WO2009147179A2 - Process of producing male sterile monocotyledonous plants - Google Patents
Process of producing male sterile monocotyledonous plants Download PDFInfo
- Publication number
- WO2009147179A2 WO2009147179A2 PCT/EP2009/056825 EP2009056825W WO2009147179A2 WO 2009147179 A2 WO2009147179 A2 WO 2009147179A2 EP 2009056825 W EP2009056825 W EP 2009056825W WO 2009147179 A2 WO2009147179 A2 WO 2009147179A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- nucleic acid
- acid sequence
- terminal part
- protein
- coding
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8201—Methods for introducing genetic material into plant cells, e.g. DNA, RNA, stable or transient incorporation, tissue culture methods adapted for transformation
- C12N15/8213—Targeted insertion of genes into the plant genome by homologous recombination
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8216—Methods for controlling, regulating or enhancing expression of transgenes in plant cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8262—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield involving plant development
- C12N15/8265—Transgene containment, e.g. gene dispersal
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8287—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for fertility modification, e.g. apomixis
- C12N15/8289—Male sterility
Definitions
- the present invention relates to a process of producing male sterile monocotyle- donous plants by introducing into said plants fragments of a nucleotide sequence coding for a protein which provides for male sterility and reconstituting the complete protein which provides for male sterility by intein-mediated trans-splicing.
- male sterile plants In agriculture, the demand for male sterile plants is increasing for several reasons. First, the use of male sterile plants leads to an enhanced safety of transgenic plants, as these male sterile plants allow to control transgene flow and avoid the undesired and random transfer of foreign genes to related plant species through pollen.
- hybrid progeny shows the so-called “heterosis effect” which means that they display superior plant growth, seed yield and a pronounced stress tolerance in comparison to both parental lines.
- CMS-based hydridization technology is a multi-component genetic system that is difficult to discover, introgress and maintain.
- a genetic source of male sterility must be identified.
- second, for the propagation of male sterile phenotypes so-called "maintainer lines" are needed.
- fertility in the hybrid must be restored, thus fertility restorer lines are required.
- these genetic components have had to be discovered and brought together for each crop species separately.
- the existing hybridization systems introduced by classical breeding methods are difficult to develop, complex to maintain, often marginally reliable and species-specific.
- the barnase enzyme was split into two inactive peptides wherein each partial peptide fragment carries at least one active site residue, so that neither peptide has enzyme activity (Burgess et al. (2002) The Plant Journal 31(1): 113 - 125).
- the ribonuclease activity is then reconstituted by crossing parents wherein one parent has the first fragment of the barnase enzyme and the other parent has the second fragment of the barnase enzyme.
- the two fragments present in the progeny of these crosses are not linked by peptide bonds.
- the barnase activity is not stable at high temperatures and the progeny plants are not suitable for growing in the field.
- WO 03/102197 Al describes a process for producing a transgenic multi-cellular plant expressing a trait of interest, e.g. male sterility, with said trait having a controlled distribution of said trait to progeny, wherein a first fragment of a nucleotide sequence encoding said trait is located on a first locus of a nuclear chromosome and a second fragment of a nucleotide sequence encoding said trait is located on a second locus of a nuclear chromosome.
- progeny Upon crossing the first and the second plant, progeny is created which has the functional trait of interest due to the binding between the protein encoded by said first heterologous nucleotide sequence and the protein encoded by said second heterologous nucleotide sequence.
- the polypeptides are assembled to a functional protein by intein-mediated trans-splicing of the peptides.
- This enables the production of a biologically safe transgenic plant which minimizes the undesired transmission of the transgenic trait to other crops.
- these male sterile monocotyledonous plants may be used in crosses with male fertile plants to produce hybrid plants with superior characteristics.
- Another object of the present invention is to provide a process of producing a male sterile transgenic plant, whereby distribution of the male sterility phenotype to the progeny is strictly controlled and occurs with low probability.
- the present invention provides a method of producing male sterile monocotyledonous plants, comprising the steps of: a) introducing into a monocotyledonous plant or plant cell a first expression cassette comprising the following elements in 5' to 3' orientation: - a tapetum-specific promoter functional in cells of a monocotyledonous plant; operatively linked thereto a nucleic acid sequence coding for an N-terminal part of a protein which provides for male sterility; a nucleic acid sequence coding for the N-terminal part of a first intein; and operatively linked thereto a terminator sequence functional in plant cells; and b) introducing into said plant or plant cell a second expression cassette comprising the following elements in 5' to 3' orientation: - a tapetum-specific promoter functional in cells of a monocotyledonous plant; operatively linked thereto a nucleic acid sequence coding for a C-terminal part of said first intein a nucleic
- a further aspect of the present invention provides a method of producing mono- cotyledonous hybrid plants, comprising the steps of: a) producing a male sterile monocotyledonous plant by a method of the present invention and b) crossing the male sterile monocotyledonous plant of step a) with a male fertile monocotyledonous plant.
- the present invention relates to a transgenic monocotyledonous plant produced by a method of the present invention.
- the present invention relates to a transgenic monocotyledonous plant comprising a nucleic acid sequence coding for an N-terminal part of barnase.
- the invention provides a transgenic monocotyledonous plant comprising a nucleic acid sequence coding for a C-terminal part of barnase. Further, the present invention relates to a transgenic monocotyledonous plant comprising a nucleic acid sequence coding for an N-terminal part of acetolactate synthase.
- the invention provides a transgenic monocotyledonous plant comprising a nucleic acid sequence coding for a C-terminal part of acetolactate synthase.
- the present invention relates to a recombinant nucleic acid molecule comprising the following elements: a) a first expression cassette comprising the following elements in 5' to 3' orientation: a tapetum-specific promoter functional in cells of a monocotyledonous plant; operatively linked thereto a nucleic acid sequence coding for an N-terminal part of a protein which provides for male sterility; a nucleic acid sequence coding for the N-terminal part of a first intein; and operatively linked thereto a terminator sequence functional in said plant cells; and b) a second expression cassette comprising the following elements in 5' to 3' orientation: a tapetum-specific promoter functional in cells of a monocotyledonous plant; operatively linked thereto a nucleic acid sequence coding for a C-terminal part of said first intein a nucleic acid sequence coding for at least one copy of a flexible linker sequence; a nucleic acid sequence coding for a
- the present invention provides an isolated nucleic acid molecule comprising a nucleic acid sequence according to SEQ ID No. 51 or a fragment of said nucleic acid sequence coding for a functional acetolactate synthase fragment.
- the present invention provides an isolated nucleic acid molecule coding for the N-terminal part of an acetolactate synthase, selected from the group consisting of: a) a nucleic acid sequence according to SEQ ID No. 33 or 53; b) nucleic acid sequences coding for a protein according to SEQ ID No. 34 or 54 or a functional fragment thereof; c) nucleic acid sequences hybridising to a complementary strand of the nucleic acid sequence according to SEQ ID No. 33 or 53 under stringent conditions; and d) nucleic acid sequences which are at least 50 % homologous to the nucleic acid sequence shown in SEQ ID No. 33 or 53.
- the present invention provides an isolated nucleic acid molecule coding for the C-terminal part of an acetolactate synthase, selected from the group consisting of: a) a nucleic acid sequence according to SEQ ID No. 43 or 55; b) nucleic acid sequences coding for a protein according to SEQ ID No. 44 or 56 or a functional fragment thereof; c) nucleic acid sequences hybridising to a complementary strand of the nucleic acid sequence according to SEQ ID No. 43 or 55 under stringent conditions; and d) nucleic acid sequences which are at least 50 % homologous to the nucleic acid sequence shown in SEQ ID No. 43 or 55.
- the present invention relates to an isolated nucleic acid molecule comprising a nucleic acid sequence according to SEQ ID No. 49 or a fragment of said nucleic acid sequence coding for a functional barnase fragment.
- the inventors of the present invention have surprisingly found that a vector which led to a high frequency of male sterile dicotyledonous plants among primary transformants did not produce male sterile plants when introduced into mono- cotyledonous plants.
- the nucleotide sequence encoding a protein which provides for male sterility is split into two fragments, thus obtaining a 5' and a 3' part of the nucleotide sequence.
- Said 5' part encodes the N-terminal part of the protein which provides for male sterility and said 3 ' part encodes the C-terminal part of the protein which provides for male sterility.
- Said nucleotide sequence is typically a coding sequence (or an open reading frame) of a protein providing male sterility. However, said nucleotide sequence may also contain one or more introns.
- said nucleotide sequence is preferably split such that each obtained fragment, upon expression, is incapable of generating a protein which provides for male sterility in the absence of the other fragment.
- Each fragment contains a sequence portion necessary for the function of the protein providing for male sterility.
- each fragment preferably contains amino acids necessary for catalysis or substrate binding of the enzyme.
- the protein providing for male sterility may be split into said fragments in many different ways provided that expression of the male sterility requires all said fragments and binding thereof to each other. Structural and functional information known about the protein providing for male sterility may be helpful for finding a suitable splitting site of said nucleotide sequence.
- a fragment generated by splitting a nucleotide sequence at a randomly chosen site is capable of providing male sterility by expressing the fragment in the tapetum of plants and investigating if these plants are able to develop viable pollen.
- a further assay for testing the functionality of the fragments is described in example 6, i.e. syringe infiltration of Nicotiana benthamia- na leaves using Agrobacterium containing either an N- terminal part or a C-terminal fragment of the protein and detection of lesions in the leaves. If lesions occur upon infiltration only with the N-terminal or the C-terminal fragment, these fragments are not suitable for use in the method of the present invention.
