WO2009140309A2 - Boron-containing small molecules - Google Patents
Boron-containing small molecules Download PDFInfo
- Publication number
- WO2009140309A2 WO2009140309A2 PCT/US2009/043672 US2009043672W WO2009140309A2 WO 2009140309 A2 WO2009140309 A2 WO 2009140309A2 US 2009043672 W US2009043672 W US 2009043672W WO 2009140309 A2 WO2009140309 A2 WO 2009140309A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- exemplary embodiment
- compound
- member selected
- substituted
- lactamase
- Prior art date
Links
- 229910052796 boron Inorganic materials 0.000 title description 23
- ZOXJGFHDIHLPTG-UHFFFAOYSA-N Boron Chemical compound [B] ZOXJGFHDIHLPTG-UHFFFAOYSA-N 0.000 title description 20
- 150000003384 small molecules Chemical class 0.000 title description 2
- -1 6-substituted benzoxaborole compounds Chemical class 0.000 claims abstract description 126
- 208000035143 Bacterial infection Diseases 0.000 claims abstract description 59
- 208000022362 bacterial infectious disease Diseases 0.000 claims abstract description 59
- 150000001875 compounds Chemical class 0.000 claims description 533
- 238000000034 method Methods 0.000 claims description 196
- 150000003839 salts Chemical class 0.000 claims description 142
- 125000000217 alkyl group Chemical group 0.000 claims description 125
- 102000006635 beta-lactamase Human genes 0.000 claims description 99
- 108090000204 Dipeptidase 1 Proteins 0.000 claims description 98
- 239000000203 mixture Substances 0.000 claims description 97
- 241000894006 Bacteria Species 0.000 claims description 93
- 125000003118 aryl group Chemical group 0.000 claims description 51
- 241001465754 Metazoa Species 0.000 claims description 50
- 239000003814 drug Substances 0.000 claims description 50
- 125000004093 cyano group Chemical group *C#N 0.000 claims description 45
- 125000001072 heteroaryl group Chemical group 0.000 claims description 40
- 230000002401 inhibitory effect Effects 0.000 claims description 40
- 125000004404 heteroalkyl group Chemical group 0.000 claims description 38
- 125000000592 heterocycloalkyl group Chemical group 0.000 claims description 38
- 230000003115 biocidal effect Effects 0.000 claims description 37
- 125000000449 nitro group Chemical group [O-][N+](*)=O 0.000 claims description 36
- 125000000753 cycloalkyl group Chemical group 0.000 claims description 33
- 239000002552 dosage form Substances 0.000 claims description 32
- 238000004519 manufacturing process Methods 0.000 claims description 32
- 239000008194 pharmaceutical composition Substances 0.000 claims description 32
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 claims description 28
- 238000009472 formulation Methods 0.000 claims description 23
- 229910052736 halogen Inorganic materials 0.000 claims description 23
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 23
- 239000013543 active substance Substances 0.000 claims description 21
- 150000002367 halogens Chemical class 0.000 claims description 21
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 claims description 21
- 241000282414 Homo sapiens Species 0.000 claims description 20
- 208000015181 infectious disease Diseases 0.000 claims description 19
- 239000003242 anti bacterial agent Substances 0.000 claims description 18
- 230000012010 growth Effects 0.000 claims description 18
- 108090000364 Ligases Proteins 0.000 claims description 16
- 229910052739 hydrogen Inorganic materials 0.000 claims description 16
- 229910052757 nitrogen Inorganic materials 0.000 claims description 16
- IJGRMHOSHXDMSA-UHFFFAOYSA-N nitrogen Substances N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 claims description 16
- 102000003960 Ligases Human genes 0.000 claims description 15
- 229910052717 sulfur Inorganic materials 0.000 claims description 14
- 230000000699 topical effect Effects 0.000 claims description 14
- 229910052799 carbon Inorganic materials 0.000 claims description 13
- 238000001228 spectrum Methods 0.000 claims description 11
- 238000011282 treatment Methods 0.000 claims description 11
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 claims description 10
- 125000001188 haloalkyl group Chemical group 0.000 claims description 10
- 230000002147 killing effect Effects 0.000 claims description 10
- 125000004076 pyridyl group Chemical group 0.000 claims description 10
- 108010071170 Leucine-tRNA ligase Proteins 0.000 claims description 8
- 108010087702 Penicillinase Proteins 0.000 claims description 8
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 claims description 8
- 238000000338 in vitro Methods 0.000 claims description 8
- 125000000547 substituted alkyl group Chemical group 0.000 claims description 8
- 239000011593 sulfur Substances 0.000 claims description 8
- 229940056360 penicillin g Drugs 0.000 claims description 7
- RJQXTJLFIWVMTO-TYNCELHUSA-N Methicillin Chemical compound COC1=CC=CC(OC)=C1C(=O)N[C@@H]1C(=O)N2[C@@H](C(O)=O)C(C)(C)S[C@@H]21 RJQXTJLFIWVMTO-TYNCELHUSA-N 0.000 claims description 6
- 125000004103 aminoalkyl group Chemical group 0.000 claims description 6
- 229960002100 cefepime Drugs 0.000 claims description 6
- 108060004734 metallo-beta-lactamase Proteins 0.000 claims description 6
- 102000020235 metallo-beta-lactamase Human genes 0.000 claims description 6
- 229960003085 meticillin Drugs 0.000 claims description 6
- 229950009506 penicillinase Drugs 0.000 claims description 6
- 125000003386 piperidinyl group Chemical group 0.000 claims description 6
- 125000000335 thiazolyl group Chemical group 0.000 claims description 6
- 108020004256 Beta-lactamase Proteins 0.000 claims description 5
- WKDDRNSBRWANNC-UHFFFAOYSA-N Thienamycin Natural products C1C(SCCN)=C(C(O)=O)N2C(=O)C(C(O)C)C21 WKDDRNSBRWANNC-UHFFFAOYSA-N 0.000 claims description 5
- 150000001721 carbon Chemical group 0.000 claims description 5
- 229960000603 cefalotin Drugs 0.000 claims description 5
- VUFGUVLLDPOSBC-XRZFDKQNSA-M cephalothin sodium Chemical compound [Na+].N([C@H]1[C@@H]2N(C1=O)C(=C(CS2)COC(=O)C)C([O-])=O)C(=O)CC1=CC=CS1 VUFGUVLLDPOSBC-XRZFDKQNSA-M 0.000 claims description 5
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 claims description 5
- 150000003952 β-lactams Chemical group 0.000 claims description 5
- GNWUOVJNSFPWDD-XMZRARIVSA-M Cefoxitin sodium Chemical compound [Na+].N([C@]1(OC)C(N2C(=C(COC(N)=O)CS[C@@H]21)C([O-])=O)=O)C(=O)CC1=CC=CS1 GNWUOVJNSFPWDD-XMZRARIVSA-M 0.000 claims description 4
- UIOFUWFRIANQPC-JKIFEVAISA-N Floxacillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C1=C(C)ON=C1C1=C(F)C=CC=C1Cl UIOFUWFRIANQPC-JKIFEVAISA-N 0.000 claims description 4
- 229930195708 Penicillin V Natural products 0.000 claims description 4
- 229960003022 amoxicillin Drugs 0.000 claims description 4
- LSQZJLSUYDQPKJ-NJBDSQKTSA-N amoxicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=C(O)C=C1 LSQZJLSUYDQPKJ-NJBDSQKTSA-N 0.000 claims description 4
- 229960000723 ampicillin Drugs 0.000 claims description 4
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 claims description 4
- JTWOMNBEOCYFNV-NFFDBFGFSA-N azlocillin Chemical compound N([C@@H](C(=O)N[C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C=1C=CC=CC=1)C(=O)N1CCNC1=O JTWOMNBEOCYFNV-NFFDBFGFSA-N 0.000 claims description 4
- 229960003623 azlocillin Drugs 0.000 claims description 4
- FPPNZSSZRUTDAP-UWFZAAFLSA-N carbenicillin Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)C(C(O)=O)C1=CC=CC=C1 FPPNZSSZRUTDAP-UWFZAAFLSA-N 0.000 claims description 4
- 229960003669 carbenicillin Drugs 0.000 claims description 4
- 229960004261 cefotaxime Drugs 0.000 claims description 4
- AZZMGZXNTDTSME-JUZDKLSSSA-M cefotaxime sodium Chemical compound [Na+].N([C@@H]1C(N2C(=C(COC(C)=O)CS[C@@H]21)C([O-])=O)=O)C(=O)\C(=N/OC)C1=CSC(N)=N1 AZZMGZXNTDTSME-JUZDKLSSSA-M 0.000 claims description 4
- 229960002682 cefoxitin Drugs 0.000 claims description 4
- 229960000466 cefpirome Drugs 0.000 claims description 4
- DKOQGJHPHLTOJR-WHRDSVKCSA-N cefpirome Chemical compound N([C@@H]1C(N2C(=C(C[N+]=3C=4CCCC=4C=CC=3)CS[C@@H]21)C([O-])=O)=O)C(=O)\C(=N/OC)C1=CSC(N)=N1 DKOQGJHPHLTOJR-WHRDSVKCSA-N 0.000 claims description 4
- 229960000484 ceftazidime Drugs 0.000 claims description 4
- ORFOPKXBNMVMKC-DWVKKRMSSA-N ceftazidime Chemical compound S([C@@H]1[C@@H](C(N1C=1C([O-])=O)=O)NC(=O)\C(=N/OC(C)(C)C(O)=O)C=2N=C(N)SC=2)CC=1C[N+]1=CC=CC=C1 ORFOPKXBNMVMKC-DWVKKRMSSA-N 0.000 claims description 4
- 229910052801 chlorine Inorganic materials 0.000 claims description 4
- YFAGHNZHGGCZAX-JKIFEVAISA-N dicloxacillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C1=C(C)ON=C1C1=C(Cl)C=CC=C1Cl YFAGHNZHGGCZAX-JKIFEVAISA-N 0.000 claims description 4
- 229960001585 dicloxacillin Drugs 0.000 claims description 4
- 229960004273 floxacillin Drugs 0.000 claims description 4
- 229910052731 fluorine Inorganic materials 0.000 claims description 4
- ZSKVGTPCRGIANV-ZXFLCMHBSA-N imipenem Chemical compound C1C(SCC\N=C\N)=C(C(O)=O)N2C(=O)[C@H]([C@H](O)C)[C@H]21 ZSKVGTPCRGIANV-ZXFLCMHBSA-N 0.000 claims description 4
- 229960002182 imipenem Drugs 0.000 claims description 4
- DMJNNHOOLUXYBV-PQTSNVLCSA-N meropenem Chemical compound C=1([C@H](C)[C@@H]2[C@H](C(N2C=1C(O)=O)=O)[C@H](O)C)S[C@@H]1CN[C@H](C(=O)N(C)C)C1 DMJNNHOOLUXYBV-PQTSNVLCSA-N 0.000 claims description 4
- 229960002260 meropenem Drugs 0.000 claims description 4
- YPBATNHYBCGSSN-VWPFQQQWSA-N mezlocillin Chemical compound N([C@@H](C(=O)N[C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C=1C=CC=CC=1)C(=O)N1CCN(S(C)(=O)=O)C1=O YPBATNHYBCGSSN-VWPFQQQWSA-N 0.000 claims description 4
- 229960000198 mezlocillin Drugs 0.000 claims description 4
- LSQZJLSUYDQPKJ-UHFFFAOYSA-N p-Hydroxyampicillin Natural products O=C1N2C(C(O)=O)C(C)(C)SC2C1NC(=O)C(N)C1=CC=C(O)C=C1 LSQZJLSUYDQPKJ-UHFFFAOYSA-N 0.000 claims description 4
- 235000019371 penicillin G benzathine Nutrition 0.000 claims description 4
- 229940056367 penicillin v Drugs 0.000 claims description 4
- BPLBGHOLXOTWMN-MBNYWOFBSA-N phenoxymethylpenicillin Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)COC1=CC=CC=C1 BPLBGHOLXOTWMN-MBNYWOFBSA-N 0.000 claims description 4
- OHKOGUYZJXTSFX-KZFFXBSXSA-N ticarcillin Chemical compound C=1([C@@H](C(O)=O)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)C=CSC=1 OHKOGUYZJXTSFX-KZFFXBSXSA-N 0.000 claims description 4
- 229960004659 ticarcillin Drugs 0.000 claims description 4
- 108010056874 AmpC beta-lactamases Proteins 0.000 claims description 3
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 claims description 3
- 229960001139 cefazolin Drugs 0.000 claims description 3
- MLYYVTUWGNIJIB-BXKDBHETSA-N cefazolin Chemical compound S1C(C)=NN=C1SCC1=C(C(O)=O)N2C(=O)[C@@H](NC(=O)CN3N=NN=C3)[C@H]2SC1 MLYYVTUWGNIJIB-BXKDBHETSA-N 0.000 claims description 3
- 229960004755 ceftriaxone Drugs 0.000 claims description 3
- VAAUVRVFOQPIGI-SPQHTLEESA-N ceftriaxone Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1CSC1=NC(=O)C(=O)NN1C VAAUVRVFOQPIGI-SPQHTLEESA-N 0.000 claims description 3
- 125000002541 furyl group Chemical group 0.000 claims description 3
- 125000002768 hydroxyalkyl group Chemical group 0.000 claims description 3
- 125000002883 imidazolyl group Chemical group 0.000 claims description 3
- 238000011321 prophylaxis Methods 0.000 claims description 3
- 125000003226 pyrazolyl group Chemical group 0.000 claims description 3
- 125000001544 thienyl group Chemical group 0.000 claims description 3
- 125000001425 triazolyl group Chemical group 0.000 claims description 3
- KZDCMKVLEYCGQX-UDPGNSCCSA-N 2-(diethylamino)ethyl 4-aminobenzoate;(2s,5r,6r)-3,3-dimethyl-7-oxo-6-[(2-phenylacetyl)amino]-4-thia-1-azabicyclo[3.2.0]heptane-2-carboxylic acid;hydrate Chemical compound O.CCN(CC)CCOC(=O)C1=CC=C(N)C=C1.N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 KZDCMKVLEYCGQX-UDPGNSCCSA-N 0.000 claims description 2
- HGGAKXAHAYOLDJ-FHZUQPTBSA-N 6alpha-[(R)-1-hydroxyethyl]-2-[(R)-tetrahydrofuran-2-yl]pen-2-em-3-carboxylic acid Chemical compound S([C@@H]1[C@H](C(N1C=1C(O)=O)=O)[C@H](O)C)C=1[C@H]1CCCO1 HGGAKXAHAYOLDJ-FHZUQPTBSA-N 0.000 claims description 2
- JUZNIMUFDBIJCM-ANEDZVCMSA-N Invanz Chemical compound O=C([C@H]1NC[C@H](C1)SC=1[C@H](C)[C@@H]2[C@H](C(N2C=1C(O)=O)=O)[C@H](O)C)NC1=CC=CC(C(O)=O)=C1 JUZNIMUFDBIJCM-ANEDZVCMSA-N 0.000 claims description 2
- 108010068385 carbapenemase Proteins 0.000 claims description 2
- QYIYFLOTGYLRGG-GPCCPHFNSA-N cefaclor Chemical compound C1([C@H](C(=O)N[C@@H]2C(N3C(=C(Cl)CS[C@@H]32)C(O)=O)=O)N)=CC=CC=C1 QYIYFLOTGYLRGG-GPCCPHFNSA-N 0.000 claims description 2
- 229960005361 cefaclor Drugs 0.000 claims description 2
- 229960003012 cefamandole Drugs 0.000 claims description 2
- OLVCFLKTBJRLHI-AXAPSJFSSA-N cefamandole Chemical compound CN1N=NN=C1SCC1=C(C(O)=O)N2C(=O)[C@@H](NC(=O)[C@H](O)C=3C=CC=CC=3)[C@H]2SC1 OLVCFLKTBJRLHI-AXAPSJFSSA-N 0.000 claims description 2
- SRZNHPXWXCNNDU-RHBCBLIFSA-N cefotetan Chemical compound N([C@]1(OC)C(N2C(=C(CSC=3N(N=NN=3)C)CS[C@@H]21)C(O)=O)=O)C(=O)C1SC(=C(C(N)=O)C(O)=O)S1 SRZNHPXWXCNNDU-RHBCBLIFSA-N 0.000 claims description 2
- 229960005495 cefotetan Drugs 0.000 claims description 2
- 229960005090 cefpodoxime Drugs 0.000 claims description 2
- WYUSVOMTXWRGEK-HBWVYFAYSA-N cefpodoxime Chemical compound N([C@H]1[C@@H]2N(C1=O)C(=C(CS2)COC)C(O)=O)C(=O)C(=N/OC)\C1=CSC(N)=N1 WYUSVOMTXWRGEK-HBWVYFAYSA-N 0.000 claims description 2
- 229960001668 cefuroxime Drugs 0.000 claims description 2
- JFPVXVDWJQMJEE-IZRZKJBUSA-N cefuroxime Chemical compound N([C@@H]1C(N2C(=C(COC(N)=O)CS[C@@H]21)C(O)=O)=O)C(=O)\C(=N/OC)C1=CC=CO1 JFPVXVDWJQMJEE-IZRZKJBUSA-N 0.000 claims description 2
- 229940106164 cephalexin Drugs 0.000 claims description 2
- ZAIPMKNFIOOWCQ-UEKVPHQBSA-N cephalexin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)C)C(O)=O)=CC=CC=C1 ZAIPMKNFIOOWCQ-UEKVPHQBSA-N 0.000 claims description 2
- 229960002770 ertapenem Drugs 0.000 claims description 2
- 229960000379 faropenem Drugs 0.000 claims description 2
- WIDKTXGNSOORHA-CJHXQPGBSA-N n,n'-dibenzylethane-1,2-diamine;(2s,5r,6r)-3,3-dimethyl-7-oxo-6-[(2-phenylacetyl)amino]-4-thia-1-azabicyclo[3.2.0]heptane-2-carboxylic acid;tetrahydrate Chemical compound O.O.O.O.C=1C=CC=CC=1CNCCNCC1=CC=CC=C1.N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1.N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 WIDKTXGNSOORHA-CJHXQPGBSA-N 0.000 claims description 2
- BVCKFLJARNKCSS-DWPRYXJFSA-N temocillin Chemical compound N([C@]1(OC)C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C(C(O)=O)C=1C=CSC=1 BVCKFLJARNKCSS-DWPRYXJFSA-N 0.000 claims description 2
- 229960001114 temocillin Drugs 0.000 claims description 2
- 229930182555 Penicillin Natural products 0.000 claims 20
- 229940049954 penicillin Drugs 0.000 claims 14
- 229930186147 Cephalosporin Natural products 0.000 claims 12
- 229940124587 cephalosporin Drugs 0.000 claims 12
- 150000001780 cephalosporins Chemical class 0.000 claims 12
- 150000002960 penicillins Chemical class 0.000 claims 6
- WZPBZJONDBGPKJ-VEHQQRBSSA-N aztreonam Chemical compound O=C1N(S([O-])(=O)=O)[C@@H](C)[C@@H]1NC(=O)C(=N/OC(C)(C)C(O)=O)\C1=CSC([NH3+])=N1 WZPBZJONDBGPKJ-VEHQQRBSSA-N 0.000 claims 4
- 229960003644 aztreonam Drugs 0.000 claims 4
- YZBQHRLRFGPBSL-RXMQYKEDSA-N carbapenem Chemical compound C1C=CN2C(=O)C[C@H]21 YZBQHRLRFGPBSL-RXMQYKEDSA-N 0.000 claims 3
- QJVHTELASVOWBE-AGNWQMPPSA-N (2s,5r,6r)-6-[[(2r)-2-amino-2-(4-hydroxyphenyl)acetyl]amino]-3,3-dimethyl-7-oxo-4-thia-1-azabicyclo[3.2.0]heptane-2-carboxylic acid;(2r,3z,5r)-3-(2-hydroxyethylidene)-7-oxo-4-oxa-1-azabicyclo[3.2.0]heptane-2-carboxylic acid Chemical compound OC(=O)[C@H]1C(=C/CO)/O[C@@H]2CC(=O)N21.C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=C(O)C=C1 QJVHTELASVOWBE-AGNWQMPPSA-N 0.000 claims 1
- WZPBZJONDBGPKJ-UHFFFAOYSA-N Antibiotic SQ 26917 Natural products O=C1N(S(O)(=O)=O)C(C)C1NC(=O)C(=NOC(C)(C)C(O)=O)C1=CSC(N)=N1 WZPBZJONDBGPKJ-UHFFFAOYSA-N 0.000 claims 1
- 102000043856 Leucine-tRNA ligase Human genes 0.000 claims 1
- 229940040977 beta-lactamase resistant penicillins Drugs 0.000 claims 1
- HVFLCNVBZFFHBT-ZKDACBOMSA-N cefepime Chemical compound S([C@@H]1[C@@H](C(N1C=1C([O-])=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1C[N+]1(C)CCCC1 HVFLCNVBZFFHBT-ZKDACBOMSA-N 0.000 claims 1
- UCKZMPLVLCKKMO-LHLIQPBNSA-N cephamycin Chemical compound S1CC(C)=C(C(O)=O)N2C(=O)[C@@H](C)[C@]21OC UCKZMPLVLCKKMO-LHLIQPBNSA-N 0.000 claims 1
- 229960004912 cilastatin Drugs 0.000 claims 1
- DHSUYTOATWAVLW-WFVMDLQDSA-N cilastatin Chemical compound CC1(C)C[C@@H]1C(=O)N\C(=C/CCCCSC[C@H](N)C(O)=O)C(O)=O DHSUYTOATWAVLW-WFVMDLQDSA-N 0.000 claims 1
- 229960002292 piperacillin Drugs 0.000 claims 1
- WCMIIGXFCMNQDS-IDYPWDAWSA-M piperacillin sodium Chemical compound [Na+].O=C1C(=O)N(CC)CCN1C(=O)N[C@H](C=1C=CC=CC=1)C(=O)N[C@@H]1C(=O)N2[C@@H](C([O-])=O)C(C)(C)S[C@@H]21 WCMIIGXFCMNQDS-IDYPWDAWSA-M 0.000 claims 1
- DWHGNUUWCJZQHO-ZVDZYBSKSA-M potassium;(2s,5r,6r)-6-[[(2r)-2-amino-2-(4-hydroxyphenyl)acetyl]amino]-3,3-dimethyl-7-oxo-4-thia-1-azabicyclo[3.2.0]heptane-2-carboxylic acid;(2r,3z,5r)-3-(2-hydroxyethylidene)-7-oxo-4-oxa-1-azabicyclo[3.2.0]heptane-2-carboxylate Chemical compound [K+].[O-]C(=O)[C@H]1C(=C/CO)/O[C@@H]2CC(=O)N21.C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=C(O)C=C1 DWHGNUUWCJZQHO-ZVDZYBSKSA-M 0.000 claims 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 123
- 201000010099 disease Diseases 0.000 description 117
- 102000004127 Cytokines Human genes 0.000 description 69
- 108090000695 Cytokines Proteins 0.000 description 69
- 108700028939 Amino Acyl-tRNA Synthetases Proteins 0.000 description 51
- 102000052866 Amino Acyl-tRNA Synthetases Human genes 0.000 description 50
- 244000005700 microbiome Species 0.000 description 45
- 210000004027 cell Anatomy 0.000 description 35
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 31
- 229940079593 drug Drugs 0.000 description 31
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 31
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 30
- 102000019034 Chemokines Human genes 0.000 description 29
- 108010012236 Chemokines Proteins 0.000 description 29
- 108020004566 Transfer RNA Proteins 0.000 description 29
- 125000001424 substituent group Chemical group 0.000 description 28
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 28
- 238000003556 assay Methods 0.000 description 27
- 239000000651 prodrug Substances 0.000 description 27
- 229940002612 prodrug Drugs 0.000 description 27
- 210000003491 skin Anatomy 0.000 description 27
- 239000004480 active ingredient Substances 0.000 description 23
- 239000000243 solution Substances 0.000 description 23
- 210000004209 hair Anatomy 0.000 description 22
- 210000000003 hoof Anatomy 0.000 description 22
- 210000000282 nail Anatomy 0.000 description 22
- 210000000078 claw Anatomy 0.000 description 21
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 20
- 230000003247 decreasing effect Effects 0.000 description 20
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 20
- 239000012453 solvate Substances 0.000 description 20
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 19
- 239000002585 base Substances 0.000 description 19
- 230000000694 effects Effects 0.000 description 19
- 239000011541 reaction mixture Substances 0.000 description 19
- 241000193998 Streptococcus pneumoniae Species 0.000 description 18
- 150000002148 esters Chemical class 0.000 description 18
- 239000003921 oil Substances 0.000 description 18
- 241000588724 Escherichia coli Species 0.000 description 17
- 150000001413 amino acids Chemical class 0.000 description 17
- 239000002773 nucleotide Substances 0.000 description 17
- 125000003729 nucleotide group Chemical group 0.000 description 17
- 108090000623 proteins and genes Proteins 0.000 description 17
- 241000894007 species Species 0.000 description 17
- 241000191967 Staphylococcus aureus Species 0.000 description 16
- WYURNTSHIVDZCO-UHFFFAOYSA-N Tetrahydrofuran Chemical compound C1CCOC1 WYURNTSHIVDZCO-UHFFFAOYSA-N 0.000 description 16
- 238000006243 chemical reaction Methods 0.000 description 16
- 239000003795 chemical substances by application Substances 0.000 description 16
- 239000002904 solvent Substances 0.000 description 16
- 239000000126 substance Substances 0.000 description 16
- 229940024606 amino acid Drugs 0.000 description 15
- 230000001965 increasing effect Effects 0.000 description 15
- 241000588626 Acinetobacter baumannii Species 0.000 description 14
- 241000589513 Burkholderia cepacia Species 0.000 description 14
- 241000588919 Citrobacter freundii Species 0.000 description 14
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 14
- 241000588697 Enterobacter cloacae Species 0.000 description 14
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 14
- 241000607715 Serratia marcescens Species 0.000 description 14
- 241000193996 Streptococcus pyogenes Species 0.000 description 14
- 235000019441 ethanol Nutrition 0.000 description 14
- 125000005842 heteroatom Chemical group 0.000 description 14
- 125000004051 hexyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 14
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 14
- 235000019198 oils Nutrition 0.000 description 14
- 108090000765 processed proteins & peptides Proteins 0.000 description 14
- 229940124597 therapeutic agent Drugs 0.000 description 14
- 108010002350 Interleukin-2 Proteins 0.000 description 13
- 108090001050 Phosphoric Diester Hydrolases Proteins 0.000 description 13
- 102000004861 Phosphoric Diester Hydrolases Human genes 0.000 description 13
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 13
- 239000002775 capsule Substances 0.000 description 13
- 239000003995 emulsifying agent Substances 0.000 description 13
- 230000005764 inhibitory process Effects 0.000 description 13
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 12
- 241000283690 Bos taurus Species 0.000 description 12
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 12
- 241000122973 Stenotrophomonas maltophilia Species 0.000 description 12
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 12
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 12
- 239000002253 acid Substances 0.000 description 12
- 125000004429 atom Chemical group 0.000 description 12
- 239000000839 emulsion Substances 0.000 description 12
- 238000003818 flash chromatography Methods 0.000 description 12
- 230000002757 inflammatory effect Effects 0.000 description 12
- 239000000463 material Substances 0.000 description 12
- 238000002360 preparation method Methods 0.000 description 12
- 108090000978 Interleukin-4 Proteins 0.000 description 11
- 241000589516 Pseudomonas Species 0.000 description 11
- 201000004681 Psoriasis Diseases 0.000 description 11
- 150000001412 amines Chemical class 0.000 description 11
- 239000006071 cream Substances 0.000 description 11
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 11
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 11
- 231100000252 nontoxic Toxicity 0.000 description 11
- 230000003000 nontoxic effect Effects 0.000 description 11
