WO2010000565A1 - Method for diagnosing cancers expressing the her2 receptor or its truncated variants - Google Patents

Method for diagnosing cancers expressing the her2 receptor or its truncated variants Download PDF

Info

Publication number
WO2010000565A1
WO2010000565A1 PCT/EP2009/056976 EP2009056976W WO2010000565A1 WO 2010000565 A1 WO2010000565 A1 WO 2010000565A1 EP 2009056976 W EP2009056976 W EP 2009056976W WO 2010000565 A1 WO2010000565 A1 WO 2010000565A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
seq
fragment
her2
her2 receptor
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2009/056976
Other languages
French (fr)
Inventor
Joaquín ARRIBAS LÓPEZ
Kim Pedersen
Pier-Davide Angellini
Josep Lluis Parra Palau
Sirle Laos
José BASELGA TORRES
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Institucio Catalana de Recerca i Estudis Avancats ICREA
Fundacio Privada Institut dInvestigacio Oncologica Vall dHebron
Fundacio Institut de Recerca Hospital Universitari Vall dHebron
Original Assignee
Institucio Catalana de Recerca i Estudis Avancats ICREA
Fundacio Privada Institut dInvestigacio Oncologica Vall dHebron
Fundacio Institut de Recerca Hospital Universitari Vall dHebron
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN200980126660.1A priority Critical patent/CN102202692B/en
Priority to EP09772265.6A priority patent/EP2293819B1/en
Priority to HRP20141158AT priority patent/HRP20141158T1/en
Priority to KR1020167032972A priority patent/KR20160140974A/en
Priority to AU2009265921A priority patent/AU2009265921B2/en
Priority to PL09772265T priority patent/PL2293819T3/en
Priority to DK09772265.6T priority patent/DK2293819T3/en
Priority to SI200931079T priority patent/SI2293819T1/en
Priority to HK11112126.9A priority patent/HK1157658B/en
Priority to JP2011512150A priority patent/JP5753079B2/en
Priority to ES09772265.6T priority patent/ES2528132T3/en
Application filed by Institucio Catalana de Recerca i Estudis Avancats ICREA, Fundacio Privada Institut dInvestigacio Oncologica Vall dHebron, Fundacio Institut de Recerca Hospital Universitari Vall dHebron filed Critical Institucio Catalana de Recerca i Estudis Avancats ICREA
Priority to CA2727365A priority patent/CA2727365A1/en
Priority to EA201001874A priority patent/EA025218B1/en
Priority to BRPI0914969A priority patent/BRPI0914969A2/en
Priority to KR1020117000466A priority patent/KR101785117B1/en
Priority to MX2010013419A priority patent/MX2010013419A/en
Publication of WO2010000565A1 publication Critical patent/WO2010000565A1/en
Priority to IL209769A priority patent/IL209769A/en
Anticipated expiration legal-status Critical
Priority to ZA2010/09010A priority patent/ZA201009010B/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/71Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3015Breast
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/5758Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/71Assays involving receptors, cell surface antigens or cell surface determinants for growth factors; for growth regulators

