g., that of a Lys residue) to form a stable amide bond.
- the resulting peptide has a pyridyldisul- fide group that will then react with a sulfhydryl group of the same peptide (e.g., that of a Cys residue) to form a disulfide bond, thereby establishing the covalent linkage.
- a sulfhydryl group of the same peptide e.g., that of a Cys residue
- This chemistry is well described in the literature; see for instance: Carlsson, J., et al. (1978) Biochem. J. 173, 723-737; Stan, R.V. (2004) Am. J. Physiol. Heart Circ. Physiol. 286, H1347-H1353; Mader, C, et al. (2004) J. Bacterid. 186, 1758-1768.
- heterobifunctional cross-linkers can be used in a similar fashion, e.g., 4- succinimidyloxycarbonyl- ⁇ -methyl- ⁇ -(2-pyridyldithio)-toluene (SMPT) or sulfo-SMPT, N- succinimidyl-3- (2-pyridyldithio)-propionate (SPDP) or sulfo-SPDP.
- SMPT succinimidyloxycarbonyl- ⁇ -methyl- ⁇ -(2-pyridyldithio)-toluene
- SPDP N- succinimidyl-3- (2-pyridyldithio)-propionate
- a further example of a heterobifunctional cross-linker that can be used to form a cross-link between the amine of, e.g., a Lys side chain and the free -SH of, e.g., a Cys side chain is N- succinimidyl-S-acetylthioacetate (SATA) or sulfo-SATA.
- SATA N- succinimidyl-S-acetylthioacetate
- the amine-reactive N- hydroxysuccinimide (NHS) ester will react with an amino group (e.g., that of a Lys residue) to form a stable amide bond.
- the protected -SH group of the resulting peptide will then be de- protected by treatment with hydroxylamine, and the resulating free -SH will then react with a sulfhydryl group of the same peptide (e.g., that of a Cys residue) to form a disulfide bond, thereby establishing the covalent linkage.
- a sulfhydryl group of the same peptide e.g., that of a Cys residue
- heterobifunctional cross-linkers can be used in a similar fashion, e.g., N- succinimidyl-S-acetylthiopropionate or its sulfosuccinimide analog.
- heterobifunctional cross-linkers include N-succinimidyl-(4-iodoacetyl)- aminobenzoate (SIAB) or sulfo-SIAB.
- stepwise cross-linkages can also be formed between amino (-NH 2 ) and carboxy (- COOH) groups.
- EDC 1-ethyl-3-(3-dimethylaminopropyl)-carbodiimide hydrochloride
- o-acylisourea ester e.g., that of an Asp, GIu, Dab (2,4-diaminobutyric acid), Dap (2,4-diaminopropionic acid), or ornithine residue
- the reactive o-acylisourea ester will then react with an amino group of the same peptide (e.g., that of a Lys residue) to form an amide bond, thereby establishing the covalent linkage.
- the reactive o- acylisourea ester may be reacted with N-hydroxysuccinimide, N-hydroxysulfosuccinimide or sulfo-N-hydroxysulfosuccinimide to give the semi-stable amine-reactive NHS ester which will then react with an amino group of the same peptide (e.g., that of a Lys residue) to form an amide bond, thereby establishing the covalent linkage.
- This chemistry is well described in the literature; see for instance: DeSilva, N. S. (2003) Interactions of Surfactant Protein D with Fatty Acids. Am. J. Respir. Cell MoI. Biol. 29, 757-770; Grabarek, Z.
- Heterobifunctional cross-linkers also include the reaction of Lys(N3) and propargyl glycine amino acids. This reaction can be performed in solution or on resin (as described, for instance, in Jiang, S., (2008) Curr. Org. Chem. 12, 1502-1542 and references therein).
- a particular class of cross-linkers in particular heterobifunctional cross-linkers, includes photoreactive cross-linkers.
- (SDA) can be used to form a cross-link between the amine of, e.g., a Lys side chain and the amine of, e.g., another Lys side chain.
- the amine-reactive N- hydroxysuccinimide (NHS) ester will react with an amino group (e.g., that of a Lys residue) to form a stable amide bond.
- the resulting peptide has a photo-labile diazirine moiety that, upon exposure to UV light, will react with an amino group (e.g., that of a Lys residue) of the same peptide to form a stable bond, thereby establishing the covalent linkage.
- photoreactive cross-linkers include bis-[ ⁇ -(4-azidosalicylamido)-ethyl]- disulfide (BASED) and N-succinimidyl-6-(4'-azido-2'-nitrophenyl-amino)-hexanoate (SAN- PAH).
- heterobifunctional cross-linkers In addition to the heterobifunctional cross-linkers, there exist a number of other cross-linking agents including homobifunctional cross-linkers. These include homobifunctional cross-linkers for forming linkages between two amino (-NH 2 ) groups.
- DSS disuccinimidyl suberate
- the amine- reactive N-hydroxysuccinimide (NHS) ester will react with an amino group (e.g., that of a Lys residue) to form a stable amide bond.
- the resulting peptide will then react with another amine group of the same peptide (e.g., that of a Lys residue) to form a further stable amide bond, thereby establishing the covalent linkage.
- homobifunctional cross-linkers include bismaleimidohexane (BMH) and di- methylpimelimidate (DMP).
- Suitable homobifunctional cross-linkers include a methylenedithioether linkage between two cysteines.
- the reaction of the peptide with TBAF (tetrabutylammonium fluoride) can be performed on resin containing the partially deprotected peptide followed by cleavage (see, for instance, Ueki et al., (1999) Bioorg. Med. Chem. Lett., 9, 1767-1772, and Ueki et al. in Peptide Science, 1999, 539-541 ).
- suitable homobifunctional cross-linking systems include ring closing metathesis reac- tions between allylglycines (see, for instance, WeIs, B. et al., (2005) Bioorg. Med. Chem. 13, 4221-4227) or modified amino acids, e.g. (S)-Fmoc- ⁇ (2'pentenyl)alanine (see, for instance, Walensky, L.D., et al., (2004) Science 305, 1466-1470; Schafffle, CE. , et al., (2000) J. Am. Chem. Soc.
- Homo- and heterobifunctional cross-linker may comprise a spacer arm or bridge.
- the bridge is the structure that connects the two reactive ends. The most apparent attribute of the bridge is its effect on steric hindrance. In some instances, a longer bridge can more easily span the distance necessary to link two amino acid residues.
- amyloid ⁇ peptide analogues of the invention may comprise more than one covalent linkage.
- the present invention also relates to oligomers comprising a plurality of amyloid ⁇ peptide analogues as defined herein.
- oligomer here refers to a non-covalent association of two or more amyloid ⁇ peptide analogues as defined herein, possessing homogeneity and distinct physical characteris- tics. According to one aspect, oligomers are stable, non-fibrillar, oligomeric assemblies of amyloid ⁇ peptide analogues. According to one embodiment, said assemblies comprise 2 to 28 amyloid ⁇ peptide analogues.
- Such oligomers may be further characterized by particular interactions between two or amy- loid ⁇ peptide analogues.
- each amyloid ⁇ peptide analogue comprises the sequence L 34 M 35 V 36 Gs 7 G 3 S, with the sequence L A 34 M A 3 5V A 3 6G A 3 7G A 3 8 of one amyloid ⁇ peptide analogue (A) being in parallel orientation to the sequence L B 34 M B 35 V B 36 G B 3 7G B 3 8 of another amyloid ⁇ peptide analogue (B).
- the interproton distance for at least one atom pair selected from the group consisting of M A 35 (NH)-V B 36 (NH), G A 37 (NH)-G B 38 (NH), L A 34 (NH)-L B 34 (C ⁇ H 3 ) , M A 35 (NH)-V B 36 (C ⁇ H 3 ) is 1.8 to 6.5 Angstroms.
- the invention relates to oligomers wherein the amino acid sequence of each amyloid ⁇ peptide analogue comprises the sequence G 33 L 34 M 35 V 36 G 37 G 38 V 39 , with the sequence G A 33 L A 34 M A 35 V A 36 G A 37 G A 38 V A 3 9 of one amyloid ⁇ peptide analogue (A) being in parallel orientation to the sequence G B 33 L B 34 M B 35 V B 36 G B 37 G B 38 V B 39 of another amyloid ⁇ peptide analogue (B).
- the interproton distance for at least one atom pair selected from the group consisting of G A 33 (NH)-G B 34 (NH), M A 35 (NH)-V B 36 (NH), G A 37 (NH)-G B 38 (NH), L A 34 (NH)- L B 34 (C ⁇ H 3 ) , M A 35 (NH)-V B 36 (C ⁇ H 3 ), G A 38 (NH)-V B 39 (C ⁇ H 3 ) and V A 39 (NH)-V B 39 (C ⁇ H 3 ) is 1.8 to 6.5 Angstroms.
- the oligomer comprises an inter-molecular parallel ⁇ -sheet formed by ⁇ -strands of different amyloid ⁇ peptide analogues.
- the ⁇ -sheet comprises the amino acid sequence G A 33 L A 34 M A 35 V A 36 G A 37 G A 38 V A 39 of one amyloid ⁇ peptide analogue (A) and the amino acid sequence G A 33 L A 34 M A 35 V A 36 G A 37 G A 38 V A 39 of another amyloid ⁇ peptide analogue (B).
- the atom pairs G A 33(CO)-L B 34(N), L B 34(CO)-M A 35(N), M A 35(CO)-V B 36(N), V B 36(CO)-G A 37(N), and G B 37(CO)-G A 38(N) are at a distance of 3.3 ⁇ 0.5 A, wherein CO indicates the backbone oxygen atom, and the phi ( ⁇ ) angles of the residues range from -180 to -30 and psi ( ⁇ ) angles of the residues range from approximately 60 to 180 or from approximately -180 to -150.
- lnterproton distances defining the structure of the antiparallel ⁇ -sheet can be determined by the intra-molecular nuclear Overhauser effects (NOEs) between the backbone amides and between the backbone amides and side chains.
- NOEs intra-molecular nuclear Overhauser effects
- lnterproton distances defining the structure of the parallel ⁇ -sheet can be determined by inter-molecular NOEs between backbone NH-NH and between backbone NH and methyl groups of the side chains.
- the intra- vs. inter-molecular NOEs can be distinguished using different isotope-labeled samples, as described, for instance in WO2007/064917, in particular Example V, part G, NMR Features, which is incorporated herein by reference.
- structures can be calculated, e.g. using the program CNX [AT. Brunger, et al., Acta Crystallogr. D54 (Pt 5), 905-21 , (1998)] by using a simulated annealing protocol [M. Nilges, et al., FEBS Lett. 229, 317-324, (1988)], thereby providing further intra-molecular and/or inter-molecular distances between two atoms.
- amyloid ⁇ peptide analogues or oligomers of the invention are characterized by their reactivity with particular antibodies.
- Such antibodies include in particular antibodies having a binding affinity to an A ⁇ (20-42) truncated globu- lomer that is greater than the binding affinity of the antibody to an A ⁇ (1-42) globulomer.
- a ⁇ (X-Y) globulomer refers to a soluble, globular, non-covalent association of A ⁇ (X-Y) peptides as defined herein, possessing homogeneity and distinct physical characteristics.
- a ⁇ (X-Y) globulomers are stable, non-fibrillar, oligomeric assemblies of A ⁇ (X-Y) peptides. In contrast to monomer and fibrils, these globulomers are characterized by defined assembly numbers of subunits (e.g.
- oligomers A early assembly forms
- the globulomers have a 3-dimensional globular type structure ("molten globule”, see Barghorn et al., 2005, J Neurochem, 95, 834-847).
- globulomers may be further characterized by one or more of the following features: - cleavability of N-terminal amino acids X-23 with promiscuous proteases (such as ther- molysin or endoproteinase GIuC) yielding truncated forms of globulomers; non-accessibility of C-terminal amino acids 24-Y with promiscuous proteases and antibodies; truncated forms of these globulomers maintain the 3-dimensional core structure of said globulomers with a better accessibility of the core epitope A ⁇ (20-Y) in its globulomer conformation.
- promiscuous proteases such as ther- molysin or endoproteinase GIuC
- a ⁇ (X-Y) globulomer also includes the N-Met A ⁇ (X-Y) globulomers described in WO2007/064917.
- a ⁇ (X-Y) truncated globulomer here refers to a truncated form of A ⁇ (X-Y) globulomer which can be obtained by subjecting A ⁇ (X-Y) globulomer to limited proteolytic digestion. More specifically, A ⁇ (X-Y) truncated globulomers include N-terminally truncated forms wherein X is selected from the group consisting of the numbers 2 .. 24, with X preferably being 20 or 12, and Y is as defined herein, which are obtainable by truncating A ⁇ (1-Y) globulomers by treatment with appropriate proteases.
- an A ⁇ (20-42) globulomer can be obtained by subjecting an A ⁇ (1-42) globulomer to thermolysin proteolysis
- an A ⁇ (12-42) globulomer can be obtained by subjecting an A ⁇ (1-42) globulomer to endoproteinase GIuC proteolysis.
- the protease is inactivated in a generally known manner.
- the resulting globulomers may then be isolated following the procedures already described herein and, if required, processed further by further work-up and purification steps. A detailed description of said processes is disclosed in WO 2004/067561 , which is incorporated herein by reference.
- an A ⁇ (1-42) globulomer is in particular the A ⁇ (1- 42) globulomer as described in reference example 1 herein;
- an N-Met A ⁇ (1 -42) globulomer is in particular the N-Met A ⁇ (1-42) globulomer as described in reference example 2;
- an A ⁇ (20-42) truncated globulomer is in particular the A ⁇ (20-42) truncated globulomer as described in reference example 3 herein, and an A ⁇ (12-42) truncated globulomer is in particu- lar the A ⁇ (12-42) truncated globulomer as described in reference example 4 herein.
- Antibodies having a binding affinity to an A ⁇ (20-42) truncated globulomer that is greater than the binding affinity of the antibody to an A ⁇ (1-42) globulomer are described in WO 2007/062852 and include, for instance, a monoclonal antibody selected from the group con- sisting of 7C6, 7E5, 4D10 und 5F7. According to a particular embodiment, the said antibody binds to the amyloid ⁇ peptide analogues or oligomers of the invention with a K D in the range of at least 1x10 ⁇ 6 M.
- the antibodies bind to the amyloid ⁇ peptide analogues or oligomers of the present invention with high affinity, for instance with a K 0 of 1x10 ⁇ 7 M or greater affinity, e.g. with a K 0 of 3x10 ⁇ 8 M or greater affinity, with a K D of 1x10 ⁇ 8 M or greater affinity, e.g. with a K D of 3x1 CT 9 M or greater affinity, with a K 0 of IxI O "9 M or greater affinity, e.g. with a K 0 of 3x10 ⁇ 10 M or greater affinity, with a K D of 1x10 ⁇ 10 M or greater affinity, e.g. with a K D of 3x10 ⁇ 11 M or greater affinity, or with a K 0 of 1x10 ⁇ 11 M or greater affinity.
- affinity for instance with a K 0 of 1x10 ⁇ 7 M or greater affinity, e.g. with a K 0 of 3x10 ⁇ 8 M or
- greater affinity refers to a degree of interaction where the equilibrium be- tween unbound antibody and unbound amyloid ⁇ peptide analogue or oligomer on the one hand and antibody-amyloid ⁇ peptide analogue/oligomer complex on the other is further in favour of the antibody-amyloid ⁇ peptide analogue/oligomer complex.
- small affinity refers to a degree of interaction where the equilibrium between unbound antibody and unbound amyloid ⁇ peptide analogue or oligomer on the one hand and antibody-amyloid ⁇ peptide analogue/oligomer complex on the other is further in favour of the unbound antibody and unbound amyloid ⁇ peptide analogue or oligomer.
- greater affinity is synonymous with the term “higher affinity” and term “smaller affinity” is synonymous with the term “lower affinity”.
- the binding affinities of antibodies (monoclonal or polyclonal) to a given antigen may be evaluated by using standardized in-vitro immunoassays such as ELISA, dot blot or BIAcore analyses (Pharmacia Biosensor AB, Uppsala, Sweden and Piscataway, NJ).
- ELISA electrospent assay for ELISA
- BIAcore analyses Pharmacia Biosensor AB, Uppsala, Sweden and Piscataway, NJ.
- the affinities defined herein refer to the values obtained by performing a dot blot as described in example 12 and evaluating it by densitome- try.
- determining the binding affinity by dot blot comprises the following: a certain amount of the antigen or, expediently, an appropriate dilution thereof, for instance in 20 mM NaH 2 PO 4 , 140 mM NaCI, pH 7.4, 0.2 mg/ml BSA to an antigen concentration of, for example, 100 pmol/ ⁇ l, 10 pmol/ ⁇ l, 1 pmol/ ⁇ l, 0.1 pmol/ ⁇ l and 0.01 pmol/ ⁇ l, is dotted onto a nitrocellulose membrane, the membrane is then blocked with milk to prevent unspecific binding and washed, then contacted with the antibody of interest followed by detection of the latter by means of an enzyme-conjugated sec- ondary antibody and a colorimetric reaction; at defined antibody concentrations, the amount of antibody bound allows affinity
- the relative affinity of two different antibodies to one target, or of one antibody to two different targets is here defined as the relation of the respective amounts of target-bound antibody observed with the two antibody- target combinations under otherwise identical dot blot conditions.
- the dot blot approach will determine an antibody's affinity to a given target in the latter's natural conformation.
- K ⁇ is intended to refer to the dissociation constant of a particular antibody-antigen interaction as is known in the art.
- Amyloid ⁇ peptide analogues or oligomers of the present invention that react with globu- lomer-specific antibodies are believed to display at least one globulomer epitope. Therefore, the amyloid ⁇ peptide analogues or oligomers of the present invention are capable of eliciting an immune response having a similar profil as the immune response elicited when A ⁇ (20-42) truncated globulomers or other truncated globulomers are used as immunogen.
- epitope includes any polypeptide determinant capable of specific binding to an immunoglobulin.
- epitope determinants include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl, or sul- fonyl, and, in certain embodiments, may have specific three dimensional structural characteristics, and/or specific charge characteristics.
- An epitope is a region of an antigen that is bound by an antibody. An epitope may also be recognized by other binding agents than immunoglobulins.
- amyloid ⁇ peptide analogues or oligomers of the invention are characterized by their ability of eliciting such a particular immune response, for instance if a mammal, e.g. a rabbit or a mouse, is immunized with an oligomer or derivative of the invention.
- An immune response may be regarded as a mixture of antibodies resulting from challenging (immunizing) a host with an antigen (the immunogen). Said mixture of antibodies can be obtained from the host and is hereinafter referred to as the polyclonal antiserum.
- such a particular immune response i.e., the corresponding polyclonal antise- rum
- a particular immune response is characterized by comprising an antibody having a binding affinity to an amyloid ⁇ peptide analogue or oligomer of the invention or to an A ⁇ (20-42) truncated globulomer that is greater than the binding affinity of the antibody to at least one A ⁇ form selected from the group consisting of monomeric A ⁇ (1-42), monomeric A ⁇ (1-40), monomeric A ⁇ (20-42), fibril- lomeric A ⁇ (1-42), fibrillomeric A ⁇ (1-40) and A ⁇ (1-42) globulomer.
- the immune response i.e., the corresponding polyclonal antiserum
- the immune response is characterized by having an affinity to an amyloid ⁇ peptide analogue or oligomer of the invention or to an A ⁇ (20-42) truncated globulomer which is at least 2 times, e. g. at least 3 times or at least 5 times, preferably at least 10 times, e. g. at least 20 times, at least 30 times or at least 50 times, more preferably at least 100 times, e. g. at least 200 times, at least 300 times or at least 500 times, and even more preferably at least 1000 times, e. g.
- a ⁇ (X-Y) monomer or “monomeric A ⁇ (X-Y)” here refers to the isolated form of the A ⁇ (X-Y) peptide, preferably a form of the A ⁇ (X-Y) peptide which is not engaged in essen- tially non-covalent interactions with other A ⁇ peptides. It represents the essentially unfolded peptide which does not display a globulomer epitope.
- the A ⁇ (X-Y) monomer is usually provided in the form of an aqueous solution.
- the aqueous monomer solution contains 0.05 % to 0.2 %, more preferably about 0.1 % NH 4 OH.
- the aqueous monomer solution contains 0.05 % to 0.2 %, more preferably about 0.1 % NaOH.
- a ⁇ (1-40) monomer here refers to an A ⁇ (1-40) monomer preparation as described in reference example 5 herein
- a ⁇ (1-42) monomer here refers to an A ⁇ (1-42) preparation as described in reference example 6 herein.
