WO2010000565A1 - Method for diagnosing cancers expressing the her2 receptor or its truncated variants - Google Patents
Method for diagnosing cancers expressing the her2 receptor or its truncated variants Download PDFInfo
- Publication number
- WO2010000565A1 WO2010000565A1 PCT/EP2009/056976 EP2009056976W WO2010000565A1 WO 2010000565 A1 WO2010000565 A1 WO 2010000565A1 EP 2009056976 W EP2009056976 W EP 2009056976W WO 2010000565 A1 WO2010000565 A1 WO 2010000565A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- seq
- fragment
- her2
- her2 receptor
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/71—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3015—Breast
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/32—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/5758—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/71—Assays involving receptors, cell surface antigens or cell surface determinants for growth factors; for growth regulators
Definitions
- Tne present invention relates to a method of diagnosis in isolated samples of cancers expressing the HER2 receptor.
- the invention also provides compounds for use in the early diagnosis and identification of the cancer as well as for use in therapy
- HER2 ⁇ also known as c-erbB2, ErbB2 or Neu ss a type i transmembrane protein belonging to the family of epidermal growth factor receptors or EGFR, also known as HER1 or ErbB1 .
- Two additional members, HER3 and HER4 complete this family When HER1 , 3 or 4 binds to an EGF-type ligand, its extracellular domain adopts the conformation referred to as "open", which allows the formation of homodimers and heterodimers. Even if it does not bind to any ligand, HER2 also interacts with other HER receptors linked to a ligand, due to the fact that its extracellular domain is con ⁇ tifutively in "open" conformation
- the dime ⁇ sation directed by the extracellular domain leads to interaction of tne intracellular kinase of HER receptors and to the subsequent transphosphorylation of some tyrosine residues.
- These phosphotyrosmes act as couplers of a group of intracellular phosphotyrosine-binding proteins
- the interactions established at the plasmatic membrane are transduced to the cell nucleus by means of different signalling routes, such as the protein kinase route activated by mitogen activated protein kinase (MARK), the protein kinase route activated by stress (JNK), phosphoiipase C gamma, etc.
- All of these signalling circuits control tne expression of genes that act in a coordinated way to modify determining aspects of the state of the cell, such as eel! proliferation, migration, survival and adhesion.
- eel! proliferation e.g., proliferation, migration, survival and adhesion.
- activation of the HER receptors results in a dramatic cell response, which can range from transformation into a malignant cell to a premature senescence.
- the HER receptors or fragments tnereof can be endocyted and transported to the nucleus, where they can directly regulate the expression of certain genes. This fact has been observed for the specific case of HER2 (Wang et al,, "Binding at and transactivat ⁇ on of tne COX-2 promoter oy nuclear tyrosine kinase receptor ⁇ rbB-2". Cancer Ceil-2004, Voi. 6, pp 251 -261 ).
- CTF carboxy terminal fragment
- ft is very important to be able to detect the presence of HER2 in tumours on time and even more to determine wnether it is in a complete or truncated (CTF) form.
- the recommended therapy consists of administering therapeutic monoclonal antibodies, such as Genentecn ' s trastuzumab.
- therapeutic monoclonal antibodies such as Genentecn ' s trastuzumab.
- the use of this monocsonai antibody for the treatment of cancer is described in the apDiication WO 8906692 on oehalf of Genentech.
- WO 8906692 describes monoclonal or polyclonal antibodies directed against the extracellular region of HER2. this extracellular region matching with the complete external part of the protein, which ss its N-terminal end.
- the epitopes recognised by the antibodies cited in WO 8906692 are antigenic regions of the extracellular domain of the HER2 complete form and are not included in truncated forms or carboxy terminal fragments of HER2. Therefore, with the antibodies and the diagnosis method described in WO 8906692 it will not be possible to defect the presence of truncated HER2 (CTFs). Also, in breast tumours where sad CTFs of HER2 are expressed, antibodies sucn as trastuzumao are not therapeutic, since they do not recognise any epitope. This fact explains tne resistance to the treatment with trastuzumab observed in patients expressing truncated forms (CTFs) of HER2
- CTFs truncated HER2
- This new detection method can be carried out on sections of tissue embedded in paraffin and fixed with formalin following clinical protocols
- the new methodology arises from observing that the truncated form p95H ⁇ R2, and not the entire form of the receptor, ss tocated in both the plasmatic membrane and the cytoplasm of the cell
- This metnod proposes comparing whether there is expression of p95HER2 by means of staining the detected cytoplasm with an ant ⁇ -HER2 antibody that binds the receptor's cytoplasmic domain, and confirming these results with those of a detection with an ant ⁇ -cytokeratin antibody, a protesn whose distribution has been extensively used as a tool for the diagnosis of tumours.
- this method efficiently distinguishes those tumours expressing the complete form of HER2 from those that express the truncated forms
- the present invention offers benefits related to the problems cited above and represents a novel solution in the early classification of cancer specifically breast cancer
- CTF-611 This HER2 truncated form (CTF-611 ) has been identified and found to have the sequence SEQ ID NO:1 .
- Thss sequence has been used to develop several tools for detecting its presence in tissue samples, thus providing a new and solid diagnosis set that is aiso applicable in clinical routine
- the present invention also provides new antibodies, or fragments thereof, that recognise this truncated form or CTF of HER2, which ss not recognised by trastuzumab These antibodies recognize an epitope being defined by a se ⁇ uence included in SEQ ID NO 2
- the invention also provides hyb ⁇ doma ceil lines suitable for producing such antibodies Ants-HER2 antibo ⁇ ies currently available recognize CTFs and HER2 or only HER2, making it very difficult to discriminate patients expressing only HER2 from patsens expressing HER2 and CTFs
- the antibodies described here preferentially bind to CTF-61 1 allowing to identify patients expressing this CTF
- the present invention also refers to a method of cancer diagnosis in patient samples which comprises the detection of the presence in said sample of the HER2 receptor truncated form consisting of SEQ ID NO 1
- the present invention also provides the use of the antibody or fragment thereof of the present invention for the diagnosis and determination of prognosis in isolated samples of cancers where the HER2 receptor ⁇ S expressed
- the present invention further provides an agent of diagnosis and determination of prognosis in isolated samples of cancers where the HER2 receptor and/or C-terminal fragments is expressed which compi ise ⁇ at least one aniiDody or a fragment tnereof as described above
- the present invention also provides a kit of diagnosis and determination of prognosis in isolated samples of cancers where the HER2 receptoi is expressed, that comprises means for detecting the presence in said sample of the HER2 receptor truncated form consisting of the SEQ ID NO 1
- the invention also provides an antibody or a fragment thereof as described above ⁇ or use m therapy or in the manufacture of a medicament
- the medicament is for the treatment or prevention of cancers where at least the HER2 receptor truncated form consisting of the SEQ ⁇ D NO 1 is expressed
- the use of antibodies or rragrnents is foi the manufacture of a medicament for treating or preventing breast cancers in mammals, including human beings
- Another object of the present invention is a pharmaceutical composition for the treatment of cancers wherein at least the HER2 receptor truncated form consisting of SEQ ID NO 1 is expressed, which comprises an antibody or a fragment thereof as described above and at least one pharmaceutically acceptable excipient and/or vehicle.