- 150000003254 radicals Chemical class 0.000 description 11
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 11
- 239000003981 vehicle Substances 0.000 description 11
- 241000194032 Enterococcus faecalis Species 0.000 description 10
- 241000194031 Enterococcus faecium Species 0.000 description 10
- 102000004190 Enzymes Human genes 0.000 description 10
- 108090000790 Enzymes Proteins 0.000 description 10
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 10
- 108010065637 Interleukin-23 Proteins 0.000 description 10
- 241000588747 Klebsiella pneumoniae Species 0.000 description 10
- 241000186359 Mycobacterium Species 0.000 description 10
- 206010035664 Pneumonia Diseases 0.000 description 10
- 241000588770 Proteus mirabilis Species 0.000 description 10
- 241000588768 Providencia Species 0.000 description 10
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 10
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 10
- 230000004071 biological effect Effects 0.000 description 10
- 125000004432 carbon atom Chemical group C* 0.000 description 10
- 230000007423 decrease Effects 0.000 description 10
- 239000003974 emollient agent Substances 0.000 description 10
- 229940088598 enzyme Drugs 0.000 description 10
- 239000000499 gel Substances 0.000 description 10
- BXWNKGSJHAJOGX-UHFFFAOYSA-N hexadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCO BXWNKGSJHAJOGX-UHFFFAOYSA-N 0.000 description 10
- IXCSERBJSXMMFS-UHFFFAOYSA-N hydrogen chloride Substances Cl.Cl IXCSERBJSXMMFS-UHFFFAOYSA-N 0.000 description 10
- 229910000041 hydrogen chloride Inorganic materials 0.000 description 10
- 239000003883 ointment base Substances 0.000 description 10
- 239000012071 phase Substances 0.000 description 10
- 239000003755 preservative agent Substances 0.000 description 10
- 238000000746 purification Methods 0.000 description 10
- 230000002829 reductive effect Effects 0.000 description 10
- 239000007787 solid Substances 0.000 description 10
- 229940031000 streptococcus pneumoniae Drugs 0.000 description 10
- 241000588914 Enterobacter Species 0.000 description 9
- 108090000174 Interleukin-10 Proteins 0.000 description 9
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 9
- YXFVVABEGXRONW-UHFFFAOYSA-N Toluene Chemical compound CC1=CC=CC=C1 YXFVVABEGXRONW-UHFFFAOYSA-N 0.000 description 9
- 125000002947 alkylene group Chemical group 0.000 description 9
- 230000015572 biosynthetic process Effects 0.000 description 9
- 235000014113 dietary fatty acids Nutrition 0.000 description 9
- 239000000194 fatty acid Substances 0.000 description 9
- 229930195729 fatty acid Natural products 0.000 description 9
- 229910052760 oxygen Inorganic materials 0.000 description 9
- 239000000725 suspension Substances 0.000 description 9
- 238000012360 testing method Methods 0.000 description 9
- 125000002023 trifluoromethyl group Chemical group FC(F)(F)* 0.000 description 9
- HBAQYPYDRFILMT-UHFFFAOYSA-N 8-[3-(1-cyclopropylpyrazol-4-yl)-1H-pyrazolo[4,3-d]pyrimidin-5-yl]-3-methyl-3,8-diazabicyclo[3.2.1]octan-2-one Chemical class C1(CC1)N1N=CC(=C1)C1=NNC2=C1N=C(N=C2)N1C2C(N(CC1CC2)C)=O HBAQYPYDRFILMT-UHFFFAOYSA-N 0.000 description 8
- 101001039702 Escherichia coli (strain K12) Methyl-accepting chemotaxis protein I Proteins 0.000 description 8
- 241000606768 Haemophilus influenzae Species 0.000 description 8
- 108010002616 Interleukin-5 Proteins 0.000 description 8
- 108090001005 Interleukin-6 Proteins 0.000 description 8
- 108090001007 Interleukin-8 Proteins 0.000 description 8
- 201000009906 Meningitis Diseases 0.000 description 8
- 241000588778 Providencia stuartii Species 0.000 description 8
- 230000010261 cell growth Effects 0.000 description 8
- XEYBRNLFEZDVAW-ARSRFYASSA-N dinoprostone Chemical compound CCCCC[C@H](O)\C=C\[C@H]1[C@H](O)CC(=O)[C@@H]1C\C=C/CCCC(O)=O XEYBRNLFEZDVAW-ARSRFYASSA-N 0.000 description 8
- 229960002986 dinoprostone Drugs 0.000 description 8
- 150000004665 fatty acids Chemical class 0.000 description 8
- 239000007788 liquid Substances 0.000 description 8
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical class CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 8
- 239000006186 oral dosage form Substances 0.000 description 8
- 239000000047 product Substances 0.000 description 8
- XEYBRNLFEZDVAW-UHFFFAOYSA-N prostaglandin E2 Natural products CCCCCC(O)C=CC1C(O)CC(=O)C1CC=CCCCC(O)=O XEYBRNLFEZDVAW-UHFFFAOYSA-N 0.000 description 8
- 238000011200 topical administration Methods 0.000 description 8
- XOQABDOICLHPIS-UHFFFAOYSA-N 1-hydroxy-2,1-benzoxaborole Chemical class C1=CC=C2B(O)OCC2=C1 XOQABDOICLHPIS-UHFFFAOYSA-N 0.000 description 7
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 7
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 7
- 241000186216 Corynebacterium Species 0.000 description 7
- 241000588722 Escherichia Species 0.000 description 7
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 7
- 108010065805 Interleukin-12 Proteins 0.000 description 7
- 241000588748 Klebsiella Species 0.000 description 7
- 102100023339 Leucine-tRNA ligase, cytoplasmic Human genes 0.000 description 7
- 208000002193 Pain Diseases 0.000 description 7
- 230000001154 acute effect Effects 0.000 description 7
- 125000002252 acyl group Chemical group 0.000 description 7
- 125000004122 cyclic group Chemical group 0.000 description 7
- 239000002270 dispersing agent Substances 0.000 description 7
- 235000019439 ethyl acetate Nutrition 0.000 description 7
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 7
- 239000006210 lotion Substances 0.000 description 7
- 230000001404 mediated effect Effects 0.000 description 7
- 239000002609 medium Substances 0.000 description 7
- GLDOVTGHNKAZLK-UHFFFAOYSA-N octadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCCCO GLDOVTGHNKAZLK-UHFFFAOYSA-N 0.000 description 7
- 230000035515 penetration Effects 0.000 description 7
- 235000015424 sodium Nutrition 0.000 description 7
- 239000011734 sodium Substances 0.000 description 7
- 229910052708 sodium Inorganic materials 0.000 description 7
- 229940083542 sodium Drugs 0.000 description 7
- 239000003826 tablet Substances 0.000 description 7
- 230000001225 therapeutic effect Effects 0.000 description 7
- 239000013638 trimer Substances 0.000 description 7
- VBICKXHEKHSIBG-UHFFFAOYSA-N 1-monostearoylglycerol Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)CO VBICKXHEKHSIBG-UHFFFAOYSA-N 0.000 description 6
- 241000589291 Acinetobacter Species 0.000 description 6
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 6
- 241000283707 Capra Species 0.000 description 6
- 241000700199 Cavia porcellus Species 0.000 description 6
- 208000006545 Chronic Obstructive Pulmonary Disease Diseases 0.000 description 6
- 241001135265 Cronobacter sakazakii Species 0.000 description 6
- 101100296720 Dictyostelium discoideum Pde4 gene Proteins 0.000 description 6
- 241000283073 Equus caballus Species 0.000 description 6
- IAYPIBMASNFSPL-UHFFFAOYSA-N Ethylene oxide Chemical compound C1CO1 IAYPIBMASNFSPL-UHFFFAOYSA-N 0.000 description 6
- 241000282326 Felis catus Species 0.000 description 6
- 241000287828 Gallus gallus Species 0.000 description 6
- 208000005577 Gastroenteritis Diseases 0.000 description 6
- 241000699694 Gerbillinae Species 0.000 description 6
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 6
- 241000588915 Klebsiella aerogenes Species 0.000 description 6
- 241000283973 Oryctolagus cuniculus Species 0.000 description 6
- 241001494479 Pecora Species 0.000 description 6
- 241000009328 Perro Species 0.000 description 6
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 6
- 101100082610 Plasmodium falciparum (isolate 3D7) PDEdelta gene Proteins 0.000 description 6
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 6
- 206010040047 Sepsis Diseases 0.000 description 6
- 241000191963 Staphylococcus epidermidis Species 0.000 description 6
- 241000282898 Sus scrofa Species 0.000 description 6
- 150000001298 alcohols Chemical class 0.000 description 6
- 239000012267 brine Substances 0.000 description 6
- 244000309464 bull Species 0.000 description 6
- 239000000969 carrier Substances 0.000 description 6
- 206010009887 colitis Diseases 0.000 description 6
- 239000003086 colorant Substances 0.000 description 6
- 206010012601 diabetes mellitus Diseases 0.000 description 6
- 208000035475 disorder Diseases 0.000 description 6
- 229940092559 enterobacter aerogenes Drugs 0.000 description 6
- 229940032049 enterococcus faecalis Drugs 0.000 description 6
- 150000002191 fatty alcohols Chemical class 0.000 description 6
- 239000000706 filtrate Substances 0.000 description 6
- 239000000796 flavoring agent Substances 0.000 description 6
- 125000000524 functional group Chemical group 0.000 description 6
- 229940047650 haemophilus influenzae Drugs 0.000 description 6
- 125000004474 heteroalkylene group Chemical group 0.000 description 6
- UFVKGYZPFZQRLF-UHFFFAOYSA-N hydroxypropyl methyl cellulose Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)O)C(CO)O1 UFVKGYZPFZQRLF-UHFFFAOYSA-N 0.000 description 6
- 235000010445 lecithin Nutrition 0.000 description 6
- 239000000787 lecithin Substances 0.000 description 6
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 6
- 125000001160 methoxycarbonyl group Chemical group [H]C([H])([H])OC(*)=O 0.000 description 6
- 230000035772 mutation Effects 0.000 description 6
- 239000002674 ointment Substances 0.000 description 6
- 230000036961 partial effect Effects 0.000 description 6
- BWHMMNNQKKPAPP-UHFFFAOYSA-L potassium carbonate Chemical compound [K+].[K+].[O-]C([O-])=O BWHMMNNQKKPAPP-UHFFFAOYSA-L 0.000 description 6
- 238000002953 preparative HPLC Methods 0.000 description 6
- 238000000926 separation method Methods 0.000 description 6
- HPALAKNZSZLMCH-UHFFFAOYSA-M sodium;chloride;hydrate Chemical compound O.[Na+].[Cl-] HPALAKNZSZLMCH-UHFFFAOYSA-M 0.000 description 6
- 239000007921 spray Substances 0.000 description 6
- 239000000375 suspending agent Substances 0.000 description 6
- 239000003765 sweetening agent Substances 0.000 description 6
- 238000003786 synthesis reaction Methods 0.000 description 6
- 230000009885 systemic effect Effects 0.000 description 6
- 239000012049 topical pharmaceutical composition Substances 0.000 description 6
- ITMCEJHCFYSIIV-UHFFFAOYSA-M triflate Chemical compound [O-]S(=O)(=O)C(F)(F)F ITMCEJHCFYSIIV-UHFFFAOYSA-M 0.000 description 6
- 125000000876 trifluoromethoxy group Chemical group FC(F)(F)O* 0.000 description 6
- 208000019206 urinary tract infection Diseases 0.000 description 6
- MMRINLZOZVAPDZ-LSGRDSQZSA-N (6r,7r)-7-[[(2z)-2-(2-amino-1,3-thiazol-4-yl)-2-methoxyiminoacetyl]amino]-3-[(1-methylpyrrolidin-1-ium-1-yl)methyl]-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid;chloride Chemical compound Cl.S([C@@H]1[C@@H](C(N1C=1C([O-])=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1C[N+]1(C)CCCC1 MMRINLZOZVAPDZ-LSGRDSQZSA-N 0.000 description 5
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 5
- 241000186046 Actinomyces Species 0.000 description 5
- 241000193830 Bacillus <bacterium> Species 0.000 description 5
- 241000606125 Bacteroides Species 0.000 description 5
- 241000588807 Bordetella Species 0.000 description 5
- 241000589562 Brucella Species 0.000 description 5
- 241000589876 Campylobacter Species 0.000 description 5
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 5
- 241000193403 Clostridium Species 0.000 description 5
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 5
- 241000606790 Haemophilus Species 0.000 description 5
- 241000606860 Pasteurella Species 0.000 description 5
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 5
- 241000588769 Proteus <enterobacteria> Species 0.000 description 5
- 241000607142 Salmonella Species 0.000 description 5
- 206010040070 Septic Shock Diseases 0.000 description 5
- 241000607720 Serratia Species 0.000 description 5
- 241000607768 Shigella Species 0.000 description 5
- 241000607598 Vibrio Species 0.000 description 5
- 241000607734 Yersinia <bacteria> Species 0.000 description 5
- 238000010521 absorption reaction Methods 0.000 description 5
- 150000007513 acids Chemical class 0.000 description 5
- 150000008064 anhydrides Chemical class 0.000 description 5
- 229940088710 antibiotic agent Drugs 0.000 description 5
- 238000006795 borylation reaction Methods 0.000 description 5
- 229960000541 cetyl alcohol Drugs 0.000 description 5
- 238000004296 chiral HPLC Methods 0.000 description 5
- 239000007859 condensation product Substances 0.000 description 5
- 238000009792 diffusion process Methods 0.000 description 5
- 239000000539 dimer Substances 0.000 description 5
- 239000003623 enhancer Substances 0.000 description 5
- 235000003599 food sweetener Nutrition 0.000 description 5
- 239000008187 granular material Substances 0.000 description 5
- 239000001257 hydrogen Substances 0.000 description 5
- 230000007062 hydrolysis Effects 0.000 description 5
- 238000006460 hydrolysis reaction Methods 0.000 description 5
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 208000014674 injury Diseases 0.000 description 5
- 230000003834 intracellular effect Effects 0.000 description 5
- 229940067606 lecithin Drugs 0.000 description 5
- 125000001570 methylene group Chemical group [H]C([H])([*:1])[*:2] 0.000 description 5
- 201000006417 multiple sclerosis Diseases 0.000 description 5
- OHENQANLQNOMAO-UHFFFAOYSA-N oxaborole Chemical compound O1B=CC=C1 OHENQANLQNOMAO-UHFFFAOYSA-N 0.000 description 5
- 230000036407 pain Effects 0.000 description 5
- 235000019271 petrolatum Nutrition 0.000 description 5
- 229920001223 polyethylene glycol Polymers 0.000 description 5
- 229920001184 polypeptide Polymers 0.000 description 5
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 5
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 5
- 238000001556 precipitation Methods 0.000 description 5
- 102000004196 processed proteins & peptides Human genes 0.000 description 5
- 125000006239 protecting group Chemical group 0.000 description 5
- JUJWROOIHBZHMG-UHFFFAOYSA-N pyridine Substances C1=CC=NC=C1 JUJWROOIHBZHMG-UHFFFAOYSA-N 0.000 description 5
- 238000006798 ring closing metathesis reaction Methods 0.000 description 5
- 239000000741 silica gel Substances 0.000 description 5
- 229910002027 silica gel Inorganic materials 0.000 description 5
- 208000011580 syndromic disease Diseases 0.000 description 5
- 235000015112 vegetable and seed oil Nutrition 0.000 description 5
- 239000008158 vegetable oil Substances 0.000 description 5
- 239000000080 wetting agent Substances 0.000 description 5
- LNAZSHAWQACDHT-XIYTZBAFSA-N (2r,3r,4s,5r,6s)-4,5-dimethoxy-2-(methoxymethyl)-3-[(2s,3r,4s,5r,6r)-3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6r)-4,5,6-trimethoxy-2-(methoxymethyl)oxan-3-yl]oxyoxane Chemical compound CO[C@@H]1[C@@H](OC)[C@H](OC)[C@@H](COC)O[C@H]1O[C@H]1[C@H](OC)[C@@H](OC)[C@H](O[C@H]2[C@@H]([C@@H](OC)[C@H](OC)O[C@@H]2COC)OC)O[C@@H]1COC LNAZSHAWQACDHT-XIYTZBAFSA-N 0.000 description 4
- HBXWUCXDUUJDRB-UHFFFAOYSA-N 1-octadecoxyoctadecane Chemical compound CCCCCCCCCCCCCCCCCCOCCCCCCCCCCCCCCCCCC HBXWUCXDUUJDRB-UHFFFAOYSA-N 0.000 description 4
- 206010001052 Acute respiratory distress syndrome Diseases 0.000 description 4
- 241000589158 Agrobacterium Species 0.000 description 4
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 4
- 241000272525 Anas platyrhynchos Species 0.000 description 4
- 241000272814 Anser sp. Species 0.000 description 4
- 241000256844 Apis mellifera Species 0.000 description 4
- 201000001320 Atherosclerosis Diseases 0.000 description 4
- 241000606124 Bacteroides fragilis Species 0.000 description 4
- 241001416153 Bos grunniens Species 0.000 description 4
- 241001453380 Burkholderia Species 0.000 description 4
- 102100036150 C-X-C motif chemokine 5 Human genes 0.000 description 4
- 206010006895 Cachexia Diseases 0.000 description 4
- 241000282836 Camelus dromedarius Species 0.000 description 4
- 208000024172 Cardiovascular disease Diseases 0.000 description 4
- 241000282994 Cervidae Species 0.000 description 4
- 102000001327 Chemokine CCL5 Human genes 0.000 description 4
- 108010055166 Chemokine CCL5 Proteins 0.000 description 4
- 102000016950 Chemokine CXCL1 Human genes 0.000 description 4
- 108010014419 Chemokine CXCL1 Proteins 0.000 description 4
- 241000606161 Chlamydia Species 0.000 description 4
- 241001647372 Chlamydia pneumoniae Species 0.000 description 4
- 241000588923 Citrobacter Species 0.000 description 4
- 241000193163 Clostridioides difficile Species 0.000 description 4
- 206010009900 Colitis ulcerative Diseases 0.000 description 4
- 241000272201 Columbiformes Species 0.000 description 4
- 206010010744 Conjunctivitis allergic Diseases 0.000 description 4
- 208000011231 Crohn disease Diseases 0.000 description 4
- 206010012438 Dermatitis atopic Diseases 0.000 description 4
- 206010012735 Diarrhoea Diseases 0.000 description 4
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 4
- 102000012673 Follicle Stimulating Hormone Human genes 0.000 description 4
- 108010079345 Follicle Stimulating Hormone Proteins 0.000 description 4
- 241000282412 Homo Species 0.000 description 4
- 101000947186 Homo sapiens C-X-C motif chemokine 5 Proteins 0.000 description 4
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 4
- 108010002386 Interleukin-3 Proteins 0.000 description 4
- 108010002586 Interleukin-7 Proteins 0.000 description 4
- 108010002335 Interleukin-9 Proteins 0.000 description 4
- 241000589242 Legionella pneumophila Species 0.000 description 4
- 241001233242 Lontra Species 0.000 description 4
- 241000406668 Loxodonta cyclotis Species 0.000 description 4
- 101000577064 Lymnaea stagnalis Molluscan insulin-related peptide 1 Proteins 0.000 description 4
- 101000737895 Mytilus edulis Contraction-inhibiting peptide 1 Proteins 0.000 description 4
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 4
- 239000007832 Na2SO4 Substances 0.000 description 4
- 244000038458 Nepenthes mirabilis Species 0.000 description 4
- 241000272458 Numididae Species 0.000 description 4
- 239000004264 Petrolatum Substances 0.000 description 4
- 241000186429 Propionibacterium Species 0.000 description 4
- 241000283011 Rangifer Species 0.000 description 4
- 208000013616 Respiratory Distress Syndrome Diseases 0.000 description 4
- PMZURENOXWZQFD-UHFFFAOYSA-L Sodium Sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O PMZURENOXWZQFD-UHFFFAOYSA-L 0.000 description 4
- 241000191984 Staphylococcus haemolyticus Species 0.000 description 4
- 241000122971 Stenotrophomonas Species 0.000 description 4
- 241001478878 Streptobacillus Species 0.000 description 4
- 241000193985 Streptococcus agalactiae Species 0.000 description 4
- 241000187747 Streptomyces Species 0.000 description 4
- 241000272534 Struthio camelus Species 0.000 description 4
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 4
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 4
- 201000006704 Ulcerative Colitis Diseases 0.000 description 4
- 208000011341 adult acute respiratory distress syndrome Diseases 0.000 description 4
- 201000000028 adult respiratory distress syndrome Diseases 0.000 description 4
- 150000001299 aldehydes Chemical class 0.000 description 4
- 125000003545 alkoxy group Chemical group 0.000 description 4
- 208000002205 allergic conjunctivitis Diseases 0.000 description 4
- 230000003110 anti-inflammatory effect Effects 0.000 description 4
- 239000004599 antimicrobial Substances 0.000 description 4
- 239000003963 antioxidant agent Substances 0.000 description 4
- 235000006708 antioxidants Nutrition 0.000 description 4
- 239000008346 aqueous phase Substances 0.000 description 4
- 239000007900 aqueous suspension Substances 0.000 description 4
- 208000006673 asthma Diseases 0.000 description 4
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 4
- 201000008937 atopic dermatitis Diseases 0.000 description 4
- 244000052616 bacterial pathogen Species 0.000 description 4
- 210000004556 brain Anatomy 0.000 description 4
- 206010006451 bronchitis Diseases 0.000 description 4
- 235000010980 cellulose Nutrition 0.000 description 4
- 229920002678 cellulose Polymers 0.000 description 4
- 239000001913 cellulose Substances 0.000 description 4
- 239000000460 chlorine Substances 0.000 description 4
- 125000001309 chloro group Chemical group Cl* 0.000 description 4
- 206010014665 endocarditis Diseases 0.000 description 4
- 238000001914 filtration Methods 0.000 description 4
- 125000001153 fluoro group Chemical group F* 0.000 description 4
- 229940028334 follicle stimulating hormone Drugs 0.000 description 4
- 235000013355 food flavoring agent Nutrition 0.000 description 4
- 230000006870 function Effects 0.000 description 4
- 239000003349 gelling agent Substances 0.000 description 4
- 125000005843 halogen group Chemical group 0.000 description 4
- 238000013537 high throughput screening Methods 0.000 description 4
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 4
- 239000003112 inhibitor Substances 0.000 description 4
- 238000001990 intravenous administration Methods 0.000 description 4
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 4
- 229940115932 legionella pneumophila Drugs 0.000 description 4
- 229920000609 methyl cellulose Polymers 0.000 description 4
- 235000010981 methylcellulose Nutrition 0.000 description 4
- 239000001923 methylcellulose Substances 0.000 description 4
- 229960002900 methylcellulose Drugs 0.000 description 4
- 125000002816 methylsulfanyl group Chemical group [H]C([H])([H])S[*] 0.000 description 4
- 239000001788 mono and diglycerides of fatty acids Substances 0.000 description 4
- 239000004006 olive oil Substances 0.000 description 4
- 235000008390 olive oil Nutrition 0.000 description 4
- 239000012044 organic layer Substances 0.000 description 4
- 239000001301 oxygen Substances 0.000 description 4
- 229940066842 petrolatum Drugs 0.000 description 4
- 230000000144 pharmacologic effect Effects 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 4
- 229920000053 polysorbate 80 Polymers 0.000 description 4
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 4
- 239000000843 powder Substances 0.000 description 4
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 4
- 230000002285 radioactive effect Effects 0.000 description 4
- 206010039073 rheumatoid arthritis Diseases 0.000 description 4
- 229910052938 sodium sulfate Inorganic materials 0.000 description 4
- 229940037649 staphylococcus haemolyticus Drugs 0.000 description 4
- 238000006467 substitution reaction Methods 0.000 description 4
- 239000004094 surface-active agent Substances 0.000 description 4
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 4
- 239000002562 thickening agent Substances 0.000 description 4
- 230000037317 transdermal delivery Effects 0.000 description 4
- 230000008733 trauma Effects 0.000 description 4
- RIOQSEWOXXDEQQ-UHFFFAOYSA-N triphenylphosphine Chemical compound C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1 RIOQSEWOXXDEQQ-UHFFFAOYSA-N 0.000 description 4