- such an immune response is characterized by comprising an antibody having a binding affinity to an amyloid ⁇ peptide analogue or oligomer of the invention or to an A ⁇ (20-42) truncated globulomer that is greater than the binding affinity of the antibody to an A ⁇ (1-42) globulomer.
- fibrill here refers to a molecular structure that comprises assemblies of non- covalently associated, individual A ⁇ (X-Y) peptides, which show fibrillary structure in the elec- tron microscope, which bind Congo red and then exhibit birefringence under polarized light and whose X-ray diffraction pattern is a cross- ⁇ structure.
- a fibril is a molecular structure obtainable by a process that comprises the self-induced polymeric aggregation of a suitable A ⁇ peptide in the ab- sence of detergents, e. g. in 0.1 M HCI, leading to the formation of aggregates of more than 24, preferably more than 100 units.
- a ⁇ (X- Y) fibrils are used in the form of an aqueous solution.
- the aqueous fibril solution is made by dissolving the A ⁇ peptide in 0.1 % NH 4 OH, diluting it 1 : 4 with 20 mM NaH 2 PO 4 , 140 mM NaCI, pH 7.4, followed by readjusting the pH to 7.4, incubating the solution at 37 0 C for 20 h, followed by centrifugation at 10,000 g for 10 min and resuspension in 20 mM NaH 2 PO 4 , 140 mM NaCI, pH 7.4.
- a ⁇ (X-Y) fibril here refers to a fibril consisting essentially of A ⁇ (X-Y) subunits, where it is preferred if on average at least 90 % of the subunits are of the A ⁇ (X-Y) type, more preferred if at least 98 % of the subunits are of the A ⁇ (X-Y) type, and most preferred if the content of non-A ⁇ (X-Y) peptides is below the detection threshold.
- a ⁇ (1-42) fibril here refers to a A ⁇ (1-42) fibril preparation as described in reference example 7 herein.
- the present invention also relates to a purified amyloid ⁇ peptide analogue or oligomer of the invention.
- a purified amyloid ⁇ peptide analogue or oligomer is one which has a purity of more than 80 % by weight of total A ⁇ peptide, preferably of more than 90 % by weight of total A ⁇ peptide, preferably of more than 95 % by weight of total A ⁇ peptide.
- amyloid ⁇ peptide analogues or oligomers of the invention comprise, in addition to the amyloid ⁇ -derived amino acid sequence or peptidomimetic thereof, one or more further moieties.
- diagnostic applications may require labelling the amyloid ⁇ peptide analogues or oligomers.
- active immunization it may be of advantage to attach moieties which prove expedient in active immunization applications.
- the present invention also relates to amyloid ⁇ peptide analogues or oligomers, as defined herein, which comprise a covalently linked group that facilitates detection, preferably a fluorophore, e. g.
- fluorescein isothiocyanate phycoerythrin, Alexa-488, Aequorea victoria fluorescent protein, Dictyosoma fluorescent protein or any combination or fluorescence- active derivative thereof; a chromophore; a chemoluminophore, e. g. luciferase, preferably Photinus pyralis luciferase, Vibrio fischeri luciferase, or any combination or chemolumines- cence-active derivative thereof; an enzymatically active group, e. g. peroxidase, e. g.
- horseradish peroxidase or any enzymatically active derivative thereof; an electron-dense group, e. g. a heavy metal containing group, e.g. a gold containing group; a hapten, e. g. a phenol derived hapten; a strongly antigenic structure, e. g. peptide sequence predicted to be antigenic, e. g.
- a molecule which helps elicit an immune response to the amyloid ⁇ peptide analogue or oligomer e.g., serum albumin, ovalbumin, keyhole limpet hemocyanin, thyroglobulin, a toxoid from bacteria such as tetanus toxoid and diphtheria toxoid, a naturally occurring T cell epitope, a naturally occurring T helper cell epitope; an artificial T-cell epitope such as the pan DR epitope ("PADRE"; WO 95/07707), or another immunostimulatory agent, e.g., mannan, tripalmi- toyl-S-glycerine cysteine, and the like; an aptamer for another molecule; a chelating group, e.
- a chelating group e.
- amyloid ⁇ peptide analogues or oligomers comprising a molecule which is capable of directing the immune response to the anti-inflammatory pathway (Th2-pathway), e.g.
- amyloid ⁇ peptide analogues and oligomers disclosed herein can be produced in a manner which known per se in the art.
- a peptide comprising the amino acid sequence of the desired amyloid ⁇ peptide analogue or a peptidomimetic thereof is provided.
- Said peptide or peptidomimetic may be produced by chemical synthesis using various solid- phase techniques such as those described in G. Barany and R. B. Merrifield, "The Peptides: Analysis, Synthesis, Biology”; Volume 2 - “Special Methods in Peptide Synthesis, Part A", pp. 3-284, E. Gross and J. Meienhofer, Eds., Academic Press, New York, 1980; and in J. M. Stewart and J. D.
- the peptides can be synthesized in a stepwise manner on an insoluble polymer support (also referred to as "resin") starting from the C-terminus of the peptide.
- a synthesis is begun by appending the C-terminal amino acid of the peptide to the resin through formation of an amide or ester linkage. This allows the eventual release of the resulting peptide as a C- terminal amide or carboxylic acid, respectively.
- the C-terminal residue may be attached to 2-Methoxy-4- alkoxybenzyl alcohol resin (SASRINTM, Bachem Bioscience, Inc., King of Prussia, PA) as described herein and, after completion of the peptide sequence assembly, the resulting peptide alcohol is released with LiBH 4 in THF (see J. M. Stewart and J. D. Young, supra, p. 92).
- SASRINTM 2-Methoxy-4- alkoxybenzyl alcohol resin
- the C-terminal amino acid and all other amino acids used in the synthesis are required to have their ⁇ -amino groups and side chain functionalities (if present) differentially protected such that the ⁇ -amino protecting group may be selectively removed during the synthesis.
- the coupling of an amino acid is performed by activation of its carboxyl group as an active ester and reaction thereof with the unblocked ⁇ -amino group of the N-terminal amino acid appended to the resin.
- the sequence of ⁇ -amino group deprotection and coupling is re- peated until the entire peptide sequence is assembled.
- the peptide is then released from the resin with concomitant deprotection of the side chain functionalities, usually in the presence of appropriate scavengers to limit side reactions.
- the resulting peptide is finally purified by reverse phase HPLC.
- peptidyl-resins required as precursors to the final peptides utilizes commercially available cross-linked polystyrene polymer resins (Novabiochem, San Diego, CA; Applied Biosystems, Foster City, CA).
- Preferred solid supports are: 4-(2',4'- dimethoxyphenyl-Fmoc-aminomethyl)-phenoxyacetyl-p-methyl benzhydrylamine resin (Rink amide MBHA resin); ⁇ -Fmoc-amino-xanthen-S-yloxy-Merrifield resin (Sieber amide resin); 4- (9-Fmoc)aminomethyl-3,5-dimethoxyphenoxy)valeryl-aminomethyl-Merrifield resin (PAL resin), for C-terminal carboxamides.
- Coupling of first and subsequent amino acids can be accomplished using HOBT or HOAT active esters produced from DIC/HOBT, HBTU/HOBT, BOP, PyBOP, or from DIC/HOAT, HATU/HOAT, respectively.
- Preferred solid supports are: 2-Chlorotrityl chloride resin and 9-Fmoc-amino-xanthen-3-yloxy-Merrifield resin (Sieber amide resin) for protected peptide fragments.
- Loading of the first amino acid onto the 2- chlorotrityl chloride resin is best achieved by reacting the Fmoc-protected amino acid with the resin in dichloromethane and DIEA. If necessary, a small amount of DMF may be added to facilitate dissolution of the amino acid.
- the syntheses can be carried out by using a peptide synthesizer, such as an Advanced Chemtech Multiple Peptide Synthesizer (MPS396) or an Applied Biosystems Inc. peptide synthesizer (ABI 433a).
- a peptide synthesizer such as an Advanced Chemtech Multiple Peptide Synthesizer (MPS396) or an Applied Biosystems Inc. peptide synthesizer (ABI 433a).
- any other appropriate methodology known to those familiar with the art could be used, including: 1 ) synthesis of multiple copies of the desired peptide or peptidomimetic separated by the appropriate cleavage sites for enzymatic or chemical cleavage of peptide bonds, resulting in the desired peptide peptidomimetic, 2) recombinant expression of APP in any system known to those familiar with the art, and containing the amino acid sequence, followed by either enzymatic or chemical processing to yield the desired peptide, 3) recombinant expression of the desired peptide as a fusion protein in any system known to those familiar with the art, 4) recombinant expression of the desired peptide directly in any system known to those familiar with the art.
- the peptide or peptidomimetic obtained is subjected to conditions that allow the linkage to form.
- the conditions will, of course, depend on the type of linkage to form and can easily be determined by the skilled artisan. Reference is made to to description of linkages and their chemistry provided herein.
- Oligomer synthesis additionally involves oligomer formation.
- the second step will not only comprise linkage but also oligomer formation.
- oligomer formation may precede linkage formation. This is advantageous if the pre-formed oligomer directs or promots the linkages to be formed.
- linkage for- mation may precede oligomer formation. This is advantageous if pre-formed linkages direct or promote oligomer formation. Oligomer formation and linkage formation may also take place concomitantly.
- Both the amyloid ⁇ peptide analogue and the oligomer may be prepared using a peptide or peptidomimetic which differs from the amino aicd sequence or the peptidomimetic comprised by the final amyloid ⁇ peptide analogue or oligomer.
- the starting peptide may comprise additional amino acids at its C- and/or N-terminus which will then be removed during the synthesis, e.g., by proteolytic cleavage.
- oligomers are formed with a peptide or peptidomimetic thereof and subsequently stabilized by one or more intra-peptide or intra-peptidomimetic covalent bond(s).
- oligomers are formed with a peptide or peptidomimetic thereof, stabilized by one or more intra-peptide or intra-peptidomimetic covalent bond(s), and subsequently processed by chemical or enzymatic means to a truncated form that better displays the relevant structural elements.
- oligomers are formed with a peptide or peptidomimetic thereof, processed by chemical or enzymatic means to a trun- cated form that better displays relevant structural elements, and subsequently stabilized by one or more intra-peptide or intra-peptidomimetic covalent bond(s).
- a peptide or peptidomimetic thereof is used to form the relevant structural elements, wherein the peptide or peptidomimetic would be held in the proper conformation by one or more intra-peptide or intra-peptidomimetic covalent bond(s), rather than by interaction with adjacent peptides or peptidomimetic in an oligomer. It is envisioned that these amyloid ⁇ peptide analogues, stabilized with the appropriate intra- peptide or intra-peptidomimetic covalent bond(s), will present the relevant structural elements as a monomer. In this embodiment, it may be expedient to use a peptidomimetic rather than a peptide.
- amyloid ⁇ peptide analogues or oligomers of the invention have many utilities. For instance, they can be used in: 1 ) immunization-based interventional therapies (e.g., amyloid ⁇ peptide analogues or oligomers may be used in active immunization to treat or prevent an amyloidosis); 2) diagnostic testing (e.g., the amyloid ⁇ peptide analogues or oligomers may be used to diagnose an amyloidosis; 3) providing agents such as antibodies and aptamers that bind to the amyloid ⁇ peptide analogues or oligomers; and 4) crystallographic or NMR- based structure-based design research for developing agents such as antibodies and aptamers that bind to the amyloid ⁇ peptide analogues or oligomers.
- immunization-based interventional therapies e.g., amyloid ⁇ peptide analogues or oligomers may be used in active
- amyloidosis here denotes a number of disorders characterized by abnormal folding, clumping, aggregation and/or accumulation of particular proteins (amyloids, fibrous proteins and their precursors) in various tissues of the body.
- nerve tissue is affected, and in cerebral amyloid angiopathy (CAA) blood vessels are affected.
- CAA cerebral amyloid angiopathy
- an amyloidosis is selected from the group consisting of Alzheimer's disease (AD) and the amyloidosis of Down's syndrome.
- a ⁇ (20 - 42) truncated globulomer was shown to be effective in re- versing cognitive defects in Alzheimer Disease transgenic mice.
- the amyloid ⁇ peptide analogues or oligomers of the present invention are able to elicit an immune response whose profil is similar to the profil of the immune response elicited by A ⁇ (20 - 42) truncated globulomer.
- the invention also relates to the amyloid ⁇ peptide analogue or oligomer as defined herein for therapeutic uses.
- the invention relates to therapeutic compositions comprising an amyloid ⁇ peptide analogue or oligomer as defined herein.
- said compositions are pharmaceutical compositions which further comprise a pharmaceutical acceptable carrier.
- the invention relates to the use of the amyloid ⁇ peptide analogue or oligomer as defined herein for preparing a pharmaceutical composition for treating or preventing an amyloidosis.
- the pharmaceutical composition is a vaccine for active immunization.
- the invention also relates to a method of treating or preventing an amyloidosis in a subject in need thereof, which comprises administering the amyloid ⁇ peptide analogue or oligomer as defined herein to the subject.
- administering the amyloid ⁇ peptide analogue or oligomer is for actively immunizing the subject against an amyloidosis.
- amyloid ⁇ peptide analogue or oligomer is not able to enter the patient's CNS in significant amounts.
- the pharmaceutical composition comprising the amyloid ⁇ peptide analogue or oligomer is capable of inducing a strong immune response against A ⁇ oligomers, preferably a strong immune response directed against A ⁇ oligomers only, more preferably a strong non-inflammatory antibody-based immune response against A ⁇ oligomers only.
- the pharmaceutical composition comprises an immunological adjuvant, preferably an adjuvant and a signalling molecule, e. g. a cytokine, that directs the immune response towards the non-inflammatory, antibody- based type.
- a signalling molecule e. g. a cytokine
- the pharmaceutical composition for active immunization is administered via a route selected from the group consisting of the intravenous route, the intramus- cular route, the subcutaneous route, the intranasal route, and by inhalation. It is also particularly preferred if the composition is administered by a method selected from injection, bolus infusion and continuous infusion, each of which may be performed once, repeatedly or in regular intervals.
- long-term continuous infusion is achieved by employing an implantable device.
- the composition is applied as an implantable sustained release or controlled release depot formulation. Suitable formulations and devices are known to those skilled in the art. The details of the method to be used for any given route will depend on the stage and severity of the disease and the overall medical parameters of the subject and are preferably decided upon individually at the treating physician's or veterinary's discretion.
- the pharmaceutical composition for active immunization comprises one or more substances selected from the group consisting of pharmaceutically acceptable preservatives, pharmaceutically acceptable colorants, pharmaceutically acceptable protective colloids, pharmaceutically acceptable pH regulators and pharmaceutically acceptable osmotic pressure regulators. Such substances are described in the art.
- amyloid ⁇ peptide analogues or oligomers of the present invention react with antibodies that are specifically reactive with said epitopes the oligomers are believed to display the same or a very similar epitope.
- the invention thus also relates to the amyloid ⁇ peptide analogue or oligomer as defined herein for diagnostic uses.
- the invention relates to diagnostic compositions comprising an amyloid ⁇ peptide analogue or oligomer as defined herein.
- said compositions are pharmaceutical compositions which further comprise a pharmaceutical acceptable carrier.
- the invention relates to the use of an amyloid ⁇ peptide analogue or oligomer as defined herein for preparing a composition for diagnosing an amyloidosis.
- the invention also relates to a method of diagnosing an amyloidosis which comprises providing a sample from the subject suspected of having the amyloidosis, contacting the sample with an amyloid ⁇ peptide analogue or oligomer as defined herein for a time and under conditions sufficient for the formation of a complex comprising the amyloid ⁇ peptide analogue or oligomer and an antibody, the presence of the complex indicating the subject has the amyloidosis.
- at least the step of contacting the sample is carried out ex vivo and in particular in vitro.
- amyloid ⁇ peptide analogue or oligomer of the present invention may be used in a variety of diagnostic methods and assays.
- the method of diagnosing an amyloidosis in a patient sus- pected of having this disease comprises the steps of: a) isolating a biological sample from the patient; b) contacting the biological sample with an amyloid ⁇ peptide analogue or oligomer for a time and under conditions sufficient for the formation of antibody/amyloid ⁇ peptide analogue or oligomer complexes; c) adding a conjugate to the resulting antibody/ amyloid ⁇ peptide analogue or oligomer complexes for a time and under conditions sufficient to allow the conjugate to bind to the bound antibody, wherein the conjugate comprises an antibody attached to a signal generating compound capable of generating a detectable signal; and d) detecting the presence of antibodies which may be present in the biological sample by detecting a signal generated by the signal generating compound, the signal indicating a diagnosis of an amyloidosis in the patient.
- the method of diagnosing an amyloidosis in a patient suspected of having this disease comprises the steps of: a) isolating a biological sample from the patient; b) contacting the biological sample with anti-antibody specific for antibodies in the sample for a time and under conditions sufficient to allow for formation of anti- antibody/antibody complexes; b) adding a conjugate to resulting anti-antibody/antibody complexes for a time and under conditions sufficient to allow the conjugate to bind to bound antibody, wherein the conjugate comprises an amyloid ⁇ peptide analogue or oligomer of the present invention attached to a signal generating compound capable of generating a detectable signal; and c) detecting a signal generated by the signal generating compound, the signal indicating a diagnosis of an amyloidosis in the patient.
- step a) At least one of said steps b) and c) is carried out ex vivo and in particular in vitro.
- the method does not comprise step a). More specifically, as the amyloid ⁇ peptide analogues or oligomers of the present invention display the globulomer epitope and the globulomer epitope is believed to be an endogenous antigen which gives rise to an endogenous immune response, diagnosis of amyloidoses can be related to the determination of the presence of auto-antibodies which specifically bind to the amyloid ⁇ peptide analogues or oligomers of the invention.
- the invention thus also relates to the use of the amyloid ⁇ peptide analogue or oligomer as defined herein for preparing a composition for detecting in a subject auto-antibodies that bind to the oligomer or derivative. Accordingly, the invention also relates to a method of detecting auto-antibodies that bind to the amyloid ⁇ peptide analogue or oligomer in a subject, which method comprises administering to the subject amyloid ⁇ peptide analogue or oligomer as defined herein and detecting a complex formed by the antibody and the amyloid ⁇ peptide analogue or oligomer, the presence of the complex indicating the presence of the auto-antibodies.
- the subject is suspected of having any form of amyloidosis, e.g. Alzheimer's disease, and detecting auto-antibodies is for diagnosing the presence or absence of any form of amyloidosis, e.g. Alzheimer's disease, in the subject.
- any form of amyloidosis e.g. Alzheimer's disease
- detecting auto-antibodies is for diagnosing the presence or absence of any form of amyloidosis, e.g. Alzheimer's disease, in the subject.
- the invention also relates to the use of the amyloid ⁇ peptide analogue or oligomer as defined herein for detecting auto-antibodies that bind to the oligomer or derivative in a sample. Accordingly, the invention also refers to a method of detecting auto-antibodies that bind to the A ⁇ amyloid ⁇ peptide analogue or oligomer in a sample, which method comprises contacting the sample with the amyloid ⁇ peptide analogue or oligomer as defined herein and detecting a complex formed by the antibody and the amyloid ⁇ peptide analogue or oligomer, the presence of the complex indicating the presence of the auto-antibodies.
- the step of contacting the sample is carried out ex vivo and in particular in vitro.
- the sample is derived from a subject suspected of having an amyloidosis, e.g. Alzheimer's disease, and detecting the auto-antibodies is for diagnosing the presence or absence of the amyloidosis, e.g. Alzheimer's disease in the subject.
- Suitable samples include biological fluids which may be tested by the aforesaid method. These include plasma, whole blood, dried whole blood, serum, cerebrospinal fluid or aqueous or organo-aqueous extracts of tissues and cells.
- detecting auto-antibodies as described herein further comprises a pre-treatment of the preparation (sample) which causes dissociation of auto-antibody/antigen complexes.
- a method comprising such a pre-treatment may therefore be used in order to determine the total amount of auto-antibodies present in the preparation (sample) while a method not comprising said pre-treatment may be used in order to determine the amount of auto-antibodies which can still bind to the antigen. Further, both methods will allow to indirectly determine the amount of complexed auto-antibodies.
- Conditions suitable for inducing dissociation of auto-antibody/antigen complexes are known to the skilled person. For instance, treating the preparation (sample) with acid, e.g., using a buffer such that the pH of the resulting preparation (sample) is in the range of 1 to 5, preferably in the range of 2 to 4 and in particular in the range of 2 to 3, may be expedient.
- Suitable buffers include salts in a physiological concentration, e.g. NaCI and acetic acid.