- FIG. 1 Diagram of the protein sequence of the truncated form CTF-61 1 , compared with the sequence of the complete H ⁇ R2 receptor and with the truncated form known as p95 (648-CTF/p95), product of the proteolysis by aipha-secretases
- the transmembrane domain is represented as a nelicoidal line.
- the remaining molecule is indicated with a grey box.
- the sequence of the peptide used to generate mono and polyclonal antibodies appears underlined.
- the positions of intramolecular dssulphsde bridges are also indicated with connections oetween the cysteines.
- FI3 2 Electrophoresis and Wesiern-blot (transfer to membrane) of Dreast cancer samples.
- S means soluble fraction and
- JvI membrane fraction, in order to detect complete HER2 and the CTF-61 1 form, antibodies directed to the cyroplasmic domain of the proteins were used.
- DHL- Lacatafe dehydrogenase (used as control)
- FiG. 3 Results of the evaluation of the numoer of tumours developed in Transgenic mice tnat express the truncated CTF-61 1 (FIQ 3A) form in comparison with transgenic mice that express the complete HER2 receptor; and the results of the volume of detected tumours (FIG. 3B) On the Y axis, N and V mean Number of Tumours and Volume of Tumours, respectively On the X axis, T refers to Time in weeks.
- FIG. 4A shows an electrophoresis and Western-Blot (transfer to membrane) revealed with an antibody (CB11 ) that recognises the cytoplasmic domain of the HER2 receptor (common domain in all complete and truncated forms) or with polyclonal antibodies generated against the peptide of SEQ ID NO. 3 ( ⁇ -61 1 -A and ⁇ - 61 1 -B)
- the tracks correspond to MCF7 cell iysate extracts (previously transformed with the constructions of FIG. 1 ) that express the complete form of the HER2 receptor, the CTF-611 truncated form and p95 truncated form.
- FIG 4B shows the result of an immunoprecipitation test with the antibodies os-61 1 -A 1 ⁇ -61 1 -B and CB1 1 carried out on samples containing both the complete HER2 receptor as well as the truncated forms CTF-61 1 and p95
- FIG 5 MCF7 celis expressing HER2, 611 -CTF or 648-CTF were lysed and analyzed by Western blot with CB1 1 , an antibody against the cytoplasmic domain of HER2, or with two independent monoclonal ant ⁇ -61 1 -CTF antibodies raised against the peptide MPIWKFPDEEGASQPSPiNSTHSSVDLDDKGC (see Fig 1 ⁇
- B The lysates from MCF7 cells expressing H ⁇ R2 S 61 1 -CTF or 648-CTF were mixed 1 1 -1 and subjected to immunoprecipitation with the indicated monoclonal antibodies Washed immunoprecipitates were analyzed by Western biot with the CB1 1 antibody As a negative control a mock immunoprecipitation with no antibody (-) was performed
- C MCF7 cells expressing HER2 61 1 -CTF or 648-CT ⁇ were analyzed in a confocal microscope by indirect immunofluorescence with the indicated
- FIG S- Characterization of epitopes Fig 8 ⁇ A Graph showing the primary sequence of the juxtamembrane region of 61 1-CTF and the se ⁇ uence of the different constructs used to map tne epitopes- Fig 8(B) Western blots
- FIG 9 Analysis of breast cancer samples Fig 9(A) Table with analytical results Fig 9(B) immunocytochemica! staining
- FIG 3 shows the results of the evaluation of the numoer of tumours ⁇ eveloped in transgenic mice expressing tne truncated form CTF-61 1 (SEQ ID NO 1 )
- cDNA constructs were expressed in the breast epithelium of mice, said constructs coding the human SEQ ID NO: 1 (CTF- 61 1 ), identified in the figure as M61 1 -CTF
- This construct comprises the SEQ ID NO- 1 under control of the promoter of the mouse mammary tumour virus (MMTV),
- MMTV mouse mammary tumour virus
- FVB/N-Tg(MMTVneu)202J that expresses the complete form of HER2 was used, also under control of the MMTV promoter.
- tumours in mice expressing the cDNA construct with the CTF-611 form (SEQ ID NO: 1 ) is much higher than the one of the FVB/N- Tg(MMTVneu)202J line, identified in this figure with the designation HER2/neu.
- the tumours tn the transgenic animals were detected at 17 weeks of age of the transgenic animals expressing CTF-611 , which represents three months before the first detection in FVB/N-Tg ⁇ MMTVneu)202J mice. This fact would explain the greater aggressiveness of tumours that express HER2 fragments in relation to those tumours that express the complete form.
- FIG 3B also shows that the volume of the tumours is much greater in the animals expressing the CTF truncated form of HER2 with SEQ ID NO 1 , in relation to those animals expressing constitutive!;/ the whole receptor, also known as HER2/neu
- This second fact also explains tne greater aggressiveness of this type of tumours
- the inventors also determined that those tumours expressing the truncated form of se ⁇ uence SEQ ID NO- 1 showed higher lung metastasis indices than those observed in tne umours bxpre&tsng H ⁇ R2/neu. Furtner experiments proving the clinical relevance are provided in Example 9 below.
- said SEQ ID NO' 1 includes all variants derived from allelic vaisanons between individuals, which entail variations in number and type, of some amino acids, such as more or less than two or three amino acids, or the replacement of an amino acid by another one which does not modify the overall receptor s structuie.
- HER2 can contain neo-epitopes, in other words, new antigenic determinants not present in the molecule of the whole receptor, meaning that they ⁇ o not interact sn the same way With the molecules as with the whole receptor (antibodies, medicaments, etc.).
- Antibodies to CTF-611 can contain neo-epitopes, in other words, new antigenic determinants not present in the molecule of the whole receptor, meaning that they ⁇ o not interact sn the same way With the molecules as with the whole receptor (antibodies, medicaments, etc.).
- the inventors could produce both polyclonal and monoclonal antibodies to CTF-611 These antibodies recognize an epitope that is defined by a sequence included m SEQ ID NO 2, preferably by a sequence included in or defined by SEQ ID NO 3 Most preferred are antioodies that recognize an epitope that is included in or defined by MPiWKFPDEEGAS (SEQ ID NO 5).
- epitope is understood to mean the part of a pepffdic type macromolecule (or of an antigen), whose sequence and/or spatial configuration is recognsse ⁇ by the immune system (antibodies, T cells, B cells)
- the antibodies of the present invention can preferably distinguish the protein of SEQ ID NO 1 from the HER2 receptor. Furthermore, the antibodies of the present invention can preferably distinguish the protein of SEQ ID NO 1 from the HER2 receptor truncated form 648-CTF/p95 Tn ss distinction can be visualized by one or more of immunofluorescence, flow cytometry, immunohistochemistry in cultured cells and immunoh ⁇ stochemistry in samples from patients. It is particularly D referred that the distinction can oe quantified bom m flow cytometry and immunoprecipitation
- the binding of tne antibodies of the present invention to 61 1 -CTF is preferably at least 300 times, more preferaoly at least 1000 times, most preferably 1000 to 2000 times stronger than tnejr binding to HER2 in an immunoprecipitation experiment, as described in more detail in Example 3 (using 5 microgram of 32H2 and 5 microgram of 20F4),
- the antibody can be polyclonal or monoclonal,
- polyclonal antibody 1' shaSI De understood to mean the group of antioodies produced by different B cell lines (B lymphocytes) Polyclonal antibodies are mixtures of immunoglobulins secreted against an antigen (macromolecule), each one of these immunoglobulins being capable of recognising a difrerent epitope, since it comes from a different B cell.