- ZORQXIQZAOLNGE-UHFFFAOYSA-N 1,1-difluorocyclohexane Chemical compound FC1(F)CCCCC1 ZORQXIQZAOLNGE-UHFFFAOYSA-N 0.000 description 3
- RYHBNJHYFVUHQT-UHFFFAOYSA-N 1,4-Dioxane Chemical compound C1COCCO1 RYHBNJHYFVUHQT-UHFFFAOYSA-N 0.000 description 3
- ILCOCZBHMDEIAI-UHFFFAOYSA-N 2-(2-octadecoxyethoxy)ethanol Chemical compound CCCCCCCCCCCCCCCCCCOCCOCCO ILCOCZBHMDEIAI-UHFFFAOYSA-N 0.000 description 3
- 125000004105 2-pyridyl group Chemical group N1=C([*])C([H])=C([H])C([H])=C1[H] 0.000 description 3
- 125000003349 3-pyridyl group Chemical group N1=C([H])C([*])=C([H])C([H])=C1[H] 0.000 description 3
- 208000002874 Acne Vulgaris Diseases 0.000 description 3
- 208000024827 Alzheimer disease Diseases 0.000 description 3
- 241000193738 Bacillus anthracis Species 0.000 description 3
- 208000031729 Bacteremia Diseases 0.000 description 3
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 3
- 108020004414 DNA Proteins 0.000 description 3
- 206010012442 Dermatitis contact Diseases 0.000 description 3
- 241000192125 Firmicutes Species 0.000 description 3
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 3
- JZNWSCPGTDBMEW-UHFFFAOYSA-N Glycerophosphorylethanolamin Natural products NCCOP(O)(=O)OCC(O)CO JZNWSCPGTDBMEW-UHFFFAOYSA-N 0.000 description 3
- 206010019280 Heart failures Diseases 0.000 description 3
- 241000589989 Helicobacter Species 0.000 description 3
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 3
- 208000004575 Infectious Arthritis Diseases 0.000 description 3
- 206010024229 Leprosy Diseases 0.000 description 3
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 3
- 241000588653 Neisseria Species 0.000 description 3
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 3
- 208000018737 Parkinson disease Diseases 0.000 description 3
- 229920001213 Polysorbate 20 Polymers 0.000 description 3
- 229920001214 Polysorbate 60 Polymers 0.000 description 3
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 3
- NPXOKRUENSOPAO-UHFFFAOYSA-N Raney nickel Chemical compound [Al].[Ni] NPXOKRUENSOPAO-UHFFFAOYSA-N 0.000 description 3
- 206010063837 Reperfusion injury Diseases 0.000 description 3
- 206010039085 Rhinitis allergic Diseases 0.000 description 3
- 241000191940 Staphylococcus Species 0.000 description 3
- 229920002472 Starch Polymers 0.000 description 3
- 241000194017 Streptococcus Species 0.000 description 3
- 208000006011 Stroke Diseases 0.000 description 3
- 206010044248 Toxic shock syndrome Diseases 0.000 description 3
- 231100000650 Toxic shock syndrome Toxicity 0.000 description 3
- 206010047249 Venous thrombosis Diseases 0.000 description 3
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 3
- 230000002378 acidificating effect Effects 0.000 description 3
- 206010000496 acne Diseases 0.000 description 3
- 125000002015 acyclic group Chemical group 0.000 description 3
- UDMBCSSLTHHNCD-KQYNXXCUSA-N adenosine 5'-monophosphate Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@H]1O UDMBCSSLTHHNCD-KQYNXXCUSA-N 0.000 description 3
- 201000010105 allergic rhinitis Diseases 0.000 description 3
- 125000003277 amino group Chemical group 0.000 description 3
- 125000004202 aminomethyl group Chemical group [H]N([H])C([H])([H])* 0.000 description 3
- 125000000129 anionic group Chemical group 0.000 description 3
- 125000003710 aryl alkyl group Chemical group 0.000 description 3
- 125000004104 aryloxy group Chemical group 0.000 description 3
- 239000012298 atmosphere Substances 0.000 description 3
- 208000024998 atopic conjunctivitis Diseases 0.000 description 3
- 208000010668 atopic eczema Diseases 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 230000008499 blood brain barrier function Effects 0.000 description 3
- 210000001218 blood-brain barrier Anatomy 0.000 description 3
- 230000037396 body weight Effects 0.000 description 3
- GDTBXPJZTBHREO-UHFFFAOYSA-N bromine Chemical compound BrBr GDTBXPJZTBHREO-UHFFFAOYSA-N 0.000 description 3
- 239000011575 calcium Substances 0.000 description 3
- 229910052791 calcium Inorganic materials 0.000 description 3
- 229910000019 calcium carbonate Inorganic materials 0.000 description 3
- 235000010216 calcium carbonate Nutrition 0.000 description 3
- 239000001506 calcium phosphate Substances 0.000 description 3
- 229910000389 calcium phosphate Inorganic materials 0.000 description 3
- 235000011010 calcium phosphates Nutrition 0.000 description 3
- 229910002092 carbon dioxide Inorganic materials 0.000 description 3
- 239000001768 carboxy methyl cellulose Substances 0.000 description 3
- 210000004534 cecum Anatomy 0.000 description 3
- 230000001684 chronic effect Effects 0.000 description 3
- LQOLIRLGBULYKD-JKIFEVAISA-N cloxacillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C1=C(C)ON=C1C1=CC=CC=C1Cl LQOLIRLGBULYKD-JKIFEVAISA-N 0.000 description 3
- 229960003326 cloxacillin Drugs 0.000 description 3
- 208000010247 contact dermatitis Diseases 0.000 description 3
- 239000002537 cosmetic Substances 0.000 description 3
- 125000000113 cyclohexyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 3
- 238000010511 deprotection reaction Methods 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 235000019329 dioctyl sodium sulphosuccinate Nutrition 0.000 description 3
- 239000003651 drinking water Substances 0.000 description 3
- 235000020188 drinking water Nutrition 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 230000002708 enhancing effect Effects 0.000 description 3
- 230000032050 esterification Effects 0.000 description 3
- 238000005886 esterification reaction Methods 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 230000003325 follicular Effects 0.000 description 3
- 239000012634 fragment Substances 0.000 description 3
- 239000003205 fragrance Substances 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 229940075507 glyceryl monostearate Drugs 0.000 description 3
- 150000004677 hydrates Chemical class 0.000 description 3
- 239000001863 hydroxypropyl cellulose Substances 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 125000000959 isobutyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])* 0.000 description 3
- 239000010410 layer Substances 0.000 description 3
- 125000005647 linker group Chemical group 0.000 description 3
- 229940057995 liquid paraffin Drugs 0.000 description 3
- 206010027175 memory impairment Diseases 0.000 description 3
- 239000002480 mineral oil Substances 0.000 description 3
- 235000010446 mineral oil Nutrition 0.000 description 3
- 239000012046 mixed solvent Substances 0.000 description 3
- 238000002156 mixing Methods 0.000 description 3
- GOQYKNQRPGWPLP-UHFFFAOYSA-N n-heptadecyl alcohol Natural products CCCCCCCCCCCCCCCCCO GOQYKNQRPGWPLP-UHFFFAOYSA-N 0.000 description 3
- GPXLMGHLHQJAGZ-JTDSTZFVSA-N nafcillin Chemical compound C1=CC=CC2=C(C(=O)N[C@@H]3C(N4[C@H](C(C)(C)S[C@@H]43)C(O)=O)=O)C(OCC)=CC=C21 GPXLMGHLHQJAGZ-JTDSTZFVSA-N 0.000 description 3
- 229960000515 nafcillin Drugs 0.000 description 3
- 230000007935 neutral effect Effects 0.000 description 3
- 125000004433 nitrogen atom Chemical group N* 0.000 description 3
- 229910000069 nitrogen hydride Inorganic materials 0.000 description 3
- 239000002736 nonionic surfactant Substances 0.000 description 3
- 230000003287 optical effect Effects 0.000 description 3
- 201000008482 osteoarthritis Diseases 0.000 description 3
- 239000008177 pharmaceutical agent Substances 0.000 description 3
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 3
- 229910052700 potassium Inorganic materials 0.000 description 3
- 239000011591 potassium Substances 0.000 description 3
- 229910000027 potassium carbonate Inorganic materials 0.000 description 3
- 235000015320 potassium carbonate Nutrition 0.000 description 3
- 239000002244 precipitate Substances 0.000 description 3
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 3
- UMJSCPRVCHMLSP-UHFFFAOYSA-N pyridine Natural products COC1=CC=CN=C1 UMJSCPRVCHMLSP-UHFFFAOYSA-N 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- 208000037803 restenosis Diseases 0.000 description 3
- 201000001223 septic arthritis Diseases 0.000 description 3
- 239000012279 sodium borohydride Substances 0.000 description 3
- 229910000033 sodium borohydride Inorganic materials 0.000 description 3
- 229940035049 sorbitan monooleate Drugs 0.000 description 3
- 235000011069 sorbitan monooleate Nutrition 0.000 description 3
- 239000001593 sorbitan monooleate Substances 0.000 description 3
- 235000019698 starch Nutrition 0.000 description 3
- 239000007858 starting material Substances 0.000 description 3
- 230000004936 stimulating effect Effects 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 125000004434 sulfur atom Chemical group 0.000 description 3
- 238000001356 surgical procedure Methods 0.000 description 3
- 239000006188 syrup Substances 0.000 description 3
- 235000020357 syrup Nutrition 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 231100000419 toxicity Toxicity 0.000 description 3
- 230000001988 toxicity Effects 0.000 description 3
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 3
- 201000008297 typhoid fever Diseases 0.000 description 3
- PUPZLCDOIYMWBV-UHFFFAOYSA-N (+/-)-1,3-Butanediol Chemical compound CC(O)CCO PUPZLCDOIYMWBV-UHFFFAOYSA-N 0.000 description 2
- FKENQMMABCRJMK-LWOQYNTDSA-N (5r)-3,3-dimethyl-4,4,7-trioxo-4$l^{6}-thia-1-azabicyclo[3.2.0]heptane-2-carboxylic acid Chemical compound O=S1(=O)C(C)(C)C(C(O)=O)N2C(=O)C[C@H]21 FKENQMMABCRJMK-LWOQYNTDSA-N 0.000 description 2
- ALSTYHKOOCGGFT-KTKRTIGZSA-N (9Z)-octadecen-1-ol Chemical compound CCCCCCCC\C=C/CCCCCCCCO ALSTYHKOOCGGFT-KTKRTIGZSA-N 0.000 description 2
- 125000004178 (C1-C4) alkyl group Chemical group 0.000 description 2
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 description 2
- PORPENFLTBBHSG-MGBGTMOVSA-N 1,2-dihexadecanoyl-sn-glycerol-3-phosphate Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(O)=O)OC(=O)CCCCCCCCCCCCCCC PORPENFLTBBHSG-MGBGTMOVSA-N 0.000 description 2
- TZCPCKNHXULUIY-RGULYWFUSA-N 1,2-distearoyl-sn-glycero-3-phosphoserine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCCCC TZCPCKNHXULUIY-RGULYWFUSA-N 0.000 description 2
- RYCNUMLMNKHWPZ-SNVBAGLBSA-N 1-acetyl-sn-glycero-3-phosphocholine Chemical compound CC(=O)OC[C@@H](O)COP([O-])(=O)OCC[N+](C)(C)C RYCNUMLMNKHWPZ-SNVBAGLBSA-N 0.000 description 2
- UHDGCWIWMRVCDJ-UHFFFAOYSA-N 1-beta-D-Xylofuranosyl-NH-Cytosine Natural products O=C1N=C(N)C=CN1C1C(O)C(O)C(CO)O1 UHDGCWIWMRVCDJ-UHFFFAOYSA-N 0.000 description 2
- IXPNQXFRVYWDDI-UHFFFAOYSA-N 1-methyl-2,4-dioxo-1,3-diazinane-5-carboximidamide Chemical compound CN1CC(C(N)=N)C(=O)NC1=O IXPNQXFRVYWDDI-UHFFFAOYSA-N 0.000 description 2
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 2
- LAXPJIJQTHJGCK-UHFFFAOYSA-N 2-bromo-1-(2-bromophenyl)ethanone Chemical class BrCC(=O)C1=CC=CC=C1Br LAXPJIJQTHJGCK-UHFFFAOYSA-N 0.000 description 2
- IZHVBANLECCAGF-UHFFFAOYSA-N 2-hydroxy-3-(octadecanoyloxy)propyl octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)COC(=O)CCCCCCCCCCCCCCCCC IZHVBANLECCAGF-UHFFFAOYSA-N 0.000 description 2
- VZQXUWKZDSEQRR-SDBHATRESA-N 2-methylthio-N(6)-(Delta(2)-isopentenyl)adenosine Chemical group C12=NC(SC)=NC(NCC=C(C)C)=C2N=CN1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O VZQXUWKZDSEQRR-SDBHATRESA-N 0.000 description 2
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- PXACTUVBBMDKRW-UHFFFAOYSA-M 4-bromobenzenesulfonate Chemical compound [O-]S(=O)(=O)C1=CC=C(Br)C=C1 PXACTUVBBMDKRW-UHFFFAOYSA-M 0.000 description 2
- HIQIXEFWDLTDED-UHFFFAOYSA-N 4-hydroxy-1-piperidin-4-ylpyrrolidin-2-one Chemical compound O=C1CC(O)CN1C1CCNCC1 HIQIXEFWDLTDED-UHFFFAOYSA-N 0.000 description 2
- SPXOTSHWBDUUMT-UHFFFAOYSA-M 4-nitrobenzenesulfonate Chemical compound [O-][N+](=O)C1=CC=C(S([O-])(=O)=O)C=C1 SPXOTSHWBDUUMT-UHFFFAOYSA-M 0.000 description 2
- 125000000339 4-pyridyl group Chemical group N1=C([H])C([H])=C([*])C([H])=C1[H] 0.000 description 2
- ZLOIGESWDJYCTF-XVFCMESISA-N 4-thiouridine Chemical group O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=S)C=C1 ZLOIGESWDJYCTF-XVFCMESISA-N 0.000 description 2
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 description 2
- 208000030507 AIDS Diseases 0.000 description 2
- 235000006491 Acacia senegal Nutrition 0.000 description 2
- 244000215068 Acacia senegal Species 0.000 description 2
- 241001541756 Acinetobacter calcoaceticus subsp. anitratus Species 0.000 description 2
- 208000020154 Acnes Diseases 0.000 description 2
- 241000186041 Actinomyces israelii Species 0.000 description 2
- 208000004476 Acute Coronary Syndrome Diseases 0.000 description 2
- 241000589155 Agrobacterium tumefaciens Species 0.000 description 2
- 235000003911 Arachis Nutrition 0.000 description 2
- 244000105624 Arachis hypogaea Species 0.000 description 2
- 206010053555 Arthritis bacterial Diseases 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 241000416162 Astragalus gummifer Species 0.000 description 2
- 208000009137 Behcet syndrome Diseases 0.000 description 2
- 102000004506 Blood Proteins Human genes 0.000 description 2
- 108010017384 Blood Proteins Proteins 0.000 description 2
- 241000589567 Brucella abortus Species 0.000 description 2
- 108091007914 CDKs Proteins 0.000 description 2
- 241000589874 Campylobacter fetus Species 0.000 description 2
- 241000589875 Campylobacter jejuni Species 0.000 description 2
- 208000031229 Cardiomyopathies Diseases 0.000 description 2
- LZZYPRNAOMGNLH-UHFFFAOYSA-M Cetrimonium bromide Chemical compound [Br-].CCCCCCCCCCCCCCCC[N+](C)(C)C LZZYPRNAOMGNLH-UHFFFAOYSA-M 0.000 description 2
- 241001647378 Chlamydia psittaci Species 0.000 description 2
- 241000606153 Chlamydia trachomatis Species 0.000 description 2
- HZZVJAQRINQKSD-UHFFFAOYSA-N Clavulanic acid Natural products OC(=O)C1C(=CCO)OC2CC(=O)N21 HZZVJAQRINQKSD-UHFFFAOYSA-N 0.000 description 2
- 241000193155 Clostridium botulinum Species 0.000 description 2
- 241000193468 Clostridium perfringens Species 0.000 description 2
- 241000193449 Clostridium tetani Species 0.000 description 2
- 206010010904 Convulsion Diseases 0.000 description 2
- 208000014997 Crohn colitis Diseases 0.000 description 2
- 241000186427 Cutibacterium acnes Species 0.000 description 2
- 102000003903 Cyclin-dependent kinases Human genes 0.000 description 2
- 108090000266 Cyclin-dependent kinases Proteins 0.000 description 2
- 201000003883 Cystic fibrosis Diseases 0.000 description 2
- UHDGCWIWMRVCDJ-PSQAKQOGSA-N Cytidine Natural products O=C1N=C(N)C=CN1[C@@H]1[C@@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-PSQAKQOGSA-N 0.000 description 2
- 201000004624 Dermatitis Diseases 0.000 description 2
- 206010012689 Diabetic retinopathy Diseases 0.000 description 2
- 101100135868 Dictyostelium discoideum pde3 gene Proteins 0.000 description 2
- 101100407335 Dictyostelium discoideum pde7 gene Proteins 0.000 description 2
- 101100189582 Dictyostelium discoideum pdeD gene Proteins 0.000 description 2
- 101100351286 Dictyostelium discoideum pdeE gene Proteins 0.000 description 2
- 101100135859 Dictyostelium discoideum regA gene Proteins 0.000 description 2
- 241000194033 Enterococcus Species 0.000 description 2
- QUSNBJAOOMFDIB-UHFFFAOYSA-N Ethylamine Chemical compound CCN QUSNBJAOOMFDIB-UHFFFAOYSA-N 0.000 description 2
- 208000001640 Fibromyalgia Diseases 0.000 description 2
- 241000589602 Francisella tularensis Species 0.000 description 2
- 208000018522 Gastrointestinal disease Diseases 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 206010018364 Glomerulonephritis Diseases 0.000 description 2
- ZWZWYGMENQVNFU-UHFFFAOYSA-N Glycerophosphorylserin Natural products OC(=O)C(N)COP(O)(=O)OCC(O)CO ZWZWYGMENQVNFU-UHFFFAOYSA-N 0.000 description 2
- 235000010469 Glycine max Nutrition 0.000 description 2
- 244000068988 Glycine max Species 0.000 description 2
- 201000005569 Gout Diseases 0.000 description 2
- 229920000084 Gum arabic Polymers 0.000 description 2
- 241000590002 Helicobacter pylori Species 0.000 description 2
- 238000006842 Henry reaction Methods 0.000 description 2
- 101000988424 Homo sapiens cAMP-specific 3',5'-cyclic phosphodiesterase 4B Proteins 0.000 description 2
- 208000023105 Huntington disease Diseases 0.000 description 2
- 108050003558 Interleukin-17 Proteins 0.000 description 2
- 108090000171 Interleukin-18 Proteins 0.000 description 2
- WMFOQBRAJBCJND-UHFFFAOYSA-M Lithium hydroxide Chemical compound [Li+].[OH-] WMFOQBRAJBCJND-UHFFFAOYSA-M 0.000 description 2
- 208000019693 Lung disease Diseases 0.000 description 2
- 208000016604 Lyme disease Diseases 0.000 description 2
- BAVYZALUXZFZLV-UHFFFAOYSA-N Methylamine Chemical compound NC BAVYZALUXZFZLV-UHFFFAOYSA-N 0.000 description 2
- 241000588655 Moraxella catarrhalis Species 0.000 description 2
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 2
- FFDGPVCHZBVARC-UHFFFAOYSA-N N,N-dimethylglycine Chemical compound CN(C)CC(O)=O FFDGPVCHZBVARC-UHFFFAOYSA-N 0.000 description 2
- MZRVEZGGRBJDDB-UHFFFAOYSA-N N-Butyllithium Chemical compound [Li]CCCC MZRVEZGGRBJDDB-UHFFFAOYSA-N 0.000 description 2
- 206010028703 Nail psoriasis Diseases 0.000 description 2
- 241000588652 Neisseria gonorrhoeae Species 0.000 description 2
- 241000588650 Neisseria meningitidis Species 0.000 description 2
- 206010028980 Neoplasm Diseases 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 239000005642 Oleic acid Substances 0.000 description 2
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 description 2
- 208000001132 Osteoporosis Diseases 0.000 description 2
- 101150098694 PDE5A gene Proteins 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- 101100082606 Plasmodium falciparum (isolate 3D7) PDEbeta gene Proteins 0.000 description 2
- 108010039918 Polylysine Proteins 0.000 description 2
- 206010036105 Polyneuropathy Diseases 0.000 description 2
- 229920001219 Polysorbate 40 Polymers 0.000 description 2
- 239000004372 Polyvinyl alcohol Substances 0.000 description 2
- 241001648298 Propionivibrio Species 0.000 description 2
- 201000001263 Psoriatic Arthritis Diseases 0.000 description 2
- 208000036824 Psoriatic arthropathy Diseases 0.000 description 2
- 208000010378 Pulmonary Embolism Diseases 0.000 description 2
- SMWDFEZZVXVKRB-UHFFFAOYSA-N Quinoline Chemical compound N1=CC=CC2=CC=CC=C21 SMWDFEZZVXVKRB-UHFFFAOYSA-N 0.000 description 2
- 241000606697 Rickettsia prowazekii Species 0.000 description 2
- 241000606695 Rickettsia rickettsii Species 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 2
- 101100135860 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) PDE2 gene Proteins 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N Sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 2
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 2
- BCKXLBQYZLBQEK-KVVVOXFISA-M Sodium oleate Chemical compound [Na+].CCCCCCCC\C=C/CCCCCCCC([O-])=O BCKXLBQYZLBQEK-KVVVOXFISA-M 0.000 description 2
- HVUMOYIDDBPOLL-XWVZOOPGSA-N Sorbitan monostearate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O HVUMOYIDDBPOLL-XWVZOOPGSA-N 0.000 description 2
- 201000002661 Spondylitis Diseases 0.000 description 2
- 241001147691 Staphylococcus saprophyticus Species 0.000 description 2
- 235000021355 Stearic acid Nutrition 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- WPMWEFXCIYCJSA-UHFFFAOYSA-N Tetraethylene glycol monododecyl ether Chemical compound CCCCCCCCCCCCOCCOCCOCCOCCO WPMWEFXCIYCJSA-UHFFFAOYSA-N 0.000 description 2
- 208000007536 Thrombosis Diseases 0.000 description 2
- 229920001615 Tragacanth Polymers 0.000 description 2
- 208000037386 Typhoid Diseases 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- 206010046851 Uveitis Diseases 0.000 description 2
- 206010046914 Vaginal infection Diseases 0.000 description 2
- 201000008100 Vaginitis Diseases 0.000 description 2
- 206010047115 Vasculitis Diseases 0.000 description 2
- 241000607626 Vibrio cholerae Species 0.000 description 2
- 241000607272 Vibrio parahaemolyticus Species 0.000 description 2
- 241000607479 Yersinia pestis Species 0.000 description 2
- OGQICQVSFDPSEI-UHFFFAOYSA-N Zorac Chemical compound N1=CC(C(=O)OCC)=CC=C1C#CC1=CC=C(SCCC2(C)C)C2=C1 OGQICQVSFDPSEI-UHFFFAOYSA-N 0.000 description 2
- SZYSLWCAWVWFLT-UTGHZIEOSA-N [(2s,3s,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)-2-[(2r,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxolan-2-yl]methyl octadecanoate Chemical compound O([C@@H]1[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O1)O)[C@]1(COC(=O)CCCCCCCCCCCCCCCCC)O[C@H](CO)[C@@H](O)[C@@H]1O SZYSLWCAWVWFLT-UTGHZIEOSA-N 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 235000010489 acacia gum Nutrition 0.000 description 2
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 2
- 125000003668 acetyloxy group Chemical group [H]C([H])([H])C(=O)O[*] 0.000 description 2
- 125000004423 acyloxy group Chemical group 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine group Chemical group [C@@H]1([C@H](O)[C@H](O)[C@@H](CO)O1)N1C=NC=2C(N)=NC=NC12 OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- 239000000443 aerosol Substances 0.000 description 2
- 235000010443 alginic acid Nutrition 0.000 description 2
- 229920000615 alginic acid Polymers 0.000 description 2
- 239000000783 alginic acid Substances 0.000 description 2
- 229960001126 alginic acid Drugs 0.000 description 2
- 150000004781 alginic acids Chemical class 0.000 description 2
- 208000026935 allergic disease Diseases 0.000 description 2
- 229910021529 ammonia Inorganic materials 0.000 description 2
- 239000002280 amphoteric surfactant Substances 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 239000003945 anionic surfactant Substances 0.000 description 2
- 230000000844 anti-bacterial effect Effects 0.000 description 2
- 206010003246 arthritis Diseases 0.000 description 2
- 125000005002 aryl methyl group Chemical group 0.000 description 2
- 229940065181 bacillus anthracis Drugs 0.000 description 2
- 230000004888 barrier function Effects 0.000 description 2
- 125000005605 benzo group Chemical group 0.000 description 2
- 239000003781 beta lactamase inhibitor Substances 0.000 description 2
- 229940126813 beta-lactamase inhibitor Drugs 0.000 description 2
- 238000002306 biochemical method Methods 0.000 description 2
- KWAMCZWYLSPKDL-UHFFFAOYSA-N borinino[4,3-b]furan Chemical compound C1=CB=CC2=C1OC=C2 KWAMCZWYLSPKDL-UHFFFAOYSA-N 0.000 description 2
- 229910052794 bromium Inorganic materials 0.000 description 2
- 125000001246 bromo group Chemical group Br* 0.000 description 2
- 229940056450 brucella abortus Drugs 0.000 description 2
- 239000006172 buffering agent Substances 0.000 description 2
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 2
- 102100029168 cAMP-specific 3',5'-cyclic phosphodiesterase 4B Human genes 0.000 description 2
- 102100029175 cGMP-specific 3',5'-cyclic phosphodiesterase Human genes 0.000 description 2
- 201000011510 cancer Diseases 0.000 description 2
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 2