- dissociating the antibody from the antigen in the antibody/antigen complex comprises the steps of: contacting the sample containing an antibody/antigen complex with a dissociation buffer; incubating the sample; and optionally concentrating the sample.
- the dissociation buffer may be a PBS buffer which has a pH in the range as indicated herein.
- a PBS buffer containing about 1.5 % BSA and 0.2 M glycine-acetate pH 2.5, or 140 mM NaCI and 0.58 % acetic acid is suitable.
- Concentration can be achieved in a manner known per se, for instance by passing the sample over a Centriprep YM30 (Amincon Inc.).
- the amyloid ⁇ peptide analogue or oligomer, or a portion thereof is coated on a solid phase.
- the sample e.g., whole blood, cerebrospinal fluid, serum, etc.
- the antibodies e.g. the autoantibodies
- the direct method comprises simply detecting presence of the complex itself and thus presence of the antibodies.
- a conjugate is added to the bound antibody.
- the conjugate comprises a second antibody, which binds to the first bound antibodies, attached to a signal-generating compound or label. Should the second antibody bind to a bound first antibody, the signal-generating compound generates a measurable signal. Such a signal then indicates presence of the first antibodies in the sample.
- solid phases used in diagnostic immunoassays are porous and non-porous materials, latex particles, magnetic particles, microparticles (see U.S. Patent No. 5,705,330), beads, membranes, microtiter wells and plastic tubes.
- the choice of the solid phase material and the method of labeling the antigen or antibodies present in the conjugate, if desired, are determined based upon desired assay format performance characteristics.
- the conjugate (or indicator reagent) will comprise an antibody (or perhaps anti-antibodies, depending upon the assay), attached to a signal-generating compound or "label".
- This signal-generating compound or label is itself detectable or may be reacted with one or more additional compounds to generate a detectable product.
- signal- generating compounds examples include chromophores, radioisotopes (e.g., 1251, 1311, 32P, 3H, 35S and 14C), chemiluminescent compounds (e.g., ac- ridinium), particles (visible or fluorescent), nucleic acids, complexing agents, or catalysts such as enzymes (e.g., alkaline phosphatase, acid phosphatase, horseradish peroxidase, beta-galactosidase and ribonuclease).
- chromophores e.g., radioisotopes (e.g., 1251, 1311, 32P, 3H, 35S and 14C)
- chemiluminescent compounds e.g., ac- ridinium
- particles visible or fluorescent
- nucleic acids complexing agents
- catalysts such as enzymes (e.g., alkaline phosphatase, acid phosphatase, horseradish peroxidase
- chromo-, fluro-, or lumo-genic substrate results in generation of a detectable signal.
- detection systems such as time-resolved fluorescence, internal-reflection fluorescence, amplification (e.g., polymerase chain reaction) and Raman spectroscopy are also useful.
- kits are also included within the scope of the present invention. More specifically, the present invention includes kits for determining the presence of antibodies such as autoantibodies in a subject.
- a kit for determining the presence of said antibodies in a sample comprises a) a amyloid ⁇ peptide analogue or oligomer as defined herein; andop- tionally b) a conjugate comprising an antibody attached to a signal generating compound capable of generating a detectable signal.
- the kit may also contain a control or calibrator which comprises a reagent which binds to the antigen.
- the present invention also includes another type of kit for detecting antibodies such as autoantibodies in a sample.
- the kit may comprise a) an anti-antibody specific for the antibody of interest, and b) amyloid ⁇ peptide analogue or oligomer as defined herein.
- a control or calibrator comprising a reagent which binds to the amyloid ⁇ peptide analogue or oligomer may also be included.
- the kit may comprise a) an anti-antibody specific for the auto-antibody and b) a conjugate comprising the amyloid ⁇ peptide analogue or oligomer, the conjugate being attached to a signal generating compound capable of generating a detectable signal.
- the kit may also comprise a control or calibrator comprising a reagent which binds to the antigen.
- the kit may also comprise one container such as a vial, bottle or strip, with each container with a pre-set solid phase, and other containers containing the respective conjugates.
- These kits may also contain vials or containers of other reagents needed for performing the assay, such as washing, processing and indicator reagents.
- amyloid ⁇ peptide analogues or oligomers of the invention are useful for providing agents that are capable of binding to the amyloid ⁇ peptide analogue or oligomer.
- agents include, e.g., antibodies (hereinafter also referred to as anti-oligomer antibody), non- antibody binding molecules (such as affibodies, affilin molecules, AdNectins, Anticalins, DARPins, domain antibodies, evibodies, knotins, Kunitz-type domains, maxibodies, tetranectins, trans-bodies, and V(NAR)S, as described, for instance, in the Handbook of Therapeutic Antibodies, ed. by Stefan D ⁇ bel, Volume II, Chapter 7, Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim, 2007), aptamers or small-molecular weight compounds.
- the invention thus relates to the use of the amyloid ⁇ peptide analogue or oligomer for screening an agent that is capable of binding to the amyloid ⁇ peptide analogue or oligomer.
- the invention also relates to a method of identifying such agents, which method comprises the steps of: a) exposing one or more agents of interest to the amyloid ⁇ peptide analogue or oligomer described herein for a time and under conditions sufficient for the one or more agents to bind to the amyloid ⁇ peptide analogue or oligomer; and b) identifying those agents which bind to the amyloid ⁇ peptide analogue or oligomer.
- the invention relates to the use of the amyloid ⁇ peptide analogue or oligomer for enriching an agent that is capable of binding to the amyloid ⁇ peptide analogue or oligomer in a preparation comprising said agent.
- the invention also relates to a method of enriching such an agent in a preparation comprising said agent, which method comprises the steps of: a) exposing to the amyloid ⁇ peptide analogue or oligomer the preparation comprising the agent that is capable of binding to the amyloid ⁇ peptide analogue or oligomer for a time and under conditions sufficient for the agent to bind to the amy- loid ⁇ peptide analogue or oligomer; and b) obtaining the agent in enriched form.
- the amyloid ⁇ peptide analogue or oligomer can be immobilized (for instance on a resin), which allows the agent to be captured.
- Obtaining the agent in enriched form may then comprise desorbing the captured agent, preferably in such a way that desorbing the captured agent comprises contacting the captured agent with a high salt buffer or an acidic solution.
- This method can, for instance, be used for enriching auto-antibodies as described herein by subjecting commercial immunoglobulin preparations like IVIG or Octagam® (Octa- pharma Inc. Vienna, Austria) to this method. It is believed that these immunoglobulin preparations contain auto-antibodies to A ⁇ , and by treating subjects one raises the level of anti-A ⁇ antibodies in their body. A preparation that is enriched for said auto-antibodies would be expected to be more efficacious.
- the invention thus relates to the use of the amyloid ⁇ peptide analogue or oligomer for providing an antibody that binds to the amyloid ⁇ peptide analogue or oligomer.
- the invention also relates to a method for providing an antibody that binds to the amyloid ⁇ peptide analogue or oligomer as defined herein, which method comprises: a) providing an antigen comprising the amyloid ⁇ peptide analogue or oligomer; b) exposing an antibody repertoire or potential antibody repertoire to said antigen; and c) selecting from said repertoire an antibody which binds to said amyloid ⁇ peptide analogue or oligomer.
- a “potential antibody repertoire” refers to any library, collec- tion, assembly or set of amino acid or corresponding nucleic acid sequences or to any generator of such a library, collection, assembly or set of amino acid sequences that can be used for producing an antibody repertoire in vivo or in vitro.
- the generator is the adaptive immune system of an animal, in particular the antigen-producing part of the immune system of a mammal which generates antibody diversity by a recombination process well known to those skilled in the art.
- the generator is a system for the spawning of random nucleic acid sequences which can then, by insertion into a suitable antibody framework, be used to produce an antibody repertoire in vitro.
- the antibody repertoire or potential antibody repertoire is exposed to the antigen in vivo by immunizing an organism with said antigen.
- the potential antibody repertoire is a library of suitable nucleic acids which is exposed to the antibody by in vitro affinity screening as described in the art, e.g. a phage display and panning system.
- the invention also provides antibodies that bind to the A ⁇ (X - 38 .. 43) amyloid ⁇ peptide analogue or oligomer as defined herein.
- the antibody is obtainable by a method comprising selecting the antibody from a repertoire or potential repertoire as described herein.
- the present invention provides amyloid ⁇ peptide analogue- or oligomer-specific antibodies.
- These include in particular antibodies having a comparatively smaller affinity for both the monomeric and fibrillomeric forms of A ⁇ peptide than for the amyloid ⁇ peptide analogue or oligomer of the invention.
- an antibody is said to specifically bind an antigen when it preferentially recognizes its target antigen in a complex mixture of proteins and/or macromolecules.
- the affinity of the antibody to the amyloid ⁇ peptide analogue or oligomer is at least 2 times, e. g. at least 3 times or at least 5 times, pref- erably at least 10 times, e. g. at least 20 times, at least 30 times or at least 50 times, more preferably at least 100 times, e. g. at least 200 times, at least 300 times or at least 500 times, and even more preferably at least 1000 times, e. g. at least 2000 times, at least 3000 times or at least 5000 times, even more preferably at least 10000 times, e. g. at least 20000 times, at least 30000 or at least 50000 times, and most preferably at least 100000 times greater than the binding affinity of the antibody to a monomeric A ⁇ (1 - 42).
- the affinity of the antibody to the amyloid ⁇ peptide analogue or oligomer is at least 2 times, e. g. at least 3 times or at least 5 times, preferably at least 10 times, e. g. at least 20 times, at least 30 times or at least 50 times, more preferably at least 100 times, e. g. at least 200 times, at least 300 times or at least 500 times, and even more preferably at least 1000 times, e. g. at least 2000 times, at least 3000 times or at least 5000 times, even more preferably at least 10000 times, e. g. at least 20000 times, at least 30000 or at least 50000 times, and most preferably at least 100000 times greater than the binding affinity of the antibody to a monomeric A ⁇ (1 - 40).
- the antibody of the present invention binds to one or, more preferably, both monomers with low affinity, most preferably with a K 0 of 1x10 "8 M or smaller affinity, e. g. with a K D of 3x10 "8 M or smaller affinity, with a K D of 1x10 "7 M or smaller affinity, e. g. with a K D of 3x10 "7 M or smaller affinity, or with a K D of 1 x10 "6 M or smaller affinity, e. g. with a K D of 3x10 "5 M or smaller affinity, or with a K D of 1 x10 "5 M or smaller affinity.
- the affinity of the antibody to the amyloid ⁇ peptide analogue or oligomer is at least 2 times, e. g. at least 3 times or at least 5 times, preferably at least 10 times, e. g. at least 20 times, at least 30 times or at least 50 times, more preferably at least 100 times, e. g. at least 200 times, at least 300 times or at least 500 times, and even more preferably at least 1000 times, e. g. at least 2000 times, at least 3000 times or at least 5000 times, even more preferably at least 10000 times, e. g. at least 20000 times, at least 30000 or at least 50000 times, and most preferably at least 100000 times greater than the binding affinity of the antibody to a fibrillomeric A ⁇ (1 - 42).
- the affinity of the antibody to the amyloid ⁇ pep- tide analogue or oligomer is at least 2 times, e. g. at least 3 times or at least 5 times, preferably at least 10 times, e. g. at least 20 times, at least 30 times or at least 50 times, more preferably at least 100 times, e. g. at least 200 times, at least 300 times or at least 500 times, and even more preferably at least 1000 times, e. g. at least 2000 times, at least 3000 times or at least 5000 times, even more preferably at least 10000 times, e. g. at least 20000 times, at least 30000 or at least 50000 times, and most preferably at least 100000 times greater than the binding affinity of the antibody to a fibrillomeric A ⁇ (1 - 40).
- the antibody of the present invention binds to one or, more preferably, both fibrils with low affinity, most preferably with a K D of 1x10 "8 M or smaller affinity, e. g. with a K D of 3x10 "8 M or smaller affinity, with a K D of 1x10 "7 M or smaller affinity, e. g. with a K D of 3x10 " 7 M or smaller affinity, or with a K D of 1 x10 "6 M or smaller affinity, e. g. with a K D of 3x10 "5 M or smaller affinity, or with a K 0 of 1 x10 "5 M or smaller affinity.
- the antibodies of the present invention are preferably isolated antibodies.
- An "isolated anti- body” means an antibody having the binding affinities as described above and which is essentially free of other antibodies having different binding affinities.
- the term “essentially free” here refers to an antibody preparation in which at least 95 % of the antibodies, preferably at least 98 % of the antibodies and more preferably at least 99 % of the antibodies have the desired binding affinity.
- an isolated antibody may be substantially free of other cellular material and/or chemicals.
- the isolated antibodies of the present invention include monoclonal antibodies.
- a "monoclonal antibody” as used herein is intended to refer to a preparation of antibody molecules, antibodies which share a common heavy chain and common light chain amino acid se- quence, in contrast with “polyclonal” antibody preparations which contain a mixture of antibodies of different amino acid sequence.
- Monoclonal antibodies can be generated by sev- eral novel technologies like phage, bacteria, yeast or ribosomal display, as well as by classical methods exemplified by hybridoma-derived antibodies (e.g., an antibody secreted by a hybridoma prepared by hybridoma technology, such as the standard Kohler and Milstein hybridoma methodology ((1975) Nature 256:495-497).
- a non-hybridoma-derived antibody with uniform sequence is still referred to as a monoclonal antibody herein although it may have been obtained by non-classical methodologies, and the term "monoclonal" is not restricted to hybridoma-derived antibodies but used to refer to all antibodies derived from one nucleic acid clone.
- the monoclonal antibodies of the present invention include recombinant antibodies.
- the term "recombinant” herein refers to any artificial combination of two otherwise separated segments of sequence, e.g., by chemical synthesis or by the manipulation of isolated segments of nucleic acids by genetic engineering techniques.
- the term “recombinant antibody” refers to antibodies which are produced, expressed, generated or isolated by recombinant means, such as antibodies which are expressed using a recombinant expres- sion vector transfected into a host cell; antibodies isolated from a recombinant combinatorial antibody library; antibodies isolated from an animal (e.g. a mouse) which is transgenic due to human immunoglobulin genes (see, for example, Taylor, L.
- the antibody is a humanized antibody.
- the antibody may comprise an amino acid se- quence derived entirely from a single species, such as a human antibody or a mouse antibody.
- the antibody may be a chimeric antibody or a CDR graft antibody or another form of a humanized antibody.
- antibody is intended to refer to immunoglobulin molecules consisting of 4 poly- peptide chains, two heavy (H) chains and two light (L) chains.
- the chains are usually linked to one another via disulfide bonds.
- Each heavy chain is composed of a variable region of said heavy chain (abbreviated here as HCVR or VH) and a constant region of said heavy chain.
- the heavy chain constant region consists of three domains CH1 , CH2 and CH3.
- Each light chain is composed of a variable region of said light chain (abbreviated here as LCVR or VL) and a constant region of said light chain.
- the light chain constant region consists of a CL domain.
- VH and VL regions may be further divided into hypervariable regions referred to as complementarity-determining regions (CDRs) and interspersed with conserved regions referred to as framework regions (FR).
- CDRs complementarity-determining regions
- FR framework regions
- Each VH and VL region thus consists of three CDRs and four FRs which are arranged from the N terminus to the C terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, FR4. This structure is well known to those skilled in the art.
- antibody moiety refers to one or more fragments of an antibody of the invention, said fragment(s) still having the binding affinities as defined above. Fragments of a complete antibody have been shown to be able to carry out the antigen-binding function of an antibody.
- binding fragments include (i) an Fab fragment, i.e. a monovalent fragment composed of the VL, VH, CL and CH1 domains; (ii) an F(ab') 2 fragment, i.e.
- a bivalent fragment comprising two Fab fragments linked to one another in the hinge region via a disulfide bridge; (iii) an Fd fragment composed of the VH and CH 1 domains; (iv) an Fv fragment composed of the FL and VH domains of a single arm of an antibody; (v) a dAb fragment (Ward et al., (1989) Nature 341 :544-546) consisting of a VH domain or of VH, CH1 , CH2, DH3, or VH, CH2, CH3; and (vi) an isolated complementarity- determining region (CDR).
- CDR complementarity- determining region
- the two domains of the Fv fragment namely VL and VH
- VL and VH are encoded by separate genes, they may further be linked to one another using a synthetic linker, e.g. a PoIy-G 4 S amino acid sequence, and recombinant methods, making it possible to prepare them as a single protein chain in which the VL and VH regions combine in order to form monovalent molecules (known as single chain Fv (ScFv); see, for example, Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. ScL USA 85:5879-5883).
- the term "antigen-binding moiety" of an antibody is also intended to comprise such single chain antibodies.
- Diabodies are bivalent, bispecific antibodies in which VH and VL domains are expressed on a single polypeptide chain, but using a linker which is too short for the two domains being able to combine on the same chain, thereby forcing said domains to pair with complementary domains of a different chain and to form two antigen- binding sites (see, for example, Holliger, P., et al. (1993) Proc. Natl. Acad. ScL USA 90:6444-6448; Poljak, RJ. , et al. (1994) Structure 2:1121-1 123).
- An immunoglobulin con- stant domain refers to a heavy or light chain constant domain. Human IgG heavy chain and light chain constant domain amino acid sequences are known in the art.
- an antibody of the present invention or antigen-binding moiety thereof may be part of a larger immunoadhesion molecule formed by covalent or noncovalent association of said antibody or antibody-binding moiety with one or more further proteins or peptides.
- immunoadhesion molecules are the use of the streptavidin core region in order to prepare a tetrameric scFv molecule (Kipriyanov, S. M., et al. (1995) Human Antibodies and Hybridomas 6:93-101 ) and the use of a cystein residue, a marker peptide and a C-terminal polyhistidinyl, e. g.
- human antibody refers to antibodies whose variable and constant regions correspond to or are derived from immunoglobulin sequences of the human germ line, as described, for example, by Kabat et al. (see Kabat, et al. (1991 ) Sequences of Proteins of Im- munological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
- the human antibodies of the invention may contain amino acid residues not encoded by human germ line immunoglobulin sequences (for example mutations which have been introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs, and in particular in CDR3.
- Recom- binant human antibodies of the invention have variable regions and may also contain constant regions derived from immunoglobulin sequences of the human germ line (see Kabat, E. A., et al. (1991 ) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
- recombinant human antibodies are subjected to in-vitro mutagenesis (or to a somatic in-vivo mutagenesis, if an animal is used which is transgenic due to human Ig sequences) so that the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences which although related to or derived from VH and VL sequences of the human germ line, do not naturally exist in vivo within the human antibody germ line repertoire.
- recombinant antibodies of this kind are the result of selective mutagenesis or back mutation or of both.
- mutagenesis leads to an affinity to the target which is greater, and/or an affinity to non-target structures which is smaller than that of the parent antibody.
- chimeric antibody refers to antibodies which contain sequences for the variable region of the heavy and light chains from one species and constant region sequences from another species, such as antibodies having murine heavy and light chain variable regions linked to human constant regions.
- CDR-grafted antibody refers to antibodies which comprise heavy and light chain variable region sequences from one species but in which the sequences of one or more of the CDR regions of VH and/or VL are replaced with CDR sequences of another species, such as antibodies having murine heavy and light chain variable regions in which one or more of the murine CDRs (e.g., CDR3) has been replaced with human CDR sequences.
- humanized antibody refers to antibodies which contain sequences of the variable region of heavy and light chains from a nonhuman species (e.g. mouse, rat, rabbit, chicken, camelid, sheep or goat) but in which at least one part of the VH and/or VL sequence has been altered in order to be more "human-like", i.e. to be more similar to variable sequences of the human germ line.
- a humanized antibody is a CDR graft antibody in which human CDR sequences have been inserted into nonhuman VH and VL sequences to re- place the corresponding nonhuman CDR sequences.
- mice which had been made deficient in a particular endogenous protein via homologous recombination at the corresponding endogenous gene (i.e. knockout mice) have been shown to generate a humoral response to the protein with which they have been immunized and therefore to be able to be used for production of high-affinity monoclonal antibodies to the protein (see, for example, Roes, J. et al. (1995) J. Immunol. Methods 183:231-237; Lunn, M. P. et al. (2000) J. Neurochem. 75:404-412).
- a multiplicity of nonhuman mammals are suitable hosts for antibody production in order to produce nonhuman antibodies of the invention. They include mice, rats, chickens, camelids, rabbits, sheep and goats (and knockout versions thereof), although preference is given to mice for the production of hybridomas. Furthermore, a nonhuman host animal expressing a human antibody repertoire may be used for producing essentially human antibodies to a human antigen with dual specificity. Nonhuman animals of this kind include transgenic animals (e.g. mice) bearing human immunoglobulin transgenes (chimeric hu-PBMC SCID mice) and human/mouse irradiation chimeras which are described in more detail below.