Definitions

  • Tne present invention relates to a method of diagnosis in isolated samples of cancers expressing the HER2 receptor.
  • the invention also provides compounds for use in the early diagnosis and identification of the cancer as well as for use in therapy
  • HER2 ⁇ also known as c-erbB2, ErbB2 or Neu ss a type i transmembrane protein belonging to the family of epidermal growth factor receptors or EGFR, also known as HER1 or ErbB1 .
  • Two additional members, HER3 and HER4 complete this family When HER1 , 3 or 4 binds to an EGF-type ligand, its extracellular domain adopts the conformation referred to as "open", which allows the formation of homodimers and heterodimers. Even if it does not bind to any ligand, HER2 also interacts with other HER receptors linked to a ligand, due to the fact that its extracellular domain is con ⁇ tifutively in "open" conformation
  • the dime ⁇ sation directed by the extracellular domain leads to interaction of tne intracellular kinase of HER receptors and to the subsequent transphosphorylation of some tyrosine residues.
  • These phosphotyrosmes act as couplers of a group of intracellular phosphotyrosine-binding proteins
  • the interactions established at the plasmatic membrane are transduced to the cell nucleus by means of different signalling routes, such as the protein kinase route activated by mitogen activated protein kinase (MARK), the protein kinase route activated by stress (JNK), phosphoiipase C gamma, etc.
  • All of these signalling circuits control tne expression of genes that act in a coordinated way to modify determining aspects of the state of the cell, such as eel! proliferation, migration, survival and adhesion.
  • eel! proliferation e.g., proliferation, migration, survival and adhesion.
  • activation of the HER receptors results in a dramatic cell response, which can range from transformation into a malignant cell to a premature senescence.
  • the HER receptors or fragments tnereof can be endocyted and transported to the nucleus, where they can directly regulate the expression of certain genes. This fact has been observed for the specific case of HER2 (Wang et al,, "Binding at and transactivat ⁇ on of tne COX-2 promoter oy nuclear tyrosine kinase receptor ⁇ rbB-2". Cancer Ceil-2004, Voi. 6, pp 251 -261 ).
  • CTF carboxy terminal fragment
  • ft is very important to be able to detect the presence of HER2 in tumours on time and even more to determine wnether it is in a complete or truncated (CTF) form.
  • the recommended therapy consists of administering therapeutic monoclonal antibodies, such as Genentecn ' s trastuzumab.
  • therapeutic monoclonal antibodies such as Genentecn ' s trastuzumab.
  • the use of this monocsonai antibody for the treatment of cancer is described in the apDiication WO 8906692 on oehalf of Genentech.
  • WO 8906692 describes monoclonal or polyclonal antibodies directed against the extracellular region of HER2. this extracellular region matching with the complete external part of the protein, which ss its N-terminal end.
  • the epitopes recognised by the antibodies cited in WO 8906692 are antigenic regions of the extracellular domain of the HER2 complete form and are not included in truncated forms or carboxy terminal fragments of HER2. Therefore, with the antibodies and the diagnosis method described in WO 8906692 it will not be possible to defect the presence of truncated HER2 (CTFs). Also, in breast tumours where sad CTFs of HER2 are expressed, antibodies sucn as trastuzumao are not therapeutic, since they do not recognise any epitope. This fact explains tne resistance to the treatment with trastuzumab observed in patients expressing truncated forms (CTFs) of HER2
  • CTFs truncated HER2
  • This new detection method can be carried out on sections of tissue embedded in paraffin and fixed with formalin following clinical protocols
  • the new methodology arises from observing that the truncated form p95H ⁇ R2, and not the entire form of the receptor, ss tocated in both the plasmatic membrane and the cytoplasm of the cell
  • This metnod proposes comparing whether there is expression of p95HER2 by means of staining the detected cytoplasm with an ant ⁇ -HER2 antibody that binds the receptor's cytoplasmic domain, and confirming these results with those of a detection with an ant ⁇ -cytokeratin antibody, a protesn whose distribution has been extensively used as a tool for the diagnosis of tumours.
  • this method efficiently distinguishes those tumours expressing the complete form of HER2 from those that express the truncated forms
  • the present invention offers benefits related to the problems cited above and represents a novel solution in the early classification of cancer specifically breast cancer
  • CTF-611 This HER2 truncated form (CTF-611 ) has been identified and found to have the sequence SEQ ID NO:1 .
  • Thss sequence has been used to develop several tools for detecting its presence in tissue samples, thus providing a new and solid diagnosis set that is aiso applicable in clinical routine
  • the present invention also provides new antibodies, or fragments thereof, that recognise this truncated form or CTF of HER2, which ss not recognised by trastuzumab These antibodies recognize an epitope being defined by a se ⁇ uence included in SEQ ID NO 2
  • the invention also provides hyb ⁇ doma ceil lines suitable for producing such antibodies Ants-HER2 antibo ⁇ ies currently available recognize CTFs and HER2 or only HER2, making it very difficult to discriminate patients expressing only HER2 from patsens expressing HER2 and CTFs
  • the antibodies described here preferentially bind to CTF-61 1 allowing to identify patients expressing this CTF
  • the present invention also refers to a method of cancer diagnosis in patient samples which comprises the detection of the presence in said sample of the HER2 receptor truncated form consisting of SEQ ID NO 1
  • the present invention also provides the use of the antibody or fragment thereof of the present invention for the diagnosis and determination of prognosis in isolated samples of cancers where the HER2 receptor ⁇ S expressed
  • the present invention further provides an agent of diagnosis and determination of prognosis in isolated samples of cancers where the HER2 receptor and/or C-terminal fragments is expressed which compi ise ⁇ at least one aniiDody or a fragment tnereof as described above
  • the present invention also provides a kit of diagnosis and determination of prognosis in isolated samples of cancers where the HER2 receptoi is expressed, that comprises means for detecting the presence in said sample of the HER2 receptor truncated form consisting of the SEQ ID NO 1
  • the invention also provides an antibody or a fragment thereof as described above ⁇ or use m therapy or in the manufacture of a medicament
  • the medicament is for the treatment or prevention of cancers where at least the HER2 receptor truncated form consisting of the SEQ ⁇ D NO 1 is expressed
  • the use of antibodies or rragrnents is foi the manufacture of a medicament for treating or preventing breast cancers in mammals, including human beings
  • Another object of the present invention is a pharmaceutical composition for the treatment of cancers wherein at least the HER2 receptor truncated form consisting of SEQ ID NO 1 is expressed, which comprises an antibody or a fragment thereof as described above and at least one pharmaceutically acceptable excipient and/or vehicle.
  • FIG. 1 Diagram of the protein sequence of the truncated form CTF-61 1 , compared with the sequence of the complete H ⁇ R2 receptor and with the truncated form known as p95 (648-CTF/p95), product of the proteolysis by aipha-secretases
  • the transmembrane domain is represented as a nelicoidal line.
  • the remaining molecule is indicated with a grey box.
  • the sequence of the peptide used to generate mono and polyclonal antibodies appears underlined.
  • the positions of intramolecular dssulphsde bridges are also indicated with connections oetween the cysteines.
  • FI3 2 Electrophoresis and Wesiern-blot (transfer to membrane) of Dreast cancer samples.
  • S means soluble fraction and
  • JvI membrane fraction, in order to detect complete HER2 and the CTF-61 1 form, antibodies directed to the cyroplasmic domain of the proteins were used.
  • DHL- Lacatafe dehydrogenase (used as control)
  • FiG. 3 Results of the evaluation of the numoer of tumours developed in Transgenic mice tnat express the truncated CTF-61 1 (FIQ 3A) form in comparison with transgenic mice that express the complete HER2 receptor; and the results of the volume of detected tumours (FIG. 3B) On the Y axis, N and V mean Number of Tumours and Volume of Tumours, respectively On the X axis, T refers to Time in weeks.
  • FIG. 4A shows an electrophoresis and Western-Blot (transfer to membrane) revealed with an antibody (CB11 ) that recognises the cytoplasmic domain of the HER2 receptor (common domain in all complete and truncated forms) or with polyclonal antibodies generated against the peptide of SEQ ID NO. 3 ( ⁇ -61 1 -A and ⁇ - 61 1 -B)
  • the tracks correspond to MCF7 cell iysate extracts (previously transformed with the constructions of FIG. 1 ) that express the complete form of the HER2 receptor, the CTF-611 truncated form and p95 truncated form.
  • FIG 4B shows the result of an immunoprecipitation test with the antibodies os-61 1 -A 1 ⁇ -61 1 -B and CB1 1 carried out on samples containing both the complete HER2 receptor as well as the truncated forms CTF-61 1 and p95
  • FIG 5 MCF7 celis expressing HER2, 611 -CTF or 648-CTF were lysed and analyzed by Western blot with CB1 1 , an antibody against the cytoplasmic domain of HER2, or with two independent monoclonal ant ⁇ -61 1 -CTF antibodies raised against the peptide MPIWKFPDEEGASQPSPiNSTHSSVDLDDKGC (see Fig 1 ⁇
  • B The lysates from MCF7 cells expressing H ⁇ R2 S 61 1 -CTF or 648-CTF were mixed 1 1 -1 and subjected to immunoprecipitation with the indicated monoclonal antibodies Washed immunoprecipitates were analyzed by Western biot with the CB1 1 antibody As a negative control a mock immunoprecipitation with no antibody (-) was performed
  • C MCF7 cells expressing HER2 61 1 -CTF or 648-CT ⁇ were analyzed in a confocal microscope by indirect immunofluorescence with the indicated
  • FIG S- Characterization of epitopes Fig 8 ⁇ A Graph showing the primary sequence of the juxtamembrane region of 61 1-CTF and the se ⁇ uence of the different constructs used to map tne epitopes- Fig 8(B) Western blots
  • FIG 9 Analysis of breast cancer samples Fig 9(A) Table with analytical results Fig 9(B) immunocytochemica! staining
  • FIG 3 shows the results of the evaluation of the numoer of tumours ⁇ eveloped in transgenic mice expressing tne truncated form CTF-61 1 (SEQ ID NO 1 )
  • cDNA constructs were expressed in the breast epithelium of mice, said constructs coding the human SEQ ID NO: 1 (CTF- 61 1 ), identified in the figure as M61 1 -CTF
  • This construct comprises the SEQ ID NO- 1 under control of the promoter of the mouse mammary tumour virus (MMTV),
  • MMTV mouse mammary tumour virus
  • FVB/N-Tg(MMTVneu)202J that expresses the complete form of HER2 was used, also under control of the MMTV promoter.
  • tumours in mice expressing the cDNA construct with the CTF-611 form (SEQ ID NO: 1 ) is much higher than the one of the FVB/N- Tg(MMTVneu)202J line, identified in this figure with the designation HER2/neu.
  • the tumours tn the transgenic animals were detected at 17 weeks of age of the transgenic animals expressing CTF-611 , which represents three months before the first detection in FVB/N-Tg ⁇ MMTVneu)202J mice. This fact would explain the greater aggressiveness of tumours that express HER2 fragments in relation to those tumours that express the complete form.
  • FIG 3B also shows that the volume of the tumours is much greater in the animals expressing the CTF truncated form of HER2 with SEQ ID NO 1 , in relation to those animals expressing constitutive!;/ the whole receptor, also known as HER2/neu
  • This second fact also explains tne greater aggressiveness of this type of tumours
  • the inventors also determined that those tumours expressing the truncated form of se ⁇ uence SEQ ID NO- 1 showed higher lung metastasis indices than those observed in tne umours bxpre&tsng H ⁇ R2/neu. Furtner experiments proving the clinical relevance are provided in Example 9 below.
  • said SEQ ID NO' 1 includes all variants derived from allelic vaisanons between individuals, which entail variations in number and type, of some amino acids, such as more or less than two or three amino acids, or the replacement of an amino acid by another one which does not modify the overall receptor s structuie.
  • HER2 can contain neo-epitopes, in other words, new antigenic determinants not present in the molecule of the whole receptor, meaning that they ⁇ o not interact sn the same way With the molecules as with the whole receptor (antibodies, medicaments, etc.).
  • Antibodies to CTF-611 can contain neo-epitopes, in other words, new antigenic determinants not present in the molecule of the whole receptor, meaning that they ⁇ o not interact sn the same way With the molecules as with the whole receptor (antibodies, medicaments, etc.).
  • the inventors could produce both polyclonal and monoclonal antibodies to CTF-611 These antibodies recognize an epitope that is defined by a sequence included m SEQ ID NO 2, preferably by a sequence included in or defined by SEQ ID NO 3 Most preferred are antioodies that recognize an epitope that is included in or defined by MPiWKFPDEEGAS (SEQ ID NO 5).
  • epitope is understood to mean the part of a pepffdic type macromolecule (or of an antigen), whose sequence and/or spatial configuration is recognsse ⁇ by the immune system (antibodies, T cells, B cells)
  • the antibodies of the present invention can preferably distinguish the protein of SEQ ID NO 1 from the HER2 receptor. Furthermore, the antibodies of the present invention can preferably distinguish the protein of SEQ ID NO 1 from the HER2 receptor truncated form 648-CTF/p95 Tn ss distinction can be visualized by one or more of immunofluorescence, flow cytometry, immunohistochemistry in cultured cells and immunoh ⁇ stochemistry in samples from patients. It is particularly D referred that the distinction can oe quantified bom m flow cytometry and immunoprecipitation
  • the binding of tne antibodies of the present invention to 61 1 -CTF is preferably at least 300 times, more preferaoly at least 1000 times, most preferably 1000 to 2000 times stronger than tnejr binding to HER2 in an immunoprecipitation experiment, as described in more detail in Example 3 (using 5 microgram of 32H2 and 5 microgram of 20F4),
  • the antibody can be polyclonal or monoclonal,
  • polyclonal antibody 1' shaSI De understood to mean the group of antioodies produced by different B cell lines (B lymphocytes) Polyclonal antibodies are mixtures of immunoglobulins secreted against an antigen (macromolecule), each one of these immunoglobulins being capable of recognising a difrerent epitope, since it comes from a different B cell.
  • polyclonal antibodies there is a type of immunoglobulin that iecognises the epitope oi epitopes of interest of a specific antigen
  • Polyclonal antibodies can be produced for example by conjugating the peptide of SEQ ID NO 2, SEQ ID NO 3 SEQ ID NO 4 or SEQ ID NO 5 with an immunogen such as Keyhoie-iimpet hemocyanin and immunising rabbits with this conjugate
  • Monoclonal antibodies can be produced using the same or Similar ⁇ mmunogens Hybridoma cell lines can be produced in a manner known to the skilled person The hyb ⁇ doma cell line can then be grown in a suitable culture medium from which the monoclonal antibody is recovered
  • they are produced by the hybridoma cell line deposited with the 'Deut ⁇ chland Sarnmlung von Mikroorga ⁇ ismen und Zelikulturen GmbH - DSMZ' with access number DSM ACC2904 in accordance with the Ti eaty of Budapest of 9 April 2008 or the hybridoma cell line deposited with the "Deutschland Sammiung von M ⁇ kroorgamsmen und Zelikulturen GmbH - DSMZ" with access numoei DSM ACC2980 in accordance with the Treaty of Budapest of 6 November 2008
  • Monoclonal antibodies produced with these hybridoma cell lines, as we J i as monoclonal antioo ⁇ ses ihai are Tunctionaily at ⁇ east equivalent are particularly preferred Functionally at least equivalent are those antioodies that can discriminate between CTF-611 and HER2 equally well or even better