- 239000012876 carrier material Substances 0.000 description 2
- 239000003054 catalyst Substances 0.000 description 2
- 125000002091 cationic group Chemical group 0.000 description 2
- 239000003093 cationic surfactant Substances 0.000 description 2
- 239000013553 cell monolayer Substances 0.000 description 2
- 230000019522 cellular metabolic process Effects 0.000 description 2
- 210000003169 central nervous system Anatomy 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 238000002512 chemotherapy Methods 0.000 description 2
- 229940038705 chlamydia trachomatis Drugs 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 229960003324 clavulanic acid Drugs 0.000 description 2
- HZZVJAQRINQKSD-PBFISZAISA-N clavulanic acid Chemical compound OC(=O)[C@H]1C(=C/CO)/O[C@@H]2CC(=O)N21 HZZVJAQRINQKSD-PBFISZAISA-N 0.000 description 2
- 238000010549 co-Evaporation Methods 0.000 description 2
- 208000029078 coronary artery disease Diseases 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 125000000000 cycloalkoxy group Chemical group 0.000 description 2
- 125000001511 cyclopentyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 2
- UHDGCWIWMRVCDJ-ZAKLUEHWSA-N cytidine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-ZAKLUEHWSA-N 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 238000001212 derivatisation Methods 0.000 description 2
- 235000005911 diet Nutrition 0.000 description 2
- 230000037213 diet Effects 0.000 description 2
- 208000010643 digestive system disease Diseases 0.000 description 2
- 150000002009 diols Chemical class 0.000 description 2
- 206010013023 diphtheria Diseases 0.000 description 2
- 208000016097 disease of metabolism Diseases 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 229960000878 docusate sodium Drugs 0.000 description 2
- 239000013583 drug formulation Substances 0.000 description 2
- 239000008387 emulsifying waxe Substances 0.000 description 2
- 210000002615 epidermis Anatomy 0.000 description 2
- 125000004185 ester group Chemical group 0.000 description 2
- 125000004705 ethylthio group Chemical group C(C)S* 0.000 description 2
- 229940118764 francisella tularensis Drugs 0.000 description 2
- 208000018685 gastrointestinal system disease Diseases 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 239000007903 gelatin capsule Substances 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 235000011187 glycerol Nutrition 0.000 description 2
- 229940093915 gynecological organic acid Drugs 0.000 description 2
- 229940037467 helicobacter pylori Drugs 0.000 description 2
- 125000005553 heteroaryloxy group Chemical group 0.000 description 2
- 125000000623 heterocyclic group Chemical group 0.000 description 2
- FBPFZTCFMRRESA-UHFFFAOYSA-N hexane-1,2,3,4,5,6-hexol Chemical compound OCC(O)C(O)C(O)C(O)CO FBPFZTCFMRRESA-UHFFFAOYSA-N 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 239000003906 humectant Substances 0.000 description 2
- 229930195733 hydrocarbon Natural products 0.000 description 2
- 150000002430 hydrocarbons Chemical class 0.000 description 2
- 150000002431 hydrogen Chemical class 0.000 description 2
- 230000003301 hydrolyzing effect Effects 0.000 description 2
- 229940071826 hydroxyethyl cellulose Drugs 0.000 description 2
- 125000004029 hydroxymethyl group Chemical group [H]OC([H])([H])* 0.000 description 2
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 2
- 239000012442 inert solvent Substances 0.000 description 2
- 230000028709 inflammatory response Effects 0.000 description 2
- 239000000543 intermediate Substances 0.000 description 2
- 125000002346 iodo group Chemical group I* 0.000 description 2
- 239000002563 ionic surfactant Substances 0.000 description 2
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 description 2
- 208000017169 kidney disease Diseases 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 208000019423 liver disease Diseases 0.000 description 2
- 239000007937 lozenge Substances 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 2
- 108020004999 messenger RNA Proteins 0.000 description 2
- 208000030159 metabolic disease Diseases 0.000 description 2
- 229910021645 metal ion Inorganic materials 0.000 description 2
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 2
- 150000004702 methyl esters Chemical group 0.000 description 2
- 230000000813 microbial effect Effects 0.000 description 2
- 125000004573 morpholin-4-yl group Chemical group N1(CCOCC1)* 0.000 description 2
- 208000015122 neurodegenerative disease Diseases 0.000 description 2
- 125000004971 nitroalkyl group Chemical group 0.000 description 2
- LYGJENNIWJXYER-UHFFFAOYSA-N nitromethane Chemical compound C[N+]([O-])=O LYGJENNIWJXYER-UHFFFAOYSA-N 0.000 description 2
- 231100000344 non-irritating Toxicity 0.000 description 2
- 239000000346 nonvolatile oil Substances 0.000 description 2
- 150000007523 nucleic acids Chemical class 0.000 description 2
- 238000010534 nucleophilic substitution reaction Methods 0.000 description 2
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 2
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 2
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 2
- 229940055577 oleyl alcohol Drugs 0.000 description 2
- XMLQWXUVTXCDDL-UHFFFAOYSA-N oleyl alcohol Natural products CCCCCCC=CCCCCCCCCCCO XMLQWXUVTXCDDL-UHFFFAOYSA-N 0.000 description 2
- 150000007524 organic acids Chemical class 0.000 description 2
- 235000005985 organic acids Nutrition 0.000 description 2
- 239000012074 organic phase Substances 0.000 description 2
- 230000002611 ovarian Effects 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-O oxonium Chemical compound [OH3+] XLYOFNOQVPJJNP-UHFFFAOYSA-O 0.000 description 2
- 125000004430 oxygen atom Chemical group O* 0.000 description 2
- 229910052763 palladium Inorganic materials 0.000 description 2
- KDLHZDBZIXYQEI-UHFFFAOYSA-N palladium Substances [Pd] KDLHZDBZIXYQEI-UHFFFAOYSA-N 0.000 description 2
- NXJCBFBQEVOTOW-UHFFFAOYSA-L palladium(2+);dihydroxide Chemical compound O[Pd]O NXJCBFBQEVOTOW-UHFFFAOYSA-L 0.000 description 2
- 239000012188 paraffin wax Substances 0.000 description 2
- 101150037969 pde-6 gene Proteins 0.000 description 2
- 239000003961 penetration enhancing agent Substances 0.000 description 2
- 230000035699 permeability Effects 0.000 description 2
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 2
- 150000008104 phosphatidylethanolamines Chemical class 0.000 description 2
- DLYUQMMRRRQYAE-UHFFFAOYSA-N phosphorus pentoxide Inorganic materials O1P(O2)(=O)OP3(=O)OP1(=O)OP2(=O)O3 DLYUQMMRRRQYAE-UHFFFAOYSA-N 0.000 description 2
- 229920001983 poloxamer Polymers 0.000 description 2
- 229920001987 poloxamine Polymers 0.000 description 2
- 229920000656 polylysine Polymers 0.000 description 2
- 230000007824 polyneuropathy Effects 0.000 description 2
- 229920000259 polyoxyethylene lauryl ether Polymers 0.000 description 2
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 2
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 2
- 229920002451 polyvinyl alcohol Polymers 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 230000000770 proinflammatory effect Effects 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 229940055019 propionibacterium acne Drugs 0.000 description 2
- 229960004063 propylene glycol Drugs 0.000 description 2
- 235000013772 propylene glycol Nutrition 0.000 description 2
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 2
- 102000004169 proteins and genes Human genes 0.000 description 2
- 125000003373 pyrazinyl group Chemical group 0.000 description 2
- 125000000714 pyrimidinyl group Chemical group 0.000 description 2
- 238000001953 recrystallisation Methods 0.000 description 2
- 229940046939 rickettsia prowazekii Drugs 0.000 description 2
- 229940075118 rickettsia rickettsii Drugs 0.000 description 2
- 229920006395 saturated elastomer Polymers 0.000 description 2
- 201000000980 schizophrenia Diseases 0.000 description 2
- 125000003808 silyl group Chemical group [H][Si]([H])([H])[*] 0.000 description 2
- 201000009890 sinusitis Diseases 0.000 description 2
- 206010040872 skin infection Diseases 0.000 description 2
- 229940005550 sodium alginate Drugs 0.000 description 2
- 235000010413 sodium alginate Nutrition 0.000 description 2
- 239000000661 sodium alginate Substances 0.000 description 2
- WBHQBSYUUJJSRZ-UHFFFAOYSA-M sodium bisulfate Chemical compound [Na+].OS([O-])(=O)=O WBHQBSYUUJJSRZ-UHFFFAOYSA-M 0.000 description 2
- 229910000342 sodium bisulfate Inorganic materials 0.000 description 2
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 2
- APSBXTVYXVQYAB-UHFFFAOYSA-M sodium docusate Chemical compound [Na+].CCCCC(CC)COC(=O)CC(S([O-])(=O)=O)C(=O)OCC(CC)CCCC APSBXTVYXVQYAB-UHFFFAOYSA-M 0.000 description 2
- ODFAPIRLUPAQCQ-UHFFFAOYSA-M sodium stearoyl lactylate Chemical compound [Na+].CCCCCCCCCCCCCCCCCC(=O)OC(C)C(=O)OC(C)C([O-])=O ODFAPIRLUPAQCQ-UHFFFAOYSA-M 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 229940032147 starch Drugs 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 239000008117 stearic acid Substances 0.000 description 2
- 229960004274 stearic acid Drugs 0.000 description 2
- 229940012831 stearyl alcohol Drugs 0.000 description 2
- 238000003756 stirring Methods 0.000 description 2
- 210000000434 stratum corneum Anatomy 0.000 description 2
- 230000035322 succinylation Effects 0.000 description 2
- 238000010613 succinylation reaction Methods 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 229960005256 sulbactam Drugs 0.000 description 2
- 230000006103 sulfonylation Effects 0.000 description 2
- 238000005694 sulfonylation reaction Methods 0.000 description 2
- 230000000475 sunscreen effect Effects 0.000 description 2
- 239000000516 sunscreening agent Substances 0.000 description 2
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 2
- LPQZKKCYTLCDGQ-WEDXCCLWSA-N tazobactam Chemical compound C([C@]1(C)S([C@H]2N(C(C2)=O)[C@H]1C(O)=O)(=O)=O)N1C=CN=N1 LPQZKKCYTLCDGQ-WEDXCCLWSA-N 0.000 description 2
- 229960003865 tazobactam Drugs 0.000 description 2
- DYHSDKLCOJIUFX-UHFFFAOYSA-N tert-butoxycarbonyl anhydride Chemical compound CC(C)(C)OC(=O)OC(=O)OC(C)(C)C DYHSDKLCOJIUFX-UHFFFAOYSA-N 0.000 description 2
- ILMRJRBKQSSXGY-UHFFFAOYSA-N tert-butyl(dimethyl)silicon Chemical compound C[Si](C)C(C)(C)C ILMRJRBKQSSXGY-UHFFFAOYSA-N 0.000 description 2
- 125000001981 tert-butyldimethylsilyl group Chemical group [H]C([H])([H])[Si]([H])(C([H])([H])[H])[*]C(C([H])([H])[H])(C([H])([H])[H])C([H])([H])[H] 0.000 description 2
- 125000005309 thioalkoxy group Chemical group 0.000 description 2
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- WJKHJLXJJJATHN-UHFFFAOYSA-N triflic anhydride Chemical compound FC(F)(F)S(=O)(=O)OS(=O)(=O)C(F)(F)F WJKHJLXJJJATHN-UHFFFAOYSA-N 0.000 description 2
- DTQVDTLACAAQTR-UHFFFAOYSA-N trifluoroacetic acid Substances OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 2
- 125000004417 unsaturated alkyl group Chemical group 0.000 description 2
- 230000002792 vascular Effects 0.000 description 2
- 229940118696 vibrio cholerae Drugs 0.000 description 2
- 239000001993 wax Substances 0.000 description 2
- 235000010493 xanthan gum Nutrition 0.000 description 2
- 239000000230 xanthan gum Substances 0.000 description 2
- 229920001285 xanthan gum Polymers 0.000 description 2
- 229940082509 xanthan gum Drugs 0.000 description 2
- AOSZTAHDEDLTLQ-AZKQZHLXSA-N (1S,2S,4R,8S,9S,11S,12R,13S,19S)-6-[(3-chlorophenyl)methyl]-12,19-difluoro-11-hydroxy-8-(2-hydroxyacetyl)-9,13-dimethyl-6-azapentacyclo[10.8.0.02,9.04,8.013,18]icosa-14,17-dien-16-one Chemical compound C([C@@H]1C[C@H]2[C@H]3[C@]([C@]4(C=CC(=O)C=C4[C@@H](F)C3)C)(F)[C@@H](O)C[C@@]2([C@@]1(C1)C(=O)CO)C)N1CC1=CC=CC(Cl)=C1 AOSZTAHDEDLTLQ-AZKQZHLXSA-N 0.000 description 1
- JLNROMXHWGJKNH-UHFFFAOYSA-N (2,6-dimethyl-4-phenylheptan-4-yl)-dimethyl-(2-phenoxyethoxy)azanium Chemical class C=1C=CC=CC=1OCCO[N+](C)(C)C(CC(C)C)(CC(C)C)C1=CC=CC=C1 JLNROMXHWGJKNH-UHFFFAOYSA-N 0.000 description 1
- SJHPCNCNNSSLPL-CSKARUKUSA-N (4e)-4-(ethoxymethylidene)-2-phenyl-1,3-oxazol-5-one Chemical compound O1C(=O)C(=C/OCC)\N=C1C1=CC=CC=C1 SJHPCNCNNSSLPL-CSKARUKUSA-N 0.000 description 1
- WDLWHQDACQUCJR-ZAMMOSSLSA-N (6r,7r)-7-[[(2r)-2-azaniumyl-2-(4-hydroxyphenyl)acetyl]amino]-8-oxo-3-[(e)-prop-1-enyl]-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylate Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)/C=C/C)C(O)=O)=CC=C(O)C=C1 WDLWHQDACQUCJR-ZAMMOSSLSA-N 0.000 description 1
- YWKJNRNSJKEFMK-PQFQYKRASA-N (6r,7r)-7-[[(2z)-2-(2-amino-1,3-thiazol-4-yl)-2-methoxyiminoacetyl]amino]-8-oxo-3-(5,6,7,8-tetrahydroquinolin-1-ium-1-ylmethyl)-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylate Chemical compound N([C@@H]1C(N2C(=C(C[N+]=3C=4CCCCC=4C=CC=3)CS[C@@H]21)C([O-])=O)=O)C(=O)\C(=N/OC)C1=CSC(N)=N1 YWKJNRNSJKEFMK-PQFQYKRASA-N 0.000 description 1
- HMLGSIZOMSVISS-ONJSNURVSA-N (7r)-7-[[(2z)-2-(2-amino-1,3-thiazol-4-yl)-2-(2,2-dimethylpropanoyloxymethoxyimino)acetyl]amino]-3-ethenyl-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid Chemical compound N([C@@H]1C(N2C(=C(C=C)CSC21)C(O)=O)=O)C(=O)\C(=N/OCOC(=O)C(C)(C)C)C1=CSC(N)=N1 HMLGSIZOMSVISS-ONJSNURVSA-N 0.000 description 1
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 1
- FFJCNSLCJOQHKM-CLFAGFIQSA-N (z)-1-[(z)-octadec-9-enoxy]octadec-9-ene Chemical compound CCCCCCCC\C=C/CCCCCCCCOCCCCCCCC\C=C/CCCCCCCC FFJCNSLCJOQHKM-CLFAGFIQSA-N 0.000 description 1
- KZPYGQFFRCFCPP-UHFFFAOYSA-N 1,1'-bis(diphenylphosphino)ferrocene Chemical compound [Fe+2].C1=CC=C[C-]1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=C[C-]1P(C=1C=CC=CC=1)C1=CC=CC=C1 KZPYGQFFRCFCPP-UHFFFAOYSA-N 0.000 description 1
- QVEMCOSZMZXRKN-UHFFFAOYSA-N 1,2-benzoxaborol-3-ylmethanamine Chemical class C1=CC=C2C(CN)=BOC2=C1 QVEMCOSZMZXRKN-UHFFFAOYSA-N 0.000 description 1
- GDMJXXLVTYSBBE-UHFFFAOYSA-N 1,2-benzoxaborole Chemical class C1=CC=C2OB=CC2=C1 GDMJXXLVTYSBBE-UHFFFAOYSA-N 0.000 description 1
- PIMNFNXBTGPCIL-UHFFFAOYSA-N 1-(2-bromophenyl)ethanone Chemical class CC(=O)C1=CC=CC=C1Br PIMNFNXBTGPCIL-UHFFFAOYSA-N 0.000 description 1
- PZNPLUBHRSSFHT-RRHRGVEJSA-N 1-hexadecanoyl-2-octadecanoyl-sn-glycero-3-phosphocholine Chemical class CCCCCCCCCCCCCCCCCC(=O)O[C@@H](COP([O-])(=O)OCC[N+](C)(C)C)COC(=O)CCCCCCCCCCCCCCC PZNPLUBHRSSFHT-RRHRGVEJSA-N 0.000 description 1
- CYNVNMSPFHWUKW-UHFFFAOYSA-N 1-hydroxy-3-(nitromethyl)-3h-2,1-benzoxaborole Chemical compound C1=CC=C2B(O)OC(C[N+]([O-])=O)C2=C1 CYNVNMSPFHWUKW-UHFFFAOYSA-N 0.000 description 1
- VMKAFJQFKBASMU-UHFFFAOYSA-N 1-methyl-3,3-diphenyl-3a,4,5,6-tetrahydropyrrolo[1,2-c][1,3,2]oxazaborole Chemical class C12CCCN2B(C)OC1(C=1C=CC=CC=1)C1=CC=CC=C1 VMKAFJQFKBASMU-UHFFFAOYSA-N 0.000 description 1
- 125000001637 1-naphthyl group Chemical group [H]C1=C([H])C([H])=C2C(*)=C([H])C([H])=C([H])C2=C1[H] 0.000 description 1
- 125000004214 1-pyrrolidinyl group Chemical group [H]C1([H])N(*)C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 125000001462 1-pyrrolyl group Chemical group [*]N1C([H])=C([H])C([H])=C1[H] 0.000 description 1
- UTQNKKSJPHTPBS-UHFFFAOYSA-N 2,2,2-trichloroethanone Chemical group ClC(Cl)(Cl)[C]=O UTQNKKSJPHTPBS-UHFFFAOYSA-N 0.000 description 1
- 125000004206 2,2,2-trifluoroethyl group Chemical group [H]C([H])(*)C(F)(F)F 0.000 description 1
- WGIMXKDCVCTHGW-UHFFFAOYSA-N 2-(2-hydroxyethoxy)ethyl dodecanoate Chemical compound CCCCCCCCCCCC(=O)OCCOCCO WGIMXKDCVCTHGW-UHFFFAOYSA-N 0.000 description 1
- FKOKUHFZNIUSLW-UHFFFAOYSA-N 2-Hydroxypropyl stearate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(C)O FKOKUHFZNIUSLW-UHFFFAOYSA-N 0.000 description 1
- MOKBFXZQXUZAMV-UHFFFAOYSA-N 2-[2-[2-[2-[2-[2-[2-(2-hydroxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethyl octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCCOCCOCCOCCOCCOCCOCCOCCO MOKBFXZQXUZAMV-UHFFFAOYSA-N 0.000 description 1
- OKTWQKXBJUBAKS-WQADZSDSSA-N 2-[[(e,2r,3s)-2-amino-3-hydroxyoctadec-4-enoxy]-hydroxyphosphoryl]oxyethyl-trimethylazanium;chloride Chemical compound [Cl-].CCCCCCCCCCCCC\C=C\[C@H](O)[C@H](N)COP(O)(=O)OCC[N+](C)(C)C OKTWQKXBJUBAKS-WQADZSDSSA-N 0.000 description 1
- NBGAYCYFNGPNPV-UHFFFAOYSA-N 2-aminooxybenzoic acid Chemical class NOC1=CC=CC=C1C(O)=O NBGAYCYFNGPNPV-UHFFFAOYSA-N 0.000 description 1
- AOQXXCGDRSKABO-UHFFFAOYSA-N 2-azido-1-(2-bromophenyl)ethanol Chemical class [N-]=[N+]=NCC(O)C1=CC=CC=C1Br AOQXXCGDRSKABO-UHFFFAOYSA-N 0.000 description 1
- 125000004174 2-benzimidazolyl group Chemical group [H]N1C(*)=NC2=C([H])C([H])=C([H])C([H])=C12 0.000 description 1
- LSOZDQDHEMEVRG-UHFFFAOYSA-N 2-bromo-1-(2-bromophenyl)ethanol Chemical compound BrCC(O)C1=CC=CC=C1Br LSOZDQDHEMEVRG-UHFFFAOYSA-N 0.000 description 1
- OHXPHMPERMIICA-UHFFFAOYSA-N 2-bromo-3-hydroxybenzaldehyde Chemical compound OC1=CC=CC(C=O)=C1Br OHXPHMPERMIICA-UHFFFAOYSA-N 0.000 description 1
- GLCFQKXOQDQJFZ-UHFFFAOYSA-N 2-ethylhexyl 12-hydroxyoctadecanoate Chemical compound CCCCCCC(O)CCCCCCCCCCC(=O)OCC(CC)CCCC GLCFQKXOQDQJFZ-UHFFFAOYSA-N 0.000 description 1
- 125000002941 2-furyl group Chemical group O1C([*])=C([H])C([H])=C1[H] 0.000 description 1
- HZLCGUXUOFWCCN-UHFFFAOYSA-N 2-hydroxynonadecane-1,2,3-tricarboxylic acid Chemical compound CCCCCCCCCCCCCCCCC(C(O)=O)C(O)(C(O)=O)CC(O)=O HZLCGUXUOFWCCN-UHFFFAOYSA-N 0.000 description 1
- 125000004200 2-methoxyethyl group Chemical group [H]C([H])([H])OC([H])([H])C([H])([H])* 0.000 description 1
- 125000001622 2-naphthyl group Chemical group [H]C1=C([H])C([H])=C2C([H])=C(*)C([H])=C([H])C2=C1[H] 0.000 description 1
- ICIDSZQHPUZUHC-UHFFFAOYSA-N 2-octadecoxyethanol Chemical compound CCCCCCCCCCCCCCCCCCOCCO ICIDSZQHPUZUHC-UHFFFAOYSA-N 0.000 description 1
- LEACJMVNYZDSKR-UHFFFAOYSA-N 2-octyldodecan-1-ol Chemical group CCCCCCCCCCC(CO)CCCCCCCC LEACJMVNYZDSKR-UHFFFAOYSA-N 0.000 description 1
- 125000000094 2-phenylethyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000003903 2-propenyl group Chemical group [H]C([*])([H])C([H])=C([H])[H] 0.000 description 1
- 125000000389 2-pyrrolyl group Chemical group [H]N1C([*])=C([H])C([H])=C1[H] 0.000 description 1
- 125000000175 2-thienyl group Chemical group S1C([*])=C([H])C([H])=C1[H] 0.000 description 1
- MSYGAHOHLUJIKV-UHFFFAOYSA-N 3,5-dimethyl-1-(3-nitrophenyl)-1h-pyrazole-4-carboxylic acid ethyl ester Chemical compound CC1=C(C(=O)OCC)C(C)=NN1C1=CC=CC([N+]([O-])=O)=C1 MSYGAHOHLUJIKV-UHFFFAOYSA-N 0.000 description 1
- DQSRVWNGCNSDNE-UHFFFAOYSA-N 3-(pyridin-3-ylamino)propyl 4-[[3-(5-fluoro-2-hydroxyphenyl)phenyl]sulfonylamino]-2-hydroxybenzoate Chemical compound OC1=CC=C(F)C=C1C1=CC=CC(S(=O)(=O)NC=2C=C(O)C(C(=O)OCCCNC=3C=NC=CC=3)=CC=2)=C1 DQSRVWNGCNSDNE-UHFFFAOYSA-N 0.000 description 1
- 125000000474 3-butynyl group Chemical group [H]C#CC([H])([H])C([H])([H])* 0.000 description 1
- 125000003682 3-furyl group Chemical group O1C([H])=C([*])C([H])=C1[H] 0.000 description 1
- 125000001397 3-pyrrolyl group Chemical group [H]N1C([H])=C([*])C([H])=C1[H] 0.000 description 1
- 125000001541 3-thienyl group Chemical group S1C([H])=C([*])C([H])=C1[H] 0.000 description 1
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 1
- ZLOIGESWDJYCTF-UHFFFAOYSA-N 4-Thiouridine Chemical group OC1C(O)C(CO)OC1N1C(=O)NC(=S)C=C1 ZLOIGESWDJYCTF-UHFFFAOYSA-N 0.000 description 1
- UTUUPXBCDMQYRR-HSZRJFAPSA-N 4-[(2r)-2-(3-cyclopentyloxy-4-methoxyphenyl)-2-phenylethyl]pyridine Chemical compound COC1=CC=C([C@H](CC=2C=CN=CC=2)C=2C=CC=CC=2)C=C1OC1CCCC1 UTUUPXBCDMQYRR-HSZRJFAPSA-N 0.000 description 1
- QCQCHGYLTSGIGX-GHXANHINSA-N 4-[[(3ar,5ar,5br,7ar,9s,11ar,11br,13as)-5a,5b,8,8,11a-pentamethyl-3a-[(5-methylpyridine-3-carbonyl)amino]-2-oxo-1-propan-2-yl-4,5,6,7,7a,9,10,11,11b,12,13,13a-dodecahydro-3h-cyclopenta[a]chrysen-9-yl]oxy]-2,2-dimethyl-4-oxobutanoic acid Chemical compound N([C@@]12CC[C@@]3(C)[C@]4(C)CC[C@H]5C(C)(C)[C@@H](OC(=O)CC(C)(C)C(O)=O)CC[C@]5(C)[C@H]4CC[C@@H]3C1=C(C(C2)=O)C(C)C)C(=O)C1=CN=CC(C)=C1 QCQCHGYLTSGIGX-GHXANHINSA-N 0.000 description 1
- KDDQRKBRJSGMQE-UHFFFAOYSA-N 4-thiazolyl Chemical group [C]1=CSC=N1 KDDQRKBRJSGMQE-UHFFFAOYSA-N 0.000 description 1
- CWDWFSXUQODZGW-UHFFFAOYSA-N 5-thiazolyl Chemical group [C]1=CN=CS1 CWDWFSXUQODZGW-UHFFFAOYSA-N 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical class O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical group [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 1
- 206010065040 AIDS dementia complex Diseases 0.000 description 1
- 241000023308 Acca Species 0.000 description 1
- 208000007788 Acute Liver Failure Diseases 0.000 description 1
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 1
- 208000037539 Acute peripheral arterial occlusion Diseases 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 241000588986 Alcaligenes Species 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 241000191412 Alternaria infectoria Species 0.000 description 1
- 239000005995 Aluminium silicate Substances 0.000 description 1
- 206010001939 Aminoaciduria Diseases 0.000 description 1
- 244000144725 Amygdalus communis Species 0.000 description 1
- 235000011437 Amygdalus communis Nutrition 0.000 description 1
- 206010002556 Ankylosing Spondylitis Diseases 0.000 description 1
- 208000000103 Anorexia Nervosa Diseases 0.000 description 1
- 108020005098 Anticodon Proteins 0.000 description 1
- 208000019901 Anxiety disease Diseases 0.000 description 1
- 208000003017 Aortic Valve Stenosis Diseases 0.000 description 1
- 206010051113 Arterial restenosis Diseases 0.000 description 1
- 201000002909 Aspergillosis Diseases 0.000 description 1
- 208000036641 Aspergillus infections Diseases 0.000 description 1
- 206010003757 Atypical pneumonia Diseases 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 206010003827 Autoimmune hepatitis Diseases 0.000 description 1
- 206010003880 Axillary vein thrombosis Diseases 0.000 description 1
- 208000008035 Back Pain Diseases 0.000 description 1
- CWXYHOHYCJXYFQ-UHFFFAOYSA-N Betamipron Chemical compound OC(=O)CCNC(=O)C1=CC=CC=C1 CWXYHOHYCJXYFQ-UHFFFAOYSA-N 0.000 description 1
- 208000008439 Biliary Liver Cirrhosis Diseases 0.000 description 1
- 208000033222 Biliary cirrhosis primary Diseases 0.000 description 1
- 206010005098 Blastomycosis Diseases 0.000 description 1
- 208000020084 Bone disease Diseases 0.000 description 1
- 208000003508 Botulism Diseases 0.000 description 1
- 208000014644 Brain disease Diseases 0.000 description 1
- 240000002791 Brassica napus Species 0.000 description 1
- 235000004977 Brassica sinapistrum Nutrition 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- WKBOTKDWSSQWDR-UHFFFAOYSA-N Bromine atom Chemical compound [Br] WKBOTKDWSSQWDR-UHFFFAOYSA-N 0.000 description 1
- 206010006458 Bronchitis chronic Diseases 0.000 description 1
- 206010006500 Brucellosis Diseases 0.000 description 1
- 241000195940 Bryophyta Species 0.000 description 1
- 206010006550 Bulimia nervosa Diseases 0.000 description 1
- 206010006811 Bursitis Diseases 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- 206010058019 Cancer Pain Diseases 0.000 description 1