- transgenic animals e.g. mice
- human immunoglobulin transgenes chimeric hu-PBMC SCID mice
- human/mouse irradiation chimeras which are described in more detail below.
- the animal immunized with amyloid ⁇ peptide analogue or oligomer is a nonhuman mammal, preferably a mouse, which is transgenic due to human immunoglobulin genes so that said nonhuman mammal makes human antibodies upon anti- genie stimulation.
- immunoglobulin transgenes for heavy and light chains with human germ line configuration are introduced into such animals which have been altered such that their endogenous heavy and light chain loci are inactive. If such animals are stimulated with antigen (e.g. with a human antigen), antibodies derived from the human immunoglobulin sequences (human antibodies) are produced. It is possible to make from the lymphocytes of such animals human monoclonal antibodies by means of standardized hybridoma technology.
- transgenic mice with human immunoglobulins and their use in the production of human antibodies, see, for example, US 5,939,598, WO 96/33735, WO 96/34096, WO 98/24893 and WO 99/53049 (Abgenix Inc.), and US 5,545,806, US 5,569,825, US 5,625,126, US 5,633,425, US 5,661 ,016, US 5,770,429, US 5,814,318, US 5,877,397 and WO 99/45962 (Genpharm Inc.); see also MacQuitty, JJ. and Kay, R.M.
- the animal which is immunized with the amyloid ⁇ peptide analogue or oligomer may be a mouse with severe combined immunodeficiency (SCID), which has been reconstituted with human peripheral mononuclear blood cells or lymphoid cells or precursors thereof.
- SCID severe combined immunodeficiency
- Such mice which are referred to as chimeric hu-PBMC SCID mice produce human immunoglobulin responses upon antigenic stimulation, as has been proved.
- the animal which is immunized with the amyloid ⁇ peptide analogue or oligomer is a mouse which has been treated with a lethal dose of total body irradiation, then protected from radiation with bone marrow cells from mice with severe com- bined immunodeficiency (SCID) and subsequently transplanted with functional human lymphocytes.
- SCID severe com- bined immunodeficiency
- This type of chimera referred to as the Trimera system, is used in order to produce human monoclonal antibodies by immunizing said mice with the antigen of interest and then producing monoclonal antibodies by using standardized hybridoma technology.
- monoclonal antibodies may be produced by means of standardized techniques such as the hybridoma technique originally described by Kohler and Milstein (1975, Nature 256:495-497) (see also Brown et al. (1981 ) J. Immunol 127:539-46; Brown et al. (1980) J Biol Chem 255:4980-83; Yeh et al. (1976) PNAS 76:2927-31 ; and Yeh et al. (1982) Int. J. Cancer 29:269-75).
- the technology of producing monoclonal antibody hybridomas is sufficiently known (see generally R. H. Kenneth, in Monoclonal Antibodies: A New Dimension In Biological Analyses, Plenum Publishing
- an immortalized cell line typically a myeloma
- lymphocytes typically splenocytes or lymph node cells or peripheral blood lymphocytes
- the culture supernatants of the resulting hybridoma cells are screened in order to identify a hybridoma which produces a monoclonal antibody of the present invention.
- the immortalized cell line e.g. a myeloma cell line
- the immortalized cell line is derived from the same mammalian species as the lymphocytes.
- murine hybridomas may be established by fusing lymphocytes from a mouse immunized with an immunogenic preparation of the invention with an immortalized mouse cell line.
- Preferred immortalized cell lines are mouse myeloma cell lines which are sensitive to culture medium containing hypoxanthine, aminopterine and thymidine (HAT medium). Any of a number of myeloma cell lines may be used by default as fusion partner, for example the P3-NS1/1-Ag4-1 , P3-x63-Ag8.653 or Sp2/O-Ag14 myeloma lines. These myeloma cell lines are available from the American Type Culture Collection (ATCC), Rockville, MD.
- ATCC American Type Culture Collection
- HAT-sensitive mouse myeloma cells are fused to mouse splenocytes using polyethylene glycol (PEG).
- Hybridoma cells resulting from the fu- sion are then selected using HAT medium, thereby killing unfused and unproductively fused myeloma cells (unfused splenocytes die after several days because they are not transformed).
- Hybridoma cells producing monoclonal antibodies of the invention are identified by screening the hybridoma culture supernatants for such antibodies, for example by using a dot blot assay in order to select those antibodies which have the binding affinities as defined herein.
- said hybridoma can be used as a source of nucleic acid encoding light and/or heavy chains in order to recombinantly produce antibodies of the present invention, as is described below in further detail.
- antibodies of the invention may be identified and isolated by screening recombinant combinatorial immunoglobulin libraries with the amyloid ⁇ peptide analogue or oligomer to thereby isolate immunoglobulin library members which have the required binding affinity.
- Kits for generating and screening display libraries are commercially available (e.g. the Pharmacia Recombinant Phage Antibody System, catalog No. 27-9400-01 ; and the Stratagene Sur- fZAP ® Phage Display Kit, catalog No. 240612).
- the display library is an scFv library or an Fab library. The phage display technique for screening recombinant antibody libraries has been adequately described.
- Examples of methods and compounds which can be used particularly advantageously for generating and screening antibody display libraries can be found, for example, in McCafferty et al. WO 92/01047, US 5,969,108 and EP 589 877 (describes in particular scFv display), Ladner et al. US 5,223,409, US 5,403,484, US 5,571 ,698, US 5,837,500 and EP 436 597 (describes pill fusion, for exam- pie); Dower et al. WO 91/17271 , US 5,427,908, US 5,580,717 and EP 527 839 (describes in particular Fab display); Winter et al.
- WO 97/29131 (describes produc- tion of a recombinant human antibody to a human antigen (human tumor necrosis factor alpha) and also in-vitro affinity maturation of the recombinant antibody) and Salfeld et al.
- U.S. Provisional Application No. 60/126,603 and the patent applications based hereupon (likewise describes production of recombinant human antibodies to human antigen (human interleukin-12), and also in-vitro affinity maturation of the recombinant antibody).
- recombinant antibody libraries may be expressed on the surface of yeast cells or of bacterial cells.
- WO 99/36569 describes methods of preparing and screening libraries expressed on the surface of yeast cells.
- WO 98/49286 describes in more detail methods of preparing and screening libraries expressed on the surface of bacterial cells.
- a selection process for enriching recombinant antibodies with the desired properties form an integral part of the process, which is generally referred to as "panning” and often takes the form of affinity chromatography over columns to whose matrix the target structure has been attached.
- Promising candidate molecules are then subjected to individual determination of their absolute and/or relative affinities, preferably by means of a standardized dot blot assay, as described above.
- An antibody or antibody-binding moiety of the invention may be produced by recombinantly expressing the genes for light and heavy immunoglobulin chains in a host cell.
- a host cell is transfected with one or more recombinant expression vectors carrying DNA fragments encoding the light and heavy immunoglobulin chains of said antibody, thereby expressing the light and heavy chains in the host cell and secreting them preferably into the medium in which said host cells are cultured.
- the antibodies can be isolated from this medium. Standardized recombinant DNA methods are used in order to obtain genes for heavy and light antibody chains, to insert said genes into recombinant expression vectors and to introduce said vectors into host cells.
- DNA fragments encoding VH and VL segments of the antibody of interest may be further manipulated using standardized recombinant DNA techniques, for example in order to convert the genes for variable regions to genes for full length antibody chains, to genes for Fab fragments or to an scFv gene.
- These manipulations comprise linking a VL- or VH-encoding DNA fragment operatively to another DNA fragment encoding another protein, for example a constant antibody region or a flexible linker.
- the term "operatively linked” is to be understood here as meaning that the two DNA fragments are linked in such a way that the amino acid sequences encoded by said two DNA fragments remain in frame.
- the isolated DNA encoding the VH region may be converted to a gene for a full length heavy chain by operatively linking the VH-region encoding DNA with another DNA molecule encod- ing heavy chain constant regions (CH1 , CH2 and CH3).
- CH1 , CH2 and CH3 DNA molecule encod- ing heavy chain constant regions
- the sequences of human heavy chain constant region genes are well known (see, for example, Kabat, E.A., et al. (1991 ) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242), and DNA fragments spanning said regions may be obtained by means of standardized PCR amplification.
- the heavy chain con- stant region may be a constant region from IgGI , lgG2, lgG3, lgG4, IgM, IgA, IgE or IgD, with preference being given to a constant region from IgG, in particular IgGI or lgG4.
- the VH-encoding DNA may be operatively linked to another DNA molecule encoding merely the heavy chain constant region CH1.
- the isolated DNA encoding the VL region may be converted to a gene for a full length light chain (and a gene for an Fab light chain) by operatively linking the VL-encoding DNA to another DNA molecule encoding the light chain constant region CL.
- the sequences of genes of the constant region of human light chain are well known (see Kabat, E.A., et al. (1991 ) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242), and DNA fragments spanning said regions may be obtained by means of standardized PCR amplification.
- the light chain constant region may be a constant kappa or lambda region, a constant kappa region being preferred.
- the VH- and VL-encoding DNA fragments may be opera- tively linked to another fragment encoding a flexible linker, for example the amino acid sequence (Gly 4 -Ser) 3 so that the VH and VL sequences are expressed as a continuous single- chain protein, with the VL and VH regions being linked to one another via said flexible linker (see Bird et al. (1988) Science 242:423-426; Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883; McCafferty et al., Nature (1990) 348:552-554).
- a flexible linker for example the amino acid sequence (Gly 4 -Ser) 3 so that the VH and VL sequences are expressed as a continuous single- chain protein, with the VL and VH regions being linked to one another via said flexible linker
- Single domain VH and VL having the binding affinities as described above may be isolated from single domain libraries by the above-described methods.
- Two VH single-domain chains (with or without CH 1 ) or two VL chains or a pair of one VH chain and one VL chain with the desired binding affinity may be useful as described herein for the antibodies of the invention.
- the DNAs encoding partial or full length light and heavy chains may be inserted into expression vectors so as to operatively link the genes to appropriate transcriptional and translational control sequences.
- operatively linked is to be understood as mean- ing that an antibody gene is ligated in a vector in such a way that transcriptional and transla- tional control sequences within the vector fulfill their intended function of regulating transcription and translation of said antibody gene.
- the expression vector and the expression control sequences are chosen so as to be compatible with the expression host cell used.
- the gene for the antibody light chain and the gene for the antibody heavy chain may be inserted into separate vectors or both genes are inserted into the same expression vector, this being the usual case.
- the antibody genes are inserted into the expression vector by means of standardized methods (for example by ligation of complementary restriction cleavage sites on the antibody gene fragment and the vector, or by ligation of blunt ends, if no restriction cleavage sites are present).
- the expression vector may already carry sequences for antibody constant regions prior to insertion of the sequences for the light and heavy chains.
- one approach is to convert the VH and VL sequences to full length antibody genes by inserting them into expression vectors already encoding the heavy and, respectively, light chain constant regions, thereby operatively linking the VH segment to the CH segment(s) within the vector and also operatively linking the VL segment to the CL segment within the vector.
- the recombinant expression vector may encode a signal peptide which facilitates secretion of the antibody chain from the host cell.
- the gene for said antibody chain may be cloned into the vector, thereby linking the signal peptide in frame to the N terminus of the gene for the antibody chain.
- the signal peptide may be an immunoglobulin signal peptide or a heterologous signal peptide (i.e. a signal peptide from a non- immunoglobulin protein).
- the expression vectors of the invention may have regulatory sequences controlling expression of the genes for the antibody chain in a host cell.
- regulatory sequence is intended to include promoters, enhancers and further expression control elements (e.g. polyadenylation signals) which control transcription or translation of the genes for the antibody chain. Regulatory sequences of this kind are described, for example, in Goeddel; Gene Expression Technology: Methods in Enzymology 185, Aca- demic Press, San Diego, CA (1990). The skilled worker will appreciate that the expression vector design which includes selection of regulatory sequences may depend on factors such as the choice of the host cell to be transformed, the desired strength of expression of the protein, etc.
- Preferred regulatory sequences for expression in mammalian host cells include viral elements resulting in strong and constitutive protein expression in mammalian cells, such as promoters and/or enhancers derived from cytomegalovirus (CMV) (such as the CMV promoter/enhancer), simian virus 40 (SV40) (such as the SV40 promoter/enhancer), adeno- virus (e.g. the adenovirus major late promoter (AdMLP)) and polyoma.
- CMV cytomegalovirus
- SV40 simian virus 40
- AdMLP adeno- virus
- AdMLP adenovirus major late promoter
- the recombinant expression vectors of the invention may have additional sequences such as those which regulate replication of the vector in host cells (e.g. origins of replication) and selectable marker genes.
- the selectable marker genes facilitate the selection of host cells into which the vector has been introduced (see, for example, US patent Nos 4,399,216, 4,634,665 and 5,179,017, all to Axel et al.).
- Preferred selectable marker genes include the gene for dihydrofolate reductase (DHFR) (for use in dhfr host cells with methotrexate selection/amplification) and the neo gene (for G418 selection).
- DHFR dihydrofolate reductase
- neo gene for G418 selection.
- the expression vector(s) encoding said heavy and light chains is(are) transfected into a host cell by means of standardized techniques.
- the various forms of the term "transfection" are intended to comprise a multiplicity of techniques customarily used for introducing exogenous DNA into a prokaryotic or eukaryotic host cell, for example electroporation, calcium phosphate precipitation, DEAE-dextran transfec- tion, and the like.
- the antibodies of the invention are expressed either in prokaryotic or eukaryotic host cells
- Prokaryotic expression of antibody genes has been reported as being ineffective for production of high yields of active antibody (Boss, M.A. and Wood, C. R. (1985) Immunology Today 6:12-13).
- Preferred mammalian host cells for expressing recombinant antibodies of the invention in- elude CHO cells (including dhfr CHO cells described in Urlaub and Chasin, (1980) Proc. Natl. Acad. Sci. USA 77:4216-4220, which are used together with a DHFR-selectable marker, as described, for example, in RJ. Kaufman and P.A. Sharp (1982) MoI. Biol. 159:601-621 ), NSO myeloma cells, COS cells and SP2 cells.
- the antibodies When introducing recombinant expression vectors encoding the antibody genes into mammalian host cells, the antibodies are produced by culturing the host cells until the antibody is expressed in said host cells or, preferably, the antibody is secreted into the culture medium in which the host cells grow. The antibodies may then be isolated from the culture medium by using standardized protein purification methods.
- host cells in order to produce moieties of intact antibodies, such as Fab fragments or scFv molecules. Variations of the above-described procedure are of course included in the invention. For example, it may be desirable to transfect a host cell with DNA encoding either the light chain or the heavy chain (but not both) of an antibody of the invention. If either light or heavy chains are present which are not required for binding of the antigen of interest, then the DNA encoding either such a light or such a heavy chain or both may be removed partially or completely by means of recombinant DNA technology. Molecules expressed by such truncated DNA molecules are likewise included in the antibodies of the invention.
- bifunctional antibodies in which a heavy chain and a light chain are an antibody of the invention and the other heavy chain and the other light chain have specificity for an antigen different from the antigen of interest, by crosslinking an antibody of the invention to a second antibody by means of standardized chemical methods.
- a recombinant expression vector encoding both the antibody heavy chain and the antibody light chain is introduced into dhfr CHO cells by means of cal- cium phosphate-mediated transfection.
- the genes for the heavy and light antibody chains are in each case operatively linked to regulatory CMV enhancer/AdMLP-promoter elements in order to effect strong transcription of said genes.
- the recombinant expression vector also carries a DHFR gene which can be used for selecting dhfr CHO cells transfected with the vector by using methotrexate selection/amplification.
- the selected transformed host cells are cultured so that the heavy and light antibody chains are expressed, and intact antibody is isolated from the culture medium.
- Standardized molecular-biological techniques are used in order to prepare the recombinant expression vector, to transfect the host cells, to select the transformants, to culture said host cells, and to obtain the antibody from the culture medium.
- the invention also provides a method of synthesizing a recombinant antibody of the invention by culturing a host cell of the invention in a suitable culture medium until a recombinant antibody of the invention has been synthesized. The method may furthermore comprise isolating said recombinant antibody from said culture medium.
- any expression system in which a close physical linkage between a nucleic acid and the antibody encoded thereby is established and may be used to select a suitable nucleic acid sequence by virtue of the properties of the antibody it encodes may be employed.
- the recombinant antibody library is expressed in the form of RNA-protein fusions, as described in WO 98/31700 to Szostak and Roberts, and in Roberts, R.W. and Szostak, J.W. (1997) Proc. Natl. Acad. Sci. USA 94:12297-12302.
- in-vitro translation of synthetic mRNAs carrying on their 3' end puromycin, a peptidyl acceptor antibiotic generates a covalent fusion of an mRNA and the peptide or protein encoded by it.
- a specific mRNA of a complex mixture of mRNAs e.g.
- a combinatorial library may be concentrated on the basis of the properties of the encoded peptide or protein (e.g. of the antibody or a moiety thereof), such as binding of said antibody or said moiety thereof to the amyloid ⁇ peptide analogue or oligomer.
- Nucleic acid sequences which encode antibodies or moieties thereof and which are obtained by screen- ing of such libraries may be expressed by recombinant means in the above-described manner (e.g.
- the antibodies of the invention may likewise be produced by using a combination of in-vivo and in-vitro approaches such as methods in which the amyloid ⁇ peptide analogue or oli- gomer is first allowed to act on an antibody repertoire in a host animal in vivo to stimulate production of amyloid ⁇ peptide analogue- or oligomer-binding antibodies and then further antibody selection and/or antibody maturation (i.e. optimization) are accomplished with the aid of one or more in-vitro techniques.
- a combined method of this kind may comprise firstly immunizing a nonhuman animal (e.g.
- a mouse, rat, rabbit, chicken, camelid, sheep or goat or a transgenic version thereof or a chimeric mouse with said oligomer or derivative to stimulate an antibody response to the antigen and then preparing and screening a phage display antibody library by using immunoglobulin sequences of lymphocytes which have been stimulated in vivo by the action of said oligomer or derivative.
- the first step of this combined procedure may be carried out in the manner described above in connection with the in-vivo approaches, while the second step of this procedure may be carried out in the manner described above in connection with the in-vitro approaches.
- Pre- ferred methods of hyperimmunizing nonhuman animals with subsequent in-vitro screening of phage display libraries prepared from said stimulated lymphocytes include those described by BioSite Inc., see, for example, WO 98/47343, WO 91/17271 , US 5,427,908 and US 5,580,717.
- a combined method comprises firstly immunizing a non-human animal (e.g. a mouse, rat, rabbit, chicken, camelid, sheep, goat or a knockout and/or transgenic version thereof, or a chimeric mouse) with an amyloid ⁇ peptide analogue or oligomer of the invention to stimulate an antibody response to said amyloid ⁇ peptide analogue or oligomer and selecting the lymphocytes which produce the antibodies having the desired specificity by screening hybridomas (prepared, for example, from the immunized animals).
- a non-human animal e.g. a mouse, rat, rabbit, chicken, camelid, sheep, goat or a knockout and/or transgenic version thereof, or a chimeric mouse
- the genes for the antibodies or single domain antibodies are isolated from the selected clones (by means of standardized cloning methods such as reverse transcriptase polymerase chain reaction) and subjected to in-vitro affinity maturation in order to improve thereby the binding properties of the selected antibody or the selected antibodies.
- the first step of this procedure may be conducted in the manner described above in connection with the in-vivo approaches, while the second step of this procedure may be conducted in the manner described above in connection with the in-vitro approaches, in particular by using methods of in-vitro affinity maturation, such as those described in WO 97/29131 and WO 00/56772.
- the recombinant antibodies are generated from individual isolated lymphocytes by using a procedure which is known to the skilled worker as selected lymphocyte antibody methods (SLAM) and which is described in US 5,627,052, WO 92/02551 and Babcock, J.S. et al. (1996) Proc. Natl. Acad. Sci. USA 93:7843-7848.
- SLAM selected lymphocyte antibody methods
- a nonhuman animal e.g.
- a mouse, rat, rabbit, chicken, camelid, sheep, goat, or a transgenic version thereof, or a chimeric mouse is firstly immunized in vivo with the amyloid ⁇ peptide analogue or oligomer to stimulate an immune response to said amyloid ⁇ peptide analogue or oligomer, and then individual cells secreting antibodies of interest are selected by using an antigen-specific haemolytic plaque assay.