  • Useful antibodies also include humanized and human antibodies
  • the present invention thus also provides the isolated peptides of sequence SEQ ID NO 2 SEQ !D NO 3, SEQ ID NO 4 or SEQ ID NO 5
  • a fragment thereof may be used according to the present invention
  • the antibody fragments are selected from the group comprised by F(ab) F(ab') and Fv
  • a fragment of an antibody refers to a part of the antibody which is of enough size and appropriate structure to bind to an epitope present in the HER2 receptoi truncated form and thus permit its detection in a sample
  • Examples 2 and 3 show specific antibodies Evt ⁇ ently the invention extends to othe r polyclonal oi monoclonal antibodies directed agasnst the epitope of the CTF-61 1 truncated form whfch is defined by the sequences SEQ ID NO 2 and SEQ ID NO 3, since, on the basis of the teachings of this invention they can be directly derived for a skilled in the art Equally, the invention extends to fragments of said antibodies, such as F(ab), F(ab'), Fv, etc or any hybridoma cell line capable of producing monoclonal antibodies directed against the peptides of SEQ ID NO:2 and SEQ ID NO- 3
  • the detection of the presence of the HER2 receptor truncated form may be carried out through means independently selected from the group comprised by detection by differential migration in a mobile phase - stationary phase system of the HER2 receptor truncated form consisting of SEQ ID NO. 1 in respect of the complete form of said HER2 receptor- and detection by binding with specific antibodies of the HER2 receptor truncated form containing the SEQ ID NO: 1
  • Detection through differential migration should be understood to mean, in the context of the present invention, any analytical technique that allows separation of the compounds to be detected on the basis of then different mobility in a specif, c mobile phase - stationary pnase system, such as an electrophoresis.
  • Such different mobility may be caused by a different electrical charge m tne compound, different molecular weight, or different affinity for other compounds.
  • Tnis differential detection can be carne ⁇ out through analytical techniques known by the skilled in the art sucn as protein electrophoresis, molecular exclusion cnromaiographies, antibody affinity tests, immunofluorescence immunocytochemistry, immunonsstochemistry, flow cytometry, etc Particularly preferred is immunohistochemistry
  • immunohistochemistry One or more of these methods can be combined to enhance reliability
  • HER2 receptor truncated form consisting of SEQ iD NO 1 also referred to in this invention as CTF-611
  • CTF-611 Differential detection of the HER2 receptor truncated form consisting of SEQ iD NO 1 , also referred to in this invention as CTF-611 , in respect of the whole or complete HER2 receptor, implies being able to visualise two proteins with different molecular weights and different sequences as can be desired from FIG. 1.
  • the truncated form with SEQ iD NO: 1 consists of the protein resulting from the alternative initiation of translation through methionine 61 1 of the complete sequence of the HER2 receptor
  • This form or CTF tnus comprises a new extracellular domain, a transmembrane fragment and a cytosoiic domain
  • the transmembrane fragment and the cytosoiic domain are the same as those of the complete form of the HER2 receptor.
  • Another truncated form corresponds to the one of FIG 1 referred to as p95 or CTF-648
  • This last form is the product of the action of the alpha-secretases on the complete HER2 receptor, which divide a large part of the extracellular domain.
  • the step of detecting the presence in the sample of the HER2 receptor truncated form consisting of SEQ ID NO. 1 comprises the detection with at least one antibody as defined above
  • the method of diagnosis according to the invention comprises the detection of fne epitope defined by SEQ ID NO 3.
  • the antibodies or fragments thereof of the present invention are used as agents for the diagnosis and determination of prognosis, either directly marked in their own oeptidic sequence (for example with radioisotopes) or indirectly (for example by addition or binding a fluorescent agent or an agent capable of producing fluorescence Dy reaction in a selected reaction medium), all of the above with the aim of generating a visible signal, and ⁇ f possible ⁇ uantifiable. with which to detect the presence of the HER2 receptor truncated form consisting of the sequence SEQ ID NQ 1 in a sampi ⁇
  • diagnosis agent containing at least the antibodies to De adnered to a solid support, ⁇ irectly or indirectly by means of a spacer arm.
  • An agent of this type allows capturing or the form of sequence SEQ ID NQ: 1 o ⁇ a sample, in order to determine its presence afterwards with other non-specific antiDodies (such as CB1 1 )
  • Tne agents of diagnosis and determination of prognosis according to the invention can also be applie ⁇ in immunohisiochemistry protocols
  • the (primary or secondary) monoclonal or polyclonal antibodies must be duly marked to give a visible signal, and in the best of cases quantifiable, once they have come into contact with the tested tissue and they have been allowed to interact witn the proteins intended fo ⁇ detection, in other words, with the CTF fragment of HER2 of sequence SEQ ID NO 1
  • the ⁇ iagnosistic agent is provided in the form of a kit which includes, besides the antibodies, the reagents (e.g.
  • This kit may also comprise a means for carrying out a semiquantitative immunohistochemical assay for the determination of HER2 (such as HerceptestTM)
  • the invention provides a kit for diagnosis and determination of the prognosis whfch comprises at least one antibody or a fragment thereof, sad antibody or fragment being capable of recognising the epitope defined by SEQ ID NO 2 or SEQ ID NO 3 or SEQ ID NO-S, in addition to the reagent means and buffers suitable for carrying out the interaction of the antibody with the epitope and that are extensively known by those skilled in the art
  • the diagnostic method of the present invention, and tne kit of the present invention may ailow the prediction of nodal metastasis, poor prognosis, and resistance to
  • kit also object of the invention comprises all the necessary means for carrying out detection through differentia! migration of the HER2 receptor truncated form conststsng of the se ⁇ uence SEQ [D NO 1 in relation to the complete form of the HER2 receptor
  • cancers that express the HER2 recepio 1 or its truncated variants breast cancer stands out.
  • Other cancers where these proteins are aiso expressed include the cancer of lung, pancreas, coion, stomach piostate, nead and neck, skin kidney, testicle, thyroids, u ⁇ naiy bladder, uterus vulva endometrial, ovary, oesophagus, mouth, sanvaiy gland, larynx, peritoneum, nose and throat region, Fallopian tubes, Wilms tumors as welf as lymphomas, Swing sarcomas, synovial sarcoma, medulloblastomas, trophoblastic tumors, glyomas, glyoblastomas cnolangiocarcsnomas, cholesteatoma, chondrosarcoma ependymoma, neu ⁇ lemmomas, neuromas, rhabdomy
  • the antibodies of the present invention, or fragments thereof, are also useful in therapy, particularly in the therapy of cancer, particularly those cancers that express the H ER2 receptor or its truncated variants Humanized and human antibodies and fragments thereof, are preferred
  • the antibodies of this invention are used also in pharmaceutical compositions useful for the treatment of cancers in which at ieast the HER2 receptor truncated form consisting of SEQ ID NO 1 is expressed
  • the composition comprises those pharmaceutically acceptable vehicles or excioients and at ieast one antibody that recognises the epitope defined by the se ⁇ uences SEQ ID NO 2 or SEQ ID NO 3
  • the pharmaceutical composition may aiso comprise a mixture of antibodies that, besi ⁇ es an antibody of the present invention, contains otner antibodies against HER2 or fragments thereof, such as HerceptinTM
  • Ceiis MCF7 Tet-Off cells (BD bioscience) were maintained at 37 0 C and 5 " % C 10 CO2 m DMEM/F-12 (1 1 )(G ⁇ bco) containing 1 0% FBS (Gibco), 4mM L- Giutamme (PAA Laboratories) 0 2mg/mi G41 8 (Gibco) and 1 ⁇ g/m! doxycycline (Sigma). Cells were transfected with the various expression pias ⁇ nds by using FuGENES (Roche).
  • MCF7 cells expressing HER2, 61 1 -CTF or 648- were washed at 4 0 C with PBS and detached m PBS containing 5mM of EDTA. Detached cells were incubated with 10 ⁇ g/ml of anti-32H2 monoclonal antibody in PBS containing 5% BSA for 30 mm at 4°C washed and stained for 30 ram at 4 0 C with F ⁇ TC-conjugated anti- mouse IgG (Becton-Dickinson) in PBS containing 5 % BSA, Flow cytometry was done on a FACscan using FACscan Research software (Becton Dickinson lmmunocytometry Sys., Mountain View. CA).
  • MCF7 cells exoressing H ⁇ R2, 611 -CTF or 648- were washed at 4 c C with PBS and detached in PBS containing 5mM of EDTA. Then, cells were cent ⁇ fuged and cell pellets were fixed in 10% neutral formalin, dehydraied and embedded in paraffin. Sections from cetf peiieis ot from human tissues o* a thickness of 4 ⁇ m were placed on poiy-lysine-coate ⁇ glass sli ⁇ es. lmmunohistochemistry analyses were performed using the following protocol:
  • Envision Flex Wash Buffer 10x DM 81 1. Envision Flex Target Retrieval Solution High Ph 1 0x DM 812 Envision Fiex+ Mouse ( linker) SM 84 Peroxidase 5 mm and wash with washing buffer. Protein Block 5% 15-20 mm Wash with washing buffer
  • mice TG 611 and TG 687 mice were engineered by cloning the sequences encoding 687- CTF and 611 -CTF into the multiple cloning site Il downstream of the Rous sarcoma virus enhanced mouse mammary tumor virus long terminal repeat of the plvlB vector (a kind gift from Dr.
  • Mammary glands were mounted on glass slides, fixed overnight in 4% paraformaldehyde and transferred to 70% ethanol. The slides were rinsed in water for 5 5m ⁇ n and stained in a filtered solution of 0 2% carmine for 24hours Giands were tnen dehydrated sequentially with decreasing concentrations of etnanoi, then defatted and stored in methyl salicylate For histological analysis, fixed glands were blocked in paraffin, sectioned, and stained with hematoxylin and eosin.
  • EXAMPLE 1 Deiection of the fragment of SEQ ID NO 1 through differential migration.
  • FIG. 2 which corresponds to an image of an electrophoresis gel and subsequent Western-type transfer (Western-blot)
  • different samples cr bieast cancer 108, 114,
  • FIG 2 therefore shows that detection of the type of truncated forms of the HER2 receptor can be carried out through a protein electrophoresis analysis. Furthermore, the presence of a ⁇ rag ⁇ sent of HER2 of sequence SEQ ID NO' 1 is indicative of a certain type o f cancer, in the case of the example, breast cancer, which needs to be 0 evaluated and treated as an in ⁇ ividual case within the cancers that express HER2
  • EXAMPLE 2 Detection of the presence of the HER2 fragment of se ⁇ uence SEQ !D NO 1 with polyclonal antibodies directed to neo-epitopes defined by the SEQ ID NO: 2 or SEQ ID NO: 3. 5
  • SEQ ID NO 4 corresponds therefore io a peptide equivalent to that of SEQ ID NO 3 although adapted in order to carry out the immunisation technique
  • the antibodies directed against the synthesized peptide SEQ ID NO 4 will also recognise the epitope defined by the SEQ ID NO 3 present m the truncated form of the HER2 receptor (SEQ ID NO 1 or CTF-61 1 )
  • SEQ ID NO 1 or CTF-61 1 the synthesized peptide used for immunisation consists of SEQ ID NO 2 which comprises all of the amino acids of tne CTF-611 receptor located sn the extracellular zone, the results with aniiDodies directed against this other peptide are equivalent and therefore useful for the same purpose
  • the complete HER2 receptor comprises, close to the cell membrane, a structured region maintained by six disulphide bridges, indicated m FiG. 1 by connection lines between cysteines
  • the truncated form CTF-61 1 or of sequence SEQ ID NO. 1 contains only five cysteines among wnich sai ⁇ dssjlphide bridges are established to stabilise tne homodimer ⁇ of this truncated form
  • FIG 4 as a whole, one must conclude that the zone close io the ceil membrane of the truncated form of SEQ SD NO. 1 is antigemcally different from its equivalent in the complete HER2 receptor From this, it is derived that it can be detected differentially according to what has been previously indicated
  • EXAMPLE 3 Detection of the presence of the HER2 fragment of sequence SEQ ID NO: 1 with monoclonal antibodies directed at neo-epitopes defined by SEQ !D NO- 2 or SEQ ID NO: 3
  • monoclonal antibodies were obtained. From all of them, monoclonal antibody 20F4 produced by the hyb ⁇ doma cell line with access number DSM ACC2904 and monoclonal antibody 32H2 produced by the hybridoma cell line with access number DSM ACC2980 were selected. The results obtained with this antibody are shown tn FIG 5.
  • FIG. 5A is a photograph of ihe membrane of the Western revealed with CB1 1 or with the monoclonal antibodies 20F4 and 32H2, one can see that the latter recognise specifically the truncated form of HER2 corresponding to the receptor CTF- 61 1 o f SEQ ID NO.
  • the antibodies 20F4 and 32H2 are highly specific to CTF-611 and do not recognise the complete form of HER2, meaning that it can be used for the differential and highly selective detection of what form of the HER2 receptor is expressed in an isolated sample of tumour tissue,
  • These epitopes are masked both in the soiubilized molecuSe and in intact cells
  • Quantification of the different HER2 ssoforms in the CB1 1 , 32H2 and 20F4 immunprecipitates normalized to the amount of HER2 shows are as follows.
  • EXAMPLb 5 Characterization of monoclonal antibodies against the N-terminus of 61 1 -CTF by smmunomstochernistry fmmunocytochemicai staining of MCF7 cells expressing HER2, 61 1 -CTF or 648-CTF with CBH an antibody against the cytoplasmic domain of HER2 or with two independent monoclonal a ⁇ tt-61 1 -CTF antibodies raised against the peptide MPIWKFPDEEGASQPSPINSTHSSVDLDDKGC (see Fig 1 ) was carried out The result is shown in Figure 7
  • FIG. 8 Schematic showing the primary sequence of the juxtamembrane region of 61 1 - CTF. The N- and tne C- termini of the molecule are in ⁇ icated The transmembrane and the kinase domains a ⁇ e indicated by a ⁇ ashed and a grey box, respectively The sequence of diffeient deletion constructs in indicated See Figure 8(A)
  • B MCF-7 cells transiently transfected with cDNA deletion constructs starting at the indicated amino acids were lysed Cell lysates were analyzed by Western blot with CB11 , an antibody against the cytoplasmic domain of HER2, o- with two independent monoclonal ant ⁇ -61 1-CTF antibo ⁇ ies iaised against the peptide MPIWKFPDEEGASQPSPINSTHSSVDLDDKGC See Figure 8(B) Conciusfo ⁇ s The epitopes recognized by the antibodies 32H2 and 20F4 are contained o ⁇ at ieast overlap
  • mice have been instrumental in showing the oncogenic potential and relevance of HER2 in tumor progression.
  • TG transgenic mice expressing 61 1 -CTF under the control of the mouse mammary tumor virus-long terminal repeat, which is preferentially active in the manmary gland.
  • TG animals expressing 687-CTF.
  • the levels of 61 1 -CTF expressed in the heterozygous TG 611 lines F3 and F2 were ⁇ equai to and 1/3 rd , respectively, the levels of endogenous HER2, while the level in F1 was below the detection threshold.
  • the levels of 687-CTF m the homozygous lines developed varied from ⁇ double to half the levels of HER2 in the TG 687 lines F2 and F1 , respectively.
  • EXAMPLE 9 611 -CTF expression leads to the development of aggressive mammary tumors Despite the more pronounced hyperplasia in TG HER2 mice, the three lines of TG 61 1 animais developed more aggressive tumors in terms of number of tumors per animal, tumor growth and tumor onset:
  • TG HER2 mice developed lung metastasis. Three to six weeks after detection of tumors, - 1/4 sn of the TG HER2 animals had detectable nodules in the lun ⁇ s:
  • Trp lie Pro Asp GIy Giu Asn Vai Lys lie Pro VaI Aia lie Lys VaI
  • Leu Arg GIu Asn Thr Ser Pro Lys Ala Asn Lys Giu lie Leu Asp GIu 145 150 155 1 60 Ala Tyr VaI Met Ala Giy Vai GIy Ser Pro Tyr Vai Ser Arg Leu Leu
  • SEQ ID NO: 2 Epitope of a truncated form of the human HER2 protein
  • SEQ ID NO: 4 Synthetic peptide derived from an epitope of a truncated form of the human HER2 protein
  • SEQ ID NO: 5 Synthetic peptide derived from an epitope of a truncated form of the human HER2 protein