- Expression of male sterility requires the presence of both fragments in the same plant, preferably in the same cells thereof. Expression of male sterility further requires transcription and translation of said first and said second fragment and binding of the translation products of said fragments with peptide bond formation to restore a functional protein.
- This peptide bond formation is accomplished by intein-mediated trans-splicing.
- said first and said second expression cassette further code for inteins capable of mediating protein trans-splicing.
- the proteins and polypeptides encoded by said first and said second fragments may be linked by peptide bond formation.
- Trans-splicing inteins may be selected from the nucleolar and organellar genomes of different organisms including eukaryotes, archaebacteria and eubacteria. Inteins that may be used for performing this invention are listed at http ,7/www .neb . com/neb/intcins . html.
- the nucleotide sequence coding for an intein may be split into a 5 ' and a 3 ' part that code for the 5 ' and the 3 ' part of the intein, respectively. Sequence portions not necessary for intein splicing (e.g. homing endonuclease domain) may be deleted.
- the intein coding sequence is split such that the 5' and the 3' parts are capable of trans-splicing.
- the considerations published by Southworth et al. (1998) EMBO J. 17: 918 - 926 may be followed.
- the 5 ' intein coding sequence is linked to the 3 ' end of the first fragment coding for the N-terminal part of the protein which provides for male sterility and the 3' intein coding sequence is linked to the 5' end of the second fragment coding for the C-terminal part of a protein which provides for male sterility.
- peptide bond means the amide linkage between the carboxyl group of one polypeptide and the amino group of another polypeptide.
- male sterile plants is intended to mean plants which are unable to produce functional pollen and therefore are unable to self-pollinate.
- the male sterility enables the controlled breeding to obtain hybrid plants showing the heterosis effect.
- nuclear male sterility which is due to a mutation in the nuclear genome
- cytoplasmic male sterility which is due to a mutation in the mitochondrial genome.
- the term "monocotyledonous plant” is intended to comprise any monocotyledonous plant, preferably agricultural, food or feed plants. More preferably, the monocotyledonous plant is selected from the group consisting of Hordeum (barley), Avena (oat), Triticum (wheat), Secale (rye), Oryza (rice), Sorghum (millet), Zea (corn), Panicum, Pennisetum, Setaria and others. Other preferred monocotyledonous plants are plants of the genus Lolium such as Lolium multiflorum, Lolium perenne and Lolium hybridum. Most preferably, the monocotyledonous plant is a Triticum aestivum plant.
- the first and the second expression cassette can be introduced into a monocotyledonous plant or plant cell by various means, e.g. by transformation of a plant or plant cell with two expression vectors, one of which carrying the first expression cassette and the other one carrying the second expression cassette.
- one expression vector carrying both the first and second expression cassette may be transformed.
- a plant carrying the first expression cassette may be crossed with a monocotyledonous plant carrying the second expression cassette and the progeny of this cross which contains both the first and the second expression cassette will then be male sterile.
- the plants carrying the first or the second expression cassette, respectively have been produced by transformation with the appropriate expression vectors or are progeny of plants produced by such transformation.
- first and the second expression cassette could also be introduced into a plant cell by cell fusion which may be the fusion of germ cells or of somatic cells, wherein one cell carries the first expression cassette and another cell carries the second expression cassette.
- Agrobacterium rhizogenes as a transformation agent, the fusion of protoplasts, the direct gene transfer of isolated DNA into protoplasts, the electroporation of DNA, the introduction of DNA by means of the biolistic method, as well as other possibilities. Thereby, both stable and transient transformants can be generated.
- plasmids For the injection and electroporation of DNA into plant cells there are no special requirements per se for the plasmids used. The same applies for direct gene transfer. Simple plasmids, such as pUC derivates may be used. If, however, whole plants are to be regenerated from such transformed cells, the presence of a selectable marker gene is necessary. The person skilled in the art is acquainted with the current selection markers, and will have no problem in selecting an appropriate marker.
- Standard selection markers are those which mediate resistance to a biocide or an antibiotic such as kanamycin, G418, bleomycin, hygromycin, methotrexate, glyphosate, streptomycin, sulfonyl urea, gentamycin or phosphinotricin and suchlike, to the transformed plant cell.
- an antibiotic such as kanamycin, G418, bleomycin, hygromycin, methotrexate, glyphosate, streptomycin, sulfonyl urea, gentamycin or phosphinotricin and suchlike, to the transformed plant cell.
- the Ti or Ri plasmid is used for the transformation of the plant cell, at least the right flanking region, often however the right and the left flanking region of the T-DNA contained in the Ti or Ri plasmid must be linked as a flanking region with the gene to be introduced. If agrobacteria are used for the transformations, the DNA to be introduced must be cloned in special plasmids, either in an intermediary or in a binary vector.
- the intermediary vectors can be integrated into the Ti or Ri plasmid of the agrobacteria by homologous recombination. This plasmid also contains the vir region necessary for the transfer of the T-DNA. Intermediary vectors cannot replicate in agrobacteria. By means of a helper plasmid, the intermediary vector can be transferred to Agrobacterium tumefaciens (conjugation). Binary vectors can replicate in E. coli as well as in agrobacteria. They contain a selection marker gene and a linker or polylinker which are framed by the right and left T-DNA border regions.
- the agrobacterium serving as a host cell should contain a plasmid which carries a vir region. The vir region is necessary for the transfer of the T-DNA into the plant cell. T-DNA can also be present. This type of transformed agrobacterium is used for the transformation of plant cells.
- the use of T-DNA for the transformation of plant cells has been intensively investigated and is described sufficiently in EP 120 515. Both monocotyledonous and dicotyledonous plants or their cells are very accessible to transformation by means of vectors based on agrobacteria (Chan et al. (1993) Plant MoI. Biol. 22: 491-506).
- plant explants can be cultivated specifically for this purpose with Agrobacterium tumefaciens or Agrobacterium rhizogenes.
- Agrobacterium tumefaciens or Agrobacterium rhizogenes From the infected plant material (for example, pieces of leaf, stem segments, roots, but also protoplasts or suspension-cultivated plant cells) whole plants can be regenerated in an appropriate medium which can contain antibiotics or biocides for the selection of transformed cells.
- the regeneration of the plants takes place according to standard regeneration methods and using the common nutrient solutions.
- the plants and plant cells obtained in this way can be examined for the presence of the DNA introduced.
- the transformed cells grow within the plant in the normal way (see also McCormick et al. (1986) Plant Cell Reports 5: 81-84).
- the resulting plants can be raised in the normal way and be crossed with plants which have the same transformed genetic disposition or other genetic dispositions.
- the resulting hybrid individuals have the respective phenotypical properties.
- Two or more generations should be raised in order to ensure that the phenotypical feature remains stable and is inherited. Seeds should be harvested as well so as to ensure that the respective phenotype or other characteristics are maintained.
- transgenic lines can be determined which are homozygous for the expression cassettes of the present invention and their phenotypical characteristics with regard to male sterility is investigated and compared with that from hemizygous lines.
- expression cassette means a nucleic acid molecule which contains all elements which are necessary for the expression of a gene, i.e. the gene to be expressed under the control of a suitable promoter and optionally further regulatory sequences such as termination sequences.
- An expression cassette of the present invention may be part of an expression vector which is transferred into a plant cell or may be integrated into the chromosome of a transgenic plant after transformation.
- first expression cassette, second expression cassette, third expression cassette” and “fourth expression cassette” are only used to distinguish the different expression cassettes comprising different elements, but are not intended to indicate any spatial relationship or order between the expression cassettes, i.e. the second expression cassette may be located 5' of the first expression cassette within an expression vector or a chromosome.
- the expression vector is selected from the group consisting of plasmids, cosmids, (recombinant) viruses and other vectors known in the field of gene technology, with which nucleic acid molecules can be transferred to plants or plant cells.
- vector also comprises so-called minochromosomes which are linear or circular DNA fragments which contain centromer sequences of the respective plant in addition to the transgene.
- minochromosomes are stable in the nucleus and are passed on to the daughter cells during cell division. They are transferred by standard methods of transformation.
- the vector is selected from the group consisting of pBR322, pUC vectors, M13mp vectors or vectors being derived from the Ti plasmid or the Ri plasmid of agrobacteria.
- pBR322 pUC vectors, M13mp vectors or vectors being derived from the Ti plasmid or the Ri plasmid of agrobacteria.
- a large number of cloning vectors are available which contain a replication signal for E. coli and a marker gene for the selection of transformed bacterial cells. Examples of such vectors are pBR322, pUC series, M13mp series, pACYC184, etc.
- the required sequence can be introduced into the vector at an appropriate restriction site.
- the plasmid obtained is used for the transformation of E. coli cells. Transformed E.
- coli cells are cultivated in an appropriate medium, and finally harvested and lysed.
- the plasmid is recovered.
- methods such as restriction analyses, gel electrophoreses and other biochemical/molecular biological methods are generally used.
- the plasmid DNA can be cleaved and the DNA fragments obtained can be combined with other DNA sequences.
- Each plasmid DNA sequence can be cloned into the same or other plasmids. Standard cloning methods can be taken from Sambrook et al., 2001 (Molecular cloning: A laboratory manual, 3 rd edition, Cold Spring Harbor Laboratory Press).
- tapetum-specific promoter within the meaning of the present invention is understood to mean that a nucleic acid sequence under the control of a tapetum- specific promoter region is expressed in the tapetum of plants.