- the globulomer or deriva- tive thereof or structurally related molecules of interest may be coupled to sheep erythrocytes, using a linker such as biotin, thereby making it possible to identify individual cells secreting antibodies with suitable specificity by using the haemolytic plaque assay.
- variable regions of the light and heavy chains are obtained from the cells by reverse transcriptase PCR, and said variable regions may then be expressed in association with suitable immunoglobulin constant regions (e.g. human constant regions) in mammalian host cells such as COS or CHO cells.
- suitable immunoglobulin constant regions e.g. human constant regions
- the host cells transfected with the amplified immunoglobulin sequences derived from in vivo-selected lymphocytes may then be subjected to further in-vitro analysis and in- vitro selection by spreading out the transfected cells, for example, in order to isolate cells expressing antibodies with the binding affinity.
- the amplified immunoglobulin sequences may furthermore be manipulated in vitro.
- Antibodies having the required affinities defined herein can be selected by performing a dot blot essentially as described above. Briefly, the antigen is attached to a solid matrix, preferably dotted onto a nitrocellulose membrane, in serial dilutions. The immobilized antigen is then contacted with the antibody of interest followed by detection of the latter by means of an enzyme-conjugated secondary antibody and a colorimetric reaction; at defined antibody and antigen concentrations, the amount of antibody bound allows affinity determination.
- the relative affinity of two different antibodies to one target, or of one antibody to two different targets is here defined as the relation of the respective amounts of target-bound antibody observed with the two antibody-target combinations under otherwise identical dot blot condi- tions.
- Antibody moieties such as Fab and F(ab') 2 fragments may be produced from whole antibodies by using conventional techniques such as digestion with papain or pepsin.
- antibodies, antibody moieties and immunoadhesion molecules may be obtained by using standardized recombinant DNA techniques.
- the invention also relates to the use of the amyloid ⁇ peptide analogue or oligomer of the invention for providing an aptamer that binds to the amyloid ⁇ peptide analogue or oligomer (hereinafter also referred to as anti-amyloid ⁇ peptide analogue or anti- oligomer aptamer).
- the invention relates also to a method for providing an aptamer having specificity for the amyloid ⁇ peptide analogue or oligomer as defined herein, which method comprises at least the steps of a) providing a binding target comprising the amyloid ⁇ peptide analogue or oligomer; b) exposing an aptamer repertoire or potential aptamer repertoire to said binding target; and c) selecting from said repertoire an aptamer which specifically binds to said amyloid ⁇ peptide analogue or oligomer.
- An "aptamer” herein refers to oligonucleic acid or peptide molecules that are capable of specific, non-covalent binding to its target.
- Apatmer preferably comprise peptide, DNA or RNA sequence, more preferably peptide, DNA or RNA sequence of about 3 to 100 monomers, which may at one end or both ends be attached to a larger molecule, preferably a larger molecule mediating biochemical functions, more preferably a larger molecule inducing inac- tivation and/or degradation, most preferably ubiquitin, or preferably a larger molecule facilitating destruction, more preferably an enzyme or a fluorescent protein.
- a “potential aptamer repertoire” refers to any library, collec- tion, assembly or set of amino acid sequences or nucleic acid sequences or to any generator of such a library, collection, assembly or set of amino acid sequences that can be used for producing an aptamer repertoire in vivo or in vitro.
- the invention also provides aptamers that bind to the amyloid ⁇ peptide analogue or oligomer as defined herein.
- the aptamer is obtainable by a method comprising selecting the aptamer from a repertoire or potential repertoire as described herein.
- the present invention provides amyloid ⁇ peptide analogue- or oligomer-specific aptamers.
- amyloid ⁇ peptide analogue- or oligomer-specific aptamers include in particular aptamers having a comparatively smaller affinity for both the monomeric and fibrillomeric forms of A ⁇ peptide than for the amyloid ⁇ peptide analogue or oligomer of the invention.
- agents that are capable of binding to the amyloid ⁇ peptide analogue or oligomer of the invention also have many potential applications, some of which are described in the following. They are especially useful for therapeutic and diagnostic purposes.
- Antibodies that specifically bind to the globulomer epitope have proven to be useful agents in therapeuitc and disgnostic applications. As the amyloid ⁇ peptide analogues or oligomers of the present invention react with said antibodies the amyloid ⁇ peptide analogues or oligomers are believed to display the same or a very similar epitop.
- the invention also provides agents that are capable of binding to the amyloid ⁇ peptide analogue or oligomer of the invention for therapeutic uses.
- the invention also provides therapeutic compositions comprising an agent that is capable of binding to the amyloid ⁇ peptide analogue or oligomer of the invention.
- said compositions are pharmaceutical compositions which further comprise a pharmaceutical acceptable carrier.
- Said pharmaceutical compositions of the invention may furthermore contain at least one additional therapeutic agent, for example one or more additional therapeutic agents for the treatment of a disease for whose relief the agents of the invention are useful.
- the pharmaceutical composition may furthermore contain one or more additional thera-Guinic agents useful for the treatment of disorders in which the activity of said amyloid ⁇ peptide analogue or oligomer is important.
- Pharmaceutically suitable carriers include any solvents, dispersing media, coatings, antibacterial and antifungal agents, isotonic and absorption-delaying agents, and the like, as long as they are physiologically compatible.
- Pharmaceutically acceptable carriers include, for example, water, saline, phosphate-buffered saline, dextrose, glycerol, ethanol and the like, and combinations thereof.
- isotonic agents for example sugars, polyalcohols such as mannitol or sorbitol, or sodium chloride in addition.
- Pharmaceutically suitable carriers may furthermore contain relatively small amounts of auxiliary substances such as wetting agents or emulsifiers, preservatives or buffers, which increase the half life or efficacy of the antibodies.
- the pharmaceutical compositions may be suitable for parenteral administration, for example.
- the agents are prepared preferably as injectable solutions with an agent, e.g. antibody, content of 0.1 - 250 mg/ml.
- the injectable solutions may be prepared in liquid or lyophilized form, the dosage form being a flint glass or vial, an ampoule or a filled syringe.
- the buffer may contain L-histidine (1 - 50 mM, preferably 5 - 10 mM) and have a pH of 5.0 - 7.0, preferably of 6.0.
- Further suitable buffers include, without being limited thereto, sodium succinate, sodium citrate, sodium phosphate or potassium phosphate buffers.
- Sodium chloride may be used in order to adjust the tonicity of the solution to a concentration of 0 - 300 mM (preferably 150 mM for a liquid dosage form).
- Cryoprotectants for example sucrose (e.g. 0 - 10 %, preferably 0.5 - 1.0 %) may also be included for a lyophilized dosage form.
- Other suitable cryoprotectants are trehalose and lactose.
- Fillers for example mannitol (e.g. 1 - 10 %, preferably 2 - 4 %) may also be included for a lyophilized dosage form.
- Stabilizers for example L-methionine (e.g.
- 51 - 50 mM may be used both in liquid and lyophilized dosage forms.
- Further suitable fillers are glycine and arginine.
- Surfactants for example polysorbate 80 (e.g. 0 - 0.05 %, preferably 0.005 - 0.01 %), may also be used.
- Further surfactants are polysorbate 20 and BRIJ surfactants.
- compositions of the invention may have a multiplicity of forms. These include liquid, semisolid and solid dosage forms, such as liquid solutions (e.g. injectable and infusible solu- tions), dispersions or suspensions, tablets, pills, powders, liposomes and suppositories.
- liquid solutions e.g. injectable and infusible solu- tions
- dispersions or suspensions tablets, pills, powders, liposomes and suppositories.
- the preferred form depends on the intended type of administration and on the therapeutic application. Typically, preference is given to compositions in the form of injectable or infusible solutions, for example compositions which are similar to antibodies for passive immunization of humans.
- the preferred route of administration is parenteral (e.g. intravenous, subcutane- ous, intraperitoneal or intramuscular).
- the agent is administered by intravenous infusion or injection.
- the agent is administered by intramuscular or subcutaneous injection.
- compositions must typically be sterile and stable under preparation and storage conditions.
- the compositions may be formulated as solutions, microemulsions, dispersions, liposomes or other ordered structures suitable for high concentrations of active substance.
- Sterile injectable solutions may be prepared by introducing the active compound (i.e. the agent such as an antibody) in the required amount into a suitable solvent, where appropriate with one or a combination of the abovementioned ingredients, as required, and then sterile- filtering said solution.
- Dispersions are usually prepared by introducing the active compound into a sterile vehicle containing a basic dispersion medium and, where appropriate, other required ingredients.
- a sterile lyophilized powder for preparing sterile injectable solutions vacuum drying and spray drying are preferred methods of preparation, which produces a powder of the active ingredient and, where appropriate, of further desired ingredients from a previously sterile-filtered solution.
- the correct flowability of a solution may be maintained by using, for example, a coating such as lecithin, by maintaining, in the case of dispersions the required particle size or by using surfactants.
- a prolonged absorption of injectable compositions may be achieved by additionally introducing into the composition an agent which delays absorption, for example monostearate salts and gelatine.
- the agents of the invention may be administered by a multiplicity of methods known to the skilled worker, although the preferred type of administration for many therapeutic applications is subcutaneous injection, intravenous injection or infusion.
- the active compound may be prepared with a carrier which protects the compound against rapid release, such as, for example, a formulation with sustained or controlled release, which includes implants, transdermal plasters and microencapsulated release systems.
- a carrier which protects the compound against rapid release
- a carrier which protects the compound against rapid release
- a formulation with sustained or controlled release which includes implants, transdermal plasters and microencapsulated release systems.
- Biologically degradable biocompatible polymers such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters and polylactic acid may be used.
- the methods of preparing such formulations are well known to the skilled worker; see, for example, Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York
- an agent of the invention may be administered orally, for example in an inert diluent or a metabolizable edible carrier.
- the agent (and further in- gredients, if desired) may also be enclosed in a hard or soft gelatine capsule, compressed to tablets or added directly to food.
- the agents may be mixed with excipients and used in the form of oral tablets, buccal tablets, capsules, elixirs, suspensions, syrups and the like. If it is intended to administer an agent of the invention via a route other than the parenteral one, it may be necessary to choose a coating from a mate- rial which prevents its inactivation.
- the invention provides the use of an agent that is capable of binding to the amyloid ⁇ peptide analogue or oligomer of the invention for preparing a pharmaceutical composition for treating or preventing an amyloidosis.
- the pharmaceutical composition is for passive immunization.
- the invention also provides a method of treating or preventing an amyloidosis in a subject in need thereof, which comprises administering the agent that is capable of binding to the amyloid ⁇ peptide analogue or oligomer of the invention to the subject.
- administering the agent that is capable of binding to the A ⁇ (amyloid ⁇ peptide analogue or oligomer of the invention is for passively immu- nizing the subject against an amyloidosis.
- the screening of biological samples revealed that such samples may contain substances that react with agents that are capable of binding to the amyloid ⁇ peptide analogue or oligomer such as anti-amyloid ⁇ peptide analogue or anti-oligomer antibodies of the invention.
- agents that are capable of binding to the amyloid ⁇ peptide analogue or oligomer such as anti-amyloid ⁇ peptide analogue or anti-oligomer antibodies of the invention.
- antigens comprising the amyloid ⁇ peptide analogue or oligomer epitope.
- the agents that are capable of binding to the amyloid ⁇ peptide analogue or oligomer of the invention are also capable of detecting, both in vitro and in vivo, antigens comprising amyloid ⁇ peptide analogue or oligomer epitopes to which they bind.
- Said agents may therefore be used for detecting said antigens, for instance a sample that is derived from a subject suspect of having an amyloidosis, or in a subject suspect of having an amyloidosis, for instance a human individual or other mammal.
- the invention thus also provides agents that are capable of binding to the amyloid ⁇ peptide analogue or oligomer of the invention for diagnostic uses.
- the invention provides diagnostic compositions comprising an agent that is capable of binding to the amyloid ⁇ peptide analogue or oligomer of the invention.
- said compositions are pharmaceutical compositions which further comprise a pharmaceutical acceptable carrier.
- the invention provides the use of an agent that is capable of binding to the amyloid ⁇ peptide analogue or oligomer of the invention for preparing a composition for diagnosing an amyloidosis.
- the invention also provides a method of diagnosing an amyloidosis which comprises providing a sample from the subject suspected of having the amyloidosis, contacting the sample with an agent that is capable of binding to the amyloid ⁇ peptide analogue or oligomer of the invention for a time and under conditions sufficient for the formation of a complex comprising the agent that is capable of binding to the amyloid ⁇ peptide analogue or oligomer of the invention and an antigen comprising the amyloid ⁇ peptide analogue or oligomer epitope, the presence of the complex indicating the subject has the amyloidosis.
- at least the step of contacting the sample is carried out ex vivo and in particular in vitro.
- agents that are capable of binding to the amyloid ⁇ peptide analogue or oligomer of the invention may be used in a variety of diagnostic methods and assays.
- the method of diagnosing an amyloidosis in a patient suspected of having this disease comprises the steps of: 1 ) isolating a biological sample from the patient; 2) contacting the biological sample with at least one of the agents that are capable of binding to the amyloid ⁇ peptide analogue or oligomer of the invention for a time and under conditions sufficient for formation of antigen/agent complexes; and 3) detecting pres- ence of the antigen/agent complexes in said sample, presence of the complexes indicating a diagnosis of an amyloidosis, e.g. Alzheimer's disease, in the patient.
- the antigen is one comprising the amyloid ⁇ peptide analogue or oligomer epitope.
- at least one of said steps 2) and 3) is carried out ex vivo and in particular in vitro.
- the method does not comprise step 1 ).
- the method of diagnosing an amyloidosis in a patient suspected of having this disease comprises the steps of: 1 ) isolating a biological sample from the patient; 2) contacting the biological sample with an antigen for a time and under conditions sufficient for the formation of antibody/antigen complexes; 3) adding a conjugate to the resulting antibody/antigen complexes for a time and under conditions sufficient to allow the conjugate to bind to the bound antibody, wherein the conjugate comprises one of the agents that are capable of binding to amyloid ⁇ peptide analogue or oligomer of the invention, attached to a signal generating compound capable of generating a detectable signal; and 4) detecting the presence of an antibody which may be present in the biological sample, by detecting a signal generated by the signal generating compound, the signal indicating a diagnosis of an amyloidosis, e.g.
- the antigen is one comprising the amyloid ⁇ peptide analogue or oligomer epitope.
- at least one of said steps 2), 3) and 4) is carried out ex vivo and in particular in vitro.
- the method does not comprise step 1 ).
- the method of diagnosing an amyloidosis in a patient suspected of having this disease comprises the steps of: 1 ) isolating a biological sample from said patient; 2) contacting the biological sample with anti-antibody, wherein the anti- antibody is specific for one of the agents that are capable of binding to the amyloid ⁇ peptide analogue or oligomer of the invention, for a time and under conditions sufficient to allow for formation of anti-antibody/agent complexes, the complexes containing agent present in the biological sample; 3) adding a conjugate to resulting anti-antibody/agent complexes for a time and under conditions sufficient to allow the conjugate to bind to bound agent, wherein the conjugate comprises an antigen comprising the amyloid ⁇ peptide analogue or oligomer epitope, which binds to a signal generating compound capable of generating a detectable signal; and 4) detecting a signal generated by the signal generating compound, the signal indicating a diagnosis of an
- the agent that is capable of binding to the amyloid ⁇ peptide analogue or oligomer of the invention, or a portion thereof is coated on a solid phase (or is present in a liquid phase).
- the test or biological sample e.g., whole blood, cerebrospinal fluid, serum, etc.
- antigen e.g., globulomer
- such antigens bind to the agents that are capable of binding to the amyloid ⁇ peptide analogue or oligomer of the invention on the solid phase and are then detected by either a direct or indirect method.
- the direct method com- prises simply detecting presence of the complex itself and thus presence of the antigens.
- a conjugate is added to the bound agent.
- the conjugate comprises a second antibody, which binds to the bound antigen, attached to a signal-generating compound or label. Should the second antibody bind to the bound antigen, the signal-generating compound generates a measurable signal. Such signal then indicates presence of the anti- gen in the test sample.
- solid phases used in diagnostic immunoassays are porous and non-porous materials, latex particles, magnetic particles, microparticles (see U.S. Patent No. 5,705,330), beads, membranes, microtiter wells and plastic tubes.
- the choice of solid phase material and method of labeling the antigen or antibody present in the conjugate, if desired, are determined based upon desired assay format performance characteristics.
- the conjugate (or indicator reagent) will comprise an antibody (or perhaps anti-antibody, depending upon the assay), attached to a signal-generating compound or Ia- bel.
- This signal-generating compound or "label” is itself detectable or may be reacted with one or more additional compounds to generate a detectable product.
- signal- generating compounds include chromogens, radioisotopes (e.g., 1251, 1311, 32P, 3H, 35S and 14C), chemiluminescent compounds (e.g., acridinium), particles (visible or fluorescent), nucleic acids, complexing agents, or catalysts such as enzymes (e.g., alkaline phosphatase, acid phosphatase, horseradish peroxidase, beta-galactosidase and ribonuclease).
- radioisotopes e.g., 1251, 1311, 32P, 3H, 35S and 14C
- chemiluminescent compounds e.g., acridinium
- particles visible or fluorescent
- nucleic acids e.g., nucleic acids, complexing agents, or catalysts
- enzymes e.g., alkaline phosphatase, acid phosphatase, horseradish peroxidase, beta-galacto
- chromo-, fluro-, or lumo-genic substrate results in generation of a detectable signal.
- detection systems such as time-resolved fluorescence, internal-reflection fluorescence, amplification (e.g., polymerase chain reaction) and Raman spectroscopy are also useful.
- kits are also included within the scope of the present invention. More specifically, the present invention includes kits for determining the presence of antigens comprising the amyloid ⁇ peptide analogue or oligomer epitope in a subject.
- a kit for determining the presence of said antigens in a sample comprises a) an agent that is capable of binding to the amyloid ⁇ peptide analogue or oligomer of the invention; and optionally b) a conjugate comprising an antibody that binds to the agent, attached to a signal generating compound capable of generating a detectable signal.
- the kit may also contain a control or calibrator which comprises a reagent which binds to the antigen.
- the present invention also includes another type of kit for detecting antibodies such as autoantibodies in a sample.
- the kit may comprise a) an antibody specific for the agent that is capable of binding to the amyloid ⁇ peptide analogue or oligomer of the invention (e.g. an anti-antibody), and b) an antigen comprising the amyloid ⁇ peptide analogue or oligomer epitope as defined herein.
- a control or calibrator comprising a reagent which binds to the antigen may also be included.
- the kit may comprise a) an anti-antibody specific for the auto-antibody and b) a conjugate comprising antigen comprising the amyloid ⁇ peptide analogue or oligomer epitope as defined herein, the conjugate being attached to a signal generating compound capable of generating a detectable signal.
- the kit may also comprise a control or calibrator comprising a reagent which binds to the antigen.
- the kit may also comprise one container such as vial, bottles or strip, with each container with a pre-set solid phase, and other containers containing the respective conjugates.
- These kits may also contain vials or containers of other reagents needed for performing the assay, such as washing, processing and indicator reagents.
- said antigens comprising amyloid ⁇ peptide analogue or oligomer epitopes can be detected in preparations suspected of containing such epitopes, their amount can be determined in said preparations and they can be enriched. Accordingly, the present invention also provides a method for detecting, for determining the amount of and/or for enriching amyloid ⁇ peptide analogue or oligomer epitopes in preparations suspected or know to comprise such epitopes. Once detected and enriched, said substances may have potential applications similar to those described herein with respect to the amyloid ⁇ peptide analogue or oligomer of the invention.
- the present invention includes a method of designing agents such as antibodies, non-antibody biological agents or small molecules useful in the treatment or prevention of an amyloidosis in a patient.
- This method comprises the steps of: a) analyzing the three- dimensional structure of the amyloid ⁇ peptide analogue or oligomer described herein; b) identifying one or more epitopes on the surface of the amyloid ⁇ peptide analogue or oligomer of step a); and c) designing an agent such as an antibody, non-antibody biological agent or a small molecule which will bind to the identified epitope or epitopes of step b), the antibody, non-antibody biological agent or a small molecule to be used in the treatment or prevention of amyloidosis.
- amino acid composition of the amyloid ⁇ peptide analogues and oligomers of the present invention are well-defined and reproducible.
- amyloid ⁇ peptide analogues and oligomers of the present invention display a stable conformation.
- amyloid ⁇ peptide analogues and oligomers of the present invention display better hy- drodynamic properties.