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Engineering & Computer Science (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Cell Biology (AREA)
  • Urology & Nephrology (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Zoology (AREA)
  • Oncology (AREA)
  • Food Science & Technology (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Wood Science & Technology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • General Chemical & Material Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Veterinary Medicine (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

The present invention relates to a method of diagnosis and therapy of cancers expressing the HER2 receptor. The invention provides antibodies or fragments thereof that recognises an epitope of a HER2 receptor truncated form, said epitope being defined by a sequence included in SEQ ID NO: 2. The invention also provides a method of cancer diagnosis, which comprises the detection of the presence of the HER2 receptor truncated form consisting of the amino acid sequence SEQ JD NO: 1 in a patient sample.

Description

Method for diagnosing cancers expressing the HER2 receptor or its truncated variants
Tne present invention relates to a method of diagnosis in isolated samples of cancers expressing the HER2 receptor. The invention also provides compounds for use in the early diagnosis and identification of the cancer as well as for use in therapy
BACKGROUND ART
HER2 {also known as c-erbB2, ErbB2 or Neu) ss a type i transmembrane protein belonging to the family of epidermal growth factor receptors or EGFR, also known as HER1 or ErbB1 . Two additional members, HER3 and HER4 complete this family When HER1 , 3 or 4 binds to an EGF-type ligand, its extracellular domain adopts the conformation referred to as "open", which allows the formation of homodimers and heterodimers. Even if it does not bind to any ligand, HER2 also interacts with other HER receptors linked to a ligand, due to the fact that its extracellular domain is conεtifutively in "open" conformation
The dimeπsation directed by the extracellular domain leads to interaction of tne intracellular kinase of HER receptors and to the subsequent transphosphorylation of some tyrosine residues. These phosphotyrosmes, , act as couplers of a group of intracellular phosphotyrosine-binding proteins The interactions established at the plasmatic membrane are transduced to the cell nucleus by means of different signalling routes, such as the protein kinase route activated by mitogen activated protein kinase (MARK), the protein kinase route activated by stress (JNK), phosphoiipase C gamma, etc. All of these signalling circuits control tne expression of genes that act in a coordinated way to modify determining aspects of the state of the cell, such as eel! proliferation, migration, survival and adhesion. Thus, depending on the ceii context, activation of the HER receptors results in a dramatic cell response, which can range from transformation into a malignant cell to a premature senescence.
In addition to the canonical signalling mode, the HER receptors or fragments tnereof can be endocyted and transported to the nucleus, where they can directly regulate the expression of certain genes. This fact has been observed for the specific case of HER2 (Wang et al,, "Binding at and transactivatϊon of tne COX-2 promoter oy nuclear tyrosine kinase receptor ΞrbB-2". Cancer Ceil-2004, Voi. 6, pp 251 -261 ). as well as for a carboxy terminal fragment (CTF), which consists of a HER4 receptor truncated form, which includes the entire cytoplasmic part (Linggi et al , "ErbB-4 s80 intracellular domain abrogates ETO2-dependent transcriptional repression1', J_ Biological Chemιstry-2006, Vol. 281 , pp 25373-25380).
tn human breast tumours, a series of carboxy terminal fragments or CTFs has been often found, which are assumed to inciude the transmembrane and cytoplasmic domains of HER2. (Molina et al, "NH(2)-termιnal truncated HER2 protein but not fuii- iength receptor is associated with nodal metastasis in human breast cancer", Clinical Cancer Research-2002, Vol. 8. pp. 347-353). it ss also Known that patients with breast cancer expressing the HER2 CTFs, or what comes to be the same truncated forms whicn do not include the N-terminai end of HER2 (HER2 CTFs), have a greater probability of developing metastasis (Molina et al 2002 - supra) and a worse prognosis than those patients who mainiy express the complete form of HER2 (Saez et al , "p95HER2 predicts worse outcome tn patients with HER2-posιtιve oreast cancer", Clinical Cancer Research-2006, VoI 12. pp 424-431 ).
Therefore, ft is very important to be able to detect the presence of HER2 in tumours on time and even more to determine wnether it is in a complete or truncated (CTF) form.
Nowadays, at the level of routine clinical tests antibodies are used to deiect the presence of the complete form of HER2, in order to determine the type of breast tumour in question In the event of detecting the presence of HER2, the recommended therapy consists of administering therapeutic monoclonal antibodies, such as Genentecn's trastuzumab. The use of this monocsonai antibody for the treatment of cancer is described in the apDiication WO 8906692 on oehalf of Genentech. WO 8906692 describes monoclonal or polyclonal antibodies directed against the extracellular region of HER2. this extracellular region matching with the complete external part of the protein, which ss its N-terminal end. As previously mentioned, the epitopes recognised by the antibodies cited in WO 8906692 are antigenic regions of the extracellular domain of the HER2 complete form and are not included in truncated forms or carboxy terminal fragments of HER2. Therefore, with the antibodies and the diagnosis method described in WO 8906692 it will not be possible to defect the presence of truncated HER2 (CTFs). Also, in breast tumours where sad CTFs of HER2 are expressed, antibodies sucn as trastuzumao are not therapeutic, since they do not recognise any epitope. This fact explains tne resistance to the treatment with trastuzumab observed in patients expressing truncated forms (CTFs) of HER2
Patients who express truncated forms or CTFs of HER2 should be treated wrth alternative therapies m order to prevent the poor prognosis numbers observed by Saez et al 2006 (supra) For the purpose of detecting (diagnosing) and treating as soon as possible people having tumours where HER2 truncated forms are expressed, it is very interesting to be able to distinguish what form of HER2 ss expressed in order to act in consequence
The document of Anido et al., "Biosynthesis of tumoπgeπic HΞR2 C-terminai fragments by alternative initiation of translation", European Molecular Biology Organization (EMBO) Journal - 2006, VoI 25, pp 3234-3244, describes that in addition to the fragment generated by the action of the alpha-secretases on the HER2, which gives rise to a truncated form (CTF) known as P95 that includes the transmembrane and cytoplasmic fragment of the receptor, two truncated forms (CTF) are also generated through a mechanism of alternative initiation of translation starting from two methionines located upstream and downstream, respectively, of the transmembiane domain of HΞR2 Specifically, the methionines for ihe alternative initiation of translation corresponc to methionine 611 and methionine 687 of the ammo acid sequence with access number M1 1730 1 of the UniGene database of the National Center for Bsotechnoiogy information (NCB!) This document also shows that these alternative forms of the HER2 receptor (CTFs) are present in breast tumours in particular, it indicates that the most abundant corresponds to the form known as CTF687, or in other words, to the protein obtained by the alternative initiation of translation starting from the methionine in position 687 Ansdo et al proposes as therapy the use of inhibitors of the tyrosin kinase activity of HER2, such as lapatimb in order to minimise the growth of the tumours expressing these truncated forms of HER2 The inhibitors of tyrosin kinases act by interacting with the C-terminal end of the HER2 receptor that is present in an integral manner in both the complete receptor and in the CTFs αeπved from it or produced by alternative initiation of the translation.
The document of ScaStriti et al, ''Expression of ρ95HER2, a truncated form of the HER2 Receptor, and response to anti-HER2 therapies in breast cancer" Journal of National Cancer lnstrtute-2007. Voi 99, pp 628-368, represents an example of a study into an alternative methodology for detecting the presence of one of the HER2 receptor tiuncated forms and lists some of the possible causes of resistance to the treatment with trastuzumab (Herceptin) In particular, it emphasises the accumulation of the p95HER2 fragment (product of the proteolysis of HER2 by alpha-secretases) and other truncated forms of the receptor which do not have the extracellular domain recognised by Trastuzumab. Scaltπti proposes a method of immunofluorescence to detect the p95HER2 fragment (product of proteolysis by alpha-secretases). This new detection method can be carried out on sections of tissue embedded in paraffin and fixed with formalin following clinical protocols The new methodology arises from observing that the truncated form p95HΞR2, and not the entire form of the receptor, ss tocated in both the plasmatic membrane and the cytoplasm of the cell This metnod proposes comparing whether there is expression of p95HER2 by means of staining the detected cytoplasm with an antι-HER2 antibody that binds the receptor's cytoplasmic domain, and confirming these results with those of a detection with an antϊ-cytokeratin antibody, a protesn whose distribution has been extensively used as a tool for the diagnosis of tumours. However, it is not clear whether this method efficiently distinguishes those tumours expressing the complete form of HER2 from those that express the truncated forms
There is a need to locate new and efficient targets for diagnosis and therapy, properly correlated to the type of cancer in question and that make it possible to neat on time with efficient therapies those tumours having the worst prognosis, discarding from the outset those therapies that have been seen not to be effective
The present invention offers benefits related to the problems cited above and represents a novel solution in the early classification of cancer specifically breast cancer
SUMMARY OF THE INYENTiON
it has been determined that the presence of one of the truncated forms (CTF) of HER2, generated by the alternative initiation of translation, correlates very well with the prediction of the type of cancer to be treated, making easier the task of tne physician at the moment of prescribing a course of treatment. This HER2 truncated form (CTF-611 ) has been identified and found to have the sequence SEQ ID NO:1 .
Thss sequence has been used to develop several tools for detecting its presence in tissue samples, thus providing a new and solid diagnosis set that is aiso applicable in clinical routine The present invention also provides new antibodies, or fragments thereof, that recognise this truncated form or CTF of HER2, which ss not recognised by trastuzumab These antibodies recognize an epitope being defined by a seαuence included in SEQ ID NO 2 The invention also provides hybπdoma ceil lines suitable for producing such antibodies Ants-HER2 antiboαies currently available recognize CTFs and HER2 or only HER2, making it very difficult to discriminate patients expressing only HER2 from patsens expressing HER2 and CTFs In contrast with available antι-HER2 antibodies the antibodies described here preferentially bind to CTF-61 1 allowing to identify patients expressing this CTF
The present invention also refers to a method of cancer diagnosis in patient samples which comprises the detection of the presence in said sample of the HER2 receptor truncated form consisting of SEQ ID NO 1
The present invention also provides the use of the antibody or fragment thereof of the present invention for the diagnosis and determination of prognosis in isolated samples of cancers where the HER2 receptor ΪS expressed
The present invention further provides an agent of diagnosis and determination of prognosis in isolated samples of cancers where the HER2 receptor and/or C-terminal fragments is expressed which compi iseε at least one aniiDody or a fragment tnereof as described above
The present invention also provides a kit of diagnosis and determination of prognosis in isolated samples of cancers where the HER2 receptoi is expressed, that comprises means for detecting the presence in said sample of the HER2 receptor truncated form consisting of the SEQ ID NO 1
The invention also provides an antibody or a fragment thereof as described above τor use m therapy or in the manufacture of a medicament In particular the medicament is for the treatment or prevention of cancers where at least the HER2 receptor truncated form consisting of the SEQ ΪD NO 1 is expressed
According to another feature of the invention, the use of antibodies or rragrnents is foi the manufacture of a medicament for treating or preventing breast cancers in mammals, including human beings Another object of the present invention is a pharmaceutical composition for the treatment of cancers wherein at least the HER2 receptor truncated form consisting of SEQ ID NO 1 is expressed, which comprises an antibody or a fragment thereof as described above and at least one pharmaceutically acceptable excipient and/or vehicle.
BRIEF DESCRIPTION OF THE DRAWINGS
FIG. 1 Diagram of the protein sequence of the truncated form CTF-61 1 , compared with the sequence of the complete HΞR2 receptor and with the truncated form known as p95 (648-CTF/p95), product of the proteolysis by aipha-secretases The transmembrane domain is represented as a nelicoidal line. The remaining molecule is indicated with a grey box. The sequence of the peptide used to generate mono and polyclonal antibodies appears underlined. The positions of intramolecular dssulphsde bridges are also indicated with connections oetween the cysteines.
FI3 2 Electrophoresis and Wesiern-blot (transfer to membrane) of Dreast cancer samples. (S) means soluble fraction and (JvI) membrane fraction, in order to detect complete HER2 and the CTF-61 1 form, antibodies directed to the cyroplasmic domain of the proteins were used. DHL- Lacatafe dehydrogenase (used as control)
FiG. 3: Results of the evaluation of the numoer of tumours developed in Transgenic mice tnat express the truncated CTF-61 1 (FIQ 3A) form in comparison with transgenic mice that express the complete HER2 receptor; and the results of the volume of detected tumours (FIG. 3B) On the Y axis, N and V mean Number of Tumours and Volume of Tumours, respectively On the X axis, T refers to Time in weeks.
FIG. 4: FIG 4A shows an electrophoresis and Western-Blot (transfer to membrane) revealed with an antibody (CB11 ) that recognises the cytoplasmic domain of the HER2 receptor (common domain in all complete and truncated forms) or with polyclonal antibodies generated against the peptide of SEQ ID NO. 3 (α-61 1 -A and α- 61 1 -B) The tracks correspond to MCF7 cell iysate extracts (previously transformed with the constructions of FIG. 1 ) that express the complete form of the HER2 receptor, the CTF-611 truncated form and p95 truncated form. FIG 4B shows the result of an immunoprecipitation test with the antibodies os-61 1 -A1 α-61 1 -B and CB1 1 carried out on samples containing both the complete HER2 receptor as well as the truncated forms CTF-61 1 and p95
FIG 5 (A) MCF7 celis expressing HER2, 611 -CTF or 648-CTF were lysed and analyzed by Western blot with CB1 1 , an antibody against the cytoplasmic domain of HER2, or with two independent monoclonal antι-61 1 -CTF antibodies raised against the peptide MPIWKFPDEEGASQPSPiNSTHSSVDLDDKGC (see Fig 1 } (B) The lysates from MCF7 cells expressing HΞR2S 61 1 -CTF or 648-CTF were mixed 1 1 -1 and subjected to immunoprecipitation with the indicated monoclonal antibodies Washed immunoprecipitates were analyzed by Western biot with the CB1 1 antibody As a negative control a mock immunoprecipitation with no antibody (-) was performed (C) MCF7 cells expressing HER2 61 1 -CTF or 648-CT^ were analyzed in a confocal microscope by indirect immunofluorescence with the indicated antibodies
FIG 6 (A) and (B)- Characterization of one monoclonal antibody Dy flow cytometry
FtG 7 Characterization of monoclonal antibodies by immunohistochemistry
FIG S- Characterization of epitopes Fig 8{A) Graph showing the primary sequence of the juxtamembrane region of 61 1-CTF and the seαuence of the different constructs used to map tne epitopes- Fig 8(B) Western blots
FIG 9 Analysis of breast cancer samples Fig 9(A) Table with analytical results Fig 9(B) immunocytochemica! staining
DETAILED DESCRIPTtON
CTF-611
As previously mentioned, the inventors found that, surpπsingϊy the differential detection of said HER2 truncated form with SEQ ID NO- 1 correlates very well with the manifestation of a common type of cancer in breast tissue with a poor prognosis Thus, FIG 3 shows the results of the evaluation of the numoer of tumours αeveloped in transgenic mice expressing tne truncated form CTF-61 1 (SEQ ID NO 1 )
in order to obtain tne results of tms FIG 3, cDNA constructs were expressed in the breast epithelium of mice, said constructs coding the human SEQ ID NO: 1 (CTF- 61 1 ), identified in the figure as M61 1 -CTF This construct comprises the SEQ ID NO- 1 under control of the promoter of the mouse mammary tumour virus (MMTV), As control the mouse line FVB/N-Tg(MMTVneu)202J that expresses the complete form of HER2 was used, also under control of the MMTV promoter. As can be deduced from FIG. 3A the number of tumours in mice expressing the cDNA construct with the CTF-611 form (SEQ ID NO: 1 ) is much higher than the one of the FVB/N- Tg(MMTVneu)202J line, identified in this figure with the designation HER2/neu. The tumours tn the transgenic animals were detected at 17 weeks of age of the transgenic animals expressing CTF-611 , which represents three months before the first detection in FVB/N-Tg{MMTVneu)202J mice. This fact would explain the greater aggressiveness of tumours that express HER2 fragments in relation to those tumours that express the complete form. FIG 3B also shows that the volume of the tumours is much greater in the animals expressing the CTF truncated form of HER2 with SEQ ID NO 1 , in relation to those animals expressing constitutive!;/ the whole receptor, also known as HER2/neu This second fact also explains tne greater aggressiveness of this type of tumours The inventors also determined that those tumours expressing the truncated form of seαuence SEQ ID NO- 1 showed higher lung metastasis indices than those observed in tne umours bxpre&tsng HΞR2/neu. Furtner experiments proving the clinical relevance are provided in Example 9 below.
All of this data with transgenic animals reveals that the differential αetectton of the HER2 receptor truncated form of SEQ ID NO 1 in respect of the complete form of the receptor is very necessary
Evidently, said SEQ ID NO' 1 includes all variants derived from allelic vaisanons between individuals, which entail variations in number and type, of some amino acids, such as more or less than two or three amino acids, or the replacement of an amino acid by another one which does not modify the overall receptor s structuie.
These truncated forms of HER2 can contain neo-epitopes, in other words, new antigenic determinants not present in the molecule of the whole receptor, meaning that they αo not interact sn the same way With the molecules as with the whole receptor (antibodies, medicaments, etc.). Antibodies to CTF-611
The inventors could produce both polyclonal and monoclonal antibodies to CTF-611 These antibodies recognize an epitope that is defined by a sequence included m SEQ ID NO 2, preferably by a sequence included in or defined by SEQ ID NO 3 Most preferred are antioodies that recognize an epitope that is included in or defined by MPiWKFPDEEGAS (SEQ ID NO 5).
Sn the context of the present invention, epitope is understood to mean the part of a pepffdic type macromolecule (or of an antigen), whose sequence and/or spatial configuration is recognsseα by the immune system (antibodies, T cells, B cells)
The antibodies of the present invention can preferably distinguish the protein of SEQ ID NO 1 from the HER2 receptor. Furthermore, the antibodies of the present invention can preferably distinguish the protein of SEQ ID NO 1 from the HER2 receptor truncated form 648-CTF/p95 Tn ss distinction can be visualized by one or more of immunofluorescence, flow cytometry, immunohistochemistry in cultured cells and immunohϊstochemistry in samples from patients. It is particularly D referred that the distinction can oe quantified bom m flow cytometry and immunoprecipitation