- 241000222122 Candida albicans Species 0.000 description 1
- 206010007134 Candida infections Diseases 0.000 description 1
- 239000004215 Carbon black (E152) Substances 0.000 description 1
- OKTJSMMVPCPJKN-NJFSPNSNSA-N Carbon-14 Chemical compound [14C] OKTJSMMVPCPJKN-NJFSPNSNSA-N 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 208000020446 Cardiac disease Diseases 0.000 description 1
- 206010007558 Cardiac failure chronic Diseases 0.000 description 1
- 206010007559 Cardiac failure congestive Diseases 0.000 description 1
- 208000005024 Castleman disease Diseases 0.000 description 1
- UQLLWWBDSUHNEB-CZUORRHYSA-N Cefaprin Chemical compound N([C@H]1[C@@H]2N(C1=O)C(=C(CS2)COC(=O)C)C(O)=O)C(=O)CSC1=CC=NC=C1 UQLLWWBDSUHNEB-CZUORRHYSA-N 0.000 description 1
- 206010063094 Cerebral malaria Diseases 0.000 description 1
- LRBQNJMCXXYXIU-PPKXGCFTSA-N Chinese gallotannin Chemical compound OC1=C(O)C(O)=CC(C(=O)OC=2C(=C(O)C=C(C=2)C(=O)OC[C@@H]2[C@H]([C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)O2)OC(=O)C=2C=C(OC(=O)C=3C=C(O)C(O)=C(O)C=3)C(O)=C(O)C=2)O)=C1 LRBQNJMCXXYXIU-PPKXGCFTSA-N 0.000 description 1
- KZBUYRJDOAKODT-UHFFFAOYSA-N Chlorine Chemical compound ClCl KZBUYRJDOAKODT-UHFFFAOYSA-N 0.000 description 1
- 206010008609 Cholangitis sclerosing Diseases 0.000 description 1
- 206010008631 Cholera Diseases 0.000 description 1
- 208000000094 Chronic Pain Diseases 0.000 description 1
- 208000032544 Cicatrix Diseases 0.000 description 1
- 208000006561 Cluster Headache Diseases 0.000 description 1
- 241000223205 Coccidioides immitis Species 0.000 description 1
- 235000013162 Cocos nucifera Nutrition 0.000 description 1
- 244000060011 Cocos nucifera Species 0.000 description 1
- 208000015943 Coeliac disease Diseases 0.000 description 1
- 206010009895 Colitis ischaemic Diseases 0.000 description 1
- 206010056979 Colitis microscopic Diseases 0.000 description 1
- 206010009944 Colon cancer Diseases 0.000 description 1
- 208000023890 Complex Regional Pain Syndromes Diseases 0.000 description 1
- 208000013586 Complex regional pain syndrome type 1 Diseases 0.000 description 1
- 229940126657 Compound 17 Drugs 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 206010061788 Corneal infection Diseases 0.000 description 1
- 208000001778 Coronary Occlusion Diseases 0.000 description 1
- 206010011086 Coronary artery occlusion Diseases 0.000 description 1
- 240000009226 Corylus americana Species 0.000 description 1
- 235000001543 Corylus americana Nutrition 0.000 description 1
- 235000007466 Corylus avellana Nutrition 0.000 description 1
- 208000010859 Creutzfeldt-Jakob disease Diseases 0.000 description 1
- 201000007336 Cryptococcosis Diseases 0.000 description 1
- 241000221204 Cryptococcus neoformans Species 0.000 description 1
- 240000008067 Cucumis sativus Species 0.000 description 1
- 235000010799 Cucumis sativus var sativus Nutrition 0.000 description 1
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 206010012289 Dementia Diseases 0.000 description 1
- 208000016192 Demyelinating disease Diseases 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 208000007342 Diabetic Nephropathies Diseases 0.000 description 1
- 208000006926 Discoid Lupus Erythematosus Diseases 0.000 description 1
- JWCSIUVGFCSJCK-CAVRMKNVSA-N Disodium Moxalactam Chemical compound N([C@]1(OC)C(N2C(=C(CSC=3N(N=NN=3)C)CO[C@@H]21)C(O)=O)=O)C(=O)C(C(O)=O)C1=CC=C(O)C=C1 JWCSIUVGFCSJCK-CAVRMKNVSA-N 0.000 description 1
- SNRUBQQJIBEYMU-UHFFFAOYSA-N Dodecane Natural products CCCCCCCCCCCC SNRUBQQJIBEYMU-UHFFFAOYSA-N 0.000 description 1
- 101100407340 Drosophila melanogaster Pde8 gene Proteins 0.000 description 1
- 101100407341 Drosophila melanogaster Pde9 gene Proteins 0.000 description 1
- 206010059866 Drug resistance Diseases 0.000 description 1
- 206010052804 Drug tolerance Diseases 0.000 description 1
- 208000003556 Dry Eye Syndromes Diseases 0.000 description 1
- 229920005682 EO-PO block copolymer Polymers 0.000 description 1
- 206010014561 Emphysema Diseases 0.000 description 1
- 208000032274 Encephalopathy Diseases 0.000 description 1
- 201000009273 Endometriosis Diseases 0.000 description 1
- 208000037487 Endotoxemia Diseases 0.000 description 1
- 206010014824 Endotoxic shock Diseases 0.000 description 1
- 206010058838 Enterocolitis infectious Diseases 0.000 description 1
- 206010015278 Erythrodermic psoriasis Diseases 0.000 description 1
- 108010008165 Etanercept Proteins 0.000 description 1
- 229920000896 Ethulose Polymers 0.000 description 1
- ZZSNKZQZMQGXPY-UHFFFAOYSA-N Ethyl cellulose Chemical compound CCOCC1OC(OC)C(OCC)C(OCC)C1OC1C(O)C(O)C(OC)C(CO)O1 ZZSNKZQZMQGXPY-UHFFFAOYSA-N 0.000 description 1
- 239000001856 Ethyl cellulose Substances 0.000 description 1
- 239000001859 Ethyl hydroxyethyl cellulose Substances 0.000 description 1
- FPVVYTCTZKCSOJ-UHFFFAOYSA-N Ethylene glycol distearate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCCOC(=O)CCCCCCCCCCCCCCCCC FPVVYTCTZKCSOJ-UHFFFAOYSA-N 0.000 description 1
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 1
- 208000002633 Febrile Neutropenia Diseases 0.000 description 1
- 239000004606 Fillers/Extenders Substances 0.000 description 1
- PXGOKWXKJXAPGV-UHFFFAOYSA-N Fluorine Chemical compound FF PXGOKWXKJXAPGV-UHFFFAOYSA-N 0.000 description 1
- 206010016936 Folliculitis Diseases 0.000 description 1
- 206010016952 Food poisoning Diseases 0.000 description 1
- 208000019331 Foodborne disease Diseases 0.000 description 1
- 206010017076 Fracture Diseases 0.000 description 1
- 241000589601 Francisella Species 0.000 description 1
- 201000011240 Frontotemporal dementia Diseases 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 230000005526 G1 to G0 transition Effects 0.000 description 1
- 241000207202 Gardnerella Species 0.000 description 1
- 201000000628 Gas Gangrene Diseases 0.000 description 1
- 208000007882 Gastritis Diseases 0.000 description 1
- 208000007465 Giant cell arteritis Diseases 0.000 description 1
- 208000010412 Glaucoma Diseases 0.000 description 1
- 206010018366 Glomerulonephritis acute Diseases 0.000 description 1
- 206010018367 Glomerulonephritis chronic Diseases 0.000 description 1
- 102100033495 Glycine dehydrogenase (decarboxylating), mitochondrial Human genes 0.000 description 1
- 206010018612 Gonorrhoea Diseases 0.000 description 1
- 206010018634 Gouty Arthritis Diseases 0.000 description 1
- 208000009329 Graft vs Host Disease Diseases 0.000 description 1
- 206010018691 Granuloma Diseases 0.000 description 1
- 208000035895 Guillain-Barré syndrome Diseases 0.000 description 1
- 229920003114 HPC-L Polymers 0.000 description 1
- 229920003115 HPC-SL Polymers 0.000 description 1
- 206010019196 Head injury Diseases 0.000 description 1
- 244000020551 Helianthus annuus Species 0.000 description 1
- 235000003222 Helianthus annuus Nutrition 0.000 description 1
- 206010019617 Henoch-Schonlein purpura Diseases 0.000 description 1
- 208000005176 Hepatitis C Diseases 0.000 description 1
- 208000032087 Hereditary Leber Optic Atrophy Diseases 0.000 description 1
- 201000002563 Histoplasmosis Diseases 0.000 description 1
- 101001098805 Homo sapiens cAMP-specific 3',5'-cyclic phosphodiesterase 4A Proteins 0.000 description 1
- 101000988423 Homo sapiens cAMP-specific 3',5'-cyclic phosphodiesterase 4C Proteins 0.000 description 1
- 101000988419 Homo sapiens cAMP-specific 3',5'-cyclic phosphodiesterase 4D Proteins 0.000 description 1
- 240000005979 Hordeum vulgare Species 0.000 description 1
- 235000007340 Hordeum vulgare Nutrition 0.000 description 1
- OAKJQQAXSVQMHS-UHFFFAOYSA-N Hydrazine Chemical compound NN OAKJQQAXSVQMHS-UHFFFAOYSA-N 0.000 description 1
- 239000004354 Hydroxyethyl cellulose Substances 0.000 description 1
- 229920000663 Hydroxyethyl cellulose Polymers 0.000 description 1
- 229920001479 Hydroxyethyl methyl cellulose Polymers 0.000 description 1
- 229920001612 Hydroxyethyl starch Polymers 0.000 description 1
- AVXURJPOCDRRFD-UHFFFAOYSA-N Hydroxylamine Chemical group ON AVXURJPOCDRRFD-UHFFFAOYSA-N 0.000 description 1
- 208000035150 Hypercholesterolemia Diseases 0.000 description 1
- 208000033892 Hyperhomocysteinemia Diseases 0.000 description 1
- 206010020649 Hyperkeratosis Diseases 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- 208000001953 Hypotension Diseases 0.000 description 1
- 206010021143 Hypoxia Diseases 0.000 description 1
- 208000031814 IgA Vasculitis Diseases 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 102100037850 Interferon gamma Human genes 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 102000051628 Interleukin-1 receptor antagonist Human genes 0.000 description 1
- 108700021006 Interleukin-1 receptor antagonist Proteins 0.000 description 1
- 208000036209 Intraabdominal Infections Diseases 0.000 description 1
- 208000021342 Isolated sulfite oxidase deficiency Diseases 0.000 description 1
- 208000001126 Keratosis Diseases 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 239000004166 Lanolin Substances 0.000 description 1
- 201000003533 Leber congenital amaurosis Diseases 0.000 description 1
- 241000589248 Legionella Species 0.000 description 1
- 208000007764 Legionnaires' Disease Diseases 0.000 description 1
- 208000004554 Leishmaniasis Diseases 0.000 description 1
- 241000408747 Lepomis gibbosus Species 0.000 description 1
- 240000007472 Leucaena leucocephala Species 0.000 description 1
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 1
- 241000186781 Listeria Species 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 208000009564 MELAS Syndrome Diseases 0.000 description 1
- 201000009035 MERRF syndrome Diseases 0.000 description 1
- 241000208467 Macadamia Species 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 240000004658 Medicago sativa Species 0.000 description 1
- 235000017587 Medicago sativa ssp. sativa Nutrition 0.000 description 1
- 206010027202 Meningitis bacterial Diseases 0.000 description 1
- 206010027260 Meningitis viral Diseases 0.000 description 1
- 208000001145 Metabolic Syndrome Diseases 0.000 description 1
- 229920003102 Methocel™ E4M Polymers 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 208000019695 Migraine disease Diseases 0.000 description 1
- 206010049567 Miller Fisher syndrome Diseases 0.000 description 1
- 239000004909 Moisturizer Substances 0.000 description 1
- 208000005314 Multi-Infarct Dementia Diseases 0.000 description 1
- 208000034578 Multiple myelomas Diseases 0.000 description 1
- 208000001089 Multiple system atrophy Diseases 0.000 description 1
- 101100407337 Mus musculus Pde8a gene Proteins 0.000 description 1
- 206010028289 Muscle atrophy Diseases 0.000 description 1
- 206010028391 Musculoskeletal Pain Diseases 0.000 description 1
- 241000545499 Mycobacterium avium-intracellulare Species 0.000 description 1
- 241000202934 Mycoplasma pneumoniae Species 0.000 description 1
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 1
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 1
- 208000009525 Myocarditis Diseases 0.000 description 1
- 206010069825 Myoclonic epilepsy and ragged-red fibres Diseases 0.000 description 1
- SGSSKEDGVONRGC-UHFFFAOYSA-N N(2)-methylguanine Chemical group O=C1NC(NC)=NC2=C1N=CN2 SGSSKEDGVONRGC-UHFFFAOYSA-N 0.000 description 1
- 206010051606 Necrotising colitis Diseases 0.000 description 1
- 206010028885 Necrotising fasciitis Diseases 0.000 description 1
- 201000009053 Neurodermatitis Diseases 0.000 description 1
- 229910021586 Nickel(II) chloride Inorganic materials 0.000 description 1
- GRYLNZFGIOXLOG-UHFFFAOYSA-N Nitric acid Chemical compound O[N+]([O-])=O GRYLNZFGIOXLOG-UHFFFAOYSA-N 0.000 description 1
- JCXJVPUVTGWSNB-UHFFFAOYSA-N Nitrogen dioxide Chemical compound O=[N]=O JCXJVPUVTGWSNB-UHFFFAOYSA-N 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- 208000035544 Nonketotic hyperglycinaemia Diseases 0.000 description 1
- 206010029803 Nosocomial infection Diseases 0.000 description 1
- 208000008589 Obesity Diseases 0.000 description 1
- 241000219925 Oenothera Species 0.000 description 1
- 235000004496 Oenothera biennis Nutrition 0.000 description 1
- 208000003435 Optic Neuritis Diseases 0.000 description 1
- 208000005141 Otitis Diseases 0.000 description 1
- 206010033078 Otitis media Diseases 0.000 description 1
- 206010033266 Ovarian Hyperstimulation Syndrome Diseases 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 206010033645 Pancreatitis Diseases 0.000 description 1
- TYMABNNERDVXID-DLYFRVTGSA-N Panipenem Chemical compound C([C@@H]1[C@H](C(N1C=1C(O)=O)=O)[C@H](O)C)C=1S[C@H]1CCN(C(C)=N)C1 TYMABNNERDVXID-DLYFRVTGSA-N 0.000 description 1
- 235000008753 Papaver somniferum Nutrition 0.000 description 1
- 240000001090 Papaver somniferum Species 0.000 description 1
- 206010033767 Paracoccidioides infections Diseases 0.000 description 1
- 201000000301 Paracoccidioidomycosis Diseases 0.000 description 1
- 229910002666 PdCl2 Inorganic materials 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 206010058674 Pelvic Infection Diseases 0.000 description 1
- 235000008673 Persea americana Nutrition 0.000 description 1
- 244000025272 Persea americana Species 0.000 description 1
- 201000005702 Pertussis Diseases 0.000 description 1
- 208000031956 Phaehyphomycosis Diseases 0.000 description 1
- 201000011404 Phaeohyphomycosis Diseases 0.000 description 1
- 208000004983 Phantom Limb Diseases 0.000 description 1
- 206010056238 Phantom pain Diseases 0.000 description 1
- 201000007100 Pharyngitis Diseases 0.000 description 1
- 208000000609 Pick Disease of the Brain Diseases 0.000 description 1
- 206010035148 Plague Diseases 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 229920002873 Polyethylenimine Polymers 0.000 description 1
- 206010054161 Pontiac fever Diseases 0.000 description 1
- 208000012654 Primary biliary cholangitis Diseases 0.000 description 1
- 208000002158 Proliferative Vitreoretinopathy Diseases 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-N Propionic acid Substances CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 1
- HDSBZMRLPLPFLQ-UHFFFAOYSA-N Propylene glycol alginate Chemical compound OC1C(O)C(OC)OC(C(O)=O)C1OC1C(O)C(O)C(C)C(C(=O)OCC(C)O)O1 HDSBZMRLPLPFLQ-UHFFFAOYSA-N 0.000 description 1
- GOOHAUXETOMSMM-UHFFFAOYSA-N Propylene oxide Chemical compound CC1CO1 GOOHAUXETOMSMM-UHFFFAOYSA-N 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 102100032859 Protein AMBP Human genes 0.000 description 1
- 235000009827 Prunus armeniaca Nutrition 0.000 description 1
- 244000018633 Prunus armeniaca Species 0.000 description 1
- 208000003251 Pruritus Diseases 0.000 description 1
- KDCGOANMDULRCW-UHFFFAOYSA-N Purine Natural products N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 1
- 206010037575 Pustular psoriasis Diseases 0.000 description 1
- 206010037596 Pyelonephritis Diseases 0.000 description 1
- 102000014450 RNA Polymerase III Human genes 0.000 description 1
- 108010078067 RNA Polymerase III Proteins 0.000 description 1
- 201000001947 Reflex Sympathetic Dystrophy Diseases 0.000 description 1
- 208000033464 Reiter syndrome Diseases 0.000 description 1
- 208000001647 Renal Insufficiency Diseases 0.000 description 1
- 206010068956 Respiratory tract inflammation Diseases 0.000 description 1
- 206010038934 Retinopathy proliferative Diseases 0.000 description 1
- 208000006289 Rett Syndrome Diseases 0.000 description 1
- 208000004364 Rhinosporidiosis Diseases 0.000 description 1
- 240000001890 Ribes hudsonianum Species 0.000 description 1
- 235000016954 Ribes hudsonianum Nutrition 0.000 description 1
- 235000001466 Ribes nigrum Nutrition 0.000 description 1
- 235000004443 Ricinus communis Nutrition 0.000 description 1
- 206010039207 Rocky Mountain Spotted Fever Diseases 0.000 description 1
- 108010077895 Sarcosine Proteins 0.000 description 1
- 208000008765 Sciatica Diseases 0.000 description 1
- 206010039793 Seborrhoeic dermatitis Diseases 0.000 description 1
- 235000003434 Sesamum indicum Nutrition 0.000 description 1
- 244000040738 Sesamum orientale Species 0.000 description 1
- 201000003176 Severe Acute Respiratory Syndrome Diseases 0.000 description 1
- XUIMIQQOPSSXEZ-UHFFFAOYSA-N Silicon Chemical compound [Si] XUIMIQQOPSSXEZ-UHFFFAOYSA-N 0.000 description 1
- 201000010001 Silicosis Diseases 0.000 description 1
- 208000021386 Sjogren Syndrome Diseases 0.000 description 1
- 206010040893 Skin necrosis Diseases 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 1
- 229920002125 Sokalan® Polymers 0.000 description 1
- IYFATESGLOUGBX-YVNJGZBMSA-N Sorbitan monopalmitate Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O IYFATESGLOUGBX-YVNJGZBMSA-N 0.000 description 1
- 244000062793 Sorghum vulgare Species 0.000 description 1
- 239000004163 Spermaceti wax Substances 0.000 description 1
- 206010072005 Spinal pain Diseases 0.000 description 1
- 241000589970 Spirochaetales Species 0.000 description 1
- 208000007156 Spondylarthritis Diseases 0.000 description 1
- 239000001833 Succinylated monoglyceride Substances 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 108700036932 Sulfite oxidase deficiency Proteins 0.000 description 1
- 206010042496 Sunburn Diseases 0.000 description 1
- QJJXYPPXXYFBGM-LFZNUXCKSA-N Tacrolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1\C=C(/C)[C@@H]1[C@H](C)[C@@H](O)CC(=O)[C@H](CC=C)/C=C(C)/C[C@H](C)C[C@H](OC)[C@H]([C@H](C[C@H]2C)OC)O[C@@]2(O)C(=O)C(=O)N2CCCC[C@H]2C(=O)O1 QJJXYPPXXYFBGM-LFZNUXCKSA-N 0.000 description 1
- 208000001106 Takayasu Arteritis Diseases 0.000 description 1
- 208000000491 Tendinopathy Diseases 0.000 description 1
- 206010043255 Tendonitis Diseases 0.000 description 1
- 208000004760 Tenosynovitis Diseases 0.000 description 1
- 206010043269 Tension headache Diseases 0.000 description 1
- 208000008548 Tension-Type Headache Diseases 0.000 description 1
- 206010043376 Tetanus Diseases 0.000 description 1
- 229920002359 Tetronic® Polymers 0.000 description 1
- WKDDRNSBRWANNC-ATRFCDNQSA-N Thienamycin Chemical compound C1C(SCCN)=C(C(O)=O)N2C(=O)[C@H]([C@H](O)C)[C@H]21 WKDDRNSBRWANNC-ATRFCDNQSA-N 0.000 description 1
- 206010043647 Thrombotic Stroke Diseases 0.000 description 1
- 206010044314 Tracheobronchitis Diseases 0.000 description 1
- 206010048873 Traumatic arthritis Diseases 0.000 description 1
- SHGAZHPCJJPHSC-NWVFGJFESA-N Tretinoin Chemical class OC(=O)/C=C(\C)/C=C/C=C(C)C=CC1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-NWVFGJFESA-N 0.000 description 1
- GSEJCLTVZPLZKY-UHFFFAOYSA-N Triethanolamine Chemical compound OCCN(CCO)CCO GSEJCLTVZPLZKY-UHFFFAOYSA-N 0.000 description 1
- 235000021307 Triticum Nutrition 0.000 description 1
- 244000098338 Triticum aestivum Species 0.000 description 1
- YZCKVEUIGOORGS-NJFSPNSNSA-N Tritium Chemical compound [3H] YZCKVEUIGOORGS-NJFSPNSNSA-N 0.000 description 1
- 208000034784 Tularaemia Diseases 0.000 description 1
- 108010037584 Type 4 Cyclic Nucleotide Phosphodiesterases Proteins 0.000 description 1
- 102000011017 Type 4 Cyclic Nucleotide Phosphodiesterases Human genes 0.000 description 1
- 208000025865 Ulcer Diseases 0.000 description 1
- 241000202921 Ureaplasma urealyticum Species 0.000 description 1
- 208000024780 Urticaria Diseases 0.000 description 1
- 208000006374 Uterine Cervicitis Diseases 0.000 description 1
- 208000000558 Varicose Ulcer Diseases 0.000 description 1
- 201000004810 Vascular dementia Diseases 0.000 description 1
- 206010047095 Vascular pain Diseases 0.000 description 1
- 208000012346 Venoocclusive disease Diseases 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 229930003316 Vitamin D Natural products 0.000 description 1
- QYSXJUFSXHHAJI-XFEUOLMDSA-N Vitamin D3 Natural products C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C/C=C1\C[C@@H](O)CCC1=C QYSXJUFSXHHAJI-XFEUOLMDSA-N 0.000 description 1
- 208000004143 Waterhouse-Friderichsen Syndrome Diseases 0.000 description 1
- 206010052428 Wound Diseases 0.000 description 1
- 206010048038 Wound infection Diseases 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- 240000008042 Zea mays Species 0.000 description 1
- 235000016383 Zea mays subsp huehuetenangensis Nutrition 0.000 description 1
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 1
- 206010061418 Zygomycosis Diseases 0.000 description 1
- IJCWFDPJFXGQBN-RYNSOKOISA-N [(2R)-2-[(2R,3R,4S)-4-hydroxy-3-octadecanoyloxyoxolan-2-yl]-2-octadecanoyloxyethyl] octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCCCCCCCCCCCC)[C@H]1OC[C@H](O)[C@H]1OC(=O)CCCCCCCCCCCCCCCCC IJCWFDPJFXGQBN-RYNSOKOISA-N 0.000 description 1
- CWRILEGKIAOYKP-SSDOTTSWSA-M [(2r)-3-acetyloxy-2-hydroxypropyl] 2-aminoethyl phosphate Chemical compound CC(=O)OC[C@@H](O)COP([O-])(=O)OCCN CWRILEGKIAOYKP-SSDOTTSWSA-M 0.000 description 1
- WERKSKAQRVDLDW-ANOHMWSOSA-N [(2s,3r,4r,5r)-2,3,4,5,6-pentahydroxyhexyl] (z)-octadec-9-enoate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO WERKSKAQRVDLDW-ANOHMWSOSA-N 0.000 description 1
- OCRUMFQGIMSFJR-FSAWCSQFSA-N [(2s,3s,4r,5r)-4-hydroxy-5-(hydroxymethyl)-3-[(z)-octadec-9-enoyl]oxy-2-[(2r,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxolan-2-yl]methyl (z)-octadec-9-enoate Chemical compound O([C@@H]1[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O1)O)[C@]1(COC(=O)CCCCCCC\C=C/CCCCCCCC)O[C@H](CO)[C@@H](O)[C@@H]1OC(=O)CCCCCCC\C=C/CCCCCCCC OCRUMFQGIMSFJR-FSAWCSQFSA-N 0.000 description 1
- ATBOMIWRCZXYSZ-XZBBILGWSA-N [1-[2,3-dihydroxypropoxy(hydroxy)phosphoryl]oxy-3-hexadecanoyloxypropan-2-yl] (9e,12e)-octadeca-9,12-dienoate Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(COP(O)(=O)OCC(O)CO)OC(=O)CCCCCCC\C=C\C\C=C\CCCCC ATBOMIWRCZXYSZ-XZBBILGWSA-N 0.000 description 1
- PNDPGZBMCMUPRI-XXSWNUTMSA-N [125I][125I] Chemical compound [125I][125I] PNDPGZBMCMUPRI-XXSWNUTMSA-N 0.000 description 1
- HVUMOYIDDBPOLL-XGKPLOKHSA-N [2-[(2r,3r,4s)-3,4-dihydroxyoxolan-2-yl]-2-hydroxyethyl] octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)[C@H]1OC[C@H](O)[C@H]1O HVUMOYIDDBPOLL-XGKPLOKHSA-N 0.000 description 1
- 201000000690 abdominal obesity-metabolic syndrome Diseases 0.000 description 1
- 239000002250 absorbent Substances 0.000 description 1
- 230000002745 absorbent Effects 0.000 description 1
- SPTSIOTYTJZTOG-UHFFFAOYSA-N acetic acid;octadecanoic acid Chemical compound CC(O)=O.CCCCCCCCCCCCCCCCCC(O)=O SPTSIOTYTJZTOG-UHFFFAOYSA-N 0.000 description 1
- 208000009621 actinic keratosis Diseases 0.000 description 1
- 201000007691 actinomycosis Diseases 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000011149 active material Substances 0.000 description 1
- 230000009798 acute exacerbation Effects 0.000 description 1
- 231100000851 acute glomerulonephritis Toxicity 0.000 description 1
- 208000005298 acute pain Diseases 0.000 description 1
- 229960002964 adalimumab Drugs 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 235000010419 agar Nutrition 0.000 description 1
- 229940040563 agaric acid Drugs 0.000 description 1
- 230000007000 age related cognitive decline Effects 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 238000013019 agitation Methods 0.000 description 1