- amyloid ⁇ peptide analogues or oligomers of the present invention is expected to elicit a highly selective immune response for A ⁇ globulomers. Because the amyloid ⁇ peptide analogues and oligomers of the present invention can easily be designed to lack N-terminal sequences, the risk of eliciting an unspecific N-terminal A ⁇ peptide directed immune response can be eliminated.
- the amyloid ⁇ peptide analogues and oligomers of the present invention are therefore capable of eliciting an immune response that discriminates other forms of A ⁇ peptides, particularly monomers and fibrils.
- amyloid ⁇ peptide analogues or oli- gomers of the present invention will be effective in reversing cognitive deficits in AD transgenic mouse models as the elicited antibody response is comparable to active immunization with A ⁇ (20-42) truncated globulomer. The latter has been proven to reverse deficits in novel object recognition task.
- the hybridoma which produces monoclonal antibody 5F7 was deposited with the American Type Culture Collection, 10801 University Boulevard, Manassas, Vir- ginia 20110 on December 01 , 2005 under the terms of the Budapest Treaty and received designation PTA-7241. Further, the hybridoma which produces monoclonal antibody 10F11 was deposited with the American Type Culture Collection, 10801 University Boulevard, Ma- nassas, Virginia 10801 on December 01 , 2005 under the terms of the Budapest Treaty and received designation PTA-7239.
- the hybridoma which produces monoclonal antibody 4B7 was deposited with the American Type Culture Collection, 10801 University Boulevard, Manassas, Virginia 10801 on December 01 , 2005 under the terms of the Buda- pest Treaty and received designation PTA-7242, and the hybridoma which produces monoclonal antibody 7C6 was deposited with the American Type Culture Collection, 10801 University Boulevard, Manassas, Virginia 10801 on December 01 , 2005 under the terms of the Budapest Treaty and received designation PTA-7240.
- the hybridoma which produces monoclonal antibody 6A2 was deposited with the American Type Culture Collec- tion, 10801 University Boulevard, Manassas, Virginia 10801 on February 28, 2006 under the terms of the Budapest Treaty and received designation PTA-7409, and the hybridoma which produces monoclonal antibody 2F2 was deposited with the American Type Culture Collection, 10801 University Boulevard, Manassas, Virginia 10801 on February 28, 2006 under the terms of the Budapest Treaty and received designation PTA-7408.
- the hybridoma which produces monoclonal antibody 4D10 was deposited with the American Type Culture Collection, 10801 University Boulevard, Manassas, Virginia 10801 on February 28, 2006 under the terms of the Budapest Treaty and received designation PTA-7405.
- the hybridoma which produces monoclonal antibody 7E5 was deposited with the American Type Culture Collection, 10801 University Boulevard, Manassas, Virginia 10801 on August 16, 2006 under the terms of the Budapest Treaty and received designation PTA-7809.
- the hybridoma which produces monoclonal antibody 10C1 was deposited with the American Type Culture Collection, 10801 University Boulevard, Manassas, Virginia 10801 on August 16, 2006 under the terms of the Budapest Treaty and received designation PTA-7810.
- the hybridoma which produces monoclonal antibody 3B10 was deposited with the American Type Culture Collec- tion, 10801 University Boulevard, Manassas, Virginia 10801 on September 01 , 2006 under the terms of the Budapest Treaty and received designation PTA-7851. All deposits have been made on behalf of Abbott Laboratories, 100 Abbott Park Road, Abbott Park, Illinois 60064 (US). All these monoclonal antibodies are murine monoclonal antibodies.
- Example 1 Peptide synthesis All reagents were used as obtained from the vendor unless otherwise specified. Peptide synthesis reagents including diisopropylethylamine (DIEA), N-methylpyrrolidone (NMP), di- chloromethane (DCM), (2-(7-Aza-1 H-benzotriazole-1-yl)-1 ,1 ,3,3-tetramethyluronium hexafluorophosphate) (HATU), 2-(1 H-benzotriazole-1 -yl)-1 , 1 ,3,3-tetramethyl-uronium- hexafluorophosphate (HBTU), 1-hydrobenzotriazole (HOBt), and piperidine were obtained from Applied Biosystems, Inc.
- DIEA diisopropylethylamine
- NMP N-methylpyrrolidone
- DCM di- chloromethane
- HATU (2-(7-Aza-1 H-benzotriazole-1
- Fmoc-3-amino-1- carboxymethyl-pyridin-2-one and Fmoc-cis-3-phenyl-pyrrolidine-2-carboxylic acid were obtained from NeoSystem, France, France.
- Peptide synthesis resins Fmoc-Ala-PEG polystyrene resin, Fmoc-Ala-Wang resin, Rink amide MBHA resin
- Fmoc-Ala-PEG polystyrene resin Fmoc-Ala-Wang resin
- Rink amide MBHA resin Trifluoroacetic acid (TFA) was obtained from Oakwood Products, West Columbia, SC.
- Thioanisole, phenol, triisopro- pylsilane (TIS), 3,6-dioxa-1 ,8-octanedithiol (DODT), potassium ferricyanide, and isopropanol were obtained from Aldrich Chemical Co., Milwaukee, Wl.
- Matrix-assisted laser desorption ionization mass-spectra (MALDI-MS) were recorded on an Applied Biosystems Voyager DE- PRO MS).
- Electrospray mass-spectra (ESI-MS) were recorded on Finnigan SSQ7000 (Fin- nigan Corp., San Jose, CA) in both positive and negative ion mode.
- Peptides were synthesized with either 100 ⁇ mol preloaded resin/vessel on an ABI Pioneer peptide synthesizer using standard 0.1 mM coupling cycles, or 250 ⁇ mol resin/vessel on an ABI 433 peptide synthesizer.
- ABI Pioneer synthesizer coupling standard Fmoc-amino acids, preloaded tubes containing 0.4 mmol reagent were used with single-coupling with 4:4:8 Fmoc-amino acid:HATU:DIEA.
- the crude peptides were purified on a Gilson preparative HPLC system running Unipoint® analysis software (Gilson, Inc., Middleton, Wl) on an Agilent 21.2 x 250 mm column packed with Zorbax®-C3, 7 ⁇ m particles, 300 A pore size. The temperature of the column was maintained at > 60 0 C throughout the purification. Three milliliters of crude peptide solution (5 mg/mL in 75:25 formic acid:water) was purified per injection. The peaks containing the produces) from each run were pooled and lyophilized.
- Analytical HPLC was performed on a Hitachi D-7000 analytical HPLC system with a dual wavelength detector running D-7000 software on an Agilent 0.46 x 250 mm column packed with Zorbax®-C3, 5 ⁇ m particles, 300 A pore size eluted with one of the gradient methods listed below after preequilibrating at the starting conditions for 7 min. All analytical runs were run at 1 mL/min with eluents as buffer A: 0.1 % TFA-water and buffer B: acetonitrile using a 2 %/minute gradient of B for 45 min at 75 0 C.
- a ⁇ peptides and oligomers are referred to as (xXaal , yXaa2) A ⁇ (X-Y) peptides and oligomers, wherein A ⁇ (X-Y) refers to the amino acid sequence from amino acid position X to amino acid position Y of the human amyloid ⁇ protein including both X and Y as set forth in SEQ ID NO:1 (corresponding to amino acid positions 1 to 43), and Xaa1 and Xaa2 designate amino acids which replace the amino acid at position x and y, respectively, in SEQ ID NO:1.
- the term "(xXaal , yXaa2) A ⁇ (X-Y)” is synonymous with the term "A ⁇ (X-Y) (xXaa1/yXaa2)".
- MDAEFRHDSGYEVHHQKCVFFAEDVGSNKGAIIGCMVGGVVIA (SEQ ID NO:961 ) was prepared as follows.
- Preloaded resin (0.59 g, 100 ⁇ mol) was extended using the general peptide synthesis pro- cedure to give the protected resin-bound peptide (0.989 g, 57 %).
- the resin was cleaved and deprotected using the general procedure to give the crude peptide 1a as a white solid (0.319 g, 62.6 %).
- the following peptides (1 b) to (1j) were synthesized by standard Fmoc Solid Phase synthesis from the C-terminus to the N-terminus. Following synthesis, the peptides are purified by Reverse Phase HPLC. In order to maintain the free sulfhydryl groups on the cysteines (avoid oxidation), an acidic pH was maintained during production (normal procedure).
- the FMOC protecting group was removed from the amino acid that is on the resin.
- the next amino acid in the sequence was added and coupled to the first amino acid using HBTU.
- the FMOC protecting group was removed from the 2nd amino acid.
- the next amino acid in the sequence was added and coupled to the previous amino acid using HBTU. Steps 4 and 5 were repeated until the sequence was complete.
- the peptide was cleaved from the resin using TFA.
- the peptide was purified via Reverse Phase HPLC using a TFA/Acetonitrile buffer system (acidic buffer system). The purification fractions which meet Mass and purity spec, were pooled and lyophilized. Mass Spec Analysis and RP-HPLC confirmed identity of peptide.
- amyloid ⁇ peptide analogue having the amino acid sequence
- MDAEFRHDSGYEVHCQKLVFFAEDVGSNKGAIIGLMVCGWIA (SEQ ID NO:962) was pre- pared using standard peptide chemistry.
- amyloid ⁇ peptide analogue having the amino acid sequence
- MDAEFRHDSGYEVHHCKLVFFAEDVGSNKGAIIGLMCGGVVIA (SEQ ID NO:963) was pre- pared using standard peptide chemistry. d) (16C, 35C) N-Met A ⁇ (1-42) (1d)
- amyloid ⁇ peptide analogue having the amino acid sequence
- MDAEFRHDSGYEVHHQCLVFFAEDVGSNKGAIIGLCVGGVVIA (SEQ ID NO:964) was prepared using standard peptide chemistry.
- amyloid ⁇ peptide analogue having the amino acid sequence
- MDAEFRHDSGYEVHHQKCVFFAEDVGSNKGAIIGCMVGGVVIA (SEQ ID NO:965) was prepared using standard peptide chemistry.
- amyloid ⁇ peptide analogue having the amino acid sequence
- MDAEFRHDSGYEVHHQKLCFFAEDVGSNKGAIICLMVGGVVIA (SEQ ID NO:966) was prepared using standard peptide chemistry.
- amyloid ⁇ peptide analogue having the amino acid sequence
- MDAEFRHDSGYEVHHQKLVCFAEDVGSNKGAICGLMVGGVVIA (SEQ ID NO:967) was prepared using standard peptide chemistry.
- amyloid ⁇ peptide analogue having the amino acid sequence
- MDAEFRHDSGYEVHHQKLVFCAEDVGSNKGACIGLMVGGWIA (SEQ ID NO:968) was prepared using standard peptide chemistry.
- amyloid ⁇ peptide analogue having the amino acid sequence MDAEFRHDSGYEVHHQKLVFFCEDVGSNKGCIIGLMVGGVVIA (SEQ ID NO:969) was prepared using standard peptide chemistry.
- amyloid ⁇ peptide analogue having the amino acid sequence
- MDAEFRHDSGYEVHHQKLVFFACDVGSNKCAIIGLMVGGWIA (SEQ ID NO:970) was pre- pared using standard peptide chemistry. k) (17C, 34C) A ⁇ (12-42) (1 k)
- amyloid ⁇ peptide analogue having the aminoacid sequence
- VHHQKCVFFAEDVGSNKGAIIGCMVGGWIA (SEQ ID NO:971 ) was prepared by the general procedure outlined above using a Fmoc-Ala-Wang resin. Calculated MW [g/mol]: 3186.73; MALDI-MS: obs 3186.7 [(M+H) + ].
- amyloid ⁇ peptide analogue having the amino acid sequence KC(ACM)VFFAEDVGSNKGAIIGC(ACM)M-amide (SEQ ID NO:972) was prepared by the general procedure outlined above using a Rink-Amide-MBHA resin. Calculated MW [g/mol]: 2230,67; MALDI-MS: obs 2231.4, 2228.9 [(M+H) + ].
- amyloid ⁇ peptide analogue having the amino acid sequence
- KLVFFAEDVGSNKGAIIGLM-amide (SEQ ID NO:973) was prepared by the general proce- dure outlined above using a Rink-Amide-MBHA resin. Calculated MW [g/mol]: 2108,5; MALDI-MS: obs 2108.1 [(M+H) + ], 2130 [(M+Na) + ].
- amyloid ⁇ peptide analogue having the amino acid sequence KKVFFAEDVGSNKGAIIGKM-amide (SEQ ID NO:974) was prepared by the general procedure outlined above using a Rink-Amide-MBHA resin. Calculated MW [g/mol]: 2135,53; MALDI-MS: obs 2137.96 2137.91 [(M+H) + ].
- amyloid ⁇ peptide analogue having the amino acid sequence
- KC * VFFAEDVGSNKGAIIGC * M-amide (SEQ ID NO:975) was prepared by the general pro- cedure outlined above. Disulfide cyclization was accomplished by dissolving the linear precursor peptide (17C, 34C) A ⁇ (16-35)-amide (1 p) at 18 mg/mL in dimethylsulfoxide and added in one aliquot to vacuum degassed 3:2 100 mM ammonium bicarbonate:acetonitrile (200 mL, v:v). Potassium ferricyanide solution (0.05 % w/v in water, 44.3 mL) was added in one portion and the reaction stirred for 2 h at ambient.
- amyloid ⁇ peptide analogue having the amino acid sequence KCVFFAEDVGSNKGAIIGCM-amide was prepared by the general procedure outlined above using a Rink-Amide-MBHA resin. Calculated MW [g/mol]: 2088.47; MALDI-MS: obs 2087.99 [(M+H) + ], 2109.98 [(M+Na) + ].
- MDAEFRHDSGYEVHHQKKVFFAEDVGSNKGAIIGKMVGGWIA (SEQ ID NO:977) was prepared by the general procedure outlined above using a H-AIa-HMPB NovaPEG resin. Calculated MW [g/mol]: 4675,26; MALDI-MS: obs 4680.16 [(M+H) + ].
- amyloid ⁇ peptide analogue having the amino acid sequence
- HHQKKCVFFAEDVGSNKGAIIGCMVGGWIA (SEQ ID NO:978) was prepared by the general procedure outlined above using a Fmoc-Ala-Wang resin. Calculated MW [g/mol]: 3215.77; MALDI-MS: obs 3214.72 [(M+H) + ].
- amyloid ⁇ peptide analogue having the amino acid sequence
- KCVFFAEDVGSNKGAIIGCMVGGVVIA (SEQ ID NO:979) was prepared by the general procedure outlined above using a Fmoc-Ala-Wang resin. Calculated MW [g/mol]: 2685.19; MALDI-MS: obs 2683.82 [(M+H) + ], 2705.84 [(M+Na) + ].
- amyloid ⁇ peptide analogue having the amino acid sequence KC(ACM)VFFAEDVGSNKGAIIGC(ACM)M(S-oxide)-amide (SEQ ID NO:980) was prepared by the general procedure outlined above using a Fmoc-Ala-Wang resin. Calculated MW [g/mol]: 2246.67; MALDI-MS: obs 2245.48 [(M+H) + ].
- KC(ACM)VFFAEDVGSNKGAIIGC(ACM)M-amide (SEQ ID NO:981 ) was prepared by the general procedure outlined above using a Rink Amide MBHA resin. Calculated MW [g/mol]: 2230.67; MALDI-MS: obs 2229.45 [(M+H) + ].
- amyloid ⁇ peptide analogue having the amino acid sequence KKVFFAEDVGSNKGAIIGEM-amide (SEQ ID NO:982) was prepared by the general procedure outlined above using a PEGA-Novabiochem resin. Calculated MW [g/mol]: 2139.47; MALDI-MS: obs 2161.1 [(M+Na) + ].
- MDAEFRHDSGYEVHHQKKVFFAEDVGSNKGAIIGCMVGGWIA (SEQ ID NO:983) was prepared by the general procedure outlined above using a Fmoc-Ala-Wang resin. Calculated MW [g/mol]: 4650.23; MALDI-MS: obs 4651.07 [(M+H) + ].
- amyloid ⁇ peptide analogue having the amino acid sequence
- MDAEFRHDSGYEVHHQKKVFFAEDVGSNKGAIIGEMVGGWIA (SEQ ID NO:984) was prepared by the general procedure outlined above using a Fmoc-Ala-Wang resin. Calculated MW [g/mol]: 4676.21 ; MALDI-MS: obs 4676.2 [(M+H) + ].
- amyloid ⁇ peptide analogue having the amino acid sequence
- MDAEFRHDSGYEVHHQKCVFFAEDVGSNKGAIIGCMVGGVVIA (SEQ ID NO:985) was prepared by the general procedure outlined above using a Fmoc-Ala-Wang resin. Calculated MW [g/mol]: 4625.21 ; MALDI-MS: obs 4625.52 [(M+H) + ].
- amyloid ⁇ peptide analogue having the amino acid sequence KKVFFAC * DVGSNKC * AIIGKM-amide (SEQ ID NO:986) can be prepared by the general procedure outlined above and using the cyclization method described for peptide (1o).
- the amyloid ⁇ peptide analogue having the amino acid sequence KKVFFACDVGSNKCAIIGKM-amide can be prepared by the general procedure outlined above.
- ab (F20 ->FA19501 , L17C, L34C) N-Met A ⁇ (1-42)
- the amyloid ⁇ peptide analogue having the amino acid sequence MDAEFRHDSGYEVHHQKCVF-FAI ⁇ SOI-AEDVGSNKGAIIGCMVGGVVIA (SEQ ID NO:988) can be prepared by the general procedure outlined above using a Fmoc-Ala-Wang resin.
- FA19501 is the catalog number for Fmoc-cis-3-phenyl-pyrrolidine-2-carboxylic acid that can be incorporated as for the normal amino acids in the peptide.
- amyloid ⁇ peptide analogue having the amino acid sequence FACDVGSNKCAIIGLM (SEQ ID NO:989) can be prepared by the general procedure outlined above using a Fmoc- Ala-Wang resin.
- amyloid ⁇ peptide analogue having the amino acid sequence FACDVGSNKCAIIGLMVGGVVIA (SEQ ID NO:990) can be prepared by the general procedure outlined above using a Fmoc-Ala-Wang resin.
- amyloid ⁇ peptide analogue having the amino acid sequence MDAEFRHDSGYEVHHQKCVFFACDVGSNKCAIIGCMVGGWIA (SEQ ID NO:991 ) can be prepared by the general procedure outlined above using a Fmoc-Ala-Wang resin.
- amyloid ⁇ peptide analogue having the amino acid sequence MDAEFRHDSGYEVHHQKCVFFAEDVGSN-FA12401-AIIGCMVGGWIA (SEQ ID NO:992) can be prepared by the general procedure outlined above using a Fmoc-Ala-Wang resin.
- FA12401 is the catalog number for Fmoc-3-amino-1-carboxymethyl-pyridin-2-one can be incorporated as for the normal amino acids in the peptide.
- the sample was then diluted with 3 parts water, and dialyzed overnight at room temperature against 1/4th strength PBS with 0.05 % SDS, using 3500 MWCO dialysis membrane. The dialysiswas continued the next morning against 1 L fresh buffer at 4 0 C for 2 hours.
- the sample was then concentrated using a YM10 membrane in an Amicon stirred cell. A 0.5 ml aliquot was dialyzed overnight at 4 0 C against /4th strength PBS with no SDS using a Pierce lOK slidelyzer.
- N-Met A ⁇ (1 -42) peptide (1 b) of example 1 b was suspended in 100 % 1 , 1 , 1 ,3,3,3- hexafluoro-2-propanol (HFIP) at 4 mg/ml_ and incubated for complete solubilization under shaking at 37 0 C for 2 h.
- the HFIP acts as a hydrogen-bond breaker and is used to eliminate pre-existing structural inhomogeneities in the A ⁇ peptide.
- HFIP was removed by evaporation in a SpeedVac and the A ⁇ peptide dissolved or suspended at a concentration of 5 mM in dimethylsulfoxide and sonicated for 20 s.
- the 38/48-kDa (xC, yC) N-Met A ⁇ (1-42) oligomer was generated by a further dilution with three volumes of Helium aerated H 2 O and incubation for 18 h at 37 0 C. After centrifugation at 10,000 g for 10 min the supernatants were removed and stored at -30 0 C until further use.
- N-Met A ⁇ (1 -42) peptide (1 c) of example 1 c was subjected to oligomerization using the procedure described example 3a.
- N-Met A ⁇ (1 -42) peptide (1d) of example 1d was subjected to oligomerization using the procedure described example 3a.
- a ⁇ (1-42) wilde type peptide (Bachem H-1368) was subjected to oligomerization using the procedure described example 3a.