- a promoter is also tapetum-specific within the meaning of the present invention if the promoter region preferentially leads to the expression of the nucleic acid sequence in the tapetum in comparison to other cell types and leads to a significantly increased expression such as at least two-fold, preferably at least five-fold and particularly preferably at least ten-fold and most preferably at least fifty-fold increased expression in tapetum in comparison to other cell types.
- a nucleic acid sequence in different tissues and organs can be determined with in situ detection techniques known to the person skilled in the art.
- a reporter gene such as ⁇ -glucuronidase may be expressed under the control of the promoter to be investigated and the activity of the reporter gene in different organs may be determined.
- fertilizer is known to the expert and is intended to mean the highly specialized, transient tissue surrounding the (micro-)spores and/or pollen grains during their development. Supplementary information can be derived from any plant anatomy or plant physiology book such as Strassburger, Lehrbuch der Botanik, 35. Auflage 2002, Spektrum Akademischer Verlag.
- Suitable tapetum-specific promoters are known to the person skilled in the art and include the promoter of the rice osg ⁇ b gene (Tsuchiya et al. (1995) Plant Cell Physiol. 36: 487 - 494), the pca55 promoter from corn (WO 92/13956) and the pEl and pT72 promoters from rice (WO 92/13957).
- the tapetum-specific promoter is the promoter from the rice osg6B gene.
- the tapetum-specific promoter of the present invention does not have to be derived from a mono- cotyledonous plant, but can also be isolated from a dicotyledonous plant, as long as the promoter is functional in cells of a monocotyledonous plant, i.e. as long as it is capable of directing tapetum-specific expression of nucleic acid sequences operatively linked thereto in monocotyledonous plants.
- the "protein which provides for male sterility” may be any protein the expression of which in the tapetum leads to male sterile plants by interfering with the function and development of pollen.
- genes include RNases, ribosomal inhibitor proteins (Cho et al. (2001) MoI. Cells 11: 326 - 333), sucrose isomerase (WO 01/59135), protease and glucanase (Tsuchiya et al. (1995) Plant Cell Physiol. 36: 487 - 494).
- the protein which provides for male sterility is an RNase.
- RNases are barnase (Mariani et al.
- the protein which provides for male sterility is barnase, i.e. ribonuclease from Bacillus amyloliquefaciens.
- barnase i.e. ribonuclease from Bacillus amyloliquefaciens.
- the amino acid sequence of barnase from Bacillus amyloliquefaciens is shown in SEQ ID No. 2 and the native nucleic acid sequence coding for barnase is depicted in SEQ ID No. 1.
- the nucleic acid sequences coding for the N- and the C-terminal part of barnase are adapted to the codon usage of monocotyledonous plants, more preferably to the codon usage of Triticum aestivum.
- the nucleic acid sequence coding for the barnase which is adapted to the codon usage of Triticum aestivum is shown in SEQ ID No. 49.
- said nucleotide sequence is preferably split such that each obtained fragment, upon expression, is incapable of generating a functional barnase protein in the absence of the other fragment.
- Each barnase fragment contains a sequence portion necessary for the barnase function.
- the barnase may be split into said fragments in many different ways provided that expression of the male sterility requires all said fragments and binding thereof to each other.
- One can easily test experimentally whether a fragment generated by splitting the barnase nucleotide sequence at a randomly chosen site is capable of providing male sterility by expressing the fragment in the tapetum of plants and investigating if these plants are able to develop viable pollen.
- the barnase is split into said fragments in the amino acid region between amino acid residues 30 and 40 of the mature protein, i.e. between amino acids 30 and 31, 31 and 32, 32 and 33, 33 and 34, 34 and 35, 35 and 36, 36 and 37, 37 and 38, 38 and 39 or 39 and 40 of the amino acid sequence according to SEQ ID No. 50.
- the N-terminal part of the barnase comprises 36 amino acids, and the C-terminal part of the barnase comprises 75 amino acids.
- the N- terminal part of barnase may comprise 35 amino acids if no methionine is added to the N-terminus.
- the N-terminal part of the barnase is encoded by a nucleic acid sequence according to SEQ ID No. 3 or 13 and the C-terminal part of the barnase is encoded by a nucleic acid sequence according to SEQ ID No. 5 or 27.
- the N- terminal part of the barnase preferably has the amino acid sequence according to SEQ ID No. 4 or 14 and the C- terminal part of the barnase preferably has the amino acid sequence according to SEQ ID No. 6 or 28.
- the invention is also intended to comprise smaller fragments of the barnase protein or "functional barnase fragments", as long as the N- and the C-terminal parts of such fragment restore a functional, enzymatically active protein upon intein- mediated trans-splicing which protein leads to male sterility when expressed in the tapetum of plants.
- the C-terminal part may lack one or more amino acid residues at its C-terminus and/or the N-terminal part may lack one or more amino acid residues at its N-terminus.
- intein-mediated trans-splicing a protein smaller than the wild-type protein is formed from the two fragments which protein is functional and enzymatically active.
- the nucleotide sequence coding for the N- or C-terminal part of the protein which provides for male sterility is to be expressed in a cell, it has to be observed that no sequences which would lead to a termination of the transcription are located between the promoter sequence and the nucleotide sequence coding for the N- or C-terminal part of the protein which provides for male sterility.
- the "termination sequences” are sequences which ensure that the transcription or the translation is properly terminated. If the transferred nucleic acids are to be translated, the termination sequences are typically stop codons and corresponding regulatory sequences; if the transferred nucleic acids are only to be transcribed, they are generally poly-A sequences. Preferably, the termination sequence is selected from the octopine synthase terminator and the nopaline synthase terminator (Jones et al. (1992) Transgenic Res. 1: 285 - 297).
- the "flexible linker sequence" within the scope of the present invention is a short flexible peptide which is used to bridge the N- and the C-terminal part of the protein which provides for male sterility without serious steric interference.
- the flexible linker sequence brings the two splice junctions in close proximity and helps to precisely align all reacting groups. Hence, efficient splicing is supported (Chong and Xu (1997) J. Biol. Chem. 272: 15587 - 15590).
- the most widely used linker designs have sequences consisting essentially of stretches of glycine (G) and serine (S) residues, because hydrophilic amino acids allow hydrogen bonding to the solvent and glycines provide the necessary flexibility.
- linkers are not able to form an ordered secondary structure.
- the term "essentially consist of glycine and serine residues" is intended to mean that at least 60% or 65%, preferably 70% or 75%, more preferably 80%, 82%, 84%, 86% or 88%, even more preferably 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the amino acid residues within the flexible linker sequence are glycine and/or serine residues. Most preferably, all amino acid residues within the flexible linker sequence are glycine and/or serine residues.
- the length of the linker sequences should be selected such that the linker peptides are too short to allow pairing of the domains of the same amino acid chain, but favour pairing between domains in two adjacent chains.
- the length of the linker sequence may be 1 to 20 amino acids, preferably 2 to 15 amino acids, more preferably 3 to 10 amino acids, even more preferably 4 to 8 amino acids and most preferably 5 amino acids.
- the flexible linker sequence has the amino acid sequence GGGGS.
- the flexible linker sequence is present in at least one copy, preferably 1 to 5 copies, more preferably 2 to 4 copies and most preferably three copies. If multiple copies of the flexible linker sequence are used every copy is preferably encoded by different codons to avoid interference.
- the tapetum-specific promoter used in the second expression cassette may be the same as the one used in the first expression cassette or it may be different from the promoter used in the first expression cassette, preferably the same tapetum-specific promoter is used in the first and the second expression cassette to achieve equimolar expression of the N- and the C-terminal fragments.
- "Inteins” are proteins that are able to catalyze trans-splicing events between separate protein fragments as they are able to excise themselves from precursor molecules and ligate the flanking protein sequences in a process termed protein-splicing (Southworth et al. (1998) EMBO J. 17: 918 - 926; Wu et al. (1998) Proc. Natl. Acad. Sci.
- inteins are known. They are distributed among the genomes of different organisms including eukaryotes, archaebacteria and eubacteria. An overview of the currently available inteins is given by the homepage http : //tools .neb . com/inbase/indcx.php (inbase, the intein database (Perler (2002) Nucleic Acids Res. 30: 383 - 384)).
- the first intein is selected from the group consisting of DnaB and DnaE, both from the green-blue algae of Synechocystis spec. More preferably, the first intein is DnaB and most preferably, the first intein is encoded by a nucleic acid sequence according to SEQ ID No. 7 or has the amino acid sequence according to SEQ ID No. 8. The nucleic acid sequence coding for the N-terminal part of DnaB is depicted in SEQ ID No. 9 and the nucleic acid sequence coding for the C-terminal part of DnaB is shown in SEQ ID No. 11.
- nucleic acid sequences coding for the N- and the C-terminal part of the protein which provides for male sterility and the nucleic acid sequences coding for the N- and the C-terminal part of the first intein are adapted to the codon usage of monocotyledonous plants.
- the codon usage is adapted to the codon usage of the wheat plant
- the first and the second expression cassette are introduced into a rye plant
- the nucleic acid sequences are adapted to the codon usage of the rye plant.
- the use of a nucleic acid sequence the codon usage of which has been adapted to the codon usage in wheat may also have advantages in monocotyledonous plant species closely related to wheat, such as rye or barley.