- 125000003158 alcohol group Chemical group 0.000 description 1
- 230000001476 alcoholic effect Effects 0.000 description 1
- 229960002459 alefacept Drugs 0.000 description 1
- 150000001335 aliphatic alkanes Chemical class 0.000 description 1
- 229910052783 alkali metal Inorganic materials 0.000 description 1
- 125000003342 alkenyl group Chemical group 0.000 description 1
- 125000004453 alkoxycarbonyl group Chemical group 0.000 description 1
- 125000003282 alkyl amino group Chemical group 0.000 description 1
- 150000001350 alkyl halides Chemical class 0.000 description 1
- 150000008051 alkyl sulfates Chemical class 0.000 description 1
- 125000004414 alkyl thio group Chemical group 0.000 description 1
- 125000005233 alkylalcohol group Chemical group 0.000 description 1
- 125000005237 alkyleneamino group Chemical group 0.000 description 1
- 125000005238 alkylenediamino group Chemical group 0.000 description 1
- 125000005530 alkylenedioxy group Chemical group 0.000 description 1
- 125000005529 alkyleneoxy group Chemical group 0.000 description 1
- 125000000304 alkynyl group Chemical group 0.000 description 1
- 230000000172 allergic effect Effects 0.000 description 1
- 230000007815 allergy Effects 0.000 description 1
- 208000004631 alopecia areata Diseases 0.000 description 1
- HSFWRNGVRCDJHI-UHFFFAOYSA-N alpha-acetylene Natural products C#C HSFWRNGVRCDJHI-UHFFFAOYSA-N 0.000 description 1
- AWUCVROLDVIAJX-UHFFFAOYSA-N alpha-glycerophosphate Natural products OCC(O)COP(O)(O)=O AWUCVROLDVIAJX-UHFFFAOYSA-N 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 235000012211 aluminium silicate Nutrition 0.000 description 1
- SNAAJJQQZSMGQD-UHFFFAOYSA-N aluminum magnesium Chemical compound [Mg].[Al] SNAAJJQQZSMGQD-UHFFFAOYSA-N 0.000 description 1
- 206010002026 amyotrophic lateral sclerosis Diseases 0.000 description 1
- 229960004238 anakinra Drugs 0.000 description 1
- 208000007502 anemia Diseases 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 229940031955 anhydrous lanolin Drugs 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000000845 anti-microbial effect Effects 0.000 description 1
- 230000003078 antioxidant effect Effects 0.000 description 1
- 230000036506 anxiety Effects 0.000 description 1
- 206010002906 aortic stenosis Diseases 0.000 description 1
- BTFJIXJJCSYFAL-UHFFFAOYSA-N arachidyl alcohol Natural products CCCCCCCCCCCCCCCCCCCCO BTFJIXJJCSYFAL-UHFFFAOYSA-N 0.000 description 1
- 150000001491 aromatic compounds Chemical class 0.000 description 1
- 125000005418 aryl aryl group Chemical group 0.000 description 1
- 150000001499 aryl bromides Chemical class 0.000 description 1
- 125000005101 aryl methoxy carbonyl group Chemical group 0.000 description 1
- 125000005165 aryl thioxy group Chemical group 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 239000003212 astringent agent Substances 0.000 description 1
- 238000011914 asymmetric synthesis Methods 0.000 description 1
- 229960002170 azathioprine Drugs 0.000 description 1
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 201000009904 bacterial meningitis Diseases 0.000 description 1
- 235000013871 bee wax Nutrition 0.000 description 1
- 239000012166 beeswax Substances 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid group Chemical group C(C1=CC=CC=C1)(=O)O WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- 125000000051 benzyloxy group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])O* 0.000 description 1
- 108010068543 beta-lactamase CMY-2 Proteins 0.000 description 1
- 108010005622 beta-lactamase KPC-2 Proteins 0.000 description 1
- 108010002829 beta-lactamase TEM-3 Proteins 0.000 description 1
- 229960002537 betamethasone Drugs 0.000 description 1
- UREBDLICKHMUKA-DVTGEIKXSA-N betamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-DVTGEIKXSA-N 0.000 description 1
- 229950007599 betamipron Drugs 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000002051 biphasic effect Effects 0.000 description 1
- 125000000319 biphenyl-4-yl group Chemical group [H]C1=C([H])C([H])=C([H])C([H])=C1C1=C([H])C([H])=C([*])C([H])=C1[H] 0.000 description 1
- IPWKHHSGDUIRAH-UHFFFAOYSA-N bis(pinacolato)diboron Chemical compound O1C(C)(C)C(C)(C)OB1B1OC(C)(C)C(C)(C)O1 IPWKHHSGDUIRAH-UHFFFAOYSA-N 0.000 description 1
- 229920001400 block copolymer Polymers 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 230000023555 blood coagulation Effects 0.000 description 1
- 208000019664 bone resorption disease Diseases 0.000 description 1
- 150000001639 boron compounds Chemical class 0.000 description 1
- UWTDFICHZKXYAC-UHFFFAOYSA-N boron;oxolane Chemical compound [B].C1CCOC1 UWTDFICHZKXYAC-UHFFFAOYSA-N 0.000 description 1
- 201000006824 bubonic plague Diseases 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 239000004067 bulking agent Substances 0.000 description 1
- SECPBURWFOCMIZ-UHFFFAOYSA-N butanedioic acid;2,3-dihydroxyhenicosan-4-one Chemical compound OC(=O)CCC(O)=O.CCCCCCCCCCCCCCCCCC(=O)C(O)C(C)O SECPBURWFOCMIZ-UHFFFAOYSA-N 0.000 description 1
- 102100037092 cAMP-specific 3',5'-cyclic phosphodiesterase 4A Human genes 0.000 description 1
- 102100029169 cAMP-specific 3',5'-cyclic phosphodiesterase 4C Human genes 0.000 description 1
- 102100029170 cAMP-specific 3',5'-cyclic phosphodiesterase 4D Human genes 0.000 description 1
- 201000003984 candidiasis Diseases 0.000 description 1
- 150000004657 carbamic acid derivatives Chemical class 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 150000001733 carboxylic acid esters Chemical class 0.000 description 1
- 150000001735 carboxylic acids Chemical class 0.000 description 1
- 229920003123 carboxymethyl cellulose sodium Polymers 0.000 description 1
- 229940063834 carboxymethylcellulose sodium Drugs 0.000 description 1
- 230000000747 cardiac effect Effects 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- RRYMAQUWDLIUPV-BXKDBHETSA-N cefacetrile Chemical compound S1CC(COC(=O)C)=C(C(O)=O)N2C(=O)[C@@H](NC(=O)CC#N)[C@@H]12 RRYMAQUWDLIUPV-BXKDBHETSA-N 0.000 description 1
- 229960003972 cefacetrile Drugs 0.000 description 1
- 229960004841 cefadroxil Drugs 0.000 description 1
- NBFNMSULHIODTC-CYJZLJNKSA-N cefadroxil monohydrate Chemical compound O.C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)C)C(O)=O)=CC=C(O)C=C1 NBFNMSULHIODTC-CYJZLJNKSA-N 0.000 description 1
- FUBBGQLTSCSAON-PBFPGSCMSA-N cefaloglycin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)COC(=O)C)C(O)=O)=CC=CC=C1 FUBBGQLTSCSAON-PBFPGSCMSA-N 0.000 description 1
- 229950004030 cefaloglycin Drugs 0.000 description 1
- 229960003866 cefaloridine Drugs 0.000 description 1
- CZTQZXZIADLWOZ-CRAIPNDOSA-N cefaloridine Chemical compound O=C([C@@H](NC(=O)CC=1SC=CC=1)[C@H]1SC2)N1C(C(=O)[O-])=C2C[N+]1=CC=CC=C1 CZTQZXZIADLWOZ-CRAIPNDOSA-N 0.000 description 1
- 229960004350 cefapirin Drugs 0.000 description 1
- UOCJDOLVGGIYIQ-PBFPGSCMSA-N cefatrizine Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)[C@H](N)C=2C=CC(O)=CC=2)CC=1CSC=1C=NNN=1 UOCJDOLVGGIYIQ-PBFPGSCMSA-N 0.000 description 1
- 229960002420 cefatrizine Drugs 0.000 description 1
- 229960005312 cefazedone Drugs 0.000 description 1
- VTLCNEGVSVJLDN-MLGOLLRUSA-N cefazedone Chemical compound S1C(C)=NN=C1SCC1=C(C(O)=O)N2C(=O)[C@@H](NC(=O)CN3C=C(Cl)C(=O)C(Cl)=C3)[C@H]2SC1 VTLCNEGVSVJLDN-MLGOLLRUSA-N 0.000 description 1
- 229960003719 cefdinir Drugs 0.000 description 1
- RTXOFQZKPXMALH-GHXIOONMSA-N cefdinir Chemical compound S1C(N)=NC(C(=N\O)\C(=O)N[C@@H]2C(N3C(=C(C=C)CS[C@@H]32)C(O)=O)=O)=C1 RTXOFQZKPXMALH-GHXIOONMSA-N 0.000 description 1
- 229960004069 cefditoren Drugs 0.000 description 1
- KMIPKYQIOVAHOP-YLGJWRNMSA-N cefditoren Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1\C=C/C=1SC=NC=1C KMIPKYQIOVAHOP-YLGJWRNMSA-N 0.000 description 1
- 229960004041 cefetamet Drugs 0.000 description 1
- MQLRYUCJDNBWMV-GHXIOONMSA-N cefetamet Chemical compound N([C@@H]1C(N2C(=C(C)CS[C@@H]21)C(O)=O)=O)C(=O)\C(=N/OC)C1=CSC(N)=N1 MQLRYUCJDNBWMV-GHXIOONMSA-N 0.000 description 1
- 229960003791 cefmenoxime Drugs 0.000 description 1
- HJJDBAOLQAWBMH-YCRCPZNHSA-N cefmenoxime Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1CSC1=NN=NN1C HJJDBAOLQAWBMH-YCRCPZNHSA-N 0.000 description 1
- SNBUBQHDYVFSQF-HIFRSBDPSA-N cefmetazole Chemical compound S([C@@H]1[C@@](C(N1C=1C(O)=O)=O)(NC(=O)CSCC#N)OC)CC=1CSC1=NN=NN1C SNBUBQHDYVFSQF-HIFRSBDPSA-N 0.000 description 1
- 229960003585 cefmetazole Drugs 0.000 description 1
- 229960001958 cefodizime Drugs 0.000 description 1
- XDZKBRJLTGRPSS-BGZQYGJUSA-N cefodizime Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1CSC1=NC(C)=C(CC(O)=O)S1 XDZKBRJLTGRPSS-BGZQYGJUSA-N 0.000 description 1
- DYAIAHUQIPBDIP-AXAPSJFSSA-N cefonicid Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)[C@H](O)C=2C=CC=CC=2)CC=1CSC1=NN=NN1CS(O)(=O)=O DYAIAHUQIPBDIP-AXAPSJFSSA-N 0.000 description 1
- 229960004489 cefonicid Drugs 0.000 description 1
- 229960004682 cefoperazone Drugs 0.000 description 1
- GCFBRXLSHGKWDP-XCGNWRKASA-N cefoperazone Chemical compound O=C1C(=O)N(CC)CCN1C(=O)N[C@H](C=1C=CC(O)=CC=1)C(=O)N[C@@H]1C(=O)N2C(C(O)=O)=C(CSC=3N(N=NN=3)C)CS[C@@H]21 GCFBRXLSHGKWDP-XCGNWRKASA-N 0.000 description 1
- 229960004292 ceforanide Drugs 0.000 description 1
- SLAYUXIURFNXPG-CRAIPNDOSA-N ceforanide Chemical compound NCC1=CC=CC=C1CC(=O)N[C@@H]1C(=O)N2C(C(O)=O)=C(CSC=3N(N=NN=3)CC(O)=O)CS[C@@H]21 SLAYUXIURFNXPG-CRAIPNDOSA-N 0.000 description 1
- PWAUCHMQEXVFJR-PMAPCBKXSA-N cefpiramide Chemical compound C1=NC(C)=CC(O)=C1C(=O)N[C@H](C=1C=CC(O)=CC=1)C(=O)N[C@@H]1C(=O)N2C(C(O)=O)=C(CSC=3N(N=NN=3)C)CS[C@@H]21 PWAUCHMQEXVFJR-PMAPCBKXSA-N 0.000 description 1
- 229960005446 cefpiramide Drugs 0.000 description 1
- 229960002580 cefprozil Drugs 0.000 description 1
- 229950009592 cefquinome Drugs 0.000 description 1
- 229960002588 cefradine Drugs 0.000 description 1
- 229960003844 cefroxadine Drugs 0.000 description 1
- RDMOROXKXONCAL-UEKVPHQBSA-N cefroxadine Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)OC)C(O)=O)=CCC=CC1 RDMOROXKXONCAL-UEKVPHQBSA-N 0.000 description 1
- 229960003202 cefsulodin Drugs 0.000 description 1
- SYLKGLMBLAAGSC-QLVMHMETSA-N cefsulodin Chemical compound C1=CC(C(=O)N)=CC=[N+]1CC1=C(C([O-])=O)N2C(=O)[C@@H](NC(=O)[C@@H](C=3C=CC=CC=3)S(O)(=O)=O)[C@H]2SC1 SYLKGLMBLAAGSC-QLVMHMETSA-N 0.000 description 1
- 229960004366 ceftezole Drugs 0.000 description 1
- DZMVCVMFETWNIU-LDYMZIIASA-N ceftezole Chemical compound O=C([C@@H](NC(=O)CN1N=NN=C1)[C@H]1SC2)N1C(C(=O)O)=C2CSC1=NN=CS1 DZMVCVMFETWNIU-LDYMZIIASA-N 0.000 description 1
- 229960004086 ceftibuten Drugs 0.000 description 1
- UNJFKXSSGBWRBZ-BJCIPQKHSA-N ceftibuten Chemical compound S1C(N)=NC(C(=C\CC(O)=O)\C(=O)N[C@@H]2C(N3C(=CCS[C@@H]32)C(O)=O)=O)=C1 UNJFKXSSGBWRBZ-BJCIPQKHSA-N 0.000 description 1
- VOAZJEPQLGBXGO-SDAWRPRTSA-N ceftobiprole Chemical compound S1C(N)=NC(C(=N\O)\C(=O)N[C@@H]2C(N3C(=C(\C=C/4C(N([C@H]5CNCC5)CC\4)=O)CS[C@@H]32)C(O)=O)=O)=N1 VOAZJEPQLGBXGO-SDAWRPRTSA-N 0.000 description 1
- 229950004259 ceftobiprole Drugs 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 229920002301 cellulose acetate Polymers 0.000 description 1
- 208000015114 central nervous system disease Diseases 0.000 description 1
- RDLPVSKMFDYCOR-UEKVPHQBSA-N cephradine Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)C)C(O)=O)=CCC=CC1 RDLPVSKMFDYCOR-UEKVPHQBSA-N 0.000 description 1
- 230000002490 cerebral effect Effects 0.000 description 1
- 206010008323 cervicitis Diseases 0.000 description 1
- 229940081733 cetearyl alcohol Drugs 0.000 description 1
- 201000004308 chancroid Diseases 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- CFBUZOUXXHZCFB-OYOVHJISSA-N chembl511115 Chemical compound COC1=CC=C([C@@]2(CC[C@H](CC2)C(O)=O)C#N)C=C1OC1CCCC1 CFBUZOUXXHZCFB-OYOVHJISSA-N 0.000 description 1
- 201000008240 chemical colitis Diseases 0.000 description 1
- 150000005829 chemical entities Chemical class 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 230000035606 childbirth Effects 0.000 description 1
- 239000012069 chiral reagent Substances 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 150000001841 cholesterols Chemical class 0.000 description 1
- 208000007451 chronic bronchitis Diseases 0.000 description 1
- 208000023652 chronic gastritis Diseases 0.000 description 1
- 208000020832 chronic kidney disease Diseases 0.000 description 1
- 208000022831 chronic renal failure syndrome Diseases 0.000 description 1
- 229960001265 ciclosporin Drugs 0.000 description 1
- RRGUKTPIGVIEKM-UHFFFAOYSA-N cilostazol Chemical compound C=1C=C2NC(=O)CCC2=CC=1OCCCCC1=NN=NN1C1CCCCC1 RRGUKTPIGVIEKM-UHFFFAOYSA-N 0.000 description 1
- 229960004588 cilostazol Drugs 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical class OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 1
- 230000035602 clotting Effects 0.000 description 1
- 208000018912 cluster headache syndrome Diseases 0.000 description 1
- 238000011260 co-administration Methods 0.000 description 1
- 201000003486 coccidioidomycosis Diseases 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 239000003240 coconut oil Substances 0.000 description 1
- 235000019864 coconut oil Nutrition 0.000 description 1
- 230000019771 cognition Effects 0.000 description 1
- 230000007278 cognition impairment Effects 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 229940125904 compound 1 Drugs 0.000 description 1
- 229940125782 compound 2 Drugs 0.000 description 1
- 230000002508 compound effect Effects 0.000 description 1
- 238000013270 controlled release Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 230000036461 convulsion Effects 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 210000004351 coronary vessel Anatomy 0.000 description 1
- 239000003246 corticosteroid Substances 0.000 description 1
- 229960001334 corticosteroids Drugs 0.000 description 1
- 235000012343 cottonseed oil Nutrition 0.000 description 1
- 239000013058 crude material Substances 0.000 description 1
- 208000004921 cutaneous lupus erythematosus Diseases 0.000 description 1
- WZHCOOQXZCIUNC-UHFFFAOYSA-N cyclandelate Chemical compound C1C(C)(C)CC(C)CC1OC(=O)C(O)C1=CC=CC=C1 WZHCOOQXZCIUNC-UHFFFAOYSA-N 0.000 description 1
- 125000000392 cycloalkenyl group Chemical group 0.000 description 1
- 125000001995 cyclobutyl group Chemical group [H]C1([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- 125000000582 cycloheptyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 1
- 125000001559 cyclopropyl group Chemical group [H]C1([H])C([H])([H])C1([H])* 0.000 description 1
- 125000004186 cyclopropylmethyl group Chemical group [H]C([H])(*)C1([H])C([H])([H])C1([H])[H] 0.000 description 1
- PLMFYJJFUUUCRZ-UHFFFAOYSA-M decyltrimethylammonium bromide Chemical compound [Br-].CCCCCCCCCC[N+](C)(C)C PLMFYJJFUUUCRZ-UHFFFAOYSA-M 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 239000002781 deodorant agent Substances 0.000 description 1
- 229960003964 deoxycholic acid Drugs 0.000 description 1
- 210000004207 dermis Anatomy 0.000 description 1
- 239000002274 desiccant Substances 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 230000006866 deterioration Effects 0.000 description 1
- 208000033679 diabetic kidney disease Diseases 0.000 description 1
- ZBCBWPMODOFKDW-UHFFFAOYSA-N diethanolamine Chemical compound OCCNCCO ZBCBWPMODOFKDW-UHFFFAOYSA-N 0.000 description 1
- ZPTBLXKRQACLCR-XVFCMESISA-N dihydrouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)CC1 ZPTBLXKRQACLCR-XVFCMESISA-N 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 108700003601 dimethylglycine Proteins 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- CITHEXJVPOWHKC-UHFFFAOYSA-N dimyristoyl phosphatidylcholine Chemical compound CCCCCCCCCCCCCC(=O)OCC(COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCCCCCCC CITHEXJVPOWHKC-UHFFFAOYSA-N 0.000 description 1
- 229960003724 dimyristoylphosphatidylcholine Drugs 0.000 description 1
- ZZVUWRFHKOJYTH-UHFFFAOYSA-N diphenhydramine Chemical group C=1C=CC=CC=1C(OCCN(C)C)C1=CC=CC=C1 ZZVUWRFHKOJYTH-UHFFFAOYSA-N 0.000 description 1
- 125000005982 diphenylmethyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])(*)C1=C([H])C([H])=C([H])C([H])=C1[H] 0.000 description 1
- 239000001177 diphosphate Substances 0.000 description 1
- XPPKVPWEQAFLFU-UHFFFAOYSA-J diphosphate(4-) Chemical class [O-]P([O-])(=O)OP([O-])([O-])=O XPPKVPWEQAFLFU-UHFFFAOYSA-J 0.000 description 1
- 235000011180 diphosphates Nutrition 0.000 description 1
- ZGSPNIOCEDOHGS-UHFFFAOYSA-L disodium [3-[2,3-di(octadeca-9,12-dienoyloxy)propoxy-oxidophosphoryl]oxy-2-hydroxypropyl] 2,3-di(octadeca-9,12-dienoyloxy)propyl phosphate Chemical compound [Na+].[Na+].CCCCCC=CCC=CCCCCCCCC(=O)OCC(OC(=O)CCCCCCCC=CCC=CCCCCC)COP([O-])(=O)OCC(O)COP([O-])(=O)OCC(OC(=O)CCCCCCCC=CCC=CCCCCC)COC(=O)CCCCCCCC=CCC=CCCCCC ZGSPNIOCEDOHGS-UHFFFAOYSA-L 0.000 description 1
- YHAIUSTWZPMYGG-UHFFFAOYSA-L disodium;2,2-dioctyl-3-sulfobutanedioate Chemical compound [Na+].[Na+].CCCCCCCCC(C([O-])=O)(C(C([O-])=O)S(O)(=O)=O)CCCCCCCC YHAIUSTWZPMYGG-UHFFFAOYSA-L 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 208000009190 disseminated intravascular coagulation Diseases 0.000 description 1
- 201000008243 diversion colitis Diseases 0.000 description 1
- TWFQJFPTTMIETC-UHFFFAOYSA-N dodecan-1-amine;hydron;chloride Chemical compound [Cl-].CCCCCCCCCCCC[NH3+] TWFQJFPTTMIETC-UHFFFAOYSA-N 0.000 description 1
- 125000003438 dodecyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- AVAACINZEOAHHE-VFZPANTDSA-N doripenem Chemical compound C=1([C@H](C)[C@@H]2[C@H](C(N2C=1C(O)=O)=O)[C@H](O)C)S[C@@H]1CN[C@H](CNS(N)(=O)=O)C1 AVAACINZEOAHHE-VFZPANTDSA-N 0.000 description 1
- 229960000895 doripenem Drugs 0.000 description 1
- 239000000890 drug combination Substances 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 206010013663 drug dependence Diseases 0.000 description 1
- 230000036267 drug metabolism Effects 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 239000003221 ear drop Substances 0.000 description 1
- 229940047652 ear drops Drugs 0.000 description 1
- 208000019258 ear infection Diseases 0.000 description 1
- 229960000284 efalizumab Drugs 0.000 description 1
- 229940089666 egg yolk phosphatides Drugs 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 239000003480 eluent Substances 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 208000028104 epidemic louse-borne typhus Diseases 0.000 description 1
- 208000001606 epiglottitis Diseases 0.000 description 1
- 206010015037 epilepsy Diseases 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 229960000403 etanercept Drugs 0.000 description 1
- 150000002170 ethers Chemical class 0.000 description 1
- MVPICKVDHDWCJQ-UHFFFAOYSA-N ethyl 3-pyrrolidin-1-ylpropanoate Chemical compound CCOC(=O)CCN1CCCC1 MVPICKVDHDWCJQ-UHFFFAOYSA-N 0.000 description 1
- 235000019325 ethyl cellulose Nutrition 0.000 description 1
- 229920001249 ethyl cellulose Polymers 0.000 description 1
- 235000019326 ethyl hydroxyethyl cellulose Nutrition 0.000 description 1
- 125000002534 ethynyl group Chemical group [H]C#C* 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 239000003889 eye drop Substances 0.000 description 1
- 229940012356 eye drops Drugs 0.000 description 1
- 239000003885 eye ointment Substances 0.000 description 1
- 239000003925 fat Substances 0.000 description 1
- 235000019197 fats Nutrition 0.000 description 1
- 230000020764 fibrinolysis Effects 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000010408 film Substances 0.000 description 1
- 239000012467 final product Substances 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 239000011737 fluorine Substances 0.000 description 1
- 239000006260 foam Substances 0.000 description 1
- 201000003444 follicular lymphoma Diseases 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 235000019253 formic acid Nutrition 0.000 description 1
- 125000002485 formyl group Chemical group [H]C(*)=O 0.000 description 1
- 238000001640 fractional crystallisation Methods 0.000 description 1
- 238000007306 functionalization reaction Methods 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 210000004392 genitalia Anatomy 0.000 description 1
- 229910052732 germanium Inorganic materials 0.000 description 1
- GNPVGFCGXDBREM-UHFFFAOYSA-N germanium atom Chemical compound [Ge] GNPVGFCGXDBREM-UHFFFAOYSA-N 0.000 description 1
- 229940074045 glyceryl distearate Drugs 0.000 description 1
- 201000011205 glycine encephalopathy Diseases 0.000 description 1
- 208000001786 gonorrhea Diseases 0.000 description 1
- 208000024908 graft versus host disease Diseases 0.000 description 1
- 210000003714 granulocyte Anatomy 0.000 description 1
- 208000010758 granulomatous inflammation Diseases 0.000 description 1
- 229940087559 grape seed Drugs 0.000 description 1
- 206010018797 guttate psoriasis Diseases 0.000 description 1
- 238000001631 haemodialysis Methods 0.000 description 1
- 239000007902 hard capsule Substances 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 208000019622 heart disease Diseases 0.000 description 1
- 230000000322 hemodialysis Effects 0.000 description 1
- 230000002008 hemorrhagic effect Effects 0.000 description 1
- 208000007386 hepatic encephalopathy Diseases 0.000 description 1
- 125000004366 heterocycloalkenyl group Chemical group 0.000 description 1
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 1
- 229920001477 hydrophilic polymer Polymers 0.000 description 1
- 235000019447 hydroxyethyl cellulose Nutrition 0.000 description 1
- 229940050526 hydroxyethylstarch Drugs 0.000 description 1
- XSEOYPMPHHCUBN-FGYWBSQSSA-N hydroxylated lecithin Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC(COP([O-])(=O)OCC[N+](C)(C)C)COC(=O)CCCCCCC[C@@H](O)[C@H](O)CCCCCCCC XSEOYPMPHHCUBN-FGYWBSQSSA-N 0.000 description 1
- 229920003063 hydroxymethyl cellulose Polymers 0.000 description 1
- 229940031574 hydroxymethyl cellulose Drugs 0.000 description 1
- 229920003132 hydroxypropyl methylcellulose phthalate Polymers 0.000 description 1
- 229940031704 hydroxypropyl methylcellulose phthalate Drugs 0.000 description 1
- 230000003225 hyperhomocysteinemia Effects 0.000 description 1
- 208000023399 hyperprolinemia Diseases 0.000 description 1
- 230000001969 hypertrophic effect Effects 0.000 description 1
- 230000036543 hypotension Effects 0.000 description 1
- 230000007954 hypoxia Effects 0.000 description 1
- 239000005457 ice water Substances 0.000 description 1
- 150000002460 imidazoles Chemical class 0.000 description 1
- 208000015446 immunoglobulin a vasculitis Diseases 0.000 description 1
- 229940125721 immunosuppressive agent Drugs 0.000 description 1
- 239000003018 immunosuppressive agent Substances 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 239000012678 infectious agent Substances 0.000 description 1
- 208000027139 infectious colitis Diseases 0.000 description 1
- 230000004968 inflammatory condition Effects 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 229960000598 infliximab Drugs 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 208000030603 inherited susceptibility to asthma Diseases 0.000 description 1