- a ⁇ (12-42) peptide (1 k) of example 1 k was subjected to oligomerization using the procedure described example 2a, with the following modification. Following HFIP treatment, the peptide was dissolved in 1 % ammonia in 35 % acetonitrile/65 % water and incubated for about 30 min at RT to form the ammonium salt. This salt was then shell frozen and lyophi- lized to dryness overnight. Oligomerization was then completed to the 0.05 % SDS step as described in example 2a.
- a ⁇ (12-42) peptide (1 k) of example 1 k was treated with HFIP (1 ml for every 6 mg peptide) and the solvent removed by lyophilization. Following HFIP treatment, the peptide was dissolved in 1% ammonia in 35% acetonitrile/65% water and incubated for about 30 min at RT to form the ammonium salt. This salt was then shell frozen and lyophilized to dryness overnight. This was then dissolved into 4.0 ml of DMSO. This DMSO solution of the peptide was then added slowly to 45 ml.
- a ⁇ (16-35)-amide peptide (1 m) was subjected to oligomerization using the procedure de- scribed example 3k, with the exception that no DTT was used.
- N-Met A ⁇ (1-42) peptide (1w) was subjected to oligomerization using the procedure described example 3k, with the exception that no DTT was used.
- N-Met A ⁇ (1 -42) peptide (1x) was subjected to oligomerization using the procedure described example 3k, with the exception that no DTT was used.
- a ⁇ (16-35)-amide oligomer (3m) does not form cross-links.
- N-Met A ⁇ (1-42) oligomer (3w) of example 3w in 0.05 % SDS (2.37 mM peptide) were cross-linked with 11 mM sulfo-SMCC (Pierce cat #22622, supplied from a 100 mM stock in anhydrous DMSO) for 1 hr at room temperature. The reaction was quenched by the addition of 10 mM ethanolamine from a 100 mM, pH 8 aqueous stock solution. The excess reagent and reaction products were removed by dialysis vs.
- N-Met A ⁇ (1-42) oligomer (3w) of example 3w in 0.05 % SDS (2.47 mM peptide) were cross-linked with 12 mM sulfo-SIAB (Pierce cat #22327, supplied from a 100 mM stock in anhydrous DMSO) for 1 hr at room temperature. The reaction was quenched by the addition of 10 mM ethanolamine from a 100 mM, pH 8 aqueous stock solution. The excess reagent and reaction products were removed by dialysis vs.
- N-Met A ⁇ (1-42) oligomer (3x) of example 3x in 0.05 % SDS (2.14 mM peptide) were cross-linked using 20 mM EDC (Pierce cat #22980, supplied from a 100 mM aqueous stock) and 50 mM sulfo-NHS (Pierce cat #24520, supplied from a 100 mM aqueous stock) for 1 hr at room temperature.
- the excess reagent and reaction products were removed by dialysis vs. 5 mM NaPO 4 , 35 mM NaCI, 0.05 % SDS, pH 7.4 using a Slide-A-Lyzer with a 2000 Da MW cut-off membrane.
- the final concentration was determined using the BCA protein Assay (Pierce).
- Example 5 Thermolysin truncation a) Thermolysin truncation of disulfide-stabilized (14C, 37C) N-Met A ⁇ (1-42) oligomer (5a) 0.5 ml of disulfide-stabilized (14C, 37C) N-Met A ⁇ (1-42) oligomer (4a) of example 4a was added with 1/91 Thermolysin w/w (Roche, Cat. no.: 161586 ). Thermolysin was dissolved with a concentration of 1 mg/ml in H 2 O (freshly prepared). The samples were incubated under shaking for 20 h at 30 0 C.
- the concentrates were admixed with 0.2 ml of buffer (5 mM NaH 2 PO 4 , 35 mM NaCI, pH 7.4) and again concentrated to 20 ⁇ l using the 30 kDa Ultrafree-MC tubes (Ami- con, Cat. no.: UFC3LTK00). Then the concentrates were adjusted with 0.38 ml of buffer (5 mM NaH 2 PO 4 , 35 mM NaCI, pH 7.4) to a final volume of 0.4 ml. Subsequently, the samples were adjusted to an SDS content of 0.05 % with 2 ⁇ l of a 10 % strength SDS solution and stored at -30 0 C until further use.
- buffer 5 mM NaH 2 PO 4 , 35 mM NaCI, pH 7.4
- Disulfide-stabilized (22C,29C) N-Met A ⁇ (1-42) oligomer (4i) of example 4i was subjected to thermolysin truncation using the procedure described example 5a.
- a ⁇ (16-35)-amide oligomer (3m) of example 3m was subjected to thermolysin truncation using the procedure described example 5a.
- aa Thermolysin truncation of disulfide stabilized (22C, 29C) A ⁇ (16-35)-amide oligomer (5aa) Subjecting disulfide stabilized (22C, 29C) A ⁇ (16-35)-amide oligomer 22C, 29C) A ⁇ (16-35)- amide oligomer (4aa) to thermolysin truncation using the procedure described example 5a will yield the product.
- Example 7 SDS PAGE analysis a) SDS-PAGE (10-20 % tricine gel) of (17C, 34C) N-Met A ⁇ (1 -42) oligomer SDS-PAGE was run using a 10-20 % tricine gel, 1.0 mm, 15 well (Invitrogen, Cat # EC66255), employing 2-x tricine sample buffer (Invitrogen, Cat # LC1676) and tricine run- ning buffer (Invitrogen, Cat # LC1675). Samples were mixed with equal parts sample buffer and loaded without heating. The gel was developed at ambient temperature for 100 minutes using a constant voltage of 125 V.
- LC5925 consisting of myosin (210 kDa), phosphorylase (98 kDa), BSA (78 kDa), Glutamic Dehydrogenase (55 kDa), Alcohol Dehydrogenase (45 kDa), Carbonic Anhydrase (34 kDa), Myoglobin Red (17 kDa), Lysozyme (16 kDa), Aprotinin (7 kDa) and Insulin (4 kDa).
- N-Met A ⁇ (1 -42) oligomer (2a) from example 2a showed the typical A ⁇ globu- lomer banding pattern (figure 2A).
- Tris/Glycine Gel (Invitrogen Inc., Cat. no.: EC60255BOX)
- the gel was incubated in staining solution for 30 min at room temperature under shaking on a rocking platform. After staining the background of the gel was destained over night at room temperature in the destaining solution.
- thermolysin truncated (14C, 37C) N-Met A ⁇ (1 -42) oligomer from example 4a thermolysin truncated (14C, 37C) N- Met A ⁇ (1-42) oligomer from example 5a, (15C, 36C) N-Met A ⁇ (1 -42) oligomer from example 4b, thermolysin truncated (15C, 36C) N-Met A ⁇ (1-42) oligomer from example 5b, (16C, 35C) N-Met A ⁇ (1 -42) oligomer from example 4c, thermolysin truncated (16C, 35C) N-Met A ⁇ (1- 42) oligomer from example 5c, (17C, 34C) N-Met A ⁇ (1 -42) oligomer from example 4d, thermolysin truncated (17C, 34C) N-Met A ⁇ (1 -42) oligomer from example 5d, (18C, 33C) N- Met A ⁇ (
- Example 8 Direct ELISA The immunoreactivity of (17C, 34C) N-Met A ⁇ (1 -42) oligomer (2a) from example 2a was further characterized by using an antibody that is > 1000 fold selective for the A ⁇ (1-42) globulomer form over fibril and free peptide (monoclonal antibody 5F7).
- Microtiterplates were Nunc lmmuno Plate, Maxi-Sorb Surface, flat bottom, (Cata- logue #439454).
- the conjugate (secondary antibody) was Donkey anti-mouse HRPO conjugate, Jackson lmmuno Research, (Catalogue #715-035-150).
- the HRPO Substrate was 3,3',5'5'-Tetramethylbenzidine Liquid substrate (TMB), Sigma, (Catalogue #T4444).
- NFDM Non-fat Dry Milk
- PBST buffer Sigma PBS made with 0.05 % Tween 20.
- PBST with 0.5 % BSA was made by dissolving 0.5 mg BSA in 100 mL PBST.
- Blocking solution was 3 % NFDM in PBST.
- Conjugate diluent was 1 % NFDM in PBST.
- the coating buffer was 100 mM NaHCO 3 pH8.2.
- the HRPO Stop Solution was 2 M H 2 SO 4 .
- Coating the plates The A ⁇ globulomer to be tested was diluted to 1.0 ⁇ g/mL in coating buffer. 100 ⁇ L were added to each well to be coated. Plate was sealed with sealing film and left at 4 0 C overnight.
- Plate Blocking The coating solution was removed from the wells. Each each well was optionally washed 2-3 X with 150 ⁇ L of PBST. 300 ⁇ L of blocking solution were added (3 % NFDM in PBST). Plate was covered with plate sealing film and incubated for -2 hrs at room temperature, with agitation.
- the blocking solution was removed from the wells. Each each well was optionally washed 2-3 X with 150 ⁇ L of PBST. 100 ⁇ L of primary antibody solutions were added. For the full length N-Met A ⁇ (1-42) globulomer, solutions of 0.04 to 100 ⁇ g/mL of antibody 5F7 were used. The antibody was diluted using PBST with 0.5 % BSA. The plate was covered with plate sealing film and incubated for -2 to 3 hrs at room temperature with agita- tion.
- Secondary Antibody (HRPO Conjugate) The primary antibody solution was removed from the wells. Each each well was washed 2-3 X with 150 ⁇ l_ of PBST. 200 ⁇ l_ of secondary antibody (HRPO conjugate) solution diluted 1 :5000 in PBST with 1 % NFDM were added. The plate was covered with plate sealing film and incubated for ⁇ 1 hr at room temperature with agitation.
- Substrate Development The conjugate solution was removed from the wells. Each each well was washed 2-3 X with 200 ⁇ l_ of PBST. 100 ⁇ l_ of HRPO substrate solution were added to each well. Color was allowed to develop under observation. It turned blue. The reaction was usually done in 5-10 minutes at room temperature. 50 ⁇ l_ of stop solution were added to each well. The blue color turned yellow. Absorbance at 450 nm was read using a microtiterplate reader within 30 min of addition of the stop solution.
- a comparison of direct ELISA results comparing the apparent binding affinity of the globulomer-specific mAb 5F7 to disulfide stabilized (17C, 34C) A ⁇ (16-35) oligomer from example 4p vs. the same oligomer truncated at residue 20 by enzymatic cleavage with thermolysin from example 5p is shown in figure 3E.
- a comparison of direct ELISA results comparing the apparent binding affinity of the globu- lomer-specific mAb 7C6 to disulfide stabilized (17C, 34C) A ⁇ (16-35) oligomer from example 4p vs. the same oligomer truncated at residue 20 by enzymatic cleavage with thermolysin from example 5p is shown in figure 3F.
- a comparison of direct ELISA results comparing the apparent binding affinity of the globu- lomer-specific mAb 7C6 to (17C(ACM), 34C(ACM)) A ⁇ (16-35) oligomer from example 4I vs. the same oligomer truncated at residue 20 by enzymatic cleavage with thermolysin from example 5I is shown in figure 3L.
- a comparison of direct ELISA results comparing the apparent binding affinity of the globu- lomer-specific rabbit polyclonal antiserum 5599 to (17C(ACM), 34C(ACM)) A ⁇ (16-35) oligomer from example 4I vs. the same oligomer truncated at residue 20 by enzymatic cleavage with thermolysin from example 5I is shown in figure 3M.
- thermolysin truncated disulfide stabilized (17C, 34C) A ⁇ (16-35) oligomer (cyclised before oligomer formation) from example 5o vs. thermolysin truncated disulfide stabilized (17C, 34C) A ⁇ (16-42), (17C, 34C) A ⁇ (16-35) and (17C, 34C) N-Met A ⁇ (1-42) oligomer (all cyclised after oligomer formation) from examples 5s, 5p and 5y is shown in figure 3R.
- Figure 13 shows a comparison of direct Elisa response of (17K, 34C) N-Met A ⁇ (1-42) oligomer without cross-link from example 3w with disulfide-stabilized (17C, 34C) N-Met A ⁇ (1- 42) oligomer from example 4y to (A) the globulomer-specific monoclonal antibody 5F7; (B) the globulomer-specific monoclonal antibody 7C6; and (C) the globulomer-specific rabbit polyclonal antiserum 5599.
- Figure 14 shows (A) a comparison of direct Elisa response of (17K, 34C) N-Met A ⁇ (1-42) oligomer without cross-link from example 3w with (17K, 34C) N-Met A ⁇ (1 -42) oligomer cross-linked with SMCC before (from example 4w1 ) and after (from example 5w1 )thermolysin truncation to (A) the globulomer-specific monoclonal antibody 5F7; (B) the globulomer-specific monoclonal antibody 7C6; and (C) the globulomer-specific rabbit polyclonal antiserum 5599.
- Figure 15 shows (A) a comparison of direct Elisa response of (17K, 34C) N-Met A ⁇ (1 -42) oligomer without cross-link from example 3w with (17K, 34C) N-Met A ⁇ (1 -42) oligomer cross-linked with MBS before (from example 4w2) and after (from example 5w2) thermolysin truncation to (A) the globulomer-specific monoclonal antibody 5F7; (B) the globulomer- specific monoclonal antibody 7C6; and (C) the globulomer-specific rabbit polyclonal antiserum 5599.
- Figure 16 shows (A) a comparison of direct Elisa response of (17K, 34C) N-Met A ⁇ (1 -42) oligomer without cross-link from example 3w with (17K, 34C) N-Met A ⁇ (1 -42) oligomer cross-linked with SIAB before (from example 4w3) and after (from example 5w3) thermolysin truncation to (A) the globulomer-specific monoclonal antibody 5F7; (B) the globulomer- specific monoclonal antibody 7C6; and (C) the globulomer-specific rabbit polyclonal antiserum 5599.
- Figure 17 shows (A) a comparison of direct Elisa response of (17K, 34E) N-Met A ⁇ (1-42) oligomer from example 3x without cross-link with disulfide-stabilized (17C, 34C) N-Met A ⁇ (1- 42) oligomer from example 3y to (A) the globulomer-specific monoclonal antibody 5F7; (B) the globulomer-specific monoclonal antibody 7C6; and (C) the globulomer-specific rabbit polyclonal antiserum 5599.
- Figure 18 shows (A) a comparison of direct Elisa response of (17K, 34C) N-Met A ⁇ (1 -42) oligomer without cross-link with (17K, 34C) N-Met A ⁇ (1 -42) oligomer cross-linked with
- a ⁇ (16-35) peptides that are precluded from forming this disulfide linkage either through lack of cys residues (wt A ⁇ (16-35), example 3m), or ACM protection of the -SH of the cys residue ((17C ACM/34C ACM) A ⁇ (16-35), example 3I), were not able to form oligomers that displayed the globulomer epitope (figures 3H-3M).
- a variety of heterobifunc- tional cross-linking reagents can be employed for a bridge between the side-chains of these two residues, including sulfo-SMCC, sulfo-MBS, and sulfo-SIAB.
- the (17K, 34C) N-Met A ⁇ (1-42) peptide can form oligomers that display the globulomer epitope (figures 13A-13C).
- these oligomers can be subjected to cross-linking using sulfo-SMCC (example 4w1 ), sulfo-MBS (example 4w2), and sulfo-SIAB (example 4w3), and the desired intro-molecular covalent cross-link formed (figures 12A-12C).
- sulfo-SMCC example 4w1
- sulfo-MBS example 4w2
- sulfo-SIAB example 4w3
- thermolysin truncation (examples 4w1 , 4w2, & 4w3), with the expected increase in affinity to the globulomer-specific antibodies resulting (figures 14A-14C, 15A-15C, and 16A-16C).
- a variety of cross- linking strategies can be employed to for a bridge between the side-chains of these two residues, including activation of the glutamate side chain by reaction with EDC, followed by sulfo-NHS.
- This activated side chain can subsequently react with primary amine of the lysine residue introduced at position 17.
- the (17K, 34E) N-Met A ⁇ (1-42) peptide (example 3x) can form oligomers that display the globulomer epitope (figures 17A-17C).
- these oligomers can be subjected to cross-linking using EDC and sulfo-NHS, with intra-molecular covalent cross-links resulting (figure 12D).
- These cross-linked A ⁇ oligomers still display the appropriate reactivity to the globulomer-specific antibodies (figures 18A-18C).
- these A ⁇ oligomers can be subjected to thermolysin truncation (examples 4x), with the expected increase in affinity to the globulomer-specific antibodies resulting (figures 18A-18C).
- Example 9 Mass Spectroscopy Mass spectrometry of the (17C, 34C) N-Met AN-Met A ⁇ (1 -42) oligomer (2a) from example 2a confirmed that formation of oligomers with the (L17C,L34C) N-Met A ⁇ (1-42) mutant peptide (1a) of example 1a directed the efficient formation of intra-peptide disulfide bonds between the two Cys residues (figure 4A).
- the mass centered around 4622 Da, the expected mass for the (L17C, L34C) N-Met A ⁇ (1-42) mutant peptide, with a single disulfide bond formed. No sign of covalent dimer peptide was observed in the mass spectrum.
- Mass spectrometry of the (17C, 34C) A ⁇ (16-35) oligomer (3p) from example 3p confirmed that formation of oligomers with the (17C, 34C) A ⁇ (16-35) peptide (1 p) of example 1 p directed the efficient formation of intra-peptide disulfide bonds between the two Cys residues (figure 4C).
- the mass centered around 2085 Da, the expected mass for the (17C, 34C) A ⁇ (16-35) peptide, with a single disulfide bond formed. No sign of covalent dimer peptide was observed in the mass spectrum.
- the mass spectrum (ESI) of oligomers made with (17K, 34C) N-Met A ⁇ (1-42) peptide after cross-linking reaction with the heterobifunctional cross-linking reagent sulfo-SMCC from ex- ample 4w1 is shown in figure 12A. The predominant species appears to be the desired product.
- the mass spectrum (MALDI) of globulomers made with (17K, 34C) N-Met A ⁇ (1-42) peptide after cross-linking reaction with the heterobifunctional cross-linking reagent sulfo-MBS from example 4w2 is shown in figure 12B.
- Example 10 Hydrodynamic analysis Samples were loaded into standard two-sector cells using sapphire windows. All samples were examined using either a 4-hole or an 8-hole rotor.
- C(s) analysis was done as implemented in Sedfit v8.9 (P. Schuck (2000), "Size distribution analysis of macromolecules by sedimentation velocity ultracentrifugation and Lamm equation modeling", Biophysical Journal 78:1606-1619) to understand the overall heterogeneity of the samples. Both radial and time independent noise were fit and removed from the data using a maximal entropy algorithm.
- thermolysin truncated (L17C, L34C) N-Met A ⁇ (1-42) oligomer displayed better hydrodynamic properties.
- Example 1 1 lodoacetamide alkylation of thermolysin truncated (xC, yC) N-Met A ⁇ (1 -42) oligomers and SELDI-MS analysis
- A Thermolysin truncated (xC, yC) N-Met A ⁇ (1-42) oligomers and N-Met A ⁇ (1-42) globu- lomers used for alkylation:
- thermolysin truncated oligomers and globulomers were subjected to io- doacetamide alkylation
- thermolysin truncated oligomer or globulomer 2.5 ⁇ l were diluted with 5 ⁇ l 50 mM Tris/HCI, 1 mM EDTA, pH 8.6 (5 min Helium aerated)
- thermolysin alkylation samples - 2.5 ⁇ l of the thermolysin truncated oligomer or globulomer were diluted with 5 ⁇ l 50 mM Tris/HCI, 1 mM EDTA, pH 8.6 (Helium aerated)
- thermolysin truncated oligomer or globulomer 2.5 ⁇ l were diluted with 5 ⁇ l 50 mM Tris/HCI, 1 mM EDTA, 2 mM DTT, pH 8.6 (Helium aerated) - 20 min incubation at 37 0 C
- Example 12 Dot Blot analysis of (xC, yC) N-Met A ⁇ (1-42) oligomers and A ⁇ (1-42) globu- lomers before and after thermolysin truncation Method: A ⁇ standards for dot blot:
- Antibody solution I Either Rabbit sera samples or mouse monoclonal antibodies were used as Antibody solution I and prepared as in the following:
- Antibody solution I was Rabbit sera samples then Antibody solution Il was Anti-Rabbit-AP. In the case Antibody solution I was mouse monoclonal antibodies then Antibody solution Il was Anti- Mouse-AP.