- the nucleic acid sequences coding for the N- and the C-terminal part of the protein which provides for male sterility and the nucleic acid sequences coding for the N- and the C-terminal part of the first intein are adapted to the codon usage of Triticeae, more preferably they are adapted to the codon usage of plants of the genus Triticum and most preferably they are adapted to the codon usage in Triticum aestivum.
- the genetic code is redundant, as 20 amino acids are specified by 61 triplet codons. Thus, most of the 20 proteinogenic amino acids are coded by several base triplets (codons).
- the synonymous codons which specify an individual amino acid are not used with the same frequency in a specific organism, but there are preferred codons, which are used frequently, and codons which are used less frequently. Said differences in codon usage may be due to selective evolutionary pressures, and, in particular, to the efficiency of translation.
- One reason for the lower translation efficiency of rarely occurring codons could be that the corresponding aminoacyl- tRNA pools are depleted and are therefore no longer available for protein synthesis.
- the optimized nucleic acid sequence coding for the N-terminal part of the barnase is shown in SEQ ID No. 13 and the nucleic acid sequence coding for the C-terminal part of the barnase is shown in SEQ ID No. 27. Further, the optimized nucleic acid sequence coding for the N-terminal part of the DnaB intein is shown in SEQ ID No. 17 and the optimized nucleic acid sequence coding for the C-terminal part of the DnaB intein is shown in SEQ ID No. 19.
- stretches containing exon sequences are inserted between the nucleic acid sequences coding for the C-terminal part of the intein and the C-terminal part of the protein which provides for male sterility and between the N-terminal part of the protein which provides for male sterility and the N-terminal part of the intein.
- protein-splicing is dependent on the chemical nature of the splice-site junction amino acids, the insertion of stretches containing exon sequences is supposed to increase the efficiency of protein trans-splicing (Sun et al. (2001) Appl. Environ. Microbiol. 67: 1025 - 1029).
- the inserted exon sequences provide the parts of the exteins which are advantageous for the function of the corresponding intein.
- the first expression cassette comprises a nucleic acid sequence coding for an amino acid sequence comprising the amino acid sequence RESG or fragments of said sequence from the DnaB extein and the second expression cassette comprises a nucleic acid sequence coding for an amino acid sequence comprising an amino acid sequence selected from the group consisting of SEEQDHG and SIEQD or fragments of said sequences.
- the second expression cassette comprises a nucleic acid sequence coding for an amino acid sequence comprising the amino acid sequence SIEQD or fragments of said sequence.
- "Fragments of the RESG extein sequence" may be for example ESG or SG.
- “Fragments of the SIEQD extein sequence” may be for example IEQD, EQD or QD.
- the one or more additional amino acid residues are located in the N-terminus of the RESG, SEEQDHG and SIEQD sequence, respectively.
- the first and the second expression cassette do not comprise any nucleic acid sequences coding for amino acids other than the above mentioned, i.e. the N- and the C-terminal part of the protein which provides for male sterility, the N- and the C-terminal part of the first intein and the nucleic acid sequence coding for at least one copy of the flexible linker sequence as well as optionally sequences from the extein sequence as described above.
- any amino acids that have been inserted into the original vector as a result of the cloning strategies and that are not present in the native amino acid sequence of the protein which provides for male sterility are removed.
- a nucleic acid sequence coding for a protein which is a phenotypical marker is introduced into said plants together with the first and the second expression cassette.
- a protein which is a phenotypical marker is intended to mean a protein the expression of which leads to a property of the plant which allows the identification of plants that have been transformed with the nucleic acid sequence coding for the phenotypical marker.
- Suitable phenotypical markers are for example proteins conferring herbicide resistance, proteins involved in anthocyanin synthesis or reporter proteins such as glucuronidase, luciferase and green fluorescent protein.
- the phenotypical marker is a protein which confers herbicide resistance.
- the protein which confers herbicide resistance can be used for the selection of plants which contain both the N- and the C-terminal part of the protein which provides for male sterility.
- the protein which confers herbicide resistance may be selected from the group consisting of acetolactate synthase, 5-enolpyruvylshikimate-3-phosphate synthase, phosphinotricin acetyl transferase (BAR), betainaldehyde dehydrogenase (BADH), dihydrofolate reductase (DFRl) and glyphosate oxidoreductase.
- the protein which confers herbicide resistance is acetolactate synthase which is the first enzyme in the synthesis of branched chain amino acids.
- This protein can be engineered to confer resistance to sulphonylureas and imidazolinones (Tan et al. (2005) Pest Manag Sci. 61: 246 - 257).
- the acetolactate synthase gene is derived from rice (GeneBank Accession No. AP008208, Oryza sativa; japonica cultivar group; genomic DNA, chromosome 2, position 18335903 - 18337834) and has been engineered according to the teachings in Tan et al. (2005) Pest Manag Sci.
- 61: 246 - 257 to confer resistance to sulphonylureas and imidazolinones.
- a mutation of tryptophane to leucin was introduced on position 548 so that the protein is able to confer herbicide resistance.
- other mutations on other positions are conceivable, for example a tryptophane to serine mutation on position 548.
- nucleic acid sequence coding for the acetolactate synthase is selected from the group consisting of:
- nucleic acid sequences a) a nucleic acid sequence according to SEQ ID No. 31 or 51 ; b) nucleic acid sequences coding for a protein according to SEQ ID No. 32 or 52 or a functional fragment thereof; c) nucleic acid sequences hybridizing to a complementary strand of the nucleic acid sequence according to SEQ ID No. 31 or 51 under stringent conditions; and d) nucleic acid sequences which are at least 50 % homologous to the nucleic acid sequence shown in SEQ ID No. 31 or 51.
- the protein encoded by the nucleic acid sequence comprises a mutation that confers herbicide resistance.
- the mutation is a tryptophan to leucine mutation on position 548 of the amino acid sequence according to SEQ ID NO. 32 or 52 or a tryptophan to serine mutation on position 548 of the amino acid sequence according to SEQ ID NO. 32 or 52.
- the term "homologous” is generally understood to denote that the nucleic acid or amino acid sequence of a DNA molecule or of a protein is identical to the nucleic acid or amino acid sequences of acetolactate synthase or functionally equivalent parts thereof by at least 50%, preferably by at least 55%, further preferably by at least 60%, also preferably by at least 70%, 80% or 85%, especially preferably by at least 90%, 91%, 92% or 93%, particularly preferably by at least 94%, 95%, 96% or 97% and most preferably by at least 98% or 99%.
- homology is determined over the entire sequence length of acetolactate synthase.
- Identity of two proteins is understood to denote the identity of the amino acids over a particular protein region, preferably over the entire protein length, in particular the identity calculated by comparison with the aid of the Lasergene software by DNA Star Inc., Madison, Wisconsin (USA) using the CLUSTAL method (Higgins et al. (1989) Comput. Appl. Biosci. 5 (2): 151).
- Nucleic acid molecules are identical if they have identical nucleotides in the same 5' to 3 ' order.
- homology is preferably calculated over the entire amino acid or nucleic acid sequence region.
- programs mentioned above the person skilled in the art knows further programs based on different algorithms for comparing different sequences.
- the Clustal W program as can be called up at http://www.ebi.ac.uk/clustalw, was used for the sequence alignments conducted within the scope of the present invention.
- the parameters of said default homepage remained unaltered for the alignments.
- a further object of the present invention are nucleic acid molecules, which hybridize under stringent conditions with, or are substantially complementary to, those nucleic acid molecules coding for acetolactate synthase or functionally equivalent parts thereof.
- complementarity describes the capability of a nucleic acid molecule of hybridizing with another nucleic acid molecule due to hydrogen bonds formed between complementary bases. The person skilled in the art is aware of the fact that two nucleic acid molecules do not have to have a 100% complementarity in order to be able to hybridize with each other.
- a nucleic acid sequence which is supposed to hybridize with another nucleic acid sequence, is complementary to the latter by at least 40%, by at least 50%, by at least 60%, preferably by at least 70%, especially preferably by at least 80%, also especially preferably by at least 90%, particularly preferably by at least 95%, and most preferably by at least 98% or 100%.
- hybridization relates to the fact that a molecule preferably binds to a specific nucleic acid sequence under stringent conditions, provided that said nucleic acid sequence is part of a complex mixture of, for example, DNA or RNA molecules.
- stringent conditions relates to conditions, under which a nucleic acid sequence preferably binds to a target sequence, but not, or at least in a significantly reduced manner, to other sequences. Stringent conditions are dependent on the circumstances. Longer sequences hybridize specifically at higher temperatures. In general, stringent conditions are selected in such a way that the hybridization temperature is about 5°C below the melting point (T m ) for the specific sequence at a defined ionic strength and a defined pH value. T m is the temperature (at a defined pH value, a defined ionic strength, and a defined nucleic acid concentration), at which 50% of the molecules, which are complementary to a target sequence, hybridize with said target sequence.
- stringent conditions comprise salt concentrations between 0.01 and 1.0 M sodium ions (or ions of another salt) and a pH value between 7.0 and 8.3.
- the temperature is at least 30 0 C for short molecules (for example, for those comprising between 10 and 50 nucleotides).
- stringent conditions may comprise the addition of destabilizing agents, like for example formamide.
- Typical hybridization and washing buffers are of the following composition.
- Hybridization solution Pre-hybridization solution
- Pre-hybridization at least 2 h at 50-55 0 C
- the protein which confers herbicide resistance is expressed under the control of a promoter which is functional in cells of a monocotyledonous plant.
- this promoter does not have to be derived from a monocotyledonous plant as long it can govern the expression of a nucleic acid sequence operatively linked thereto in cells of a monocotyledonous plant.