According to the psesenf invention, the binding of tne antibodies of the present invention to 61 1 -CTF is preferably at least 300 times, more preferaoly at least 1000 times, most preferably 1000 to 2000 times stronger than tnejr binding to HER2 in an immunoprecipitation experiment, as described in more detail in Example 3 (using 5 microgram of 32H2 and 5 microgram of 20F4),
As noted above, the antibody can be polyclonal or monoclonal,
In the sense of the present invention, "polyclonal antibody1' shaSI De understood to mean the group of antioodies produced by different B cell lines (B lymphocytes) Polyclonal antibodies are mixtures of immunoglobulins secreted against an antigen (macromolecule), each one of these immunoglobulins being capable of recognising a difrerent epitope, since it comes from a different B cell. Thus, within the different populations of immunoglobulins contained :n a polyclonal antibody, there is a type of immunoglobulin that iecognises the epitope oi epitopes of interest of a specific antigen Polyclonal antibodies can be produced for example by conjugating the peptide of SEQ ID NO 2, SEQ ID NO 3 SEQ ID NO 4 or SEQ ID NO 5 with an immunogen such as Keyhoie-iimpet hemocyanin and immunising rabbits with this conjugate
Monoclonal antibodies can be produced using the same or Similar ^mmunogens Hybridoma cell lines can be produced in a manner known to the skilled person The hybπdoma cell line can then be grown in a suitable culture medium from which the monoclonal antibody is recovered
In a preferred embodiment, they are produced by the hybridoma cell line deposited with the 'Deutεchland Sarnmlung von Mikroorgaπismen und Zelikulturen GmbH - DSMZ' with access number DSM ACC2904 in accordance with the Ti eaty of Budapest of 9 April 2008 or the hybridoma cell line deposited with the "Deutschland Sammiung von Mϊkroorgamsmen und Zelikulturen GmbH - DSMZ" with access numoei DSM ACC2980 in accordance with the Treaty of Budapest of 6 November 2008
Monoclonal antibodies produced with these hybridoma cell lines, as weJi as monoclonal antiooαses ihai are Tunctionaily at ^east equivalent are particularly preferred Functionally at least equivalent are those antioodies that can discriminate between CTF-611 and HER2 equally well or even better
Useful antibodies also include humanized and human antibodies
The present invention thus also provides the isolated peptides of sequence SEQ ID NO 2 SEQ !D NO 3, SEQ ID NO 4 or SEQ ID NO 5
Instead of the complete antibody, a fragment thereof may be used according to the present invention The antibody fragments are selected from the group comprised by F(ab) F(ab') and Fv In the context of the present invention, a fragment of an antibody refers to a part of the antibody which is of enough size and appropriate structure to bind to an epitope present in the HER2 receptoi truncated form and thus permit its detection in a sample
Examples 2 and 3 show specific antibodies Evtαently the invention extends to other polyclonal oi monoclonal antibodies directed agasnst the epitope of the CTF-61 1 truncated form whfch is defined by the sequences SEQ ID NO 2 and SEQ ID NO 3, since, on the basis of the teachings of this invention they can be directly derived for a skilled in the art Equally, the invention extends to fragments of said antibodies, such as F(ab), F(ab'), Fv, etc or any hybridoma cell line capable of producing monoclonal antibodies directed against the peptides of SEQ ID NO:2 and SEQ ID NO- 3
Diagnostic methods
In the method of diagnosis according to the invention the detection of the presence of the HER2 receptor truncated form may be carried out through means independently selected from the group comprised by detection by differential migration in a mobile phase - stationary phase system of the HER2 receptor truncated form consisting of SEQ ID NO. 1 in respect of the complete form of said HER2 receptor- and detection by binding with specific antibodies of the HER2 receptor truncated form containing the SEQ ID NO: 1
Detection through differential migration should be understood to mean, in the context of the present invention, any analytical technique that allows separation of the compounds to be detected on the basis of then different mobility in a specif, c mobile phase - stationary pnase system, such as an electrophoresis. Such different mobility may be caused by a different electrical charge m tne compound, different molecular weight, or different affinity for other compounds.
Tnis differential detection can be carneα out through analytical techniques known by the skilled in the art sucn as protein electrophoresis, molecular exclusion cnromaiographies, antibody affinity tests, immunofluorescence immunocytochemistry, immunonsstochemistry, flow cytometry, etc Particularly preferred is immunohistochemistry One or more of these methods can be combined to enhance reliability
Differential detection of the HER2 receptor truncated form consisting of SEQ iD NO 1 , also referred to in this invention as CTF-611 , in respect of the whole or complete HER2 receptor, implies being able to visualise two proteins with different molecular weights and different sequences as can be desired from FIG. 1. The truncated form with SEQ iD NO: 1 consists of the protein resulting from the alternative initiation of translation through methionine 61 1 of the complete sequence of the HER2 receptor This form or CTF tnus comprises a new extracellular domain, a transmembrane fragment and a cytosoiic domain The transmembrane fragment and the cytosoiic domain are the same as those of the complete form of the HER2 receptor. Another truncated form corresponds to the one of FIG 1 referred to as p95 or CTF-648 This last form is the product of the action of the alpha-secretases on the complete HER2 receptor, which divide a large part of the extracellular domain.
According to another embodiment of the invention, the step of detecting the presence in the sample of the HER2 receptor truncated form consisting of SEQ ID NO. 1 , comprises the detection with at least one antibody as defined above In a particular embodiment, the method of diagnosis according to the invention comprises the detection of fne epitope defined by SEQ ID NO 3.
Sn one embodiment of the invention, the antibodies or fragments thereof of the present invention are used as agents for the diagnosis and determination of prognosis, either directly marked in their own oeptidic sequence (for example with radioisotopes) or indirectly (for example by addition or binding a fluorescent agent or an agent capable of producing fluorescence Dy reaction in a selected reaction medium), all of the above with the aim of generating a visible signal, and ϊf possible αuantifiable. with which to detect the presence of the HER2 receptor truncated form consisting of the sequence SEQ ID NQ 1 in a sampiθ
In the same way. it is contemplated for the diagnosis agent containing at least the antibodies to De adnered to a solid support, αirectly or indirectly by means of a spacer arm. An agent of this type allows capturing or the form of sequence SEQ ID NQ: 1 oτ a sample, in order to determine its presence afterwards with other non-specific antiDodies (such as CB1 1 )
Tne agents of diagnosis and determination of prognosis according to the invention can also be applieα in immunohisiochemistry protocols To this effect, the (primary or secondary) monoclonal or polyclonal antibodies must be duly marked to give a visible signal, and in the best of cases quantifiable, once they have come into contact with the tested tissue and they have been allowed to interact witn the proteins intended fo^ detection, in other words, with the CTF fragment of HER2 of sequence SEQ ID NO 1
With the aim of facilitating the task of analysis, diagnosis and determination of the prognosis to the pnysician, ft is contemplated that the αiagnosistic agent is provided in the form of a kit which includes, besides the antibodies, the reagents (e.g. reagents required for the immunohiεtochemicai staining), buffers and αetection solutions adapted to determine the presence of the truncated form of SEQ [D NO 1 in a sample, possibly control slides representing different expression levels of CTF-611 and possibly aiso detailed instructions, assisting the physician in the assessment of tne diagnosis This kit may also comprise a means for carrying out a semiquantitative immunohistochemical assay for the determination of HER2 (such as Herceptest™)
Thus, the invention provides a kit for diagnosis and determination of the prognosis whfch comprises at least one antibody or a fragment thereof, sad antibody or fragment being capable of recognising the epitope defined by SEQ ID NO 2 or SEQ ID NO 3 or SEQ ID NO-S, in addition to the reagent means and buffers suitable for carrying out the interaction of the antibody with the epitope and that are extensively known by those skilled in the art
The diagnostic method of the present invention, and tne kit of the present invention, may ailow the prediction of nodal metastasis, poor prognosis, and resistance to
Figure imgf000014_0001
Another type of kit also object of the invention comprises all the necessary means for carrying out detection through differentia! migration of the HER2 receptor truncated form conststsng of the seαuence SEQ [D NO 1 in relation to the complete form of the HER2 receptor
Within the group of cancers that express the HER2 recepio1 or its truncated variants breast cancer stands out. Other cancers where these proteins are aiso expressed include the cancer of lung, pancreas, coion, stomach piostate, nead and neck, skin kidney, testicle, thyroids, uπnaiy bladder, uterus vulva endometrial, ovary, oesophagus, mouth, sanvaiy gland, larynx, peritoneum, nose and throat region, Fallopian tubes, Wilms tumors as welf as lymphomas, Swing sarcomas, synovial sarcoma, medulloblastomas, trophoblastic tumors, glyomas, glyoblastomas cnolangiocarcsnomas, cholesteatoma, chondrosarcoma ependymoma, neuπlemmomas, neuromas, rhabdomyosarcomas The Diagnostic method of the present invention is thus particularly suitable for diagnosing one of these cancers In addition to ex-vivo detection of-CTFs the antibodies could be used for in vivo imaging Therapeutic methods
The antibodies of the present invention, or fragments thereof, are also useful in therapy, particularly in the therapy of cancer, particularly those cancers that express the H ER2 receptor or its truncated variants Humanized and human antibodies and fragments thereof, are preferred
The antibodies of this invention are used also in pharmaceutical compositions useful for the treatment of cancers in which at ieast the HER2 receptor truncated form consisting of SEQ ID NO 1 is expressed The composition comprises those pharmaceutically acceptable vehicles or excioients and at ieast one antibody that recognises the epitope defined by the seαuences SEQ ID NO 2 or SEQ ID NO 3 The pharmaceutical composition may aiso comprise a mixture of antibodies that, besiαes an antibody of the present invention, contains otner antibodies against HER2 or fragments thereof, such as Herceptin™
Based on the figures provided herein and always by way of illustrative but not limiting examples, below there are described the method of diagnosis and determination of prognosis of cancers wnere me HER£ receptor anα/or its carooxy terminals fragments (truncated variants) are expressed, new peptides and specific antibodies against said peptides, new cell lines, diagnosis agents and kits for detection, all of which being objects of the invention
Although not specified, ali tecnnical and scientific terms used in the specification have tne meaning tnat a skilled in the art, to who the invention belongs, would assign to them Similar or equivalent methods and materials to those αescnbed Herein may be used in the practice of the present invention Throughout the description and claims the word 'comprise' and variations of the word, such as "comprising", is not intended to exclude other technical features, additives, components, or steps Additional objects, advantages and features of the invention will become apparent to those skilled in the art upon examination of the description or may be iearned by practice of the invention The following examples and drawings are provided by way of illustration, and are not intended to be limiting of tne present invention
Also, it shall be understood tnat the present invention covers al! possible combinations of preferred and particular groups described above EXAMPLES
The following examples show different ways of detecting the presence of the truncated form of sequence SEQ ID NO 1 , in an isolated sample of cancer of the 5 type that expresses the HER2 receptor and/or its truncated variants
Experimental procedures
Ceiis MCF7 Tet-Off cells (BD bioscience) were maintained at 370C and 5 "%C 10 CO2 m DMEM/F-12 (1 1 )(Gιbco) containing 1 0% FBS (Gibco), 4mM L- Giutamme (PAA Laboratories) 0 2mg/mi G41 8 (Gibco) and 1 μg/m! doxycycline (Sigma). Cells were transfected with the various expression piasπnds by using FuGENES (Roche). Single stable clones with pUHD10-3h based piasmids integrated were selected with 0 1 mg/ml hygromycin B 15 (invitrogen) Expression from pUHD1 O3h encoded cDNAs of HER2 and CTFs was induced by removing doxycycisne First the cells were detached with 0 5% Trypsm-EDTA (GIBCO), washed three time by cenirifugation and the medium changed 1 0hours after seeding m culture dishes homogeneity of the mαsviduai clones was cnecKed by immunofluorescence confocal microscopy 20 with an antibody against the cytoplasmic αomain of HER2 Two independently seiecied stable clones were used in the experiments-
Western bfot Cells expressing the different HER2 isoforms were lysed in modified 25 RIPA buffer (2OmM NaH2PO4/NaOH pH7 a, -! 5OmM NaCi1 1% Triton X-100, 5mM EDTA 10OmM PMSF 25mM NaF, 16μg/ml Aprotimn, l Oμg/m1 Leupeptin and 1 3mM Na3VO4) and protesn concentrations detei mined with DC protein assay reagents (BIO-RAD) Samples were mixed with loading Duffei (fmai concentrations 62mM Tris pH6 8, 12% glycerol, 2 5% SDS) with 5% betaMercapfoethanoi and mcuoaied at 30 99°C for 5min before fractionation of 15μg protein by SDS-PAGE Specific signals in Western blots were quantified with the software ImageJ 1 38 (NiH)
ϊmmunoprecipitation. Cell iysates were incuoated with different antibodies dunng 1 hour at 4°C Then immunocompϊexes were purified with protein A 35 lrnmunoprecipitaies were washed three times with iysis buffei , mixed with loading buffer and analyzed by Western blot Cells for immunofluorescence microscopy seeded on glass cover-slips were washed with PBS, fixed with 4% paraformaldehyde for 20mm and permeabiiized with 0.2% Tπton X-100 for 1 Grmn. For blocking and antibody binding we used PBS with 1 % BSA, 0 1 % Saponin and 0.02% NaN3, and for mounting Vectashieid with DAPI (Vector laboratories).
Flow cytometry. MCF7 cells expressing HER2, 61 1 -CTF or 648- were washed at 40C with PBS and detached m PBS containing 5mM of EDTA. Detached cells were incubated with 10 μg/ml of anti-32H2 monoclonal antibody in PBS containing 5% BSA for 30 mm at 4°C washed and stained for 30 ram at 40C with FΪTC-conjugated anti- mouse IgG (Becton-Dickinson) in PBS containing 5 % BSA, Flow cytometry was done on a FACscan using FACscan Research software (Becton Dickinson lmmunocytometry Sys., Mountain View. CA).
Immunhistocheiτststry. MCF7 cells exoressing HΞR2, 611 -CTF or 648- were washed at 4cC with PBS and detached in PBS containing 5mM of EDTA. Then, cells were centπfuged and cell pellets were fixed in 10% neutral formalin, dehydraied and embedded in paraffin. Sections from cetf peiieis ot from human tissues o* a thickness of 4 μm were placed on poiy-lysine-coateα glass sliαes. lmmunohistochemistry analyses were performed using the following protocol:
1. Deparaffinizing and rehydrating the section
1.1 lncuoate the slides 30 mm at 60QC.
1 .2 Deparafπmze the slides with three 5 mm. incubaiions of clean xyiene. followed by two 3 mm washes with absolute ethanol. 1.3 Gradually bring to distilled water: Ethanoi 95°C 3 mm, Ethanol 70GC 3mιn, Efhanoi 500C 3 mm, distilled water.
2. Antigen retrieval
PT Link at low PH (6). ENVISION FLEX TARGET RETRIEVAL SOLUTION HIGH Ph 1 Ox DM 812. 20 mιn a 95°C. Wash with Envision Flex wash buffer x10 DM 81 1 15mιn.
3. lmmunohistochemicai staining AUTOSTAINER plus Link DAKO
KIT: ENVISION FLEX + MOUSE, High Ph ( Link)' Envision Flex Peroxidase Blocking SM801 . Envision Flex/ HRP SM 802.
Envision Flex DAB+CHROMOGEN DU 807. Envision Flex Substrate Buffer SM 803. i n
Envision Flex Wash Buffer 10x DM 81 1. Envision Flex Target Retrieval Solution High Ph 1 0x DM 812 Envision Fiex+ Mouse ( linker) SM 84 Peroxidase 5 mm and wash with washing buffer. Protein Block 5% 15-20 mm Wash with washing buffer
« 32H2 diluted 1 1000-1 3000 (1 mg/m! stock) or 20F^ diluted 1 .20-1 :50 ( 1 mg/ml stock) 2 hours
* Wash with washing buffer. B Secondary (Fiex HRP5 Flex+Mouse/Rabbit) 20 mm
B Wash with washing buffer
E DAB 5 mm
E Wash with wash buffei
6 Hematoxylin. E Wash wsth distilled water
3 Dehydrating and stabilizing with mounting medium
3 1 Gradually wash With increasing concentrations of erhanof ^50%, 70%, 95%, 2 min each wash)
3 2 Gradually bring to d, stilled watei (ethanoi 95%, 70%, 50%, distilled water, 3 mm each wash).
3 3 Wash with Xyiene/eucalyptoi (3 washes 2 mm each) 3 4 Mount with DPX
Transgenic Mice TG 611 and TG 687 mice were engineered by cloning the sequences encoding 687- CTF and 611 -CTF into the multiple cloning site Il downstream of the Rous sarcoma virus enhanced mouse mammary tumor virus long terminal repeat of the plvlB vector (a kind gift from Dr. Marcos Maiumbres, CNiO, Madrid) Founder lines were generated by mscroinjecting linearized plasmid DNA into fertilized oozytes narvesied from superovulated FVB mice in the Cenire of Animal Biotechnology and Gene Therapy (Centre de Biotecnoiogia Animai i Terapia Gensca, Umversitat Autonoma de Barcelona ) Founder mice were genotyped by Southern hybridization analysis After identification of fouπαer animals, routine colony maintenance was performed by PCR genotyping The male and female FV3/N-Tg(MMTVneu)202J mice were ootained from the Jackson Laboratory (Bar Harboi , ME) Whole Mounts and Histology
Mammary glands were mounted on glass slides, fixed overnight in 4% paraformaldehyde and transferred to 70% ethanol. The slides were rinsed in water for 5 5mιn and stained in a filtered solution of 0 2% carmine for 24hours Giands were tnen dehydrated sequentially with decreasing concentrations of etnanoi, then defatted and stored in methyl salicylate For histological analysis, fixed glands were blocked in paraffin, sectioned, and stained with hematoxylin and eosin.
10 EXAMPLE 1 : Deiection of the fragment of SEQ ID NO 1 through differential migration.
In FIG. 2, which corresponds to an image of an electrophoresis gel and subsequent Western-type transfer (Western-blot), different samples cr bieast cancer (108, 114,
15 101. 103, 131 134 and 145) were loaded or the tracks. From each sample botn the soluble fraction (S) and tne membrane fraction (M) of ihe cell lysate werε analysed, in order to visualise what iype of HER2 molecule was present and in what fractions, m principle it is expected that both the complete receptor and the form of tne SEQ ID NQ "ι aro in the ceil memorane For the oeiection of complete HΞR2 ana of CTF-61 1 0 form, antibodies were used (CB1 1 ) directed io the cytoplasmic domain of the proteins, which is a common domain in both protein forms As an analysis' control the presence of the lactate Dehydrogenase (DHL) enzyme was αetecteα. In most samples bands corresponding to tne complete HER2 recepior and in the membrane fraction, a band corresponding to form CTF-61 1 of SEQ ID NO 1 appears. 5
FIG 2 therefore shows that detection of the type of truncated forms of the HER2 receptor can be carried out through a protein electrophoresis analysis. Furthermore, the presence of a τragιτsent of HER2 of sequence SEQ ID NO' 1 is indicative of a certain type of cancer, in the case of the example, breast cancer, which needs to be 0 evaluated and treated as an inαividual case within the cancers that express HER2
EXAMPLE 2 Detection of the presence of the HER2 fragment of seαuence SEQ !D NO 1 with polyclonal antibodies directed to neo-epitopes defined by the SEQ ID NO: 2 or SEQ ID NO: 3. 5
With the aim of being able to deiect the presence of the HER2 truncated form, whose sequence ss the one described in SEQ ID NO 1 , ussng alternative means to those of detection through differential migration in electrophoresis, a peptide having the sequence SEQ ID NO 4 was synthesized and foui rabbits were immunised with said peptide This peptide corresponds to the 32 amino acids of the N-terminai end of the CTF-611 form or of SEQ ID NO 1 , in which most cysteines have been replaced by serines for the purpose of conjugating it with the immuπogen known as Keyhoie- lsmpet hemocyanin (KLH)