- polyclonal antibodies there is a type of immunoglobulin that iecognises the epitope oi epitopes of interest of a specific antigen
- Polyclonal antibodies can be produced for example by conjugating the peptide of SEQ ID NO 2, SEQ ID NO 3 SEQ ID NO 4 or SEQ ID NO 5 with an immunogen such as Keyhoie-iimpet hemocyanin and immunising rabbits with this conjugate
- Monoclonal antibodies can be produced using the same or Similar ⁇ mmunogens Hybridoma cell lines can be produced in a manner known to the skilled person The hyb ⁇ doma cell line can then be grown in a suitable culture medium from which the monoclonal antibody is recovered
- they are produced by the hybridoma cell line deposited with the 'Deut ⁇ chland Sarnmlung von Mikroorga ⁇ ismen und Zelikulturen GmbH - DSMZ' with access number DSM ACC2904 in accordance with the Ti eaty of Budapest of 9 April 2008 or the hybridoma cell line deposited with the "Deutschland Sammiung von M ⁇ kroorgamsmen und Zelikulturen GmbH - DSMZ" with access numoei DSM ACC2980 in accordance with the Treaty of Budapest of 6 November 2008
- Monoclonal antibodies produced with these hybridoma cell lines, as we J i as monoclonal antioo ⁇ ses ihai are Tunctionaily at ⁇ east equivalent are particularly preferred Functionally at least equivalent are those antioodies that can discriminate between CTF-611 and HER2 equally well or even better
- Useful antibodies also include humanized and human antibodies
- the present invention thus also provides the isolated peptides of sequence SEQ ID NO 2 SEQ !D NO 3, SEQ ID NO 4 or SEQ ID NO 5
- a fragment thereof may be used according to the present invention
- the antibody fragments are selected from the group comprised by F(ab) F(ab') and Fv
- a fragment of an antibody refers to a part of the antibody which is of enough size and appropriate structure to bind to an epitope present in the HER2 receptoi truncated form and thus permit its detection in a sample
- Examples 2 and 3 show specific antibodies Evt ⁇ ently the invention extends to othe r polyclonal oi monoclonal antibodies directed agasnst the epitope of the CTF-61 1 truncated form whfch is defined by the sequences SEQ ID NO 2 and SEQ ID NO 3, since, on the basis of the teachings of this invention they can be directly derived for a skilled in the art Equally, the invention extends to fragments of said antibodies, such as F(ab), F(ab'), Fv, etc or any hybridoma cell line capable of producing monoclonal antibodies directed against the peptides of SEQ ID NO:2 and SEQ ID NO- 3
- the detection of the presence of the HER2 receptor truncated form may be carried out through means independently selected from the group comprised by detection by differential migration in a mobile phase - stationary phase system of the HER2 receptor truncated form consisting of SEQ ID NO. 1 in respect of the complete form of said HER2 receptor- and detection by binding with specific antibodies of the HER2 receptor truncated form containing the SEQ ID NO: 1
- Detection through differential migration should be understood to mean, in the context of the present invention, any analytical technique that allows separation of the compounds to be detected on the basis of then different mobility in a specif, c mobile phase - stationary pnase system, such as an electrophoresis.
- Such different mobility may be caused by a different electrical charge m tne compound, different molecular weight, or different affinity for other compounds.
- Tnis differential detection can be carne ⁇ out through analytical techniques known by the skilled in the art sucn as protein electrophoresis, molecular exclusion cnromaiographies, antibody affinity tests, immunofluorescence immunocytochemistry, immunonsstochemistry, flow cytometry, etc Particularly preferred is immunohistochemistry
- immunohistochemistry One or more of these methods can be combined to enhance reliability
- HER2 receptor truncated form consisting of SEQ iD NO 1 also referred to in this invention as CTF-611
- CTF-611 Differential detection of the HER2 receptor truncated form consisting of SEQ iD NO 1 , also referred to in this invention as CTF-611 , in respect of the whole or complete HER2 receptor, implies being able to visualise two proteins with different molecular weights and different sequences as can be desired from FIG. 1.
- the truncated form with SEQ iD NO: 1 consists of the protein resulting from the alternative initiation of translation through methionine 61 1 of the complete sequence of the HER2 receptor
- This form or CTF tnus comprises a new extracellular domain, a transmembrane fragment and a cytosoiic domain
- the transmembrane fragment and the cytosoiic domain are the same as those of the complete form of the HER2 receptor.
- Another truncated form corresponds to the one of FIG 1 referred to as p95 or CTF-648
- This last form is the product of the action of the alpha-secretases on the complete HER2 receptor, which divide a large part of the extracellular domain.
- the step of detecting the presence in the sample of the HER2 receptor truncated form consisting of SEQ ID NO. 1 comprises the detection with at least one antibody as defined above
- the method of diagnosis according to the invention comprises the detection of fne epitope defined by SEQ ID NO 3.
- the antibodies or fragments thereof of the present invention are used as agents for the diagnosis and determination of prognosis, either directly marked in their own oeptidic sequence (for example with radioisotopes) or indirectly (for example by addition or binding a fluorescent agent or an agent capable of producing fluorescence Dy reaction in a selected reaction medium), all of the above with the aim of generating a visible signal, and ⁇ f possible ⁇ uantifiable. with which to detect the presence of the HER2 receptor truncated form consisting of the sequence SEQ ID NQ 1 in a sampi ⁇
- diagnosis agent containing at least the antibodies to De adnered to a solid support, ⁇ irectly or indirectly by means of a spacer arm.
- An agent of this type allows capturing or the form of sequence SEQ ID NQ: 1 o ⁇ a sample, in order to determine its presence afterwards with other non-specific antiDodies (such as CB1 1 )
- Tne agents of diagnosis and determination of prognosis according to the invention can also be applie ⁇ in immunohisiochemistry protocols
- the (primary or secondary) monoclonal or polyclonal antibodies must be duly marked to give a visible signal, and in the best of cases quantifiable, once they have come into contact with the tested tissue and they have been allowed to interact witn the proteins intended fo ⁇ detection, in other words, with the CTF fragment of HER2 of sequence SEQ ID NO 1
- the ⁇ iagnosistic agent is provided in the form of a kit which includes, besides the antibodies, the reagents (e.g.