- constitutive promoters such as the 35S promoter, the actin promoter or the ubiquitin promoter are used, however, other promoters can of course be used which are obtainable from different sources such as plants or plant viruses or fungi and which are suitable for the expression of genes in monocotyledonous plants.
- promoter and other regulatory sequences determines the local and temporal expression pattern of the gene of the protein which confers a herbicide resistance.
- tissue-specific promoters such as the phosphoenolpyruvate promoter or the fructose- 1,6-bisphosphatase promoter or inducible promoters are conceivable.
- the protein conferring herbicide resistance is expressed under the control of a rice actinl promoter (McElroy et al. (1990) Plant Cell 2: 163 - 171).
- the nucleic acid sequence coding for the protein which is a phenotypical marker is also adapted to the codon usage of monocotyledonous plants. More preferably, the codon usage is adapted to the codon usage of the plant into which the first and the second expression cassette are introduced, preferably to the codon usage of Triticeae, even more preferably to the codon usage of the genus Triticum and most preferably to the codon usage of Triticum aestivum.
- the protein which confers herbicide resistance is also split into two fragments which are assembled to a functional protein by intein-mediated trans- splicing.
- a third and a fourth expression cassette are introduced into a mono- cotyledonous plant in addition to the first and the second expression cassette.
- the third expression cassette comprises the following elements in 5' to 3' orientation:
- a promoter functional in cells of a monocotyledonous plant - operatively linked thereto a nucleic acid sequence coding for an N-terminal part of a protein which confers herbicide resistance; a nucleic acid sequence coding for the N-terminal part of the second intein; and optionally, operatively linked thereto a terminator sequence functional in said plant cells.
- the fourth expression cassette comprises the following elements in 5' to 3' orientation:
- the expression from the third and the fourth expression cassette will restore a herbicide resistance gene upon trans-splicing catalysed by the second intein.
- the protein which confers herbicide resistance is acetolactate synthase (ALS). More preferably, the acetolactate synthase is split into said fragments in the amino acid region between amino acid residues 400 and 410 of the mature protein according to SEQ ID NO. 32 or 52, i.e. between amino acids 400 and 401, 401 and
- the N-terminal part of the acetolactate synthase has
- stretches containing exon sequences are inserted between the nucleic acid sequences coding for the C-terminal part of the second intein and the C-terminal part of the protein which is a phenotypical marker and between the N-terminal part of the protein which is a phenotypical marker and the N-terminal part of the second intein.
- These exon sequences provide the parts of the extein which are advantageous for the function of the intein.
- the third expression cassette comprises a nucleic acid sequence coding for an amino acid sequence comprising the amino acid sequence DVKFAEY or fragments of said sequence from the DnaE extein and the second expression cassette comprises a nucleic acid sequence coding for an amino acid sequence comprising the amino acid sequence CFNHG or fragments of said sequence.
- “Fragments of the DVKFAEY extein sequences” may be for example VKFAEY, KFAEY, FAEY, AEY or EY.
- “Fragments of the CFNHG extein sequences” may be for example FNHG, NHG and HG.
- amino acid sequence comprising the amino acid sequence DVKFAEY or "an amino acid sequence comprising the amino acid sequence CFNHG” may be an amino acid with one or more amino acid residues in addition to the DVKFAEY or CFNHG sequence, respectively.
- the one or more amino acid residues in addition are located on the N-terminus of the DVKFAEY or CFNHG sequence, respectively.
- the fourth expression cassette further comprises a nucleic acid sequence coding for at least one copy of a flexible linker sequence which nucleic acid sequence is located between the nucleic acid sequence coding for the C-terminal part of said second intein and the nucleic acid sequence coding for a C-terminal part of said protein which is a phenotypical marker.
- the flexible linker is defined as above with respect to the second expression cassette.
- an artificial chloroplast targeting sequence has to be fused to this fusion protein.
- the artificial chloroplast targeting sequence has the amino acid sequence
- MASSMLSSAAVVATRASAAQASMVAPFTGLKSAASFPVTRKQNNLDITSIAS NGGRVQCA or is a functional fragment thereof which is still capable of directing the transport of proteins to the chloroplast.
- the second intein the N- and the C-terminal part of which are present in the third and the fourth expression cassette, respectively, is other than the first intein the N- and the C-terminal part of which is present in the first and second expression cassette so that the first and the second intein do not cross-react with each other and do not lead to mis-spliced products due to the universal nature of interaction between the intein parts.
- the first, the second, the third and the fourth expression cassette are all located on the same expression vector.
- the expression vector comprises a first part comprising the first expression cassette and the third or fourth expression cassette, and a second part comprising the second expression cassette and the third (if the first part comprises the fourth expression cassette) or fourth expression cassette (if the first part comprises the third expression cassette) . More preferably, both the first part and the second part are flanked by recombinase recognition sites.
- a “recombinase” is an enzyme which catalyzes a recombination process.
- the recombinase recognizes certain nucleic acid sequences, the so called “recombinase recognition sites", and leads to a recombination of these sites.
- One recombinase which could be used for catalyzing a recombination is the Streptomyces phage PhiC31 integrase which catalyzes the irreversible recombination between attB and attP recognition sites. The site-specific recombination between these sites leads to the deletion of sequences located between the participating recombinase recognition sites.
- an expression vector comprising a first part comprising the first expression cassette and the third or fourth expression cassette, and a second part comprising the second expression cassette and the third (if the first part comprises the fourth expression cassette) or fourth expression cassette (if the first part comprises the third expression cassette), wherein both the first part and the second part are flanked by recombinase recognition sites is first introduced into a plant to form a pro-locus.
- the recombinase Upon crossing said plants carrying the pro-locus with a plant expressing a site-specific recombinase such as Streptomyces phage PhiC31, the recombinase will catalyze the irreversible site-specific recombination between the recombinase recognition sites and derivative loci will be obtained which contain either the first or the second part.
- a site-specific recombinase such as Streptomyces phage PhiC31
- a first derivative locus contains a nucleic acid sequence coding for the N-terminal part of the protein which provides for male sterility and a nucleic acid sequence coding for the N-terminal part of a protein which confers herbicide resistance and a second derivative locus contains a nucleic acid sequence coding for the C-terminal part of the protein which provides for male sterility and the C-terminal part of the protein which confers herbicide resistance.
- the first and the second derivative locus are located on identical loci on homologous chromosomes, i.e. they are "linked in repulsion".
- the protein which confers herbicide resistance is not split.
- the first part of the expression vector then comprises either the nucleic acid sequence coding for the N-terminal part of the protein which provides for male sterility alone or together with the nucleic acid sequence coding for the full- length protein which confers herbicide resistance.
- the second part of the expression vector comprises either the nucleic acid sequence coding for the C-terminal part of the protein which provides for male sterility alone or together with the nucleic acid sequence coding for the full-length protein which confers herbicide resistance (if the latter nucleic acid sequence is not present in the first part).
- One of these derivative loci will then contain the nucleic acid sequence coding for the full-length protein which confers herbicide resistance together with either the nucleic acid sequence coding for the N-terminal part of the protein which provides for male sterility or the nucleic acid sequence coding for the C-terminal part of the protein which provides for male sterility, while the other derivative locus only contains either the nucleic acid sequence coding for the N-terminal part of the protein which provides for male sterility or the nucleic acid sequence coding for the C-terminal part of the protein which provides for male sterility.
- the male sterile plants are selected by applying a suitable herbicide, i.e. a herbicide against which the plants may be resistant by expression of the protein which confers herbicide resistance, to said plants. Only the plants which contain a functional protein which confers herbicide resistance to said plants will survive the selection. If the protein which confers herbicide resistance is acetolactate synthase, the herbicide used for selection of the plants may be selected from the groups of sulphonylureas and imidazolinones, such as primisulphuronmethyl or imazethapyr.
- a suitable herbicide i.e. a herbicide against which the plants may be resistant by expression of the protein which confers herbicide resistance
- the present invention further relates to a method of producing monocotyledonous hybrid plants, comprising the steps of:
- step a) producing a male sterile monocotyledonous plant by a method described above; and b) crossing the male sterile monocotyledonous plant of step a) with a male fertile monocotyledonous plant.
- Hybrid plants are plants which are the progeny of two genetically unidentical parents. Hybrid plants are produced by cross-pollination of genetically different parental lines. As the plants of the present invention are male sterile, the self- pollination of these plants is avoided and it is possible to perform directed crosses with a selected male fertile parent.
- male fertile parent means that this parent is able to produce functional pollen which can be used to pollinate the female sexual organs of the male sterile plant.
- the hybrid seeds produced may be 100% fertile, as either only the N-terminal fragment or only the C-terminal fragment of the protein which provides for male sterility is expressed in the progeny.
- the male fertile plant used for producing the hybrid plants should not contain a fragment of a nucleotide sequence encoding the protein which provides for male sterility and, optionally, not contain a fragment of a nucleotide sequence encoding the protein which confers herbicide resistance.
- the hybrid seed growing on the hybrid plants may then be harvested.
- Transgenic plants and transgenic plant cells can be any monocotyledonous plant or plant cell, preferably agricultural plants or cells from agricultural plants, into which a nucleic acid molecule or at least one expression cassette has been introduced. These plants can be produced by any of the methods which have been described herein. The invention is further directed to transgenic parts of this plant such as leaves and blossoms, transgenic propagation material such as protoplasts, calli, fruit, seeds, tubers, root stocks, germs, pollen, cuttings and transgenic progeny of the plant.