- Antibody solution Il was prepared as followed:
- Dot blot procedure 1 ) 1 ⁇ l each of the different A ⁇ standards (in their 5 serial dilutions) were dotted onto the nitrocellulose membrane in a distance of approximately 1 cm from each other.
- the dot blot was incubated with 30 ml 5 % low fat milk in TBS for 1.5 h at RT.
- the washing buffer was discarded and the dot blot was incubated with antibody solu- tion I for 2 h at RT.
- the antibody solution I was discarded and the dot blot was incubated under shaking with 20 ml TTBS for 10 min at RT.
- the washing solution was discarded and the dot blot was incubated under shaking with 20 ml TTBS for 10 min at RT.
- the washing solution was discarded and the dot blot was incubated under shaking with 20 ml TBS for 10 min at RT.
Abstract
Description
Claims
Priority Applications (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CA2730804A CA2730804A1 (en) | 2008-07-25 | 2009-07-24 | Amyloid .beta. peptide analogues, oligomers thereof, processes for preparing and compositions comprising said analogues or oligomers, and their uses |
CN200980137576XA CN102203124A (en) | 2008-07-25 | 2009-07-24 | Amyloid ss peptide analogues, oligomers thereof, processes for preparing and compositions comprising said analogues or oligomers, and their uses |
MX2011000975A MX2011000975A (en) | 2008-07-25 | 2009-07-24 | Amyloid ã peptide analogues, oligomers thereof, processes for preparing and compositions comprising said analogues or oligomers, and their uses. |
EP09801088A EP2303920A4 (en) | 2008-07-25 | 2009-07-24 | AMYLOID ß PEPTIDE ANALOGUES, OLIGOMERS THEREOF, PROCESSES FOR PREPARING AND COMPOSITIONS COMPRISING SAID ANALOGUES OR OLIGOMERS, AND THEIR USES |
JP2011520233A JP2011529084A (en) | 2008-07-25 | 2009-07-24 | Amyloid β peptide analogues, oligomers thereof, processes for preparing said analogues or oligomers and compositions comprising said analogues or oligomers and their use |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US8358908P | 2008-07-25 | 2008-07-25 | |
US61/083,589 | 2008-07-25 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2010011947A2 true WO2010011947A2 (en) | 2010-01-28 |
WO2010011947A3 WO2010011947A3 (en) | 2010-04-29 |
Family
ID=41570887
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2009/051721 WO2010011947A2 (en) | 2008-07-25 | 2009-07-24 | AMYLOID ß PEPTIDE ANALOGUES, OLIGOMERS THEREOF, PROCESSES FOR PREPARING AND COMPOSITIONS COMPRISING SAID ANALOGUES OR OLIGOMERS, AND THEIR USES |
Country Status (7)
Country | Link |
---|---|
US (1) | US20110092445A1 (en) |
EP (1) | EP2303920A4 (en) |
JP (1) | JP2011529084A (en) |
CN (1) | CN102203124A (en) |
CA (1) | CA2730804A1 (en) |
MX (1) | MX2011000975A (en) |
WO (1) | WO2010011947A2 (en) |
Cited By (20)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP2262526A1 (en) * | 2008-04-14 | 2010-12-22 | Mivac Development Aktiebolag | Stable amyloid beta monomers and oligomers |
WO2011029920A1 (en) | 2009-09-11 | 2011-03-17 | Probiodrug Ag | Heterocylcic derivatives as inhibitors of glutaminyl cyclase |
WO2012051089A2 (en) * | 2010-10-12 | 2012-04-19 | Caterpillar Inc. | Autonomous machine control system |
WO2012072611A1 (en) * | 2010-11-29 | 2012-06-07 | Philipps-Universität Marburg | SYNTHETIC LIGANDS FOR HUMAN ANTI-Aβ ANTIBODIES |
WO2012073111A3 (en) * | 2010-11-29 | 2012-11-15 | Akershus Universitetssykehus | Methods and compositions for monitoring phagocytic activity |
EP2542571A1 (en) * | 2010-03-03 | 2013-01-09 | The University of British Columbia | Oligomer-specific amyloid beta epitope and antibodies |
EP2787347A1 (en) * | 2013-04-03 | 2014-10-08 | Affiris AG | Method for detecting Aß-specific antibodies in a biological sample |
WO2014161890A1 (en) | 2013-04-03 | 2014-10-09 | Affiris Ag | Method for detecting proteinopathy-specific antibodies in a biological sample |
AU2013205000B2 (en) * | 2010-03-03 | 2015-05-28 | The University Of British Columbia | Oligomer-specific amyloid beta epitope and antibodies |
WO2015116923A1 (en) | 2014-01-31 | 2015-08-06 | Cognition Therapeutics, Inc. | Isoindoline compositions and methods for treating neurodegenerative disease |
WO2016005328A3 (en) * | 2014-07-07 | 2016-05-26 | AbbVie Deutschland GmbH & Co. KG | IMMUNOGENIC PRODUCTS BASED ON MUTEIN AMYLOID ß (Aß) AMINO ACID SEQUENCES AND USES THEREOF |
US9359430B2 (en) | 2006-11-30 | 2016-06-07 | Abbvie Inc. | Abeta conformer selective anti-Abeta globulomer monoclonal antibodies |
US9540432B2 (en) | 2005-11-30 | 2017-01-10 | AbbVie Deutschland GmbH & Co. KG | Anti-Aβ globulomer 7C6 antibodies |
WO2017140656A1 (en) * | 2016-02-15 | 2017-08-24 | Araclon Biotech, S.L. | Amyloid conjugate and uses and methods thereof |
US9822171B2 (en) | 2010-04-15 | 2017-11-21 | AbbVie Deutschland GmbH & Co. KG | Amyloid-beta binding proteins |
US10047121B2 (en) | 2010-08-14 | 2018-08-14 | AbbVie Deutschland GmbH & Co. KG | Amyloid-beta binding proteins |
EP3461819A1 (en) | 2017-09-29 | 2019-04-03 | Probiodrug AG | Inhibitors of glutaminyl cyclase |
US10323084B2 (en) | 2005-11-30 | 2019-06-18 | Abbvie Inc. | Monoclonal antibodies against amyloid beta protein and uses thereof |
US10464976B2 (en) | 2003-01-31 | 2019-11-05 | AbbVie Deutschland GmbH & Co. KG | Amyloid β(1-42) oligomers, derivatives thereof and antibodies thereto, methods of preparation thereof and use thereof |
CN114748605A (en) * | 2011-11-29 | 2022-07-15 | 普罗克拉拉生物科学股份有限公司 | Bacteriophage gene 3 protein compositions and use as amyloid binding agents |
Families Citing this family (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP2486928A1 (en) | 2007-02-27 | 2012-08-15 | Abbott GmbH & Co. KG | Method for the treatment of amyloidoses |
WO2010002251A1 (en) * | 2008-07-01 | 2010-01-07 | De Staat Der Nederlanden, Vert. Door De Minister Van Vws | Vaccine against amyloid folding intermediate |
US9364449B2 (en) | 2010-06-09 | 2016-06-14 | New York University | Peptoid and synthetic oligomers, pharmaceutical compositions and methods of using same |
DE102012021222B4 (en) * | 2012-10-27 | 2015-02-05 | Forschungszentrum Jülich GmbH | Process for producing a nanoporous layer on a substrate |
EP2746402A1 (en) * | 2013-03-12 | 2014-06-25 | Academisch Medisch Centrum | Method of prognosis of Alzheimers disease and substrates for use therein |
EP3200681A4 (en) * | 2014-09-05 | 2018-05-23 | System of Systems Analytics, Inc. | Methods for detecting amyloid beta oligomers |
WO2018005980A1 (en) * | 2016-07-01 | 2018-01-04 | The Scripps Research Institute | Compositions and diagnostic methods related to transthyretin amyloid diseases |
CN108148115A (en) * | 2018-01-30 | 2018-06-12 | 中国药科大学 | A kind of cyclic peptide new synthetic method and its application in drug development |
US20210262006A1 (en) * | 2018-06-18 | 2021-08-26 | Emory University | Parallel Enzyme Digestion for Protein Biomarker Detection |
CN109851660A (en) * | 2019-03-20 | 2019-06-07 | 横琴欣健生物科技研究院有限公司 | A kind of polypeptide and its vaccine for treating senile dementia |
CN109912687A (en) * | 2019-03-20 | 2019-06-21 | 横琴欣健生物科技研究院有限公司 | A kind of polypeptide drugs for treating senile dementia |
JP7357354B2 (en) | 2020-02-04 | 2023-10-06 | 国立大学法人京都大学 | Amyloid β42 cross-linked analog peptide |
Family Cites Families (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
DE69432629T3 (en) * | 1993-01-25 | 2008-01-17 | Takeda Pharmaceutical Co. Ltd. | ANTIBODIES AGAINST BETA AMYLOID OR DERIVATIVES AND ITS USE |
DE10101430B4 (en) * | 2001-01-13 | 2008-10-02 | Fraunhofer-Gesellschaft zur Förderung der angewandten Forschung e.V. | Soluble cyclic analogues for the modulation of amyloidogenesis |
US20020132758A1 (en) * | 2001-01-18 | 2002-09-19 | Shell John W. | Method for identifying compounds to treat medical pathologies associated with molecular crystallization |
US20070213512A1 (en) * | 2002-10-01 | 2007-09-13 | Krafft Grant A | Amyloid beta peptide analogs and assemblies thereof |
DE10303974A1 (en) * | 2003-01-31 | 2004-08-05 | Abbott Gmbh & Co. Kg | Amyloid β (1-42) oligomers, process for their preparation and their use |
EP1676859A1 (en) * | 2004-12-30 | 2006-07-05 | Pevion Biotech Ltd. | Immunogenic compositions of cyclic peptides derived from the beta-amyloid peptide |
KR20080021585A (en) * | 2005-03-05 | 2008-03-07 | 애보트 게엠베하 운트 콤파니 카게 | Screening method, process for purifying of non-diffusible a-beta oligomers, selective antibodies against said non-diffusible a-beta oligomers and a process for manufacturing of said antibodies |
US8263558B2 (en) * | 2005-11-30 | 2012-09-11 | Abbott Laboratories | Methods of preparation of recombinant forms of human beta-amyloid protein and uses of these proteins |
WO2008065141A1 (en) * | 2006-11-30 | 2008-06-05 | Probiodrug Ag | Novel inhibitors of glutaminyl cyclase |
-
2009
- 2009-07-24 MX MX2011000975A patent/MX2011000975A/en not_active Application Discontinuation
- 2009-07-24 WO PCT/US2009/051721 patent/WO2010011947A2/en active Application Filing
- 2009-07-24 EP EP09801088A patent/EP2303920A4/en not_active Withdrawn
- 2009-07-24 JP JP2011520233A patent/JP2011529084A/en active Pending
- 2009-07-24 CA CA2730804A patent/CA2730804A1/en not_active Abandoned
- 2009-07-24 US US12/509,325 patent/US20110092445A1/en not_active Abandoned
- 2009-07-24 CN CN200980137576XA patent/CN102203124A/en active Pending
Non-Patent Citations (1)
Title |
---|
See references of EP2303920A4 * |
Cited By (40)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10464976B2 (en) | 2003-01-31 | 2019-11-05 | AbbVie Deutschland GmbH & Co. KG | Amyloid β(1-42) oligomers, derivatives thereof and antibodies thereto, methods of preparation thereof and use thereof |
US10538581B2 (en) | 2005-11-30 | 2020-01-21 | Abbvie Inc. | Anti-Aβ globulomer 4D10 antibodies |
US10323084B2 (en) | 2005-11-30 | 2019-06-18 | Abbvie Inc. | Monoclonal antibodies against amyloid beta protein and uses thereof |
US9540432B2 (en) | 2005-11-30 | 2017-01-10 | AbbVie Deutschland GmbH & Co. KG | Anti-Aβ globulomer 7C6 antibodies |
US9359430B2 (en) | 2006-11-30 | 2016-06-07 | Abbvie Inc. | Abeta conformer selective anti-Abeta globulomer monoclonal antibodies |
US9951125B2 (en) | 2006-11-30 | 2018-04-24 | Abbvie Inc. | Aβ conformer selective anti-Aβ globulomer monoclonal antibodies |
US9394360B2 (en) | 2006-11-30 | 2016-07-19 | Abbvie Inc. | Aβ conformer selective anti-Aβ globulomer monoclonal antibodies |
US10138281B2 (en) | 2008-04-14 | 2018-11-27 | Alzinova Ab | Stable amyloid beta monomers and oligomers |
EP2262526A1 (en) * | 2008-04-14 | 2010-12-22 | Mivac Development Aktiebolag | Stable amyloid beta monomers and oligomers |
US9688734B2 (en) | 2008-04-14 | 2017-06-27 | Alzinova Ab | Stable amyloid beta monomers and oligomers |
US20110064741A1 (en) * | 2008-04-14 | 2011-03-17 | Mivac Development Aktiebolag | Stable amyloid beta monomers and oligomers |
EP2262526A4 (en) * | 2008-04-14 | 2012-04-25 | Mivac Dev Aktiebolag | Stable amyloid beta monomers and oligomers |
US10023622B2 (en) | 2008-04-14 | 2018-07-17 | Alzinova Ab | Method of immunization for reducing toxic damaged caused by oligomeric form of the amyloid-beta protein with stable amyloid beta monomers and oligomers |
WO2011029920A1 (en) | 2009-09-11 | 2011-03-17 | Probiodrug Ag | Heterocylcic derivatives as inhibitors of glutaminyl cyclase |
KR101831459B1 (en) * | 2010-03-03 | 2018-04-04 | 더 유니버시티 오브 브리티시 콜롬비아 | Oligomer-specific amyloid beta epitope and antibodies |
US9216217B2 (en) | 2010-03-03 | 2015-12-22 | The University Of British Columbia | Oligomer-specific amyloid beta epitope and antibodies |
AU2013205000B2 (en) * | 2010-03-03 | 2015-05-28 | The University Of British Columbia | Oligomer-specific amyloid beta epitope and antibodies |
EP2542571A1 (en) * | 2010-03-03 | 2013-01-09 | The University of British Columbia | Oligomer-specific amyloid beta epitope and antibodies |
EP3056510A1 (en) * | 2010-03-03 | 2016-08-17 | The University Of British Columbia | Oligomer-specific amyloid beta epitope and antibodies |
US9849165B2 (en) | 2010-03-03 | 2017-12-26 | The University Of British Columbia | Oligomer-specific amyloid beta epitope and antibodies |
EP2542571A4 (en) * | 2010-03-03 | 2013-07-31 | Univ British Columbia | Oligomer-specific amyloid beta epitope and antibodies |
RU2644335C2 (en) * | 2010-03-03 | 2018-02-08 | Зе Юниверсити Оф Бритиш Коламбия | Epitope, specific to amyloid beta oligomer and antibodies |
US9822171B2 (en) | 2010-04-15 | 2017-11-21 | AbbVie Deutschland GmbH & Co. KG | Amyloid-beta binding proteins |
US10047121B2 (en) | 2010-08-14 | 2018-08-14 | AbbVie Deutschland GmbH & Co. KG | Amyloid-beta binding proteins |
WO2012051089A2 (en) * | 2010-10-12 | 2012-04-19 | Caterpillar Inc. | Autonomous machine control system |
WO2012051089A3 (en) * | 2010-10-12 | 2012-06-07 | Caterpillar Inc. | Autonomous machine control system |
US11231426B2 (en) | 2010-11-29 | 2022-01-25 | Inven2 As | Methods and compositions for monitoring phagocytic activity |
WO2012072611A1 (en) * | 2010-11-29 | 2012-06-07 | Philipps-Universität Marburg | SYNTHETIC LIGANDS FOR HUMAN ANTI-Aβ ANTIBODIES |
WO2012073111A3 (en) * | 2010-11-29 | 2012-11-15 | Akershus Universitetssykehus | Methods and compositions for monitoring phagocytic activity |
CN114748605A (en) * | 2011-11-29 | 2022-07-15 | 普罗克拉拉生物科学股份有限公司 | Bacteriophage gene 3 protein compositions and use as amyloid binding agents |
WO2014161875A1 (en) * | 2013-04-03 | 2014-10-09 | Affiris Ag | METHOD FOR DETECTING Aβ-SPECIFIC ANTIBODIES IN A BIOLOGICAL SAMPLE |
WO2014161890A1 (en) | 2013-04-03 | 2014-10-09 | Affiris Ag | Method for detecting proteinopathy-specific antibodies in a biological sample |
EP2787347A1 (en) * | 2013-04-03 | 2014-10-08 | Affiris AG | Method for detecting Aß-specific antibodies in a biological sample |
EP3498692A1 (en) | 2014-01-31 | 2019-06-19 | Cognition Therapeutics, Inc. | Isoindoline compositions and methods for treating neurodegenerative disease |
WO2015116923A1 (en) | 2014-01-31 | 2015-08-06 | Cognition Therapeutics, Inc. | Isoindoline compositions and methods for treating neurodegenerative disease |
EP4023294A1 (en) | 2014-01-31 | 2022-07-06 | Cognition Therapeutics, Inc. | Isoindoline compositions and methods for treating alzheimer's disease |
RU2750268C2 (en) * | 2014-07-07 | 2021-06-25 | Эббви Дойчланд Гмбх Унд Ко. Кг | IMMUNOGENIC PRODUCTS OBTAINED BASED ON AMINO ACID SEQUENCES OF MUTEIN AMYLOID β (Aβ) AND THEIR APPLICATION METHODS |
WO2016005328A3 (en) * | 2014-07-07 | 2016-05-26 | AbbVie Deutschland GmbH & Co. KG | IMMUNOGENIC PRODUCTS BASED ON MUTEIN AMYLOID ß (Aß) AMINO ACID SEQUENCES AND USES THEREOF |
WO2017140656A1 (en) * | 2016-02-15 | 2017-08-24 | Araclon Biotech, S.L. | Amyloid conjugate and uses and methods thereof |
EP3461819A1 (en) | 2017-09-29 | 2019-04-03 | Probiodrug AG | Inhibitors of glutaminyl cyclase |
Also Published As
Publication number | Publication date |
---|---|
CA2730804A1 (en) | 2010-01-28 |
EP2303920A4 (en) | 2011-11-09 |
WO2010011947A3 (en) | 2010-04-29 |
US20110092445A1 (en) | 2011-04-21 |
EP2303920A2 (en) | 2011-04-06 |
MX2011000975A (en) | 2011-05-25 |
CN102203124A (en) | 2011-09-28 |
JP2011529084A (en) | 2011-12-01 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20110092445A1 (en) | Amyloid ß peptide analogues, oligomers thereof, processes for preparing and composi-tions comprising said analogues or oligomers, and their uses | |
CA2514582C (en) | Amyloid-.beta.(1-42) oligomers, derivatives thereof, antibodies for the same, method for production and use thereof | |
JP5137400B2 (en) | Peptides for diagnosing and treating amyloid-related diseases, antibodies thereto, and methods of use thereof | |
AU2021200575A1 (en) | Immunogenic products based on mutein amyloid ß (Aß) amino acid sequences and uses thereof | |
RU2546234C2 (en) | Vaccine against intermediate with amyloid coagulation | |
US20080146508A1 (en) | Soluble cyclic analogues of beta amyloid peptide | |
JP2000516572A (en) | A chaperone that binds to prion protein and can distinguish between isoforms PrPPc and PrP 上 sc | |
WO2010010469A2 (en) | Abeta (x-38..43) oligomers, and processes, compositions, and uses thereof | |
JP2006506942A (en) | Peptides for diagnosing and treating amyloid-related diseases, antibodies thereto, and methods of use thereof | |
US20090099343A1 (en) | Isolation of pathogenic prions | |
Ball et al. | Engineering the prion protein using chemical synthesis | |
US7408028B2 (en) | Peptides, antibodies thereto, and their use in treatment of central nervous system, damage | |
US20060057636A1 (en) | Composite peptide compounds for diagnosis and treatment of diseases caused by prion proteins | |
US11319348B2 (en) | Synthetic beta-amyloid peptides capable of forming stable antigenic oligomers | |
KR100829447B1 (en) | Antibodies capable to selectively detect prion PrPSc isoforms |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
WWE | Wipo information: entry into national phase |
Ref document number: 200980137576.X Country of ref document: CN |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 09801088 Country of ref document: EP Kind code of ref document: A2 |
|
ENP | Entry into the national phase |
Ref document number: 2730804 Country of ref document: CA |
|
ENP | Entry into the national phase |
Ref document number: 2011520233 Country of ref document: JP Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2009801088 Country of ref document: EP Ref document number: MX/A/2011/000975 Country of ref document: MX |
|
NENP | Non-entry into the national phase |
Ref country code: DE |