SEQ ID NO 4 corresponds therefore io a peptide equivalent to that of SEQ ID NO 3 although adapted in order to carry out the immunisation technique A skiSied in the art will understand that the antibodies directed against the synthesized peptide SEQ ID NO 4 will also recognise the epitope defined by the SEQ ID NO 3 present m the truncated form of the HER2 receptor (SEQ ID NO 1 or CTF-61 1 ) Similarly, a skilled in the art can follow that if the synthesized peptide used for immunisation consists of SEQ ID NO 2 which comprises all of the amino acids of tne CTF-611 receptor located sn the extracellular zone, the results with aniiDodies directed against this other peptide are equivalent and therefore useful for the same purpose
A SDS electrophoresis and subsequent Western ttansfet of MCF7 cell iysate extracts (previously transformed with the constructs of FIG 1 ) expressing the complete τorm of the HER2 receptor, tne CTF-61 1 truncated form and the p95 truncated form weie earned out The Truncated form of SEO ID NO 1 appeared in fact as two rragments of similar molecular weight As can be derived τrom tests performed wrth Gfycossdase-F, an enzyme that eliminates N-glycans from proteins (not shown), tne fragment CTC- 61 1 is a substrate of post-transiatjona! modifications Specifically, a fragment with approximately 110 kDa corresponds to the form that is synthesized and subsequently enters into the secretary route where it becomes N-giycosylated
The serum of two of the immunised raboits recognised botn the complete HΞR2 receptor, and CTF-61 1 This can be seen from FIG 4A, wne^e the banαs corresponding to both the complete HER2 receptor and the form of SEQ ID NO 1 or CTF-61 1 are detected As indicated in said FIG 4A the Western biot was revealed with an antibody (CB1 1) that recognises the cytoplasmic domain of the HER2 receptor (domain common in all forms, complete and truncated), or with the polyclonal antibodies generated against said peptide of SEQ ID NO 4 (α-61 1 -A and α-61 1 -Bj and that are present in the serums of rabbits Because it is comparable to tne signa. of complete HER2 ana CTF-611 , it is concluded that the antibodies α-61 1 - A and α-611 -B recognise a linear epitope that is oresent in both forms of the receptor As a negative control in the SDS electrophoresis and Western biot a MCF7 cell lysate, expressing the receptor form known as p95, which does not possess the epitope against which the antibodies had been designed, was used
In contrast to these results, when an immunoprecipstation assay was earned out with the antibodies α-61 1-A and α-61 1 -B and the antibody CB1 1 , it was detected that the antibodies directed against the peptide of SEQ ID NO 4 precipitated preferabiy the truncated form of the receptor (CTF-61 1 ) The mixture that was subjected to immunoprecipϊtation contained a proportion of 1 "1 1 of the cell lysates tnat expressed the different rorms of the HER2 receptor These results are evident in FIG 4B In this figure, the bands from a SDS electrophoresis and subsequent Western transrer appear, on tne tracks of which the results of the immunoprecspitation assays with the antibodies α-61 1 -A α-61 1 -B and CB1 1 were loaded A control track (input) was loaded with the mixture 1 1 1 of the three types of cell lysates subjected to imrnunoprecipitation with tne different antibodies The Western biot was revealed with CB1 1 (Approx 105 ceils expressing fuN-length HΞR2, 61 1 -CTF oi 648-CTF were lysed in 500μi of lysis bufler (50 mJvi Tris HCL pH7 4, 137mM NaCI 2mM EDTA, 10% Glycerol, 1 % NP40) Lysatos were clarified by centπfuga'ion at 14000 g X 30 mm Input 5μl lysate mix (Full length HER2 CTF611 CTF648.1 1 1 ) IP 50 μl lysate mix + 5μi ami 61 1 CTF serum from rabbit or CB1 1
In tne tracks corresponding to the immunoprecipitation with the antioodses σ-611 -A and α-61 1 -B, there can De distinguished bands that are ctearly more intense than the rest in those molecular weights corresponding to the glycosylated and non- glycosylated form of CTF-61 1 That is, said anftDOdies directed against tne Deptide of SEQ ID NO 4 do not immunoprecspstate the complete form of the HER2 receptor, which means that they realty recognise an epitope which is masked when the complete HER2 receptor is not denaturalised Therefore, rt can oe concluαed that the antibodies α-61 1 -A and α-61 1 -B are specific tor CTF-61 1
This specificity JS corroborated by indirect immunofluorescence assays (pot shown) in which the affinity purified polyclonal antibodies α-61 1-A and α-61 1 -B only allow the staining in samples expressing the truncated fragment CTF-61 1 This fact involves the advantage of maksng it possible to use tnem to detect differentially wnat form of the HER2 receptor is expressed in an isolated sample of iumour tissue Affinity purification of the polyclonal antibodies was performed as follows (i) Total IgG purification using a HΪTrap Protein A HP column (GE Healthcare) Antibodies from rabbit serum were immobihzed into the column equilibrated with binding Duffer (Na2HPO4). washed with 10 column volumes of binding buffer and eluted in 10 volumes of citric acid ph (2.7). The elutioπ was neutralized using Tπs- HCL pH S.
(ιι) Purification using a peptide immobilized in a HiTrap NHS column. The same peptide used to immunize the rabbtt was immobilized into a HiTrap NHS column IgGs purified in the previous step were loaded into the column equilibrated with binding buffer (Na2HPO4), washed with 10 column volumes of Dinαsng buffer and eluted in 10 volumes of citric acid ph (2 7). The elutson was neutralized using Tπs- HCL pH 8
(in) Finally the puπfied antibody was dialyzed against PBS 0 02% NaN3
The complete HER2 receptor comprises, close to the cell membrane, a structured region maintained by six disulphide bridges, indicated m FiG. 1 by connection lines between cysteines The truncated form CTF-61 1 or of sequence SEQ ID NO. 1 contains only five cysteines among wnich saiα dssjlphide bridges are established to stabilise tne homodimerε of this truncated form As can be derived from FIG 4 as a whole, one must conclude that the zone close io the ceil membrane of the truncated form of SEQ SD NO. 1 is antigemcally different from its equivalent in the complete HER2 receptor From this, it is derived that it can be detected differentially according to what has been previously indicated
Quantification of Vne different HER2 ssoforms in the input, CBt 1 and anti-61 1 -B immunprecspitates normalized to the amount of HΞR2 shows are as follows
Figure imgf000022_0001
The quantification was earned out using SmageJ 1 .38
EXAMPLE 3 Detection of the presence of the HER2 fragment of sequence SEQ ID NO: 1 with monoclonal antibodies directed at neo-epitopes defined by SEQ !D NO- 2 or SEQ ID NO: 3
Using the same peptide of SEQ ID NO, 4 of example 2, monoclonal antibodies were obtained. From all of them, monoclonal antibody 20F4 produced by the hybπdoma cell line with access number DSM ACC2904 and monoclonal antibody 32H2 produced by the hybridoma cell line with access number DSM ACC2980 were selected. The results obtained with this antibody are shown tn FIG 5.
in a simiiar way as in example 2, st was carried out a SDS electrophoresis and the subsequent Western transfer with a 1 :1 :1 mixture of MCF7 cell lysate extracts (previously transformed with the constructs of FIG 1 ), that expressed the HER2 receptor complete form, or the CTF-611 truncated form, or p95 the truncated form, in FIG. 5A, which is a photograph of ihe membrane of the Western revealed with CB1 1 or with the monoclonal antibodies 20F4 and 32H2, one can see that the latter recognise specifically the truncated form of HER2 corresponding to the receptor CTF- 61 1 of SEQ ID NO. 1 and does not present any detectable cross-reactivity with the complete form of said receptor, which means that it really recognises a new epitope meo-epiiopej that includes the pπmary amino group on the N-terminai end of the CTF-611 form of the receptor
In a similar way, when an immunoprecipitation assay was earned out with the monoclonal antibodies 20F4 and 32H2 in comparison with the aπtiboσy CB11 (which recognises the cytosolic domain of the receptors) , it was detected that the monoclonal antiboαy directed against the peptide of SEQ ID NO: 3 precipitated exclusively the truncated form of the receptor (CTF-61 1 ). These results are evident in FIG, 5B. In this figure, there are shown the results of a SDS eiectropnoresis and the subsequent Western transfer, on the tracks of which the resuits of the immunoprecipitation assays with the antibodies 20F4, 32H2 and CB1 1 were loaded.
On the track corresponding to immunoprecipitation with the antibodies 20F4 and 32H2. only the bands of the glycosylated and non-glycosylated form of the CTF-611 truncated form can be distinguished, That is, antibodies 20F4 and 32H2 do not immunoprecptate the complete form of the HER2 receptor. Therefore, it can be conciuded that the antibodies 20F4 and 32H2 are highly specific to CTF-611 and do not recognise the complete form of HER2, meaning that it can be used for the differential and highly selective detection of what form of the HER2 receptor is expressed in an isolated sample of tumour tissue, The characterization of monoclonal antibodies directed against a peptide corresponding to a the N-termsπal, 32 amino acid-long, sequence of 61 1 -CTF, comfirm the existence of epιtope(s) masked in full-length HER2 but exposed in 611 - CTF These epitopes are masked both in the soiubilized molecuSe and in intact cells Quantification of the different HER2 ssoforms in the CB1 1 , 32H2 and 20F4 immunprecipitates normalized to the amount of HER2 shows are as follows.
Figure imgf000024_0001
EXAMPLE 4 Characterization of one monoclonal antibody against the N-terminus of 61 1 -CTF by flow cytometry
(A) MC-7 cells expressing HER2, 61 1 -CTF or 648-CTF were analyzed by fiow cytometry ussng different concentrations of 32H2, a monoclonal antiDody raised against the oeptide MPIWKFPDEEGASQPSPiNSTHSSVDLDDKGC (see Fig. 1) See Figure 6(A)
(B) The results of two mdependent experiments performed as in (A) were quantified and the average are shown. See Figure 6(B)
(C) MCF7 cells expressing HER2, 611 -CTF or 648-CTF were analyzed in a confocal microscope by indirect immunofluorescence with the indicated antiboαies
As fluorophore-coupled secondary aπtiboαy, Alexa Fluor 488 goat-anu mouse IgG from invitrogen (A1 10011 ) was used To assess unspecific binding as a negative control FACS was carried out without 32H2 serum out in the presence of this secondary antiDody ("2ary")
Conclusion The eoitope recognized by the antibody 32H2 is exposed in live cells expressing 61 1 -CTF but masked in live cells expressing HER2
EXAMPLb 5 Characterization of monoclonal antibodies against the N-terminus of 61 1 -CTF by smmunomstochernistry fmmunocytochemicai staining of MCF7 cells expressing HER2, 61 1 -CTF or 648-CTF with CBH an antibody against the cytoplasmic domain of HER2 or with two independent monoclonal aπtt-61 1 -CTF antibodies raised against the peptide MPIWKFPDEEGASQPSPINSTHSSVDLDDKGC (see Fig 1 ) was carried out The result is shown in Figure 7
Conclusions The epitopes recognized by the antibodies 20F4 and 32H2 is exposed in cells expressing 61 1 -CTF analyzed by immunohistochemistry in contrast, as judged by the same technique, these epitopes are masked in the full-length HER2 molecule This result is particularly relevant giving the fact that imunohistochemistry is the technique of choice for most routine test in the clinic
EXAMPLE 6 Characterization of the epitopes recognized by the monoclonal antibodies against the N-terminus of C11-CTP
(A) Schematic showing the primary sequence of the juxtamembrane region of 61 1 - CTF. The N- and tne C- termini of the molecule are inαicated The transmembrane and the kinase domains aπe indicated by a αashed and a grey box, respectively The sequence of diffeient deletion constructs in indicated See Figure 8(A) (B) MCF-7 cells transiently transfected with cDNA deletion constructs starting at the indicated amino acids were lysed Cell lysates were analyzed by Western blot with CB11 , an antibody against the cytoplasmic domain of HER2, o- with two independent monoclonal antι-61 1-CTF antiboαies iaised against the peptide MPIWKFPDEEGASQPSPINSTHSSVDLDDKGC See Figure 8(B) Conciusfoπs The epitopes recognized by the antibodies 32H2 and 20F4 are contained o^ at ieast overlap witn the sequence MPIWKFPDEEC
EXAMPLE 7 Analysts of numan oreast cancer samples with a monoclonal antibody against tne N -terminus oτ 61 1 -CTF or with Herceptest™
(A) The expression of HER2 in the indicated samples was analyzed with Herceptest™, FSuorescence in Situ Hybridization (FISH) oi Western blot Those samples expressing αetectabie levels of HER2 caraoxy terminal fragments (also known as P95) as judged by Western DIOI are indicated (see (Scaitπt', M Rqro F , Ocana, A , Anido, J., Guzman, M , Cortes, J , Di Cosimo S., Matias-Guiu X , Ramon y Cajal, S., Arπbas, J., and Baseiga, J. (2007) J Natl Cancer Inst 99(8), 628-638)), See Figure 9(A)
(B) immunocytochemical staining of the same breast cancer samples as in A, with 32H2, a monoclonal antι-61 1 -CTF antibody raised against the peptide MPIWKFPDEEGASQPSPINSTHSSVDLDDKGC (see Rg 1 ) or with Herceptest™s which stains the cytoplasmic domain of HER2 See Figure 9(B). Conclusion. By simmunohiStochemistry, the antibody 32H2 stains human breast cancer samples previously known to express detectable levels of CTFs, as judged by Western blot.
EXAMPLE S: Generation of Animal Models to Characterize the Effect of CTF
Expression In Vivo
Mouse models have been instrumental in showing the oncogenic potential and relevance of HER2 in tumor progression. To characterize its oncogenic potential, we established transgenic (TG) mice expressing 61 1 -CTF under the control of the mouse mammary tumor virus-long terminal repeat, which is preferentially active in the manmary gland. Although the cellular models indicated that soluDle intracellular CTFs are inactive, to further explore the consequences of expression of these fragments, we also generated TG animals expressing 687-CTF. As a control, we used the classical and weli-characteπzed model expressing wild type HER2 (i.e. rat neu).
At age 7 weeks, the levels of 61 1 -CTF expressed in the heterozygous TG 611 lines F3 and F2 were ~ equai to and 1/3rd, respectively, the levels of endogenous HER2, while the level in F1 was below the detection threshold. The levels of 687-CTF m the homozygous lines developed varied from ~ double to half the levels of HER2 in the TG 687 lines F2 and F1 , respectively.
Mammary glands of the TG animals exhibited no macroscopic abnormalϊties at 7 weeks age. Howevei , morphological examination of carmine-stained whole mounts revealed hyperplasic abnormalities in the mammary ductal trees of TG HER2 mice. Similar abnormalities, albeit less pronounced, were present in all three lines of TG 61 1 mice, in contrast, the glands of TG 687 mice were indistinguishable from those of wild type mice
EXAMPLE 9: 611 -CTF expression leads to the development of aggressive mammary tumors Despite the more pronounced hyperplasia in TG HER2 mice, the three lines of TG 61 1 animais developed more aggressive tumors in terms of number of tumors per animal, tumor growth and tumor onset:
Mammary Glands
Mice Average (weeks)
HER2 (Neu) 30.3 + 7.5 22
61 1-F1 26.3 ± 4.6 6
61 Ϊ-F2 22.2 ± 4.8 12
61 1 -F3 23.7 + 5.5
(The appearance of mammary tumors was monitored by palpation weekly.)
No tumors or abnormalities were observed in TG 687 animais even after a foliow-up of more than one year. Histological analysis of the tumors showed the same typical invasive soiid nodular carcinomas induced by HER2 in the TG 61 1 mice. The only histological difference between the tumors initiated by HER2 and 61 1 -CTF was a higher number of mitotic images in the ones from TG 61 1 mice.
As previously shown, TG HER2 mice developed lung metastasis. Three to six weeks after detection of tumors, - 1/4sn of the TG HER2 animals had detectable nodules in the lunαs:
Mice Lung metastasis n_
HER2 (Neu) 22 9
61 1 -F1. F2. F3 56 9__
(Mice were sacrificed 3-6 weeks after tumor detection by palpation, and the appearance of metastasis monitored by immunohistochemistry).
Histological analysis of the lung metastases confirmed the expression of HER2 and staining with cytokeratin 18 verified that the celis originated from the primary tumor. In comparison to TG HER2, the number of animals expressing 61 1 -CTF with detectable metastases was more than double. This shows that the tumors initiated by this CTF have a more pronounced tendency to invade the iungs. SEQUENCES
SEQ ID NO: 1
Met Pro He Trp Lys Phe Pro Asp Giu GIu GIy Ala Cys GIn Pro Cys
1 5 10 15
Pro ile Asn Cys Thr His Ser Cys VaI Asp Leu Asp Asp Lys GIy Cys
20 25 30
Pro Ala GIu GIn Arg Ala Ser Pro Leu Thr Ser He VaI Ser Ala VaI 35 40 45
VaI GIy He Leu Leu VaI VaI VaI Leu Giy Vai Vai Phe GIy Ne Leu
50 55 60
He Lys Arg Arg GIn GIn Lys lie Arg Lys Tyr Thr Met Arg Arg Leu 65 70 75 80 Leu GIn GIu Thr GIu Leu VaI GIu Pro Leu Thr Pro Ser GIy Ala Met
85 90 95
Pro Asn Gin Aia GIn Met Arg Ne Leu Lys GIu Thr GIu Leu Arg Lys
100 105 1 10
VaI Lys VaI Leu GIy Ser GIy Ala Phe Gfy Thr VaI Tyr Lys Giy Ne 1 15 120 125
Trp lie Pro Asp GIy Giu Asn Vai Lys lie Pro VaI Aia lie Lys VaI
130 135 140
Leu Arg GIu Asn Thr Ser Pro Lys Ala Asn Lys Giu lie Leu Asp GIu 145 150 155 1 60 Ala Tyr VaI Met Ala Giy Vai GIy Ser Pro Tyr Vai Ser Arg Leu Leu
165 170 175
Giy ile Cys Leu Thr Ser Thr VaI Gin Leu VaI Thr Gin Leu Met Pro
180 185 190
Tyr Giy Cys Leu Leu Asp His Vai Arg Giu Asn Arg Giy Arg Leu Giy 195 200 205
Ser GIn Asp Leu Leu Asn Trp Cys Met GIn ile Ala Lys GIy Met Ser
210 215 220
Tyr Leu GIu Asp VaS Arg Leu Vai His Arg Asp Leu Ala ASa Arg Asn 225 230 235 240 VaI Leu Vai Lys Ser Pro Asn His VaI Lys lie Thr Asp Phe GIy Leu
245 250 255
Ala Arg Leu Leu Asp lie Asp GIu Thr GIu Tyr His Ala Asp GIy GIy
260 265 270 Lys VaI Pro lie Lys Trp Met Ala Leu GIu Ser lie Leu Arg Arg Arg
275 280 285
Phe Thr His GIn Ser Asp VaI Trp Ser Tyr GIy VaI Tnr Vai Trp GIu
290 295 300
Leu Met Thr Phe GIy Ala Lys Pro Tyr Asp GIy We Pro Ala Arg GIu 305 310 315 320 lie Pro Asp Leu Leu GIu Lys GIy GIu Arg Leu Pro GIn Pro Pro lie
325 330 335
Cys Thr lie Asp VaI Tyr Met He Met Vai Lys Cys Trp Met He Asp
340 345 350 Ser GIu Cys Arg Pro Arg Phe Arg GIu Leu Va! Ser GIu Phe Ser Arg
355 360 365
Met Afa Arg Asp Pro GIn Arg Phe Vai VaI lie Gin Asn GIu Asp Leu
370 375 3SO
GIy Pro Ala Ser Pro Leu Asp Ser Thr Phe Tyr Arg Ser Leu Leu Giu 385 390 395 400
Asp Asp Asp Met GIy Asp Leu Vai Asp Aia GIu GIu Tyr Leu VaI Pro
405 410 415
GIn Gin GIy Phe Phe Cys Pro Asp Pro Aia Pro Giy ASa GIy GSy Met
420 425 430 VaI His His Arg His Arg Ser Ser Ser Tnr Arg Ser GIy GIy GIy Asp
435 440 445
Leu Thr Leu GIy Leu Gtu Pro Ser Gw GIu GIu Aia Pro Arg Ser Pro
450 455 460
Leu Aia Pro Ser GIu Giy Aia GIy Ser Asp Va! Phe Asp GIy Asp Leu 465 470 475 480
Giy Met GIy Aia Ala Lys GIy Leu Gin Ser Leu Pro Thr His Asp Pro
485 490 495
Ser Pro Leu GIn Arg Tyr Ser GIu Asp Pro Thr VaI Pro Leu Pro Ser
500 505 510 GIu Thr Asp GIy Tyr Vai Aia Pro Leu Thr Cys Ser Pro GIn Pro GIu
515 520 525
Tyr VaI Asn GIn Pro Asp VaI Arg Pro GIn Pro Pro Ser Pro Arg Giu
530 535 540 GIy Pro Leu Pro Ala Ala Arg Pro Ala GIy Aia Thr Leu GIu Arg Ala
545 550 555 560
Lyε Thr Leu Ser Pro GIy Lys Asn Giy VaI Va! Lys Asp VaI Phe Aia
565 570 575
Phe GIy GIy Aia VaI Giu Asn Pro GIu Tyr Leu Thr Pro GIn GIy GIy 580 585 590
Aia Aia Pro GIn Pro His Pro Pro Pro Ala Phe Ser Pro Aia Phe Asp
595 600 605
Asn Leu Tyr Tyr Trp Asp Gin Asp Pro Pro GIu Arg Giy Aia Pro Pro
610 615 620 Ser Thr Phe Lys Giy Thr Pro Thr Ala GIu Asn Pro GIu Tyr Leu GIy
625 630 635 640
Leu Asp Vai Pro VaI 645
SEQ ID NO: 2
Met Pro lie Trp Lys Phe Pro Asp Giu Giu Giy Ala Cyε GIn Pro Cys 1 5 10 15
Pro lie Asn Cys Thr His Ser Cys Vai Asp Leu Asp Asp Lys GIy Cys 20 25 30
Pro Ala Giu Gin Arg Aia Ser Pro Leu Thr 35 40
SEQ ΪD NO: 3
Met Pro lie Trp Lys Phe Pro Asp GIu GIu Giy Ala Cys Gin Pro Cys 1 5 10 15
Pro lie Asn Cys Thr His Ser Cys VaI Asp Leu Asp Asp Lys GIy Cys 20 25 30 SEQ ID NO: 4
Met Pro lie Trp Lys Phe Pro Asp Giu GIu GIy Ala Ser GIn Pro Ser 1 5 10 15 Pro lie Asn Ser Thr His Ser Ser VaI Asp Leu Asp Asp Lys GIy Cys
20 25 30
SEQ ID NO: 5
Met Pro He Trp Lys Phe Pro Asp GIu Giu GIy Ala Ser
1 5 10
SEQUENCE LISTING FREE TEXT
SEQ ID NO: 1 Truncated form or Carboxy Terminal Fragment (CTF) of the human protein HER2
SEQ ID NO: 2 Epitope of a truncated form of the human HER2 protein
SEQ ID NO: 3 Epitope of a truncated form of the human HER2 protein
SEQ ID NO: 4 Synthetic peptide derived from an epitope of a truncated form of the human HER2 protein
SEQ ID NO: 5 Synthetic peptide derived from an epitope of a truncated form of the human HER2 protein