- the plant cells according to the invention include differentiated and undifferentiated plant cells including protoplasts which were produced by the method according to the invention and which have integrated the expression cassettes of the present invention into the plant genome, or have received these as autonomously replicating molecules.
- plant cells which contain the nucleic acid molecules according to the invention and plant cells can further be cultivated.
- Bar-N, Bar-C gene fragments from the Bacillus amyloliquifaciens barnase gene coding for the N- and C-terminal fragment of barnase, respectively (synthetic sequence with codon usage adapted for wheat; except in case of pICH13688 that carries a native sequence from Bacillus amyloliquifaciens); ALS-N, ALS-C, gene fragments coding for the N- and C-terminal fragment of a mutated version of Oryza sativa ALS or of Arabidopsis thaliana ALS (in case of pICH13688 only); IntN, IntC, gene fragments from the from the DnaE and DnaB genes of Synechocystis sp.
- coding for N- and C-terminal intein sequences ⁇ DnaB sequences fused to barnase are synthetic with codon usage adapted for wheat except in case of pICH13688); Pact, rice actin 1 promoter; Ptap, tapetum-specific promoter osg ⁇ B from rice; Tnos, nopaline synthase terminator; Toes, octopine synthase terminator; CT, artificial chloroplast-targeting signal; Pubi, maize ubiquitin promoter, HptII, hygromycin phosphotransferase gene; Pspm, maize spm promoter; linker, nucleic acid sequence coding for a flexible (GGGGS) n linker cloned in frame to the barnase C-fragment.
- GGGGS flexible
- Figure 2 Analysis of the tr ⁇ r ⁇ -splicing reaction efficiency using a transient assay in Nicotiana benthamiana
- N- and C-terminal barnase fragments fused to the N- and C-terminal fragments of the DnaB intein, respectively) were infiltrated into leafs of TV. benthamiana.
- the N-terminal gene fragments are expressed from a 35S promoter (pICH12795) whereas the C-terminal gene fragments are expressed from the weaker Arabidopsis thaliana Act2 promoter.
- the cytotoxicity increases with the size of the flexible GGGGS linkers introduced between the nucleic acid sequences coding for the C-terminal fragment of the DnaB intein and the C-terminal fragment of barnase (a-c).
- the structure of the infiltrated constructs is depicted in d.
- Construct pICH 12795 was supplied by Icon Genetics.
- Figure 3 Analysis of the tr ⁇ r ⁇ -splicing reaction efficiency using a transient assay in Nicotiana benthamiana
- Morphology of wheat spikes from a male fertile control plant (that was generated by in vitro culture methods, e. g. that grew up under identical conditions like transgenic plants) and a transgenic male sterile plant containing T-DNA pICH27371 are shown in a and b, respectively.
- the spike of the transgenic plant displays the typical "open floret" phenotype and contains no seed.
- the deformed pollen produced by plants carrying a functional barnase protein can be clearly distinguished from the pollen of wildtype plants in the Alexander's vitality tests (c, d) and in SEM analysis (e-h).
- the left-hand column shows the phenotype of the control plant and the right-hand column shows the phenotype of the male sterile plants.
- Figure 8 Selection of plants carrying pICH25881 (split ALS).
- the picture depicts a T 2 plant that is selected after two preceding selections of the Ti and the To ancestors (proving that the phenotype is stably inherited over three generations). Plants carrying the plasmid pICH27371 with the non-split ALS gene were used as a positive control for the selection. Selection conditions are described in the examples.
- Figure 10 Strategy for the maintenance of the male sterility and for the production of hybrid seed a) An expression construct containing the first, second, third and fourth expression cassettes of the present invention (corresponding to plasmid pICH25881) is transformed into plant cells to form a prolocus. Upon crossing with a plant expressing recombinase, a derivatization of the prolocus can occur in the progeny plant, thus forming two isoloci (Al, A2) on identical loci on homologous chromosomes in different progeny plants.
- Al, A2 isoloci
- PCR-Products resulting from the PCR Rec 1 - Rec 2 and 25 PCR products resulting from the PCR Rec 3 - Rec 4 were analyzed. Without exception, all sequences represented the expected recombination product containing the sequences attL or attR, respectively.
- the diagram includes two original abi sequencing files (sequencing reaction performed by the IPK-Gatersleben PGRC Sequencing Service).
- Fig. 1 All vectors used in this study (Fig. 1) are pBIN19-based binary vectors and were constructed using standard recombinant DNA methods.
- the vectors are derivatives of plasmid pICH13688 (Fig. 1).
- the structure and construction of pICH13688 is described in Gils et al. (2008) Plant Biotechnol J. 6(3): 226-35.
- the T-DNA sequence of pICH13688 is deposited in the EMBL/GENBANK database under the accession number AM888351.
- the vectors contain split barnase genes which are fused to N- and C-terminal fragments of the Ssp DnaB intein. Protein splicing is depending on the chemical nature of the splice site junction amino acids. Hence, the insertion of stretches containing exon sequences is supposed to increase the efficiency of protein tr ⁇ r ⁇ -splicing (Sun et al. (2001) Appl. Environ. Microbiol. 67: 1025-1029).
- the amino acid sequence SIEQD was inserted between DnaB IntC and Bar-C. Six of the seven amino acids belong to the adjacent extein sequence of the DnaB gene. Similar, the amino acid sequence RESG from the DnaB extein was introduced between DnaB IntN and Bar-N. Additionally, a methionine starting codon was added at the 5' terminus of the DnaB IntC sequence.
- ALS-Svstem Plasmid pICH21721 contains a rice ALS gene (Gene Bank accession number AP008208. Oryza sativa; japonica cultivar-group; genomic DNA, chromosome 2, position 18335903-18337834). At position 548, the mutation Trp>Leu was introduced according to Tan et al. (2005) Pest Manage. Sci. 61: 246- 257. The ALS gene is expressed under control of the constitutive rice Actin 1 promoter (McElroy et al. (1990) Plant Cell 2: 163-171) and the nopaline synthase (nos) terminator (Jones et al. (1992) Transgenic Res. 1: 285-297). pICH21721 serves as a control vector for transformation.
- Vector pICH25881 contains two fragments of the rice ALS gene that are expressed individually from a rice actin promoter.
- ALS-N (see Fig. 1) contains 403 amino acids of the N-terminal end of the mature ALS protein (GenBank accession no AP008208. position 18335903-18337111) whereas ALS-C contains the residues 404-644 (GenBank accession no AP008208. position 18337112-18337834).
- Ssp DnaE intein fragments were cloned in frame to the ALS segments, including extein sequence stretches, as described in (Gils et al. (2008) Plant Biotechnol J.
- the barnase-intein fusions are encoded by synthetic sequences in which the codon usage was adapted to the codon bias of Triticum aestivum genes (chemically synthesized by GENART, Regensburg, Germany). Additionally, amino acids that have been inserted into the original vector as a result of cloning strategies and are not present in the native barnase sequence (D and V between Bar-N and DnaB IntN in case of plasmid pICH13688) were removed.
- vectors pICH25301 and pICH27371 contain flexible linker sequences that are introduced in frame between the dnaB InteinC and the Barnase-C fragment.
- the linkers should not exhibit a propensity for ordered secondary structure or any tendency to interfere with domain folding.
- the sequence Gly-Gly-Gly-Gly-Ser was selected to bridge the 5'- and 3' barnase fragments either in a double [(GIy-GIy-GIy-GIy-SeT 2 ); pICH25301] or triple [(GIy- Gly-Gly-Gly-Ser) 3 ; pICH27371] configuration).
- a different codon usage was used for each of the GGGGS units.
- Vector pHW21 (N-terminal vector for transient assays) contains a fusion of Bar-N and DnaB IntN, as described for the vectors pICH24581, pICH25301, pICH27371 and pICH25881 ( Figure 1).
- the expression of the barnase-mt ⁇ n fusion was controlled by the cauliflower mosaic virus 35 S promoter and an octopine synthase terminator.
- the N-terminal amino acid of DnaB Int (Cl) was changed from cysteine in pHW21 to alanine, resulting in vector pHW211.
- the C-terminal vectors for transient assays contain a fusion of DnaB IntC and Bar-C.
- the intein-barnase fusion sequence is cloned between an Arabidopsis actin 2 promoter and a nopaline synthase terminator.
- pICH24591, pICH24601, pICH24612 and pHW231, flexible linkers composed of one to three GGGGS stretches were cloned in frame between the extein stretch SEEQD and Bar-C.
- Immature embryos (1.0-2.5 mm in length, semitransparent) were excised aseptically and placed, with scutellum-side up, on MS culture medium (Duchefa, M0222; (Murashige and Skoog (1962) Physiol Plant 15(3): 473-497), containing 30 g/1 sucrose, 2 mg/1 2,4-D (2,4-dichlorophenoxy- acetic acid) and 0.25 % phytagel for solidification. Embryos that develop compact nodular calli were selected using a stereomicroscope and used for bombardment 14- 21 days after isolation. The cultures were kept in the dark at 25° C. Microproiectile bombardment of immature embryos
- Embryos were placed in the centre of a plate to form a circle with a diameter of about 10 mm.
- the shooting was carried out using a helium pressure of 900 psi, with 15 mm distance from a macrocarrier launch point to the stopping screen and 60 mm distance from the stopping screen to the target tissue.
- the distance between rupture disk and launch point of the macrocarrier was 12 mm.