- 229940102223 injectable solution Drugs 0.000 description 1
- 229940102213 injectable suspension Drugs 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 229910052740 iodine Inorganic materials 0.000 description 1
- 229940044173 iodine-125 Drugs 0.000 description 1
- PCEBAZIVZVIQEO-UHFFFAOYSA-N iodocyclopentane Chemical compound IC1CCCC1 PCEBAZIVZVIQEO-UHFFFAOYSA-N 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 208000002551 irritable bowel syndrome Diseases 0.000 description 1
- 239000002085 irritant Substances 0.000 description 1
- 231100000021 irritant Toxicity 0.000 description 1
- 230000007794 irritation Effects 0.000 description 1
- 208000028867 ischemia Diseases 0.000 description 1
- 201000008222 ischemic colitis Diseases 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229940074928 isopropyl myristate Drugs 0.000 description 1
- 230000000155 isotopic effect Effects 0.000 description 1
- NLYAJNPCOHFWQQ-UHFFFAOYSA-N kaolin Chemical compound O.O.O=[Al]O[Si](=O)O[Si](=O)O[Al]=O NLYAJNPCOHFWQQ-UHFFFAOYSA-N 0.000 description 1
- 201000006370 kidney failure Diseases 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 229940039717 lanolin Drugs 0.000 description 1
- 235000019388 lanolin Nutrition 0.000 description 1
- 229960000433 latamoxef Drugs 0.000 description 1
- 229940094506 lauryl betaine Drugs 0.000 description 1
- 101150021684 leuS gene Proteins 0.000 description 1
- 125000001909 leucine group Chemical group [H]N(*)C(C(*)=O)C([H])([H])C(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 201000002364 leukopenia Diseases 0.000 description 1
- 231100001022 leukopenia Toxicity 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 239000003589 local anesthetic agent Substances 0.000 description 1
- 229960005015 local anesthetics Drugs 0.000 description 1
- 150000002646 long chain fatty acid esters Chemical class 0.000 description 1
- 231100000053 low toxicity Toxicity 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 208000004341 lymphocytic colitis Diseases 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 159000000003 magnesium salts Chemical class 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 235000009973 maize Nutrition 0.000 description 1
- 201000004792 malaria Diseases 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 238000013160 medical therapy Methods 0.000 description 1
- 150000004667 medium chain fatty acids Chemical class 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- HRDXJKGNWSUIBT-UHFFFAOYSA-N methoxybenzene Chemical group [CH2]OC1=CC=CC=C1 HRDXJKGNWSUIBT-UHFFFAOYSA-N 0.000 description 1
- PYFSLJVSCGXYAJ-UHFFFAOYSA-N methyl 2-hydroxy-4-[[3-(2-hydroxyphenyl)phenyl]sulfonylamino]benzoate Chemical compound C1=C(O)C(C(=O)OC)=CC=C1NS(=O)(=O)C1=CC=CC(C=2C(=CC=CC=2)O)=C1 PYFSLJVSCGXYAJ-UHFFFAOYSA-N 0.000 description 1
- QSRRZKPKHJHIRB-UHFFFAOYSA-N methyl 4-[(2,5-dichloro-4-methylthiophen-3-yl)sulfonylamino]-2-hydroxybenzoate Chemical compound C1=C(O)C(C(=O)OC)=CC=C1NS(=O)(=O)C1=C(Cl)SC(Cl)=C1C QSRRZKPKHJHIRB-UHFFFAOYSA-N 0.000 description 1
- YGDGZDGRCWHDOU-UHFFFAOYSA-N methyl 4-[[5-chloro-4-(2-hydroxyphenyl)thiophen-2-yl]sulfonylamino]-2-hydroxybenzoate Chemical compound C1=C(O)C(C(=O)OC)=CC=C1NS(=O)(=O)C1=CC(C=2C(=CC=CC=2)O)=C(Cl)S1 YGDGZDGRCWHDOU-UHFFFAOYSA-N 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 208000008275 microscopic colitis Diseases 0.000 description 1
- 230000003228 microsomal effect Effects 0.000 description 1
- 206010027599 migraine Diseases 0.000 description 1
- 235000019713 millet Nutrition 0.000 description 1
- 235000010755 mineral Nutrition 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 230000001333 moisturizer Effects 0.000 description 1
- 125000006682 monohaloalkyl group Chemical group 0.000 description 1
- 150000004712 monophosphates Chemical class 0.000 description 1
- 125000004572 morpholin-3-yl group Chemical group N1C(COCC1)* 0.000 description 1
- 125000002757 morpholinyl group Chemical group 0.000 description 1
- 235000011929 mousse Nutrition 0.000 description 1
- 210000000214 mouth Anatomy 0.000 description 1
- 201000007524 mucormycosis Diseases 0.000 description 1
- 210000004400 mucous membrane Anatomy 0.000 description 1
- 210000003097 mucus Anatomy 0.000 description 1
- 230000036457 multidrug resistance Effects 0.000 description 1
- 208000037890 multiple organ injury Diseases 0.000 description 1
- 208000010125 myocardial infarction Diseases 0.000 description 1
- 208000031225 myocardial ischemia Diseases 0.000 description 1
- 210000004165 myocardium Anatomy 0.000 description 1
- 229940078490 n,n-dimethylglycine Drugs 0.000 description 1
- 125000004108 n-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- DVEKCXOJTLDBFE-UHFFFAOYSA-N n-dodecyl-n,n-dimethylglycinate Chemical compound CCCCCCCCCCCC[N+](C)(C)CC([O-])=O DVEKCXOJTLDBFE-UHFFFAOYSA-N 0.000 description 1
- 125000003136 n-heptyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000001280 n-hexyl group Chemical group C(CCCCC)* 0.000 description 1
- 125000004123 n-propyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 208000004995 necrotizing enterocolitis Diseases 0.000 description 1
- 201000007970 necrotizing fasciitis Diseases 0.000 description 1
- 208000021971 neovascular inflammatory vitreoretinopathy Diseases 0.000 description 1
- 201000008383 nephritis Diseases 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 208000004296 neuralgia Diseases 0.000 description 1
- 230000000926 neurological effect Effects 0.000 description 1
- 201000001119 neuropathy Diseases 0.000 description 1
- 230000007823 neuropathy Effects 0.000 description 1
- 210000000440 neutrophil Anatomy 0.000 description 1
- 229910052759 nickel Inorganic materials 0.000 description 1
- QMMRZOWCJAIUJA-UHFFFAOYSA-L nickel dichloride Chemical compound Cl[Ni]Cl QMMRZOWCJAIUJA-UHFFFAOYSA-L 0.000 description 1
- 229910017604 nitric acid Inorganic materials 0.000 description 1
- 150000002828 nitro derivatives Chemical class 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- 150000003833 nucleoside derivatives Chemical class 0.000 description 1
- GYCKQBWUSACYIF-UHFFFAOYSA-N o-hydroxybenzoic acid ethyl ester Natural products CCOC(=O)C1=CC=CC=C1O GYCKQBWUSACYIF-UHFFFAOYSA-N 0.000 description 1
- 235000020824 obesity Nutrition 0.000 description 1
- 208000031237 olivopontocerebellar atrophy Diseases 0.000 description 1
- 239000003605 opacifier Substances 0.000 description 1
- 150000002894 organic compounds Chemical class 0.000 description 1
- 239000011368 organic material Substances 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 208000002865 osteopetrosis Diseases 0.000 description 1
- 206010033072 otitis externa Diseases 0.000 description 1
- 230000016087 ovulation Effects 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- PIBWKRNGBLPSSY-UHFFFAOYSA-L palladium(II) chloride Chemical compound Cl[Pd]Cl PIBWKRNGBLPSSY-UHFFFAOYSA-L 0.000 description 1
- 229950011346 panipenem Drugs 0.000 description 1
- 244000045947 parasite Species 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 239000006072 paste Substances 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 201000006195 perinatal necrotizing enterocolitis Diseases 0.000 description 1
- 208000028169 periodontal disease Diseases 0.000 description 1
- 201000001245 periodontitis Diseases 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 239000012466 permeate Substances 0.000 description 1
- 239000003208 petroleum Substances 0.000 description 1
- 239000003209 petroleum derivative Substances 0.000 description 1
- 239000003444 phase transfer catalyst Substances 0.000 description 1
- LIGACIXOYTUXAW-UHFFFAOYSA-N phenacyl bromide Chemical class BrCC(=O)C1=CC=CC=C1 LIGACIXOYTUXAW-UHFFFAOYSA-N 0.000 description 1
- 150000002989 phenols Chemical class 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 150000003905 phosphatidylinositols Chemical class 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- OJMIONKXNSYLSR-UHFFFAOYSA-N phosphorous acid Chemical class OP(O)O OJMIONKXNSYLSR-UHFFFAOYSA-N 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- RRRUXBQSQLKHEL-UHFFFAOYSA-N piclamilast Chemical compound COC1=CC=C(C(=O)NC=2C(=CN=CC=2Cl)Cl)C=C1OC1CCCC1 RRRUXBQSQLKHEL-UHFFFAOYSA-N 0.000 description 1
- 229950005184 piclamilast Drugs 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- KASDHRXLYQOAKZ-ZPSXYTITSA-N pimecrolimus Chemical compound C/C([C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@]2(O)O[C@@H]([C@H](C[C@H]2C)OC)[C@@H](OC)C[C@@H](C)C/C(C)=C/[C@H](C(C[C@H](O)[C@H]1C)=O)CC)=C\[C@@H]1CC[C@@H](Cl)[C@H](OC)C1 KASDHRXLYQOAKZ-ZPSXYTITSA-N 0.000 description 1
- 229960005330 pimecrolimus Drugs 0.000 description 1
- 125000004193 piperazinyl group Chemical group 0.000 description 1
- 125000000587 piperidin-1-yl group Chemical group [H]C1([H])N(*)C([H])([H])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 125000004483 piperidin-3-yl group Chemical group N1CC(CCC1)* 0.000 description 1
- 125000004482 piperidin-4-yl group Chemical group N1CCC(CC1)* 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 206010035653 pneumoconiosis Diseases 0.000 description 1
- 239000002798 polar solvent Substances 0.000 description 1
- 229920000058 polyacrylate Polymers 0.000 description 1
- 229920000570 polyether Polymers 0.000 description 1
- 229920000573 polyethylene Polymers 0.000 description 1
- 125000006684 polyhaloalkyl group Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 235000010483 polyoxyethylene sorbitan monopalmitate Nutrition 0.000 description 1
- 239000000249 polyoxyethylene sorbitan monopalmitate Substances 0.000 description 1
- 235000010989 polyoxyethylene sorbitan monostearate Nutrition 0.000 description 1
- 239000001818 polyoxyethylene sorbitan monostearate Substances 0.000 description 1
- 229920001451 polypropylene glycol Polymers 0.000 description 1
- 229920001296 polysiloxane Polymers 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229940068977 polysorbate 20 Drugs 0.000 description 1
- 229940101027 polysorbate 40 Drugs 0.000 description 1
- 229940113124 polysorbate 60 Drugs 0.000 description 1
- 229940068968 polysorbate 80 Drugs 0.000 description 1
- SCVFZCLFOSHCOH-UHFFFAOYSA-M potassium acetate Chemical compound [K+].CC([O-])=O SCVFZCLFOSHCOH-UHFFFAOYSA-M 0.000 description 1
- 230000035935 pregnancy Effects 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 201000000742 primary sclerosing cholangitis Diseases 0.000 description 1
- 230000006785 proliferative vitreoretinopathy Effects 0.000 description 1
- 230000001915 proofreading effect Effects 0.000 description 1
- BDERNNFJNOPAEC-UHFFFAOYSA-N propan-1-ol Chemical compound CCCO BDERNNFJNOPAEC-UHFFFAOYSA-N 0.000 description 1
- VVWRJUBEIPHGQF-MDZDMXLPSA-N propan-2-yl (ne)-n-propan-2-yloxycarbonyliminocarbamate Chemical compound CC(C)OC(=O)\N=N\C(=O)OC(C)C VVWRJUBEIPHGQF-MDZDMXLPSA-N 0.000 description 1
- 235000010409 propane-1,2-diol alginate Nutrition 0.000 description 1
- 239000000770 propane-1,2-diol alginate Substances 0.000 description 1
- 229940093625 propylene glycol monostearate Drugs 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 208000002815 pulmonary hypertension Diseases 0.000 description 1
- 235000020236 pumpkin seed Nutrition 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- 125000000561 purinyl group Chemical group N1=C(N=C2N=CNC2=C1)* 0.000 description 1
- JQJOGAGLBDBMLU-UHFFFAOYSA-N pyridine-2-sulfonyl chloride Chemical class ClS(=O)(=O)C1=CC=CC=N1 JQJOGAGLBDBMLU-UHFFFAOYSA-N 0.000 description 1
- 150000003222 pyridines Chemical class 0.000 description 1
- 125000005344 pyridylmethyl group Chemical group [H]C1=C([H])C([H])=C([H])C(=N1)C([H])([H])* 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- 125000001453 quaternary ammonium group Chemical group 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 208000002574 reactive arthritis Diseases 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 210000000664 rectum Anatomy 0.000 description 1
- 238000010992 reflux Methods 0.000 description 1
- 201000002793 renal fibrosis Diseases 0.000 description 1
- 230000010410 reperfusion Effects 0.000 description 1
- 230000008261 resistance mechanism Effects 0.000 description 1
- 239000011369 resultant mixture Substances 0.000 description 1
- 208000032253 retinal ischemia Diseases 0.000 description 1
- 229930002330 retinoic acid Natural products 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 206010039083 rhinitis Diseases 0.000 description 1
- 229910052703 rhodium Inorganic materials 0.000 description 1
- 125000000548 ribosyl group Chemical group C1([C@H](O)[C@H](O)[C@H](O1)CO)* 0.000 description 1
- 239000011435 rock Substances 0.000 description 1
- MNDBXUUTURYVHR-UHFFFAOYSA-N roflumilast Chemical compound FC(F)OC1=CC=C(C(=O)NC=2C(=CN=CC=2Cl)Cl)C=C1OCC1CC1 MNDBXUUTURYVHR-UHFFFAOYSA-N 0.000 description 1
- 229960002586 roflumilast Drugs 0.000 description 1
- HJORMJIFDVBMOB-UHFFFAOYSA-N rolipram Chemical compound COC1=CC=C(C2CC(=O)NC2)C=C1OC1CCCC1 HJORMJIFDVBMOB-UHFFFAOYSA-N 0.000 description 1
- 229950005741 rolipram Drugs 0.000 description 1
- 201000004700 rosacea Diseases 0.000 description 1
- 201000005404 rubella Diseases 0.000 description 1
- CVHZOJJKTDOEJC-UHFFFAOYSA-N saccharin Chemical compound C1=CC=C2C(=O)NS(=O)(=O)C2=C1 CVHZOJJKTDOEJC-UHFFFAOYSA-N 0.000 description 1
- 229940081974 saccharin Drugs 0.000 description 1
- 235000019204 saccharin Nutrition 0.000 description 1
- 239000000901 saccharin and its Na,K and Ca salt Substances 0.000 description 1
- 201000000306 sarcoidosis Diseases 0.000 description 1
- 229930195734 saturated hydrocarbon Natural products 0.000 description 1
- 231100000241 scar Toxicity 0.000 description 1
- 230000037387 scars Effects 0.000 description 1
- 208000010157 sclerosing cholangitis Diseases 0.000 description 1
- 208000008742 seborrheic dermatitis Diseases 0.000 description 1
- 125000002914 sec-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 230000001235 sensitizing effect Effects 0.000 description 1
- 230000036303 septic shock Effects 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 239000002453 shampoo Substances 0.000 description 1
- 229910052710 silicon Inorganic materials 0.000 description 1
- 239000010703 silicon Substances 0.000 description 1
- 208000017520 skin disease Diseases 0.000 description 1
- 239000000344 soap Substances 0.000 description 1
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 1
- 229910001467 sodium calcium phosphate Inorganic materials 0.000 description 1
- 229960005480 sodium caprylate Drugs 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- NRHMKIHPTBHXPF-TUJRSCDTSA-M sodium cholate Chemical compound [Na+].C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC([O-])=O)C)[C@@]2(C)[C@@H](O)C1 NRHMKIHPTBHXPF-TUJRSCDTSA-M 0.000 description 1
- FHHPUSMSKHSNKW-SMOYURAASA-M sodium deoxycholate Chemical compound [Na+].C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC([O-])=O)C)[C@@]2(C)[C@@H](O)C1 FHHPUSMSKHSNKW-SMOYURAASA-M 0.000 description 1
- BTURAGWYSMTVOW-UHFFFAOYSA-M sodium dodecanoate Chemical compound [Na+].CCCCCCCCCCCC([O-])=O BTURAGWYSMTVOW-UHFFFAOYSA-M 0.000 description 1
- AAYACJGHNRIFCT-YRJJIGPTSA-M sodium glycochenodeoxycholate Chemical compound [Na+].C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCC([O-])=O)C)[C@@]2(C)CC1 AAYACJGHNRIFCT-YRJJIGPTSA-M 0.000 description 1
- OABYVIYXWMZFFJ-ZUHYDKSRSA-M sodium glycocholate Chemical compound [Na+].C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCC([O-])=O)C)[C@@]2(C)[C@@H](O)C1 OABYVIYXWMZFFJ-ZUHYDKSRSA-M 0.000 description 1
- VMSNAUAEKXEYGP-YEUHZSMFSA-M sodium glycodeoxycholate Chemical compound [Na+].C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCC([O-])=O)C)[C@@]2(C)[C@@H](O)C1 VMSNAUAEKXEYGP-YEUHZSMFSA-M 0.000 description 1
- UDWXLZLRRVQONG-UHFFFAOYSA-M sodium hexanoate Chemical compound [Na+].CCCCCC([O-])=O UDWXLZLRRVQONG-UHFFFAOYSA-M 0.000 description 1
- 229940082004 sodium laurate Drugs 0.000 description 1
- 229940079862 sodium lauryl sarcosinate Drugs 0.000 description 1
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 1
- 229940045845 sodium myristate Drugs 0.000 description 1
- RYYKJJJTJZKILX-UHFFFAOYSA-M sodium octadecanoate Chemical compound [Na+].CCCCCCCCCCCCCCCCCC([O-])=O RYYKJJJTJZKILX-UHFFFAOYSA-M 0.000 description 1
- BYKRNSHANADUFY-UHFFFAOYSA-M sodium octanoate Chemical compound [Na+].CCCCCCCC([O-])=O BYKRNSHANADUFY-UHFFFAOYSA-M 0.000 description 1
- 229940045870 sodium palmitate Drugs 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- IJRHDFLHUATAOS-DPMBMXLASA-M sodium ricinoleate Chemical compound [Na+].CCCCCC[C@@H](O)C\C=C/CCCCCCCC([O-])=O IJRHDFLHUATAOS-DPMBMXLASA-M 0.000 description 1
- 159000000000 sodium salts Chemical class 0.000 description 1
- 229940080352 sodium stearoyl lactylate Drugs 0.000 description 1
- 235000010956 sodium stearoyl-2-lactylate Nutrition 0.000 description 1
- 239000003724 sodium stearoyl-2-lactylate Substances 0.000 description 1
- 229940045902 sodium stearyl fumarate Drugs 0.000 description 1
- JAJWGJBVLPIOOH-IZYKLYLVSA-M sodium taurocholate Chemical compound [Na+].C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCCS([O-])(=O)=O)C)[C@@]2(C)[C@@H](O)C1 JAJWGJBVLPIOOH-IZYKLYLVSA-M 0.000 description 1
- 229940045946 sodium taurodeoxycholate Drugs 0.000 description 1
- 229960000776 sodium tetradecyl sulfate Drugs 0.000 description 1
- WDFRNBJHDMUMBL-OICFXQLMSA-M sodium;(4r)-4-[(3r,5s,7r,8r,9s,10s,13r,14s,17r)-3,7-dihydroxy-10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1h-cyclopenta[a]phenanthren-17-yl]pentanoate Chemical compound [Na+].C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC([O-])=O)C)[C@@]2(C)CC1 WDFRNBJHDMUMBL-OICFXQLMSA-M 0.000 description 1
- WDFRNBJHDMUMBL-FUXQPCDDSA-M sodium;(4r)-4-[(3r,5s,7s,8r,9s,10s,13r,14s,17r)-3,7-dihydroxy-10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1h-cyclopenta[a]phenanthren-17-yl]pentanoate Chemical compound [Na+].C([C@H]1C[C@@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC([O-])=O)C)[C@@]2(C)CC1 WDFRNBJHDMUMBL-FUXQPCDDSA-M 0.000 description 1
- WYPBVHPKMJYUEO-NBTZWHCOSA-M sodium;(9z,12z)-octadeca-9,12-dienoate Chemical compound [Na+].CCCCC\C=C/C\C=C/CCCCCCCC([O-])=O WYPBVHPKMJYUEO-NBTZWHCOSA-M 0.000 description 1
- UNZSHUCNBUBSGW-IFNWOZJISA-M sodium;(9z,12z,15z)-octadeca-9,12,15-trienoate Chemical compound [Na+].CC\C=C/C\C=C/C\C=C/CCCCCCCC([O-])=O UNZSHUCNBUBSGW-IFNWOZJISA-M 0.000 description 1
- AQADNICIQOBXGR-CFYXSCKTSA-M sodium;(z)-hexadec-9-enoate Chemical compound [Na+].CCCCCC\C=C/CCCCCCCC([O-])=O AQADNICIQOBXGR-CFYXSCKTSA-M 0.000 description 1
- YXHRQQJFKOHLAP-FVCKGWAHSA-M sodium;2-[[(4r)-4-[(3r,5r,8r,9s,10s,12s,13r,14s,17r)-3,12-dihydroxy-10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1h-cyclopenta[a]phenanthren-17-yl]pentanoyl]amino]ethanesulfonate Chemical compound [Na+].C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCCS([O-])(=O)=O)C)[C@@]2(C)[C@@H](O)C1 YXHRQQJFKOHLAP-FVCKGWAHSA-M 0.000 description 1
- IYPNVUSIMGAJFC-HLEJRKHJSA-M sodium;2-[[(4r)-4-[(3r,5s,7r,8r,9s,10s,13r,14s,17r)-3,7-dihydroxy-10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1h-cyclopenta[a]phenanthren-17-yl]pentanoyl]amino]ethanesulfonate Chemical compound [Na+].C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCCS([O-])(=O)=O)C)[C@@]2(C)CC1 IYPNVUSIMGAJFC-HLEJRKHJSA-M 0.000 description 1
- ADWNFGORSPBALY-UHFFFAOYSA-M sodium;2-[dodecyl(methyl)amino]acetate Chemical compound [Na+].CCCCCCCCCCCCN(C)CC([O-])=O ADWNFGORSPBALY-UHFFFAOYSA-M 0.000 description 1
- OGRPJZFGZFQRHZ-UHFFFAOYSA-M sodium;4-octoxy-4-oxo-3-sulfobutanoate Chemical compound [Na+].CCCCCCCCOC(=O)C(S(O)(=O)=O)CC([O-])=O OGRPJZFGZFQRHZ-UHFFFAOYSA-M 0.000 description 1
- FIWQZURFGYXCEO-UHFFFAOYSA-M sodium;decanoate Chemical compound [Na+].CCCCCCCCCC([O-])=O FIWQZURFGYXCEO-UHFFFAOYSA-M 0.000 description 1
- GGXKEBACDBNFAF-UHFFFAOYSA-M sodium;hexadecanoate Chemical compound [Na+].CCCCCCCCCCCCCCCC([O-])=O GGXKEBACDBNFAF-UHFFFAOYSA-M 0.000 description 1
- JUQGWKYSEXPRGL-UHFFFAOYSA-M sodium;tetradecanoate Chemical compound [Na+].CCCCCCCCCCCCCC([O-])=O JUQGWKYSEXPRGL-UHFFFAOYSA-M 0.000 description 1
- UPUIQOIQVMNQAP-UHFFFAOYSA-M sodium;tetradecyl sulfate Chemical compound [Na+].CCCCCCCCCCCCCCOS([O-])(=O)=O UPUIQOIQVMNQAP-UHFFFAOYSA-M 0.000 description 1
- 239000007901 soft capsule Substances 0.000 description 1
- 239000002689 soil Substances 0.000 description 1
- 230000003381 solubilizing effect Effects 0.000 description 1
- 235000011071 sorbitan monopalmitate Nutrition 0.000 description 1
- 239000001570 sorbitan monopalmitate Substances 0.000 description 1
- 229940031953 sorbitan monopalmitate Drugs 0.000 description 1
- 235000011076 sorbitan monostearate Nutrition 0.000 description 1
- 239000001587 sorbitan monostearate Substances 0.000 description 1
- 229940035048 sorbitan monostearate Drugs 0.000 description 1
- 235000011078 sorbitan tristearate Nutrition 0.000 description 1
- 239000001589 sorbitan tristearate Substances 0.000 description 1
- 229960004129 sorbitan tristearate Drugs 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 238000004611 spectroscopical analysis Methods 0.000 description 1
- 239000012177 spermaceti Substances 0.000 description 1
- 229940084106 spermaceti Drugs 0.000 description 1
- 235000019385 spermaceti wax Nutrition 0.000 description 1
- 208000020431 spinal cord injury Diseases 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 229940098760 steareth-2 Drugs 0.000 description 1
- 229940100458 steareth-21 Drugs 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 208000011117 substance-related disease Diseases 0.000 description 1
- 235000019327 succinylated monoglyceride Nutrition 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 150000003871 sulfonates Chemical class 0.000 description 1
- 238000004808 supercritical fluid chromatography Methods 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 201000004595 synovitis Diseases 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 208000006379 syphilis Diseases 0.000 description 1
- 229960001967 tacrolimus Drugs 0.000 description 1
- QJJXYPPXXYFBGM-SHYZHZOCSA-N tacrolimus Natural products CO[C@H]1C[C@H](CC[C@@H]1O)C=C(C)[C@H]2OC(=O)[C@H]3CCCCN3C(=O)C(=O)[C@@]4(O)O[C@@H]([C@H](C[C@H]4C)OC)[C@@H](C[C@H](C)CC(=C[C@@H](CC=C)C(=O)C[C@H](O)[C@H]2C)C)OC QJJXYPPXXYFBGM-SHYZHZOCSA-N 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 150000003899 tartaric acid esters Chemical class 0.000 description 1
- 229960000565 tazarotene Drugs 0.000 description 1
- 229940036234 tazorac Drugs 0.000 description 1
- 206010043207 temporal arteritis Diseases 0.000 description 1
- 201000004415 tendinitis Diseases 0.000 description 1