Claims

1 An antibody or a fragment thereof that recognises an epitope of a HER2 receptor truncated form, said epitope being defined by a sequence included in SEQ ID NO: 2
2. The antibody or a fragment thereof according to claim 1 , wherein said epitope is one included in SEQ ID NO' 3
3, The antibody or fragment according to claim 1 or 2, wherein the antibody or fragment thereof is suitable to distinguish the protein of SEQ ID NO 1 from the HER2 receptor.
4 The antibody or fragment according to one or more of the preceding claims, wherein the antibody or fragment thereof is suitable to distinguish the protein of SEQ ID NO.1 from the HER2 receptor truncated form 648-CTF/p95
5. The antibody or fragment according to ciatm 3 or 4 wherein the distinction can be visualized by one or more of immunofluorescence, flow cytometry. immunohistσchemistry in cultured cells, and immunohsstochemistry in samples from patients.
6. The antibody or fragment thereof according to one or more of the preceding claims, which ss a polyclonal antibody
7 The antibody or fragment thereof according to one or more of claims 1 to 6, which is a monoclonal antibody or a fragment tnereof
8. The antiboαy or fragment thereof according to ciaim 7, produced by the hybπαoma ceil line deposited with the "Deutschiand Sammlung von Mikroorganismen und Zeilen - DSMZ'' with access number DSM ACC2904 or the hybπdoma cell iine deposited with the "Deutschiand Sammlung von Mikroorganismen und Zeilen - DSMZ" with access number DSM ACC2980
9. The antibody or fragment according to one or more of the preceding claims, wherein the fragment is one selected from the group formed by F{ab). F{ab') and Fv
10 A hybπdoma producing the monocionai antibody of ciaim 7 or 8
1 1 A method for producing an antibody as claimed in one or more of claims 1 to 9, involving the immunization with a peptide that conists of SEQ (D NO 3 or SEQ ID NO 4, which is optionally conjugated with an immunogen
12 The method of claim 1 1 for obtaining a monoclonal antibody, where the hybridoma cell line according to claim 10 is grown in a suitable culture medium and the monocionai antibody is recovered from this medium
13. An isolated peptide that consists of SEQ ID NO 2, SEQ ID NO- 3 SEQ ID NO 4 or SEQ ID NO 5
14 A method of cancer diagnosis, which comprises the detection of the presence of the H iEERR22 rreecceeppttoorr truncated form consisting of the amino acid sequence SEQ ID NO 1 in a patient sample
15 The method according to claim 1^, whereιn the detection ;s carried out with means independently selected from the group compi ising (ι) detection through differential migration of the HER2 receptor truncated form consisting of SEQ ID NO 1 , in relation to a complete form of said HER2 receptor and
(ii) detection by binding wsth one or more antiDodies as defined in one or more of claims 1 io 12
16 The method according to claim 14 or 15 which is a prognostic method allowing the prognosis of progression of tumor growth and/or metastases
17 Use of an antibody o; ε fragment thereof according io any of the claims 1 to 9, for the diagnosis and determination of prognosis in isolated samples of cancels wherem the HER2 receptor ss expressed
18 An agent for diagnosis and determination of prognosis in isolated samples of cancers of the type that express the HER2 receptor or its truncated variants which comprises at least one antibody or a fragment thereof according to any of the claims 1 to 9
19 The agent for diagnosis according to claim 18, wherein the antibody or fragment thereof is arranged on a solid support
20 A kit for diagnosis and determination of prognosis in isolated samples of
5 cancers of the type that express the HER2 receptor or its truncated variants, which comprises the means for detecting the presence in the sample of the HER2 receptor truncated form consisting of the SEQ ID NO 1
21 . The kit for diagnosis and determination of prognosis according to claim 22, 10 wherein the means of detection comprises at least one agent according to claims 19 or 20
22 The kit for diagnosis and determination of prognosis according to claim 20, wherein the means of detection consist of the detection by differential migration of the
15 HER2 receptor truncated form of SEQ ID NO. 1 , in relation to the complete form of said HER2 receptor
23 An antibody or a fragment tnereof according to one or more of claims 1 to 9 for therapeutic use.
20
24 The antibody or fragment according to claim 23 for use in the treatment or prevention of cancers in which at least the HER2 receptor truncated form consisting of SEQ ID NO. 1 ss expressed
25 25. Tne antibody or fragment according to claim 23 or 24, foi use in the treatment or prevention of breast cancers in mammals, including human besngs
26. The antibody or fragment according to one or more of ctasms 23 to 25, foi use n the treatment or prevention of cancers selected from the group comprising cancer
30 of lung, pancreas, colon, stomach, prostate head and neck, skin, kidney, testicle thyroids, urinary bladder, uterus, vusva, endometrium, ovary, oesophagus, mouth, salivary gland, larynx, peritoneum, nose and throat region, Fallopian tubes, Wilms tumors, as well as lymphomas, Swing sarcomas, synovial sarcoma medulloblastomas, trophoblastics tumors, glyomas. giyoblastomas,
35 choiangiocarcinomas, cholesteatoma, chondrosarcoma, ependymoma, neuπlemmomas, neuromas, rhabdomyosarcomas.
27. A use of an antibody or fragment thereof as defined in one or more of claims 1 to 9 for the manufacture of a medicament for the treatment of cancer,
28. Pharmaceutical composition for the treatment of cancers in which at least tne HER2 receptor truncated form containing the SEQ ID NO: 1 !S expressed, characterised in that it comprises an antibody or a fragment thereof according to any of the claims 1 to 9 and at least one pharmaceutically acceptable excipient and/or vehicle.
PCT/EP2009/056976 2008-06-02 2009-06-05 Method for diagnosing cancers expressing the her2 receptor or its truncated variants Ceased WO2010000565A1 (en)

Priority Applications (18)

Application Number Priority Date Filing Date Title
ES09772265.6T ES2528132T3 (en) 2008-06-02 2009-06-05 Method for diagnosing cancers that express the HER2 receptor or its truncated variants
HRP20141158AT HRP20141158T1 (en) 2008-06-02 2009-06-05 Method for diagnosing cancers expressing a truncated her2 receptor variant
KR1020167032972A KR20160140974A (en) 2008-06-02 2009-06-05 Method for diagnosing cancers expressing the her2 receptor or its truncated variants
AU2009265921A AU2009265921B2 (en) 2008-06-02 2009-06-05 Method for diagnosing cancers expressing the HER2 receptor or its truncated variants
PL09772265T PL2293819T3 (en) 2008-06-02 2009-06-05 A method of diagnosing cancers expressing a truncated variant of the Her2 receptor
DK09772265.6T DK2293819T3 (en) 2008-06-02 2009-06-05 Method for Diagnosing Cancer Expressing a Truncated HER2 Receptor Variation
SI200931079T SI2293819T1 (en) 2008-06-02 2009-06-05 Method for diagnosing cancers expressing a truncated her2 receptor variant
HK11112126.9A HK1157658B (en) 2008-06-08 2009-06-05 Method for diagnosing cancers expressing the her2 receptor or its truncated variants
CA2727365A CA2727365A1 (en) 2008-06-02 2009-06-05 Method for diagnosing cancers expressing the her2 receptor or its truncated variants
CN200980126660.1A CN102202692B (en) 2008-06-02 2009-06-05 Method for diagnosing cancer expressing HER2 receptor or truncated form thereof
EP09772265.6A EP2293819B1 (en) 2008-06-02 2009-06-05 Method for diagnosing cancers expressing a truncated her2 receptor variant
JP2011512150A JP5753079B2 (en) 2008-06-02 2009-06-05 Methods for diagnosing cancers that express the HER2 receptor or truncated variants thereof
EA201001874A EA025218B1 (en) 2008-06-02 2009-06-05 A METHOD FOR DIAGNOSTIC MALIGNANT NUMER FORMATION, EXPRESSING THE HER2 RECEPTOR OR HIS REDUCED OPTIONS
BRPI0914969A BRPI0914969A2 (en) 2008-06-02 2009-06-05 method for diagnosing cancers expressing the her2 receptor or its truncated variants
KR1020117000466A KR101785117B1 (en) 2008-06-02 2009-06-05 Method for diagnosing cancers expressing the her2 receptor or its truncated variants
MX2010013419A MX2010013419A (en) 2008-06-02 2009-06-05 Method for diagnosing cancers expressing the her2 receptor or its truncated variants.
IL209769A IL209769A (en) 2008-06-02 2010-12-05 A method for diagnosing cancers that express the 2her receptor or its variants
ZA2010/09010A ZA201009010B (en) 2008-06-02 2010-12-14 Method for diagnosing cancers expressing the her2 receptor or its truncated variants

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
ES200801652A ES2342646B1 (en) 2008-06-02 2008-06-02 METHOD OF DIAGNOSIS OF CANCERES THAT EXPRESS THE RECEIVER HER-2 OR ITS TRUNCATED VARIANTS.
ESP200801652 2008-06-02

Publications (1)

Publication Number Publication Date
WO2010000565A1 true WO2010000565A1 (en) 2010-01-07

Family

ID=40911029

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2009/056976 Ceased WO2010000565A1 (en) 2008-06-02 2009-06-05 Method for diagnosing cancers expressing the her2 receptor or its truncated variants

Country Status (20)

Country Link
US (1) US8389227B2 (en)
EP (1) EP2293819B1 (en)
JP (2) JP5753079B2 (en)
KR (2) KR20160140974A (en)
CN (1) CN102202692B (en)
AU (2) AU2009265921B2 (en)
BR (1) BRPI0914969A2 (en)
CA (1) CA2727365A1 (en)
CY (1) CY1115798T1 (en)
DK (1) DK2293819T3 (en)
EA (1) EA025218B1 (en)
ES (2) ES2342646B1 (en)
HR (1) HRP20141158T1 (en)
IL (1) IL209769A (en)
MX (1) MX2010013419A (en)
PL (1) PL2293819T3 (en)
PT (1) PT2293819E (en)
SI (1) SI2293819T1 (en)
WO (1) WO2010000565A1 (en)
ZA (1) ZA201009010B (en)