- This kit may also comprise a means for carrying out a semiquantitative immunohistochemical assay for the determination of HER2 (such as HerceptestTM)
- the invention provides a kit for diagnosis and determination of the prognosis whfch comprises at least one antibody or a fragment thereof, sad antibody or fragment being capable of recognising the epitope defined by SEQ ID NO 2 or SEQ ID NO 3 or SEQ ID NO-S, in addition to the reagent means and buffers suitable for carrying out the interaction of the antibody with the epitope and that are extensively known by those skilled in the art
- the diagnostic method of the present invention, and tne kit of the present invention may ailow the prediction of nodal metastasis, poor prognosis, and resistance to
- kit also object of the invention comprises all the necessary means for carrying out detection through differentia! migration of the HER2 receptor truncated form conststsng of the se ⁇ uence SEQ [D NO 1 in relation to the complete form of the HER2 receptor
- cancers that express the HER2 recepio 1 or its truncated variants breast cancer stands out.
- Other cancers where these proteins are aiso expressed include the cancer of lung, pancreas, coion, stomach piostate, nead and neck, skin kidney, testicle, thyroids, u ⁇ naiy bladder, uterus vulva endometrial, ovary, oesophagus, mouth, sanvaiy gland, larynx, peritoneum, nose and throat region, Fallopian tubes, Wilms tumors as welf as lymphomas, Swing sarcomas, synovial sarcoma, medulloblastomas, trophoblastic tumors, glyomas, glyoblastomas cnolangiocarcsnomas, cholesteatoma, chondrosarcoma ependymoma, neu ⁇ lemmomas, neuromas, rhabdomy
- the antibodies of the present invention, or fragments thereof, are also useful in therapy, particularly in the therapy of cancer, particularly those cancers that express the H ER2 receptor or its truncated variants Humanized and human antibodies and fragments thereof, are preferred
- the antibodies of this invention are used also in pharmaceutical compositions useful for the treatment of cancers in which at ieast the HER2 receptor truncated form consisting of SEQ ID NO 1 is expressed
- the composition comprises those pharmaceutically acceptable vehicles or excioients and at ieast one antibody that recognises the epitope defined by the se ⁇ uences SEQ ID NO 2 or SEQ ID NO 3
- the pharmaceutical composition may aiso comprise a mixture of antibodies that, besi ⁇ es an antibody of the present invention, contains otner antibodies against HER2 or fragments thereof, such as HerceptinTM
- Ceiis MCF7 Tet-Off cells (BD bioscience) were maintained at 37 0 C and 5 " % C 10 CO2 m DMEM/F-12 (1 1 )(G ⁇ bco) containing 1 0% FBS (Gibco), 4mM L- Giutamme (PAA Laboratories) 0 2mg/mi G41 8 (Gibco) and 1 ⁇ g/m! doxycycline (Sigma). Cells were transfected with the various expression pias ⁇ nds by using FuGENES (Roche).
- MCF7 cells expressing HER2, 61 1 -CTF or 648- were washed at 4 0 C with PBS and detached m PBS containing 5mM of EDTA. Detached cells were incubated with 10 ⁇ g/ml of anti-32H2 monoclonal antibody in PBS containing 5% BSA for 30 mm at 4°C washed and stained for 30 ram at 4 0 C with F ⁇ TC-conjugated anti- mouse IgG (Becton-Dickinson) in PBS containing 5 % BSA, Flow cytometry was done on a FACscan using FACscan Research software (Becton Dickinson lmmunocytometry Sys., Mountain View. CA).
- MCF7 cells exoressing H ⁇ R2, 611 -CTF or 648- were washed at 4 c C with PBS and detached in PBS containing 5mM of EDTA. Then, cells were cent ⁇ fuged and cell pellets were fixed in 10% neutral formalin, dehydraied and embedded in paraffin. Sections from cetf peiieis ot from human tissues o* a thickness of 4 ⁇ m were placed on poiy-lysine-coate ⁇ glass sli ⁇ es. lmmunohistochemistry analyses were performed using the following protocol:
- Envision Flex Wash Buffer 10x DM 81 1. Envision Flex Target Retrieval Solution High Ph 1 0x DM 812 Envision Fiex+ Mouse ( linker) SM 84 Peroxidase 5 mm and wash with washing buffer. Protein Block 5% 15-20 mm Wash with washing buffer
- mice TG 611 and TG 687 mice were engineered by cloning the sequences encoding 687- CTF and 611 -CTF into the multiple cloning site Il downstream of the Rous sarcoma virus enhanced mouse mammary tumor virus long terminal repeat of the plvlB vector (a kind gift from Dr.
- Mammary glands were mounted on glass slides, fixed overnight in 4% paraformaldehyde and transferred to 70% ethanol. The slides were rinsed in water for 5 5m ⁇ n and stained in a filtered solution of 0 2% carmine for 24hours Giands were tnen dehydrated sequentially with decreasing concentrations of etnanoi, then defatted and stored in methyl salicylate For histological analysis, fixed glands were blocked in paraffin, sectioned, and stained with hematoxylin and eosin.
- EXAMPLE 1 Deiection of the fragment of SEQ ID NO 1 through differential migration.
- FIG. 2 which corresponds to an image of an electrophoresis gel and subsequent Western-type transfer (Western-blot)
- different samples cr bieast cancer 108, 114,
- FIG 2 therefore shows that detection of the type of truncated forms of the HER2 receptor can be carried out through a protein electrophoresis analysis. Furthermore, the presence of a ⁇ rag ⁇ sent of HER2 of sequence SEQ ID NO' 1 is indicative of a certain type o f cancer, in the case of the example, breast cancer, which needs to be 0 evaluated and treated as an in ⁇ ividual case within the cancers that express HER2
- EXAMPLE 2 Detection of the presence of the HER2 fragment of se ⁇ uence SEQ !D NO 1 with polyclonal antibodies directed to neo-epitopes defined by the SEQ ID NO: 2 or SEQ ID NO: 3. 5
- SEQ ID NO 4 corresponds therefore io a peptide equivalent to that of SEQ ID NO 3 although adapted in order to carry out the immunisation technique
- the antibodies directed against the synthesized peptide SEQ ID NO 4 will also recognise the epitope defined by the SEQ ID NO 3 present m the truncated form of the HER2 receptor (SEQ ID NO 1 or CTF-61 1 )
- SEQ ID NO 1 or CTF-61 1 the synthesized peptide used for immunisation consists of SEQ ID NO 2 which comprises all of the amino acids of tne CTF-611 receptor located sn the extracellular zone, the results with aniiDodies directed against this other peptide are equivalent and therefore useful for the same purpose
- the complete HER2 receptor comprises, close to the cell membrane, a structured region maintained by six disulphide bridges, indicated m FiG. 1 by connection lines between cysteines
- the truncated form CTF-61 1 or of sequence SEQ ID NO. 1 contains only five cysteines among wnich sai ⁇ dssjlphide bridges are established to stabilise tne homodimer ⁇ of this truncated form
- FIG 4 as a whole, one must conclude that the zone close io the ceil membrane of the truncated form of SEQ SD NO. 1 is antigemcally different from its equivalent in the complete HER2 receptor From this, it is derived that it can be detected differentially according to what has been previously indicated
- EXAMPLE 3 Detection of the presence of the HER2 fragment of sequence SEQ ID NO: 1 with monoclonal antibodies directed at neo-epitopes defined by SEQ !D NO- 2 or SEQ ID NO: 3
- monoclonal antibodies were obtained. From all of them, monoclonal antibody 20F4 produced by the hyb ⁇ doma cell line with access number DSM ACC2904 and monoclonal antibody 32H2 produced by the hybridoma cell line with access number DSM ACC2980 were selected. The results obtained with this antibody are shown tn FIG 5.