- the calli were transferred to MS medium containing 60 g/1 sucrose and grown in dark conditions for one week at 25°C. Selection and regeneration
- callus selection was carried out in vitro on medium containing primisulphuronmethyl (PSM) and imazethapyr (IMA), both belonging to the class of pyrimidinylsulphonylurea herbicide.
- PSM primisulphuronmethyl
- IMA imazethapyr
- Selection of plants carrying pICH 13688 was carried out by callus selection on medium containing 150 mg/1 hygromycin B.
- T-DNA-vectors were transformed into Agrobacterium strain GV3101:pMP90.
- the infiltration of Agrobacterium into N. benthamiana plants was performed according to a protocol described in Marillonnet et al. (2004) Proc. Natl. Acad. Sci. USA 101 :
- GGGGS GGGGS 3
- T-DNAs that cany the N- and C- terminal parts of the barnase gene (under the control of constitutively expressed promoters) were introduced into leaves of N. benthamiana by syringe infiltration using Agrohacterium (Figs. 2 and 3). Delivered alone, N- or C-terminal vectors do not exhibit cytotoxicity (Gils et al. (2008) Plant Biotechnol J. 6(3):226-35).
- trans-splicing mechanism is responsible for an efficient protein assembly in the split DnaB intein- system.
- IPC intein mediated rjrotein splicing via affinity domains
- inteins For the majority of inteins, three conserved residues are essential for trans-splicing (serine, threonine or cysteine at the intein N-terminus; asparagine or glutamine at the intein C-terminus; serine, threonine or cysteine as the first extein residue following the C-terminal splice site; Perler, Cell, 92, 1-4, 2002).
- Synechocystis sp. DnaE intein to complement inactive EPSPS precursor proteins in E. coli, Chen et al.
- ATCAAGGACAAG and d) of the C-terminal ALS gene sequence were RiceALS-C FW (GCAATATGCCATTCAGGTGC) RiceALS-C REV (CACG GACTGCAGGAATATTG).
- RiceALS-C FW GAAATATGCCATTCAGGTGC
- RiceALS-C REV CACG GACTGCAGGAATATTG
- ALS-N-3 FW GATTCTCTATGTCGGTGGTG
- ALS-N-5 'REV GAGACAGAATTGCTT GAGCAG
- thermocycler DNA EngineTM PTC-0200, Bio- Rad, Kunststoff, Germany. Amplification was carried out for 35 cycles (94 0 C for 1 min; 55 0 C for 1 min; 72 0 C for 1-2 min).
- Probes of T. aestivum were dehydrated in an ethanol series, followed by critical point drying in a Bal-Tec critical point dryer (Bal-Tec AG, Balzers, Switzerland). Dried specimens were attached onto carbon coated aluminium sample blocks and coated in an Edwards S 150B sputter coater (Edwards High Vacuum Inc., Crowlesy, West Wales, UK). Probes were examined in a Hitachi S4100 SEM (Hisco Europe, Ratingen, Germany) at 5 kV acceleration voltage. Digital recordings were made and saved as tif-files.
- Pollination of male- sterile plants was performed by tearing anthers of untransformed bobwhite plants with tweezers just before anthesis and placing one anther into the closed flower of the male- sterile crossing partner.
- T-DNA vectors containing codon optimized barnase-intcin fusions and flexible linkers were constructed and delivered into wheat plants by biolistic bombardment. 1385 primary transformants (To) were assayed for pollen fertility. Pollen of at least three spikes of each To-plant was stained in double test series according to (Alexander (1969) Stain Technol. 44: 117-122) (Fig. 4). In contrast to pICH13688, it was possible to generate male sterility by transforming pICH24581. pICH25301 or pICH27371. Thus, it could be demonstrated that the constructs are functional with regard to the inlein-mediated complementation of the barnase peptide fragments.
- Sterile pollen can be identified unambiguously by a transparent phenotype in vitality- staining assays (Fig 4 d) and a degenerated phenotype as been detected in scanning electron microscopy analyses (Fig. 4 f, h).
- the amount of pollen produced by male sterile plants was not reduced compared to that of wildtype plants that were generated by in vitro culture.
- Expression of barnase does not influence the vegetative phenotype in regard to germination frequency, plant height, leaf size, flowering time and tillering.
- florets of male- sterile plants open as a consequence of inhibited self-fertilization (Fig. 4 b).
- plants carrying pJCH24581, ⁇ SCH25301 and plCH2 " 371 were grown in phytochambers from germination to maturity at 35 °C ( ⁇ f> h) and 20 0 C (8 h. see material and methods). Although some of the plants displayed stress symptoms like reduced tillering and early senescence, all individuals carrying Bar-N and Bar-C were male-sterile whereas, in contrary, the control plants formed vital pollen and seed.
- the male-sterile plants were backcrossed with wildtype plants. Except a negligible number of cases ( ⁇ 2%), all backcrosses led to vital seed, showing that the sterility was restricted to the male gametes and did not affect reproducibility of the plants in general. In 69 lines (76% of the cases), the pollen sterile phenotype was inherited to the Ti generation. This demonstrates that pollen ablation caused by tissue culture effects (somaclonal variation) is a rare event and does not affect the overall statistic to a significant extent. None of the Ti plants displaying male sterility lacked the barnase transgene fragments.
- the male-sterile phenotype can be strictly correlated with the presence of both transgene fragments. Segregation of the transgenes leads to reversion of fertility in all cases. Interestingly, some of the plants carry only an N-terminal or a C-terminal fragment of the barnase gene. Such T-DNA-truncation results from a fragmentation of the plasmids caused by physical forces during biolistic delivery. As expected, such individuals form vital pollen.
- Wheat lines carrying Streptomyces phage PhiC31 integrase were used to induce irreversible site-specific recombination reactions at the stably integrated T-DNA-loci pICH27371 according to the scheme in Figure 10).
- the identification of suitable double haploid integrase wheat lines was performed with a transient test assay and is described in Rubtsova et al. (2008) Plant Cell Rep. 27: 1821-1831
- the arrangement of the att sequences allows two alternative recombination reactions that may lead to the deletion of either the 3'- or the 5 '-part of the T-DNA- locus.
Landscapes
- Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- Chemical & Material Sciences (AREA)
- General Engineering & Computer Science (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Cell Biology (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
Description
Claims
Priority Applications (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US12/996,364 US9012729B2 (en) | 2008-06-03 | 2009-06-03 | Process of producing male sterile monocotyledonous plants |
AU2009253901A AU2009253901B2 (en) | 2008-06-03 | 2009-06-03 | Process of producing male sterile monocotyledonous plants |
EA201071408A EA201071408A1 (en) | 2008-06-03 | 2009-06-03 | METHOD OF OBTAINING SINGLE-DONE PLANTS WITH MALE STERILITY |
CA2724425A CA2724425C (en) | 2008-06-03 | 2009-06-03 | Process of producing male sterile monocotyledonous plants |
EP09757560A EP2294204B1 (en) | 2008-06-03 | 2009-06-03 | Process of producing male sterile monocotyledonous plants |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP08157508.6 | 2008-06-03 | ||
EP08157508 | 2008-06-03 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2009147179A2 true WO2009147179A2 (en) | 2009-12-10 |
WO2009147179A3 WO2009147179A3 (en) | 2010-02-18 |
Family
ID=40972861
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2009/056825 WO2009147179A2 (en) | 2008-06-03 | 2009-06-03 | Process of producing male sterile monocotyledonous plants |
Country Status (6)
Country | Link |
---|---|
US (1) | US9012729B2 (en) |
EP (1) | EP2294204B1 (en) |
AU (1) | AU2009253901B2 (en) |
CA (1) | CA2724425C (en) |
EA (1) | EA201071408A1 (en) |
WO (1) | WO2009147179A2 (en) |
Cited By (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP2423316A1 (en) * | 2010-08-25 | 2012-02-29 | Leibniz-Institut für Pflanzengenetik und Kulturpflanzenforschung (IPK) | Method for determining meiotic recombination frequencies in plants |
EP2518081A1 (en) * | 2011-04-28 | 2012-10-31 | Leibniz-Institut für Pflanzengenetik und Kulturpflanzenforschung (IPK) | Method of producing and purifying polymeric proteins in transgenic plants |
WO2013067928A1 (en) * | 2011-11-08 | 2013-05-16 | 未名兴旺系统作物设计前沿实验室(北京)有限公司 | Construct for regulating fertility of plant pollens and usage thereof |
EP3056080A1 (en) * | 2015-02-10 | 2016-08-17 | Vyzkumne centrum SELTON, s.r.o. | Method of producing hybrid F1 seed of angiosperm plants |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