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2330131A1 (en) * 2009-12-07 2011-06-08 Fundació Privada Institució Catalana De Recerca I Estudis Avancats Antibodies against HER2 truncated variant CTF-611
EP2438442A4 (en) * 2008-12-01 2013-04-03 Lab Corp America Holdings METHODS AND ASSAYS FOR MEASURING P95 AND / OR P95 IN SAMPLE AND SPECIFIC P95 ANTIBODIES
US9110066B2 (en) 2009-01-15 2015-08-18 Laboratory Corporation Of America Holdings HER-3 antibodies and methods of use
CN110172448A (en) * 2019-05-30 2019-08-27 中南大学湘雅二医院 A kind of synovial sarcoma cells system hSS-005R and its progeny cell system
US10416162B2 (en) 2007-12-20 2019-09-17 Monogram Biosciences, Inc. Her2 diagnostic methods
US10882918B2 (en) 2016-09-30 2021-01-05 Hoffmann-La Roche Inc. Bispecific T cell activating antigen binding molecules
WO2021013950A1 (en) 2019-07-23 2021-01-28 Mnemo Therapeutics Immune cells defective for suv39h1
EP3915576A1 (en) 2020-05-28 2021-12-01 Fundació Privada Institut d'Investigació Oncològica de Vall-Hebron Chimeric antigen receptors specific for p95her2 and uses thereof
WO2023126458A1 (en) 2021-12-28 2023-07-06 Mnemo Therapeutics Immune cells with inactivated suv39h1 and modified tcr
WO2023222928A2 (en) 2022-05-20 2023-11-23 Mnemo Therapeutics Compositions and methods for treating a refractory or relapsed cancer or a chronic infectious disease
WO2024062138A1 (en) 2022-09-23 2024-03-28 Mnemo Therapeutics Immune cells comprising a modified suv39h1 gene

Families Citing this family (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002081649A2 (en) * 2001-04-06 2002-10-17 The Trustees Of The University Of Pennsylvania ErbB INTERFACE PEPTIDOMIMETICS AND METHODS OF USE THEREOF
ES2342646B1 (en) * 2008-06-02 2011-04-26 Institut De Recerca Hospital Universitari Vall Hebron METHOD OF DIAGNOSIS OF CANCERES THAT EXPRESS THE RECEIVER HER-2 OR ITS TRUNCATED VARIANTS.
NZ596468A (en) * 2009-05-14 2013-11-29 Nestec Sa Biomarkers for determining sensitivity of breast cancer cells to her2-targeted therapy
CN103102414B (en) * 2013-02-04 2014-08-27 无锡傲锐东源生物科技有限公司 HER2-resistant protein monoclonal antibody and application thereof
US20160067307A1 (en) 2013-05-01 2016-03-10 Five Prime Therapeutics, Inc. Methods of treating cancer
ES2809729T3 (en) 2014-03-11 2021-03-05 Molecular Templates Inc Proteins comprising effector regions of the A subunit of Shiga toxin near the amino terminus and cell-recognition immunoglobulin-like binding regions capable of specifically binding HER2 / neu / ErbB2
JP6935195B2 (en) 2014-03-11 2021-09-15 モレキュラー テンプレーツ, インク.Molecular Templates, Inc. Protein containing binding region, effector region of Shiga toxin A subunit, and carboxy-terminal endoplasmic reticulum localization signal motif
EP3303373B1 (en) 2015-05-30 2020-04-08 Molecular Templates, Inc. De-immunized, shiga toxin a subunit scaffolds and cell-targeting molecules comprising the same
KR20180030085A (en) 2015-07-26 2018-03-21 몰레큘러 템플레이츠, 인코퍼레이션. Cell-targeting molecule comprising a cytotoxin A subunit agonist and a CD8 + T-cell epitope
CN109476744B (en) * 2016-05-12 2023-04-11 新加坡科技研究局 anti-ERBB-2 antibodies and uses thereof
MX2019008840A (en) 2017-01-25 2019-09-09 Molecular Templates Inc Cell-targeting molecules comprising de-immunized, shiga toxin a subunit effectors and cd8+ t-cell epitopes.
CN110612117B (en) 2018-04-17 2024-04-12 分子模板公司 HER2 targeting molecules comprising deimmunized shiga toxin a subunit scaffolds
CN110865184B (en) * 2019-12-04 2023-04-07 广州医科大学附属第三医院(广州重症孕产妇救治中心、广州柔济医院) Application of SRSP protein and SRSP epitope peptide and product for diagnosing and treating tumors
EP4077368A1 (en) * 2019-12-18 2022-10-26 Bracco Imaging SPA Anti-her2 polypeptides derivatives as new diagnostic molecular probes
EP4253418A1 (en) 2022-03-29 2023-10-04 Fundació Privada Institut d'Investigació Oncològica de Vall-Hebron Immune cells expressing chimeric antigen receptors and bispecific antibodies and uses thereof
KR20250147080A (en) * 2024-04-03 2025-10-13 한국원자력의학원 Radioisotope-labeled anti-HER2 antibody-chelator conjugate, pharmaceutical composition comprising the same, and method for producing the same

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1998006863A1 (en) * 1996-08-14 1998-02-19 The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services A vector for polynucleotide vaccines
WO1999031140A1 (en) * 1997-12-12 1999-06-24 Genentech, Inc. TREATMENT WITH ANTI-ErbB2 ANTIBODIES
WO2000069460A1 (en) * 1999-05-14 2000-11-23 Genentech, Inc. TREATMENT WITH ANTI-ErbB2 ANTIBODIES
WO2001015730A1 (en) * 1999-08-27 2001-03-08 Genentech, Inc. DOSAGES FOR TREATMENT WITH ANTI-ErbB2 ANTIBODIES
US7371376B1 (en) * 1996-10-18 2008-05-13 Genentech, Inc. Anti-ErbB2 antibodies

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP3040121B2 (en) 1988-01-12 2000-05-08 ジェネンテク,インコーポレイテッド Methods of treating tumor cells by inhibiting growth factor receptor function
DE69535673D1 (en) 1994-08-30 2008-02-07 Univ Dundee MEANS FOR THE INDUCTION OF APOPTOSIS AND THERAPY APPLICATION
EP1653986A4 (en) * 2003-08-01 2007-03-14 Smithkline Beecham Corp TREATMENT OF CANCERS EXPRESSING P95 SP ERBB2 / SP
JP2006316040A (en) * 2005-05-13 2006-11-24 Genentech Inc HERCEPTIN® adjuvant therapy
ES2342646B1 (en) * 2008-06-02 2011-04-26 Institut De Recerca Hospital Universitari Vall Hebron METHOD OF DIAGNOSIS OF CANCERES THAT EXPRESS THE RECEIVER HER-2 OR ITS TRUNCATED VARIANTS.
ES2637411T3 (en) * 2008-12-01 2017-10-13 Laboratory Corporation Of America Holdings Methods and assays for measuring p95 Y / O p95 in a sample and antibodies specific for p95

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1998006863A1 (en) * 1996-08-14 1998-02-19 The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services A vector for polynucleotide vaccines
US7371376B1 (en) * 1996-10-18 2008-05-13 Genentech, Inc. Anti-ErbB2 antibodies
WO1999031140A1 (en) * 1997-12-12 1999-06-24 Genentech, Inc. TREATMENT WITH ANTI-ErbB2 ANTIBODIES
WO2000069460A1 (en) * 1999-05-14 2000-11-23 Genentech, Inc. TREATMENT WITH ANTI-ErbB2 ANTIBODIES
WO2001015730A1 (en) * 1999-08-27 2001-03-08 Genentech, Inc. DOSAGES FOR TREATMENT WITH ANTI-ErbB2 ANTIBODIES

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
ANIDO JUDIT ET AL: "Biosynthesis of tumorigenic HER2 C-terminal fragments by alternative initiation of translation.", THE EMBO JOURNAL 12 JUL 2006, vol. 25, no. 13, 12 July 2006 (2006-07-12), pages 3234 - 3244, XP002540505, ISSN: 0261-4189 *
SÁEZ ROSANA ET AL: "p95HER-2 predicts worse outcome in patients with HER-2-positive breast cancer.", CLINICAL CANCER RESEARCH : AN OFFICIAL JOURNAL OF THE AMERICAN ASSOCIATION FOR CANCER RESEARCH 15 JAN 2006, vol. 12, no. 2, 15 January 2006 (2006-01-15), pages 424 - 431, XP002540504, ISSN: 1078-0432 *
SCALTRITI MAURIZIO ET AL: "Expression of p95HER2, a truncated form of the HER2 receptor, and response to anti-HER2 therapies in breast cancer.", JOURNAL OF THE NATIONAL CANCER INSTITUTE 18 APR 2007, vol. 99, no. 8, 18 April 2007 (2007-04-18), pages 628 - 638, XP002540506, ISSN: 1460-2105 *

Cited By (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10416162B2 (en) 2007-12-20 2019-09-17 Monogram Biosciences, Inc. Her2 diagnostic methods
US10273308B2 (en) 2008-12-01 2019-04-30 Laboratory Corporation Of America Holdings Methods of producing antibodies specific for p95
US9081019B2 (en) 2008-12-01 2015-07-14 Laboratory Corporation Of America Holdings Methods and assays for measuring p95 and/or p95 complexes in a sample and antibodies specific for p95
EP2438442A4 (en) * 2008-12-01 2013-04-03 Lab Corp America Holdings METHODS AND ASSAYS FOR MEASURING P95 AND / OR P95 IN SAMPLE AND SPECIFIC P95 ANTIBODIES
US9766242B2 (en) 2009-01-15 2017-09-19 Laboratory Corporation Of America Holdings Methods of determining patient response by measurement of HER-3 and P95
US10775382B2 (en) 2009-01-15 2020-09-15 Laboratory Corporation Of America Holdings Methods of determining patient response by measurement of HER-3
US9110066B2 (en) 2009-01-15 2015-08-18 Laboratory Corporation Of America Holdings HER-3 antibodies and methods of use
EP3048117A1 (en) * 2009-12-07 2016-07-27 Fundació Privada Institució Catalana de Recerca I Estudis Avançats Antibodies against her2 truncated variant ctf-611
EP2330131A1 (en) * 2009-12-07 2011-06-08 Fundació Privada Institució Catalana De Recerca I Estudis Avancats Antibodies against HER2 truncated variant CTF-611
US8741586B2 (en) 2009-12-07 2014-06-03 Fundacio Privada Institucio Catalana de Recerca i Estudis Avancats Antibodies against HER2 truncated variant CTF-611
EP2360187A1 (en) * 2009-12-07 2011-08-24 Fundació Privada Institució Catalana De Recerca I Estudis Avancats Antibodies against HER2 truncated variant CTF-611
US10882918B2 (en) 2016-09-30 2021-01-05 Hoffmann-La Roche Inc. Bispecific T cell activating antigen binding molecules
CN110172448A (en) * 2019-05-30 2019-08-27 中南大学湘雅二医院 A kind of synovial sarcoma cells system hSS-005R and its progeny cell system
WO2021013950A1 (en) 2019-07-23 2021-01-28 Mnemo Therapeutics Immune cells defective for suv39h1
EP3915576A1 (en) 2020-05-28 2021-12-01 Fundació Privada Institut d'Investigació Oncològica de Vall-Hebron Chimeric antigen receptors specific for p95her2 and uses thereof
WO2021239965A1 (en) 2020-05-28 2021-12-02 Fundació Privada Institut D'investigació Oncològica De Vall Hebron Chimeric antigen receptors specific for p95her2 and uses thereof
WO2023126458A1 (en) 2021-12-28 2023-07-06 Mnemo Therapeutics Immune cells with inactivated suv39h1 and modified tcr
WO2023222928A2 (en) 2022-05-20 2023-11-23 Mnemo Therapeutics Compositions and methods for treating a refractory or relapsed cancer or a chronic infectious disease
WO2024062138A1 (en) 2022-09-23 2024-03-28 Mnemo Therapeutics Immune cells comprising a modified suv39h1 gene

Also Published As

Publication number Publication date
ZA201009010B (en) 2012-03-28
JP5753079B2 (en) 2015-07-22
ES2528132T3 (en) 2015-02-04
PL2293819T3 (en) 2015-04-30
ES2342646B1 (en) 2011-04-26
ES2342646A1 (en) 2010-07-09
EP2293819A1 (en) 2011-03-16
KR20160140974A (en) 2016-12-07
EA201001874A1 (en) 2011-08-30
BRPI0914969A2 (en) 2015-10-20
KR20110031187A (en) 2011-03-24
KR101785117B1 (en) 2017-11-07
HK1157658A1 (en) 2012-07-06
HRP20141158T1 (en) 2015-02-13
IL209769A0 (en) 2011-02-28
CN102202692B (en) 2014-03-12
JP2015214546A (en) 2015-12-03
AU2015202854A1 (en) 2015-06-18
US20090311262A1 (en) 2009-12-17
CA2727365A1 (en) 2010-01-07
DK2293819T3 (en) 2014-12-08
IL209769A (en) 2016-04-21
EP2293819B1 (en) 2014-09-03
CN102202692A (en) 2011-09-28
MX2010013419A (en) 2011-08-15
JP2011525175A (en) 2011-09-15
PT2293819E (en) 2014-12-09
EA025218B1 (en) 2016-12-30
US8389227B2 (en) 2013-03-05
CY1115798T1 (en) 2017-01-25
SI2293819T1 (en) 2015-01-30
AU2009265921B2 (en) 2015-04-02
AU2009265921A1 (en) 2010-01-07

Similar Documents

Publication Publication Date Title
US8389227B2 (en) Method for diagnosing cancers expressing the HER2 receptor or its truncated variants
US8741586B2 (en) Antibodies against HER2 truncated variant CTF-611
WO2016171242A1 (en) Detection of epha2
CN111406070A (en) Antibodies for cancer diagnosis
JP2024020436A (en) HER2 targeting agent
JP6958817B2 (en) Anti-TMEM-180 antibody, anti-cancer drug, and cancer testing method
TWI782000B (en) Anti gpr20 antibodies, preparation method and application thereof
US20210047418A1 (en) Antibody against alpha-11 integrin and its use
RU2815883C1 (en) Antibodies useful in diagnosing cancer
HK1157658B (en) Method for diagnosing cancers expressing the her2 receptor or its truncated variants
HK40119074A (en) Antibodies useful in cancer diagnosis
HK40085652B (en) Antibodies useful in cancer diagnosis
CA3186062A1 (en) Cell surface mica and micb detection using antibodies

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200980126660.1

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 09772265

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 209769

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 2011512150

Country of ref document: JP

Ref document number: 2727365

Country of ref document: CA

Ref document number: MX/A/2010/013419

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 2009265921

Country of ref document: AU

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2009772265

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 201001874

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: 99/DELNP/2011

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 20117000466

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2009265921

Country of ref document: AU

Date of ref document: 20090605

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: PI0914969

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20101207