- FIG. 5A is a photograph of ihe membrane of the Western revealed with CB1 1 or with the monoclonal antibodies 20F4 and 32H2, one can see that the latter recognise specifically the truncated form of HER2 corresponding to the receptor CTF- 61 1 o f SEQ ID NO.
- the antibodies 20F4 and 32H2 are highly specific to CTF-611 and do not recognise the complete form of HER2, meaning that it can be used for the differential and highly selective detection of what form of the HER2 receptor is expressed in an isolated sample of tumour tissue,
- These epitopes are masked both in the soiubilized molecuSe and in intact cells
- Quantification of the different HER2 ssoforms in the CB1 1 , 32H2 and 20F4 immunprecipitates normalized to the amount of HER2 shows are as follows.
- EXAMPLb 5 Characterization of monoclonal antibodies against the N-terminus of 61 1 -CTF by smmunomstochernistry fmmunocytochemicai staining of MCF7 cells expressing HER2, 61 1 -CTF or 648-CTF with CBH an antibody against the cytoplasmic domain of HER2 or with two independent monoclonal a ⁇ tt-61 1 -CTF antibodies raised against the peptide MPIWKFPDEEGASQPSPINSTHSSVDLDDKGC (see Fig 1 ) was carried out The result is shown in Figure 7
- FIG. 8 Schematic showing the primary sequence of the juxtamembrane region of 61 1 - CTF. The N- and tne C- termini of the molecule are in ⁇ icated The transmembrane and the kinase domains a ⁇ e indicated by a ⁇ ashed and a grey box, respectively The sequence of diffeient deletion constructs in indicated See Figure 8(A)
- B MCF-7 cells transiently transfected with cDNA deletion constructs starting at the indicated amino acids were lysed Cell lysates were analyzed by Western blot with CB11 , an antibody against the cytoplasmic domain of HER2, o- with two independent monoclonal ant ⁇ -61 1-CTF antibo ⁇ ies iaised against the peptide MPIWKFPDEEGASQPSPINSTHSSVDLDDKGC See Figure 8(B) Conciusfo ⁇ s The epitopes recognized by the antibodies 32H2 and 20F4 are contained o ⁇ at ieast overlap
- mice have been instrumental in showing the oncogenic potential and relevance of HER2 in tumor progression.
- TG transgenic mice expressing 61 1 -CTF under the control of the mouse mammary tumor virus-long terminal repeat, which is preferentially active in the manmary gland.
- TG animals expressing 687-CTF.
- the levels of 61 1 -CTF expressed in the heterozygous TG 611 lines F3 and F2 were ⁇ equai to and 1/3 rd , respectively, the levels of endogenous HER2, while the level in F1 was below the detection threshold.
- the levels of 687-CTF m the homozygous lines developed varied from ⁇ double to half the levels of HER2 in the TG 687 lines F2 and F1 , respectively.
- EXAMPLE 9 611 -CTF expression leads to the development of aggressive mammary tumors Despite the more pronounced hyperplasia in TG HER2 mice, the three lines of TG 61 1 animais developed more aggressive tumors in terms of number of tumors per animal, tumor growth and tumor onset:
- TG HER2 mice developed lung metastasis. Three to six weeks after detection of tumors, - 1/4 sn of the TG HER2 animals had detectable nodules in the lun ⁇ s:
- Trp lie Pro Asp GIy Giu Asn Vai Lys lie Pro VaI Aia lie Lys VaI
- Leu Arg GIu Asn Thr Ser Pro Lys Ala Asn Lys Giu lie Leu Asp GIu 145 150 155 1 60 Ala Tyr VaI Met Ala Giy Vai GIy Ser Pro Tyr Vai Ser Arg Leu Leu
- SEQ ID NO: 2 Epitope of a truncated form of the human HER2 protein
- SEQ ID NO: 4 Synthetic peptide derived from an epitope of a truncated form of the human HER2 protein
- SEQ ID NO: 5 Synthetic peptide derived from an epitope of a truncated form of the human HER2 protein
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Engineering & Computer Science (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Cell Biology (AREA)
- Urology & Nephrology (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Zoology (AREA)
- Oncology (AREA)
- Food Science & Technology (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Wood Science & Technology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- General Chemical & Material Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Veterinary Medicine (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
Description
Claims
Priority Applications (18)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| ES09772265.6T ES2528132T3 (en) | 2008-06-02 | 2009-06-05 | Method for diagnosing cancers that express the HER2 receptor or its truncated variants |
| HRP20141158AT HRP20141158T1 (en) | 2008-06-02 | 2009-06-05 | Method for diagnosing cancers expressing a truncated her2 receptor variant |
| KR1020167032972A KR20160140974A (en) | 2008-06-02 | 2009-06-05 | Method for diagnosing cancers expressing the her2 receptor or its truncated variants |
| AU2009265921A AU2009265921B2 (en) | 2008-06-02 | 2009-06-05 | Method for diagnosing cancers expressing the HER2 receptor or its truncated variants |
| PL09772265T PL2293819T3 (en) | 2008-06-02 | 2009-06-05 | A method of diagnosing cancers expressing a truncated variant of the Her2 receptor |
| DK09772265.6T DK2293819T3 (en) | 2008-06-02 | 2009-06-05 | Method for Diagnosing Cancer Expressing a Truncated HER2 Receptor Variation |
| SI200931079T SI2293819T1 (en) | 2008-06-02 | 2009-06-05 | Method for diagnosing cancers expressing a truncated her2 receptor variant |
| HK11112126.9A HK1157658B (en) | 2008-06-08 | 2009-06-05 | Method for diagnosing cancers expressing the her2 receptor or its truncated variants |
| CA2727365A CA2727365A1 (en) | 2008-06-02 | 2009-06-05 | Method for diagnosing cancers expressing the her2 receptor or its truncated variants |
| CN200980126660.1A CN102202692B (en) | 2008-06-02 | 2009-06-05 | Method for diagnosing cancer expressing HER2 receptor or truncated form thereof |
| EP09772265.6A EP2293819B1 (en) | 2008-06-02 | 2009-06-05 | Method for diagnosing cancers expressing a truncated her2 receptor variant |