UY34176A (en) | 2011-07-01 | 2013-01-31 | Monsanto Technology Llc | ? A DNA CONSTRUCTION, METHOD TO PREPARE IT, PLANTS AND SEEDS THAT INCLUDE IT AND METHODS TO GENERATE THEM ?. |
EP3324732B1 (en) | 2015-07-22 | 2022-11-23 | Monsanto Technology LLC | Methods and compositions for selective regulation of protein expression |
Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0120515A2 (en) | 1983-02-24 | 1984-10-03 | Rijksuniversiteit Leiden | A process for the incorporation of foreign DNA into the genome of dicotyledonous plants; a process for the production of Agrobacterium tumefaciens bacteria |
WO1992013956A1 (en) | 1991-02-08 | 1992-08-20 | Plant Genetic Systems, N.V. | Stamen-specific promoters from rice |
WO1992013957A1 (en) | 1991-02-07 | 1992-08-20 | Plant Genetic Systems, N.V. | Stamen-specific promoters from corn |
WO2001059135A1 (en) | 2000-02-14 | 2001-08-16 | IPK Institut für Pflanzengenetik und Kulturpflanzenforschung | Method for influencing the pollen development by modifying the sucrose metabolism |
WO2003102197A1 (en) | 2002-05-31 | 2003-12-11 | Icon Genetics Ag | Transgenic plants with controlled distribution of a trait to progeny |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
DE60036942T2 (en) * | 1999-05-24 | 2008-08-07 | New England Biolabs, Inc., Beverly | METHOD OF GENERATING SEPARATE, NON-TRANSFERABLE GENES WHICH ARE ABLE TO EXPRESS AN ACTIVE PROTEIN PRODUCT |
-
2009
- 2009-06-03 WO PCT/EP2009/056825 patent/WO2009147179A2/en active Application Filing
- 2009-06-03 EA EA201071408A patent/EA201071408A1/en unknown
- 2009-06-03 CA CA2724425A patent/CA2724425C/en not_active Expired - Fee Related
- 2009-06-03 AU AU2009253901A patent/AU2009253901B2/en not_active Ceased
- 2009-06-03 US US12/996,364 patent/US9012729B2/en not_active Expired - Fee Related
- 2009-06-03 EP EP09757560A patent/EP2294204B1/en not_active Not-in-force
Patent Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0120515A2 (en) | 1983-02-24 | 1984-10-03 | Rijksuniversiteit Leiden | A process for the incorporation of foreign DNA into the genome of dicotyledonous plants; a process for the production of Agrobacterium tumefaciens bacteria |
WO1992013957A1 (en) | 1991-02-07 | 1992-08-20 | Plant Genetic Systems, N.V. | Stamen-specific promoters from corn |
WO1992013956A1 (en) | 1991-02-08 | 1992-08-20 | Plant Genetic Systems, N.V. | Stamen-specific promoters from rice |
WO2001059135A1 (en) | 2000-02-14 | 2001-08-16 | IPK Institut für Pflanzengenetik und Kulturpflanzenforschung | Method for influencing the pollen development by modifying the sucrose metabolism |
WO2003102197A1 (en) | 2002-05-31 | 2003-12-11 | Icon Genetics Ag | Transgenic plants with controlled distribution of a trait to progeny |
Non-Patent Citations (35)
Title |
---|
BEMD-SOUZA ET AL., GENET. MOL. BIOL., vol. 23, no. 2, 2000, pages 435 - 443 |
BURGESS ET AL., THE PLANT JOURNAL, vol. 31, no. 1, 2002, pages 113 - 125 |
CHAN ET AL., PLANT MOL. BIOL., vol. 22, 1993, pages 491 - 506 |
CHEN ET AL., GENE, vol. 263, 2001, pages 39 - 48 |
CHIN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 100, 2003, pages 4510 - 4515 |
CHO ET AL., MOL. CELLS, vol. 11, 2001, pages 326 - 333 |
CHONG; XU, J. BIOL. CHEM., vol. 272, 1997, pages 15587 - 15590 |
DE BLOCK ET AL., THEOR. APPL. GENET., vol. 95, 1997, pages 125 - 131 |
DENIS ET AL., PLANT PHYSIOL., vol. 101, 1993, pages 1295 - 1304 |
FENG; DOOLITTLE, J. MOL. EVOLUTION., vol. 25, 1987, pages 351 - 360 |
GILS ET AL., PLANT BIOTECHNOL. J., vol. 6, no. 3, 2008, pages 226 - 235 |
HIGGINS ET AL., CABIOS, vol. 5, 1989, pages 151 - 153 |
HIGGINS ET AL., COMPUT. APPL. BIOSCI., vol. 5, no. 2, 1989, pages 151 |
HOLSTERS ET AL., MOLECULAR AND GENERAL GENETICS, vol. 163, 1978, pages 181 - 187 |
JONES ET AL., TRANSGENIC RES., vol. 1, 1992, pages 285 - 297 |
L. WILLMITZER ET AL.: "Transgenic Plants in: Biotechnology, A Multi-Volume Comprehensive Treatise", vol. 2, 1993, VCH, pages: 627 - 659 |
MARIANI ET AL., NATURE, vol. 347, 1990, pages 737 - 741 |
MARIANI ET AL., NATURE, vol. 357, 1992, pages 384 - 387 |
MCCORMICK ET AL., PLANT CELL REPORTS, vol. 5, 1986, pages 81 - 84 |
MCELROY ET AL., PLANT CELL, vol. 2, 1990, pages 163 - 171 |
NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 - 453 |
PERLER, CELL, vol. 92, 1998, pages 1 - 4 |
PERLER, NUCLEIC ACIDS RES., vol. 30, 2002, pages 383 - 384 |
RITALA ET AL., PLANT MOL. BIO., vol. 24, 1994, pages 317 - 325 |
SALEH; PERLER, CHEM. REC., vol. 6, 2006, pages 183 - 193 |
SAMBROOK ET AL.: "Molecular cloning: A laboratory manual, 3rd edition,", 2001, COLD SPRING HARBOR LABORATORY PRESS |
SMITH; WATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482 - 489 |
SOUTHWORTH ET AL., EMBO J., vol. 17, 1998, pages 918 - 926 |
SPENCER ET AL., THEOR. APPL. GENET., vol. 79, 1990, pages 625 - 631 |
SUN ET AL., APPL. ENVIRON. MICROBIOL., vol. 67, 2001, pages 1025 - 1029 |
TAN ET AL., PEST MANAG SCI., vol. 61, 2005, pages 246 - 257 |
TSUCHIYA ET AL., PLANT CELL PHYSIOL., vol. 36, 1995, pages 487 - 494 |
VASIL ET AL., BIO/TECHNOLOGY, vol. 11, 1993, pages 1553 - 1558 |
WAN; LEMAUX, PLANT PHYSIOL., vol. 104, 1994, pages 37 - 48 |
WU ET AL., PROC. NATL. ACAD. SCI. USA, vol. 95, 1998, pages 9226 - 9231 |
Cited By (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP2423316A1 (en) * | 2010-08-25 | 2012-02-29 | Leibniz-Institut für Pflanzengenetik und Kulturpflanzenforschung (IPK) | Method for determining meiotic recombination frequencies in plants |
EP2518081A1 (en) * | 2011-04-28 | 2012-10-31 | Leibniz-Institut für Pflanzengenetik und Kulturpflanzenforschung (IPK) | Method of producing and purifying polymeric proteins in transgenic plants |
WO2013067928A1 (en) * | 2011-11-08 | 2013-05-16 | 未名兴旺系统作物设计前沿实验室(北京)有限公司 | Construct for regulating fertility of plant pollens and usage thereof |
CN103261419A (en) * | 2011-11-08 | 2013-08-21 | 未名兴旺系统作物设计前沿实验室(北京)有限公司 | Construct for regulating fertility of plant pollens and usage thereof |
CN103261419B (en) * | 2011-11-08 | 2015-06-10 | 未名兴旺系统作物设计前沿实验室(北京)有限公司 | Construct for regulating fertility of plant pollens and usage thereof |
EP3056080A1 (en) * | 2015-02-10 | 2016-08-17 | Vyzkumne centrum SELTON, s.r.o. | Method of producing hybrid F1 seed of angiosperm plants |
Also Published As
Publication number | Publication date |
---|---|
EP2294204A2 (en) | 2011-03-16 |
US20110167513A1 (en) | 2011-07-07 |
CA2724425C (en) | 2016-09-13 |
AU2009253901A1 (en) | 2009-12-10 |
EA201071408A1 (en) | 2011-06-30 |
EP2294204B1 (en) | 2013-02-27 |
CA2724425A1 (en) | 2009-12-10 |
WO2009147179A3 (en) | 2010-02-18 |
AU2009253901B2 (en) | 2014-08-07 |
US9012729B2 (en) | 2015-04-21 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20230279413A1 (en) | Plant genome modification using guide rna/cas endonuclease systems and methods of use | |
AU747636B2 (en) | Novel nucleic acid sequence encoding FLP recombinase | |
US8604281B2 (en) | Transgenic plants with controlled distribution of a trait to progeny | |
CA2724425C (en) | Process of producing male sterile monocotyledonous plants | |
Gils et al. | A novel hybrid seed system for plants | |
AU783800B2 (en) | Site-specific recombination system to manipulate the plastid genome of higher plants | |
Kempe et al. | Intein‐mediated protein assembly in transgenic wheat: production of active barnase and acetolactate synthase from split genes | |
CA2307956A1 (en) | Nuclear male sterile plants, method of producing same and methods to restore fertility | |
WO2018129564A1 (en) | Compositions and methods for improving plastid transformation efficiency in higher plants | |
CN112867794A (en) | DNA constructs for genome editing in plants | |
US20240141311A1 (en) | Compositions and methods for generating male sterile plants | |
EP2423316B1 (en) | Method for determining meiotic recombination frequencies in plants |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 09757560 Country of ref document: EP Kind code of ref document: A2 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2724425 Country of ref document: CA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2009253901 Country of ref document: AU |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 2009253901 Country of ref document: AU Date of ref document: 20090603 Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2009757560 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 201071408 Country of ref document: EA |
|
WWE | Wipo information: entry into national phase |
Ref document number: A201015908 Country of ref document: UA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 12996364 Country of ref document: US |