| JP2011512150A JP5753079B2 (en) | 2008-06-02 | 2009-06-05 | Methods for diagnosing cancers that express the HER2 receptor or truncated variants thereof |
| EA201001874A EA025218B1 (en) | 2008-06-02 | 2009-06-05 | A METHOD FOR DIAGNOSTIC MALIGNANT NUMER FORMATION, EXPRESSING THE HER2 RECEPTOR OR HIS REDUCED OPTIONS |
| BRPI0914969A BRPI0914969A2 (en) | 2008-06-02 | 2009-06-05 | method for diagnosing cancers expressing the her2 receptor or its truncated variants |
| KR1020117000466A KR101785117B1 (en) | 2008-06-02 | 2009-06-05 | Method for diagnosing cancers expressing the her2 receptor or its truncated variants |
| MX2010013419A MX2010013419A (en) | 2008-06-02 | 2009-06-05 | Method for diagnosing cancers expressing the her2 receptor or its truncated variants. |
| IL209769A IL209769A (en) | 2008-06-02 | 2010-12-05 | A method for diagnosing cancers that express the 2her receptor or its variants |
| ZA2010/09010A ZA201009010B (en) | 2008-06-02 | 2010-12-14 | Method for diagnosing cancers expressing the her2 receptor or its truncated variants |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| ES200801652A ES2342646B1 (en) | 2008-06-02 | 2008-06-02 | METHOD OF DIAGNOSIS OF CANCERES THAT EXPRESS THE RECEIVER HER-2 OR ITS TRUNCATED VARIANTS. |
| ESP200801652 | 2008-06-02 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2010000565A1 true WO2010000565A1 (en) | 2010-01-07 |
Family
ID=40911029
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2009/056976 Ceased WO2010000565A1 (en) | 2008-06-02 | 2009-06-05 | Method for diagnosing cancers expressing the her2 receptor or its truncated variants |
Country Status (20)
| Country | Link |
|---|---|
| US (1) | US8389227B2 (en) |
| EP (1) | EP2293819B1 (en) |
| JP (2) | JP5753079B2 (en) |
| KR (2) | KR20160140974A (en) |
| CN (1) | CN102202692B (en) |
| AU (2) | AU2009265921B2 (en) |
| BR (1) | BRPI0914969A2 (en) |
| CA (1) | CA2727365A1 (en) |
| CY (1) | CY1115798T1 (en) |
| DK (1) | DK2293819T3 (en) |
| EA (1) | EA025218B1 (en) |
| ES (2) | ES2342646B1 (en) |
| HR (1) | HRP20141158T1 (en) |
| IL (1) | IL209769A (en) |
| MX (1) | MX2010013419A (en) |
| PL (1) | PL2293819T3 (en) |
| PT (1) | PT2293819E (en) |
| SI (1) | SI2293819T1 (en) |
| WO (1) | WO2010000565A1 (en) |
| ZA (1) | ZA201009010B (en) |
Cited By (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2330131A1 (en) * | 2009-12-07 | 2011-06-08 | Fundació Privada Institució Catalana De Recerca I Estudis Avancats | Antibodies against HER2 truncated variant CTF-611 |
| EP2438442A4 (en) * | 2008-12-01 | 2013-04-03 | Lab Corp America Holdings | METHODS AND ASSAYS FOR MEASURING P95 AND / OR P95 IN SAMPLE AND SPECIFIC P95 ANTIBODIES |
| US9110066B2 (en) | 2009-01-15 | 2015-08-18 | Laboratory Corporation Of America Holdings | HER-3 antibodies and methods of use |
| CN110172448A (en) * | 2019-05-30 | 2019-08-27 | 中南大学湘雅二医院 | A kind of synovial sarcoma cells system hSS-005R and its progeny cell system |
| US10416162B2 (en) | 2007-12-20 | 2019-09-17 | Monogram Biosciences, Inc. | Her2 diagnostic methods |
| US10882918B2 (en) | 2016-09-30 | 2021-01-05 | Hoffmann-La Roche Inc. | Bispecific T cell activating antigen binding molecules |
| WO2021013950A1 (en) | 2019-07-23 | 2021-01-28 | Mnemo Therapeutics | Immune cells defective for suv39h1 |
| EP3915576A1 (en) | 2020-05-28 | 2021-12-01 | Fundació Privada Institut d'Investigació Oncològica de Vall-Hebron | Chimeric antigen receptors specific for p95her2 and uses thereof |
| WO2023126458A1 (en) | 2021-12-28 | 2023-07-06 | Mnemo Therapeutics | Immune cells with inactivated suv39h1 and modified tcr |
| WO2023222928A2 (en) | 2022-05-20 | 2023-11-23 | Mnemo Therapeutics | Compositions and methods for treating a refractory or relapsed cancer or a chronic infectious disease |
| WO2024062138A1 (en) | 2022-09-23 | 2024-03-28 | Mnemo Therapeutics | Immune cells comprising a modified suv39h1 gene |
Families Citing this family (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2002081649A2 (en) * | 2001-04-06 | 2002-10-17 | The Trustees Of The University Of Pennsylvania | ErbB INTERFACE PEPTIDOMIMETICS AND METHODS OF USE THEREOF |
| ES2342646B1 (en) * | 2008-06-02 | 2011-04-26 | Institut De Recerca Hospital Universitari Vall Hebron | METHOD OF DIAGNOSIS OF CANCERES THAT EXPRESS THE RECEIVER HER-2 OR ITS TRUNCATED VARIANTS. |
| NZ596468A (en) * | 2009-05-14 | 2013-11-29 | Nestec Sa | Biomarkers for determining sensitivity of breast cancer cells to her2-targeted therapy |
| CN103102414B (en) * | 2013-02-04 | 2014-08-27 | 无锡傲锐东源生物科技有限公司 | HER2-resistant protein monoclonal antibody and application thereof |
| US20160067307A1 (en) | 2013-05-01 | 2016-03-10 | Five Prime Therapeutics, Inc. | Methods of treating cancer |
| ES2809729T3 (en) | 2014-03-11 | 2021-03-05 | Molecular Templates Inc | Proteins comprising effector regions of the A subunit of Shiga toxin near the amino terminus and cell-recognition immunoglobulin-like binding regions capable of specifically binding HER2 / neu / ErbB2 |
| JP6935195B2 (en) | 2014-03-11 | 2021-09-15 | モレキュラー テンプレーツ, インク.Molecular Templates, Inc. | Protein containing binding region, effector region of Shiga toxin A subunit, and carboxy-terminal endoplasmic reticulum localization signal motif |
| EP3303373B1 (en) | 2015-05-30 | 2020-04-08 | Molecular Templates, Inc. | De-immunized, shiga toxin a subunit scaffolds and cell-targeting molecules comprising the same |
| KR20180030085A (en) | 2015-07-26 | 2018-03-21 | 몰레큘러 템플레이츠, 인코퍼레이션. | Cell-targeting molecule comprising a cytotoxin A subunit agonist and a CD8 + T-cell epitope |
| CN109476744B (en) * | 2016-05-12 | 2023-04-11 | 新加坡科技研究局 | anti-ERBB-2 antibodies and uses thereof |
| MX2019008840A (en) | 2017-01-25 | 2019-09-09 | Molecular Templates Inc | Cell-targeting molecules comprising de-immunized, shiga toxin a subunit effectors and cd8+ t-cell epitopes. |
| CN110612117B (en) | 2018-04-17 | 2024-04-12 | 分子模板公司 | HER2 targeting molecules comprising deimmunized shiga toxin a subunit scaffolds |
| CN110865184B (en) * | 2019-12-04 | 2023-04-07 | 广州医科大学附属第三医院(广州重症孕产妇救治中心、广州柔济医院) | Application of SRSP protein and SRSP epitope peptide and product for diagnosing and treating tumors |
| EP4077368A1 (en) * | 2019-12-18 | 2022-10-26 | Bracco Imaging SPA | Anti-her2 polypeptides derivatives as new diagnostic molecular probes |
| EP4253418A1 (en) | 2022-03-29 | 2023-10-04 | Fundació Privada Institut d'Investigació Oncològica de Vall-Hebron | Immune cells expressing chimeric antigen receptors and bispecific antibodies and uses thereof |
| KR20250147080A (en) * | 2024-04-03 | 2025-10-13 | 한국원자력의학원 | Radioisotope-labeled anti-HER2 antibody-chelator conjugate, pharmaceutical composition comprising the same, and method for producing the same |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1998006863A1 (en) * | 1996-08-14 | 1998-02-19 | The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services | A vector for polynucleotide vaccines |
| WO1999031140A1 (en) * | 1997-12-12 | 1999-06-24 | Genentech, Inc. | TREATMENT WITH ANTI-ErbB2 ANTIBODIES |
| WO2000069460A1 (en) * | 1999-05-14 | 2000-11-23 | Genentech, Inc. | TREATMENT WITH ANTI-ErbB2 ANTIBODIES |
| WO2001015730A1 (en) * | 1999-08-27 | 2001-03-08 | Genentech, Inc. | DOSAGES FOR TREATMENT WITH ANTI-ErbB2 ANTIBODIES |
| US7371376B1 (en) * | 1996-10-18 | 2008-05-13 | Genentech, Inc. | Anti-ErbB2 antibodies |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP3040121B2 (en) | 1988-01-12 | 2000-05-08 | ジェネンテク,インコーポレイテッド | Methods of treating tumor cells by inhibiting growth factor receptor function |
| DE69535673D1 (en) | 1994-08-30 | 2008-02-07 | Univ Dundee | MEANS FOR THE INDUCTION OF APOPTOSIS AND THERAPY APPLICATION |
| EP1653986A4 (en) * | 2003-08-01 | 2007-03-14 | Smithkline Beecham Corp | TREATMENT OF CANCERS EXPRESSING P95 SP ERBB2 / SP |
| JP2006316040A (en) * | 2005-05-13 | 2006-11-24 | Genentech Inc | HERCEPTIN® adjuvant therapy |
| ES2342646B1 (en) * | 2008-06-02 | 2011-04-26 | Institut De Recerca Hospital Universitari Vall Hebron | METHOD OF DIAGNOSIS OF CANCERES THAT EXPRESS THE RECEIVER HER-2 OR ITS TRUNCATED VARIANTS. |
| ES2637411T3 (en) * | 2008-12-01 | 2017-10-13 | Laboratory Corporation Of America Holdings | Methods and assays for measuring p95 Y / O p95 in a sample and antibodies specific for p95 |
-
2008
- 2008-06-02 ES ES200801652A patent/ES2342646B1/en not_active Withdrawn - After Issue
-
2009
- 2009-06-05 AU AU2009265921A patent/AU2009265921B2/en not_active Ceased
- 2009-06-05 CA CA2727365A patent/CA2727365A1/en not_active Abandoned
- 2009-06-05 PT PT97722656T patent/PT2293819E/en unknown
- 2009-06-05 DK DK09772265.6T patent/DK2293819T3/en active
- 2009-06-05 HR HRP20141158AT patent/HRP20141158T1/en unknown
- 2009-06-05 ES ES09772265.6T patent/ES2528132T3/en active Active
- 2009-06-05 PL PL09772265T patent/PL2293819T3/en unknown
- 2009-06-05 WO PCT/EP2009/056976 patent/WO2010000565A1/en not_active Ceased
- 2009-06-05 KR KR1020167032972A patent/KR20160140974A/en not_active Ceased
- 2009-06-05 KR KR1020117000466A patent/KR101785117B1/en not_active Expired - Fee Related
- 2009-06-05 EA EA201001874A patent/EA025218B1/en not_active IP Right Cessation
- 2009-06-05 CN CN200980126660.1A patent/CN102202692B/en active Active
- 2009-06-05 US US12/479,035 patent/US8389227B2/en active Active
- 2009-06-05 MX MX2010013419A patent/MX2010013419A/en active IP Right Grant
- 2009-06-05 BR BRPI0914969A patent/BRPI0914969A2/en not_active Application Discontinuation
- 2009-06-05 JP JP2011512150A patent/JP5753079B2/en not_active Expired - Fee Related
- 2009-06-05 EP EP09772265.6A patent/EP2293819B1/en active Active
- 2009-06-05 SI SI200931079T patent/SI2293819T1/en unknown
-
2010
- 2010-12-05 IL IL209769A patent/IL209769A/en not_active IP Right Cessation
- 2010-12-14 ZA ZA2010/09010A patent/ZA201009010B/en unknown
-
2014
- 2014-11-28 CY CY20141100995T patent/CY1115798T1/en unknown
-
2015
- 2015-05-21 JP JP2015103316A patent/JP2015214546A/en active Pending
- 2015-05-26 AU AU2015202854A patent/AU2015202854A1/en not_active Abandoned
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1998006863A1 (en) * | 1996-08-14 | 1998-02-19 | The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services | A vector for polynucleotide vaccines |
| US7371376B1 (en) * | 1996-10-18 | 2008-05-13 | Genentech, Inc. | Anti-ErbB2 antibodies |
| WO1999031140A1 (en) * | 1997-12-12 | 1999-06-24 | Genentech, Inc. | TREATMENT WITH ANTI-ErbB2 ANTIBODIES |
| WO2000069460A1 (en) * | 1999-05-14 | 2000-11-23 | Genentech, Inc. | TREATMENT WITH ANTI-ErbB2 ANTIBODIES |
| WO2001015730A1 (en) * | 1999-08-27 | 2001-03-08 | Genentech, Inc. | DOSAGES FOR TREATMENT WITH ANTI-ErbB2 ANTIBODIES |
Non-Patent Citations (3)
| Title |
|---|
| ANIDO JUDIT ET AL: "Biosynthesis of tumorigenic HER2 C-terminal fragments by alternative initiation of translation.", THE EMBO JOURNAL 12 JUL 2006, vol. 25, no. 13, 12 July 2006 (2006-07-12), pages 3234 - 3244, XP002540505, ISSN: 0261-4189 * |
| SÁEZ ROSANA ET AL: "p95HER-2 predicts worse outcome in patients with HER-2-positive breast cancer.", CLINICAL CANCER RESEARCH : AN OFFICIAL JOURNAL OF THE AMERICAN ASSOCIATION FOR CANCER RESEARCH 15 JAN 2006, vol. 12, no. 2, 15 January 2006 (2006-01-15), pages 424 - 431, XP002540504, ISSN: 1078-0432 * |
| SCALTRITI MAURIZIO ET AL: "Expression of p95HER2, a truncated form of the HER2 receptor, and response to anti-HER2 therapies in breast cancer.", JOURNAL OF THE NATIONAL CANCER INSTITUTE 18 APR 2007, vol. 99, no. 8, 18 April 2007 (2007-04-18), pages 628 - 638, XP002540506, ISSN: 1460-2105 * |
Cited By (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10416162B2 (en) | 2007-12-20 | 2019-09-17 | Monogram Biosciences, Inc. | Her2 diagnostic methods |
| US10273308B2 (en) | 2008-12-01 | 2019-04-30 | Laboratory Corporation Of America Holdings | Methods of producing antibodies specific for p95 |
| US9081019B2 (en) | 2008-12-01 | 2015-07-14 | Laboratory Corporation Of America Holdings | Methods and assays for measuring p95 and/or p95 complexes in a sample and antibodies specific for p95 |
| EP2438442A4 (en) * | 2008-12-01 | 2013-04-03 | Lab Corp America Holdings | METHODS AND ASSAYS FOR MEASURING P95 AND / OR P95 IN SAMPLE AND SPECIFIC P95 ANTIBODIES |
| US9766242B2 (en) | 2009-01-15 | 2017-09-19 | Laboratory Corporation Of America Holdings | Methods of determining patient response by measurement of HER-3 and P95 |
| US10775382B2 (en) | 2009-01-15 | 2020-09-15 | Laboratory Corporation Of America Holdings | Methods of determining patient response by measurement of HER-3 |
| US9110066B2 (en) | 2009-01-15 | 2015-08-18 | Laboratory Corporation Of America Holdings | HER-3 antibodies and methods of use |
| EP3048117A1 (en) * | 2009-12-07 | 2016-07-27 | Fundació Privada Institució Catalana de Recerca I Estudis Avançats | Antibodies against her2 truncated variant ctf-611 |
| EP2330131A1 (en) * | 2009-12-07 | 2011-06-08 | Fundació Privada Institució Catalana De Recerca I Estudis Avancats | Antibodies against HER2 truncated variant CTF-611 |
| US8741586B2 (en) | 2009-12-07 | 2014-06-03 | Fundacio Privada Institucio Catalana de Recerca i Estudis Avancats | Antibodies against HER2 truncated variant CTF-611 |
| EP2360187A1 (en) * | 2009-12-07 | 2011-08-24 | Fundació Privada Institució Catalana De Recerca I Estudis Avancats | Antibodies against HER2 truncated variant CTF-611 |
| US10882918B2 (en) | 2016-09-30 | 2021-01-05 | Hoffmann-La Roche Inc. | Bispecific T cell activating antigen binding molecules |
| CN110172448A (en) * | 2019-05-30 | 2019-08-27 | 中南大学湘雅二医院 | A kind of synovial sarcoma cells system hSS-005R and its progeny cell system |
| WO2021013950A1 (en) | 2019-07-23 | 2021-01-28 | Mnemo Therapeutics | Immune cells defective for suv39h1 |
| EP3915576A1 (en) | 2020-05-28 | 2021-12-01 | Fundació Privada Institut d'Investigació Oncològica de Vall-Hebron | Chimeric antigen receptors specific for p95her2 and uses thereof |
| WO2021239965A1 (en) | 2020-05-28 | 2021-12-02 | Fundació Privada Institut D'investigació Oncològica De Vall Hebron | Chimeric antigen receptors specific for p95her2 and uses thereof |
| WO2023126458A1 (en) | 2021-12-28 | 2023-07-06 | Mnemo Therapeutics | Immune cells with inactivated suv39h1 and modified tcr |
| WO2023222928A2 (en) | 2022-05-20 | 2023-11-23 | Mnemo Therapeutics | Compositions and methods for treating a refractory or relapsed cancer or a chronic infectious disease |
| WO2024062138A1 (en) | 2022-09-23 | 2024-03-28 | Mnemo Therapeutics | Immune cells comprising a modified suv39h1 gene |
Also Published As
| Publication number | Publication date |
|---|---|
| ZA201009010B (en) | 2012-03-28 |
| JP5753079B2 (en) | 2015-07-22 |
| ES2528132T3 (en) | 2015-02-04 |
| PL2293819T3 (en) | 2015-04-30 |
| ES2342646B1 (en) | 2011-04-26 |
| ES2342646A1 (en) | 2010-07-09 |
| EP2293819A1 (en) | 2011-03-16 |
| KR20160140974A (en) | 2016-12-07 |
| EA201001874A1 (en) | 2011-08-30 |
| BRPI0914969A2 (en) | 2015-10-20 |
| KR20110031187A (en) | 2011-03-24 |
| KR101785117B1 (en) | 2017-11-07 |
| HK1157658A1 (en) | 2012-07-06 |
| HRP20141158T1 (en) | 2015-02-13 |
| IL209769A0 (en) | 2011-02-28 |
| CN102202692B (en) | 2014-03-12 |
| JP2015214546A (en) | 2015-12-03 |
| AU2015202854A1 (en) | 2015-06-18 |
| US20090311262A1 (en) | 2009-12-17 |
| CA2727365A1 (en) | 2010-01-07 |
| DK2293819T3 (en) | 2014-12-08 |
| IL209769A (en) | 2016-04-21 |
| EP2293819B1 (en) | 2014-09-03 |
| CN102202692A (en) | 2011-09-28 |
| MX2010013419A (en) | 2011-08-15 |
| JP2011525175A (en) | 2011-09-15 |
| PT2293819E (en) | 2014-12-09 |
| EA025218B1 (en) | 2016-12-30 |
| US8389227B2 (en) | 2013-03-05 |
| CY1115798T1 (en) | 2017-01-25 |
| SI2293819T1 (en) | 2015-01-30 |
| AU2009265921B2 (en) | 2015-04-02 |
| AU2009265921A1 (en) | 2010-01-07 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US8389227B2 (en) | Method for diagnosing cancers expressing the HER2 receptor or its truncated variants | |
| US8741586B2 (en) | Antibodies against HER2 truncated variant CTF-611 | |
| WO2016171242A1 (en) | Detection of epha2 | |
| CN111406070A (en) | Antibodies for cancer diagnosis | |
| JP2024020436A (en) | HER2 targeting agent | |
| JP6958817B2 (en) | Anti-TMEM-180 antibody, anti-cancer drug, and cancer testing method | |
| TWI782000B (en) | Anti gpr20 antibodies, preparation method and application thereof | |
| US20210047418A1 (en) | Antibody against alpha-11 integrin and its use | |
| RU2815883C1 (en) | Antibodies useful in diagnosing cancer | |
| HK1157658B (en) | Method for diagnosing cancers expressing the her2 receptor or its truncated variants | |
| HK40119074A (en) | Antibodies useful in cancer diagnosis | |
| HK40085652B (en) | Antibodies useful in cancer diagnosis | |
| CA3186062A1 (en) | Cell surface mica and micb detection using antibodies |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 200980126660.1 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 09772265 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 209769 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011512150 Country of ref document: JP Ref document number: 2727365 Country of ref document: CA Ref document number: MX/A/2010/013419 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2009265921 Country of ref document: AU |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2009772265 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 201001874 Country of ref document: EA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 99/DELNP/2011 Country of ref document: IN |
|
| ENP | Entry into the national phase |
Ref document number: 20117000466 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2009265921 Country of ref document: AU Date of ref document: 20090605 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: PI0914969 Country of ref document: BR Kind code of ref document: A2 Effective date: 20101207 |