- 125000005931 tert-butyloxycarbonyl group Chemical group [H]C([H])([H])C(OC(*)=O)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 125000004192 tetrahydrofuran-2-yl group Chemical group [H]C1([H])OC([H])(*)C([H])([H])C1([H])[H] 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 206010043554 thrombocytopenia Diseases 0.000 description 1
- 206010044008 tonsillitis Diseases 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 229960001727 tretinoin Drugs 0.000 description 1
- 125000004044 trifluoroacetyl group Chemical group FC(C(=O)*)(F)F 0.000 description 1
- UFTFJSFQGQCHQW-UHFFFAOYSA-N triformin Chemical compound O=COCC(OC=O)COC=O UFTFJSFQGQCHQW-UHFFFAOYSA-N 0.000 description 1
- 235000011178 triphosphate Nutrition 0.000 description 1
- 239000001226 triphosphate Substances 0.000 description 1
- UNXRWKVEANCORM-UHFFFAOYSA-N triphosphoric acid Chemical class OP(O)(=O)OP(O)(=O)OP(O)(O)=O UNXRWKVEANCORM-UHFFFAOYSA-N 0.000 description 1
- NHDIQVFFNDKAQU-UHFFFAOYSA-N tripropan-2-yl borate Chemical compound CC(C)OB(OC(C)C)OC(C)C NHDIQVFFNDKAQU-UHFFFAOYSA-N 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- 229910052722 tritium Inorganic materials 0.000 description 1
- 238000001665 trituration Methods 0.000 description 1
- 125000002221 trityl group Chemical group [H]C1=C([H])C([H])=C([H])C([H])=C1C([*])(C1=C(C(=C(C(=C1[H])[H])[H])[H])[H])C1=C([H])C([H])=C([H])C([H])=C1[H] 0.000 description 1
- 229960004418 trolamine Drugs 0.000 description 1
- 201000008827 tuberculosis Diseases 0.000 description 1
- MDYZKJNTKZIUSK-UHFFFAOYSA-N tyloxapol Chemical compound O=C.C1CO1.CC(C)(C)CC(C)(C)C1=CC=C(O)C=C1 MDYZKJNTKZIUSK-UHFFFAOYSA-N 0.000 description 1
- 229920001664 tyloxapol Polymers 0.000 description 1
- 229960004224 tyloxapol Drugs 0.000 description 1
- 206010061393 typhus Diseases 0.000 description 1
- 208000000143 urethritis Diseases 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 201000005539 vernal conjunctivitis Diseases 0.000 description 1
- 125000000391 vinyl group Chemical group [H]C([*])=C([H])[H] 0.000 description 1
- 229920002554 vinyl polymer Polymers 0.000 description 1
- 201000010044 viral meningitis Diseases 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 208000009935 visceral pain Diseases 0.000 description 1
- 235000019166 vitamin D Nutrition 0.000 description 1
- 239000011710 vitamin D Substances 0.000 description 1
- 150000003710 vitamin D derivatives Chemical class 0.000 description 1
- 229940046008 vitamin d Drugs 0.000 description 1
- 239000003039 volatile agent Substances 0.000 description 1
- 239000007762 w/o emulsion Substances 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000003871 white petrolatum Substances 0.000 description 1
- 229940045860 white wax Drugs 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
- A61K31/425—Thiazoles
- A61K31/429—Thiazoles condensed with heterocyclic ring systems
- A61K31/43—Compounds containing 4-thia-1-azabicyclo [3.2.0] heptane ring systems, i.e. compounds containing a ring system of the formula, e.g. penicillins, penems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07F—ACYCLIC, CARBOCYCLIC OR HETEROCYCLIC COMPOUNDS CONTAINING ELEMENTS OTHER THAN CARBON, HYDROGEN, HALOGEN, OXYGEN, NITROGEN, SULFUR, SELENIUM OR TELLURIUM
- C07F5/00—Compounds containing elements of Groups 3 or 13 of the Periodic Table
- C07F5/02—Boron compounds
- C07F5/025—Boronic and borinic acid compounds
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the invention provides a compound having a structure according to the formula:
- A is a member selected from cycloalkyl, heterocycloalkyl, aryl and heteroaryl; Y is a member selected from O and -S(O) 2 NH- wherein the sulfur in- S(O) 2 NH- is covalently attached to A; R 3 is a member selected from H, cyano and substituted alkyl; R a is a member selected from H, -OR 10 , -NR 10 R 11 , -SR 10 , -S(O)R 10 , -S(O) 2 R 10 , -S(O) 2 NR 10 R 11 , -C(O)R 10 , -C(O)OR 10 , -C(O)NR 10 R 11 , nitro, cyano, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted hetero
- the invention provides a pharmaceutical formulation comprising: a) a compound of the invention or a combination of the invention; and b) a pharmaceutically acceptable excipient.
- the invention provides a method of treating a bacterial infection comprising: administering to an animal suffering from said infection an effective amount of a compound of the invention, and an effective amount of an antibiotic, wherein said antibiotic comprises a ⁇ -lactam moiety, thereby treating the bacterial infection.
- the invention provides a method of killing or inhibiting the growth of a bacteria, said method comprising: contacting said bacteria with an effective amount of a compound of the invention or a combination of the invention, or a pharmaceutically acceptable salt thereof, thereby killing or inhibiting the growth of the bacteria.
- the invention provides a method of inhibiting a ⁇ - lactamase, comprising contacting the ⁇ -lactamase with an effective amount of a compound of the invention, thereby inhibiting the ⁇ -lactamase.
- the invention provides a method of treating a bacterial infection comprising: administering to an animal suffering from said infection an effective amount of a compound of the invention, thereby treating the bacterial infection.
- the invention provides a method of inhibiting the editing domain of a t-RNA synthetase, comprising: contacting the synthetase with an effective amount of a compound of the invention, thereby inhibiting the synthetase.
- the invention provides a use of a compound of the invention or a combination of the invention, in the manufacture of a medicament for the treatment and/or prophylaxis of bacterial infection.
- FIG. 1 displays exemplary compounds of the invention.
- FIG. 2 displays biological data for exemplary compounds of the invention.
- FIG. 3 displays biological data for exemplary compounds of the invention.
- 'ND' stands for a value that was not determined.
- Compound of the invention refers to the compounds discussed herein, salts (e.g. pharmaceutically acceptable salts), prodrugs, solvates and hydrates of these compounds.
- Combination of the invention refers to the compounds and antibiotics discussed herein as well as acids, bases, salt forms (such as pharmaceutically acceptable salts), prodrugs, solvates and hydrates of these compounds and antibiotics.
- Boon containing compounds refers to the compounds of the invention that contain boron as part of their chemical formula.
- MIC or minimum inhibitory concentration
- MIC is the point where the compound stops more than 50% of cell growth, preferably 60% of cell growth, preferably 70% of cell growth, preferably 80% of cell growth, preferably 90% of cell growth, relative to an untreated control.
- substituent groups are specified by their conventional chemical formulae, written from left to right, they equally encompass the chemically identical substituents, which would result from writing the structure from right to left, e.g., -CH 2 O- is intended to also recite -OCH 2 -.
- poly as used herein means at least 2.
- a polyvalent metal ion is a metal ion having a valency of at least 2.
- Moiety refers to a radical of a molecule that is attached to the remainder of the molecule.
- V ⁇ /V P indicates the point at which the displayed moiety is attached to the remainder of the molecule.
- alkyl by itself or as part of another substituent, means, unless otherwise stated, a straight or branched chain, or cyclic hydrocarbon radical, or combination thereof, which may be fully saturated, mono- or polyunsaturated and can include di- and multivalent radicals, having the number of carbon atoms designated (i.e. Ci-Cio means one to ten carbons).
- the term “alkyl” means a straight or branched chain, or combinations thereof, which may be fully saturated, mono- or polyunsaturated and can include di- and multivalent radicals.
- saturated hydrocarbon radicals include, but are not limited to, groups such as methyl, ethyl, n-propyl, isopropyl, n-butyl, t-butyl, isobutyl, sec-butyl, cyclohexyl, (cyclohexyl)methyl, cyclopropylmethyl, homologs and isomers of, for example, n- pentyl, n-hexyl, n-heptyl, n-octyl, and the like.
- An unsaturated alkyl group is one having one or more double bonds or triple bonds.
- unsaturated alkyl groups include, but are not limited to, vinyl, 2-propenyl, crotyl, 2-isopentenyl, 2- (butadienyl), 2,4-pentadienyl, 3-(l,4-pentadienyl), ethynyl, 1- and 3-propynyl, 3- butynyl, and the higher homologs and isomers.
- alkylene by itself or as part of another substituent means a divalent radical derived from an alkane, as exemplified, but not limited, by - CH2CH2CH2CH2-, and further includes those groups described below as “heteroalkylene.”
- an alkyl (or alkylene) group will have from 1 to 24 carbon atoms, with those groups having 10 or fewer carbon atoms being preferred in the present invention.
- a “lower alkyl” or “lower alkylene” is a shorter chain alkyl or alkylene group, generally having eight or fewer carbon atoms.
- alkoxy alkylamino and “alkylthio” (or thioalkoxy) are used in their conventional sense, and refer to those alkyl groups attached to the remainder of the molecule via an oxygen atom, an amino group, or a sulfur atom, respectively.
- heteroalkyl by itself or in combination with another term, means, unless otherwise stated, a stable straight or branched chain, or cyclic hydrocarbon radical, or combinations thereof, consisting of the stated number of carbon atoms and at least one heteroatom.
- the term “heteroalkyl,” by itself or in combination with another term means a stable straight or branched chain, or combinations thereof, consisting of the stated number of carbon atoms and at least one heteroatom.
- the heteroatoms can be selected from the group consisting of B, O, N and S, and wherein the nitrogen and sulfur atoms may optionally be oxidized and the nitrogen heteroatom may optionally be quaternized.
- the heteroatom(s) B, O, N and S may be placed at any interior position of the heteroalkyl group or at the position at which the alkyl group is attached to the remainder of the molecule.
- heteroalkylene by itself or as part of another substituent means a divalent radical derived from heteroalkyl, as exemplified, but not limited by, -CH 2 -CH 2 -S-CH 2 -CH 2 - and -CH 2 -S-CH 2 -CH 2 -NH-CH 2 -.
- heteroatoms can also occupy either or both of the chain termini (e.g., alkyleneoxy, alkylenedioxy, alkyleneamino, alkylenediamino, and the like).
- cycloalkyl and “heterocycloalkyl”, by themselves or in combination with other terms, represent, unless otherwise stated, cyclic versions of “alkyl” and “heteroalkyl”, respectively. Additionally, for heterocycloalkyl, a heteroatom can occupy the position at which the heterocycle is attached to the remainder of the molecule. Examples of cycloalkyl include, but are not limited to, cyclopentyl, cyclohexyl, 1-cyclohexenyl, 3-cyclohexenyl, cycloheptyl, and the like.
- heterocycloalkyl examples include, but are not limited to, 1 -(1,2,5,6- tetrahydropyridyl), 1-piperidinyl, 2-piperidinyl, 3-piperidinyl, 4-morpholinyl, 3- morpholinyl, tetrahydrofuran-2-yl, tetrahydrofuran-3-yl, tetrahydrothien-2-yl, tetrahydrothien-3-yl, 1 -piperazinyl, 2-piperazinyl, and the like.
- halo or halogen
- haloalkyl by themselves or as part of another substituent, mean, unless otherwise stated, a fluorine, chlorine, bromine, or iodine atom.
- terms such as “haloalkyl,” are meant to include monohaloalkyl and polyhaloalkyl.
- halo(Ci-C 4 )alkyl is mean to include, but not be limited to, trifluoromethyl, 2,2,2-trifluoroethyl, 4-chlorobutyl, 3-bromopropyl, and the like.
- aryl means, unless otherwise stated, a polyunsaturated, aromatic, substituent that can be a single ring or multiple rings (preferably from 1 to 3 rings), which are fused together or linked covalently.
- heteroaryl refers to aryl groups (or rings) that contain from one to four heteroatoms.
- the heteroatom is selected from B, N, O, and S, wherein the nitrogen and sulfur atoms are optionally oxidized, and the nitrogen atom(s) are optionally quaternized.
- a heteroaryl group can be attached to the remainder of the molecule through a heteroatom.
- Non- limiting examples of aryl and heteroaryl groups include phenyl, 1-naphthyl, 2-naphthyl, 4-biphenyl, 1-pyrrolyl, 2-pyrrolyl, 3-pyrrolyl, 3- pyrazolyl, 2-imidazolyl, 4-imidazolyl, pyrazinyl, 2-oxazolyl, 4-oxazolyl, 2-phenyl-4- oxazolyl, 5-oxazolyl, 3-isoxazolyl, 4-isoxazolyl, 5-isoxazolyl, 2-thiazolyl, 4-thiazolyl, 5-thiazolyl, 2-furyl, 3-furyl, 2-thienyl, 3-thienyl, 2-pyridyl, 3-pyridyl, 4-pyridyl, 2- pyrimidyl, 4-pyrimidyl, 5-benzothiazolyl, purinyl, 2-benzimidazolyl, 5-indolyl, 1-
- aryl when used in combination with other terms (e.g. , aryloxy, arylthioxy, arylalkyl) includes both aryl and heteroaryl rings as defined above.
- arylalkyl is meant to include those radicals in which an aryl group is attached to an alkyl group (e.g.
- benzyl, phenethyl, pyridylmethyl and the like including those alkyl groups in which a carbon atom (e.g., a methylene group) has been replaced by, for example, an oxygen atom (e.g., phenoxymethyl, 2- pyridyloxymethyl, 3-(l-naphthyloxy)propyl, and the like).
- a carbon atom e.g., a methylene group
- an oxygen atom e.g., phenoxymethyl, 2- pyridyloxymethyl, 3-(l-naphthyloxy)propyl, and the like.
- -NR""-C(NR'R") NR'", -S(O)R', -S(O) 2 R', -S(O) 2 NR 5 R", -NR"S0 2 R', -CN, -NO 2 , -N 3 , -CH(Ph) 2 , fluoro(Ci-C 4 )alkoxy, and fluoro(Ci-C 4 )alkyl, in a number ranging from zero to (2m'+l), where m' is the total number of carbon atoms in such radical.
- R', R", R'", R"" and R'" each preferably independently refer to hydrogen, substituted or unsubstituted heteroalkyl, substituted or unsubstituted aryl, e.g. , aryl substituted with 1-3 halogens, substituted or unsubstituted alkyl, alkoxy or thioalkoxy groups, or arylalkyl groups.
- each of the R groups is independently selected as are each R', R", R'", R"" and R'"" groups when more than one of these groups is present.
- R' and R" When R' and R" are attached to the same nitrogen atom, they can be combined with the nitrogen atom to form a 5-, 6-, or 7-membered ring.
- -NR'R is meant to include, but not be limited to, 1-pyrrolidinyl and 4-morpholinyl.
- alkyl is meant to include groups including carbon atoms bound to groups other than hydrogen groups, such as haloalkyl (e.g., -CF 3 and -CH 2 CF 3 ) and acyl (e.g., - C(O)CH 3 , -C(O)CF 3 , -C(O)CH 2 OCH 3 , and the like).
- haloalkyl e.g., -CF 3 and -CH 2 CF 3
- acyl e.g., - C(O)CH 3 , -C(O)CF 3 , -C(O)CH 2 OCH 3 , and the like.
- substituents for the aryl and heteroaryl groups are generically referred to as "aryl group substituents.”
- Two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally be replaced with a substituent of the formula -T-C(O)-(CRR') q -U-, wherein T and U are independently -NR-, -O-, -CRR'- or a single bond, and q is an integer of from 0 to 3.
- two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally be replaced with a substituent of the formula - A-(CH 2 ) r -B-, wherein A and B are independently -CRR'-, -O-, -NR-, -S-, -S(O)-, -S(O) 2 -, -S(O) 2 NR'- or a single bond, and r is an integer of from 1 to 4.
- One of the single bonds of the new ring so formed may optionally be replaced with a double bond.
- two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally be replaced with a substituent of the formula - (CRR')s-X-(CR"R'")d-, where s and d are independently integers of from 0 to 3, and X is -O-, -NR'-, -S-, -S(O)-, -S(O) 2 -, or -S(O) 2 NR'-.
- the substituents R, R', R" and R'" are preferably independently selected from hydrogen or substituted or unsubstituted (Ci-C6)alkyl.
- Ring means a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
- a ring includes fused ring moieties. The number of atoms in a ring is typically defined by the number of members in the ring. For example, a "5- to 7-membered ring" means there are 5 to 7 atoms in the encircling arrangement. Unless otherwise specified, the ring optionally includes a heteroatom.
- the term “5- to 7-membered ring” includes, for example phenyl, pyridinyl and piperidinyl.
- the term “ring” further includes a ring system comprising more than one "ring”, wherein each "ring” is independently defined as above.
- heteroatom includes atoms other than carbon (C) and hydrogen (H). Examples include oxygen (O), nitrogen (N) sulfur (S), silicon (Si), germanium (Ge), aluminum (Al) and boron (B).
- leaving group means a functional group or atom which can be displaced by another functional group or atom in a substitution reaction, such as a nucleophilic substitution reaction.
- representative leaving groups include triflate, chloro, bromo and iodo groups; sulfonic ester groups, such as mesylate, tosylate, brosylate, nosylate and the like; and acyloxy groups, such as acetoxy, trifluoroacetoxy and the like.
- R is a general abbreviation that represents a substituent group that is selected from substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted cycloalkyl and substituted or unsubstituted heterocycloalkyl groups.
- effective amount of a drug, formulation, or permeant is meant a sufficient amount of an active agent to provide the desired local or systemic effect.
- Topicically effective refers to the amount of drug needed to effect the desired therapeutic result.
- Topicically effective refers to a material that, when applied to the skin, nail, hair, claw or hoof produces a desired pharmacological result either locally at the place of application or systemically as a result of transdermal passage of an active ingredient in the material.
- Cosmetically effective refers to a material that, when applied to the skin, nail, hair, claw or hoof, produces a desired cosmetic result locally at the place of application of an active ingredient in the material.
- pharmaceutically acceptable salt is meant to include a salt of a compound of the invention which are prepared with relatively nontoxic acids or bases, depending on the particular substituents found on the compounds described herein.
- base addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired base, either neat or in a suitable inert solvent.
- pharmaceutically acceptable base addition salts include sodium, potassium, calcium, ammonium, organic amino, or magnesium salt, or a similar salt.
- acid addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired acid, either neat or in a suitable inert solvent.
- Examples of pharmaceutically acceptable acid addition salts include those derived from inorganic acids like hydrochloric, hydrobromic, nitric, carbonic, monohydrogencarbonic, phosphoric, monohydrogenphosphoric, dihydrogenphosphoric, sulfuric, monohydrogensulfuric, hydriodic, or phosphorous acids and the like, as well as the salts derived from relatively nontoxic organic acids like acetic, propionic, isobutyric, maleic, malonic, benzoic, succinic, suberic, fumaric, lactic, mandelic, phthalic, benzenesulfonic, p-tolylsulfonic, citric, tartaric, methanesulfonic, and the like.
- inorganic acids like hydrochloric, hydrobromic, nitric, carbonic, monohydrogencarbonic, phosphoric, monohydrogenphosphoric, dihydrogenphosphoric, sulfuric, monohydrogensulfuric, hydriodic, or phosphorous acids and
- salts of amino acids such as arginate and the like, and salts of organic acids like glucuronic or galactunoric acids and the like (see, for example, Berge et al., "Pharmaceutical Salts", Journal of Pharmaceutical Science 66: 1-19 (1977)).
- Certain specific compounds of the invention contain both basic and acidic functionalities that allow the compounds to be converted into either base or acid addition salts.
- the neutral forms of the compounds are preferably regenerated by contacting the salt with a base or acid and isolating the parent compounds in the conventional manner.
- the parent form of the compound differs from the various salt forms in certain physical properties, such as solubility in polar solvents.
- the present invention provides compounds which are in a prodrug form.
- Prodrugs of the compounds described herein readily undergo chemical changes under physiological conditions to provide the compounds of the invention. Additionally, prodrugs can be converted to the compounds of the invention by chemical or biochemical methods in an ex vivo environment.
- Certain compounds of the invention can exist in unsolvated forms as well as solvated forms, including hydrated forms. In general, the solvated forms are equivalent to unsolvated forms and are encompassed within the scope of the present invention. Certain compounds of the invention may exist in multiple crystalline or amorphous forms.
- Certain compounds of the invention possess asymmetric carbon atoms (optical centers) or double bonds; the racemates, diastereomers, geometric isomers and individual isomers are encompassed within the scope of the present invention.
- the graphic representations of racemic, ambiscalemic and scalemic or enantiomerically pure compounds used herein are taken from Maehr, J. Chem. Ed. 1985, 62: 114-120. Solid and broken wedges are used to denote the absolute configuration of a stereocenter unless otherwise noted.
- the compounds described herein contain olefinic double bonds or other centers of geometric asymmetry, and unless specified otherwise, it is intended that the compounds include both E and Z geometric isomers. Likewise, all tautomeric forms are included.
- Compounds of the invention can exist in particular geometric or stereoisomeric forms.
- the invention contemplates all such compounds, including cis- and trans -isomers, (-)- and (+)-enantiomers, (R)- and (S)-enantiomers, diastereomers, (D)-isomers, (L)-isomers, the racemic mixtures thereof, and other mixtures thereof, such as enantiomerically or diastereomerically enriched mixtures, as falling within the scope of the invention.
- Additional asymmetric carbon atoms can be present in a substituent such as an alkyl group. All such isomers, as well as mixtures thereof, are intended to be included in this invention.
- Optically active (R)- and (5)-isomers and d and / isomers can be prepared using chiral synthons or chiral reagents, or resolved using conventional techniques. If, for instance, a particular enantiomer of a compound of the present invention is desired, it can be prepared by asymmetric synthesis, or by derivatization with a chiral auxiliary, where the resulting diastereomeric mixture is separated and the auxiliary group cleaved to provide the pure desired enantiomers.
- diastereomeric salts can be formed with an appropriate optically active acid or base, followed by resolution of the diastereomers thus formed by fractional crystallization or chromatographic means known in the art, and subsequent recovery of the pure enantiomers.
- separation of enantiomers and diastereomers is frequently accomplished using chromatography employing chiral, stationary phases, optionally in combination with chemical derivatization (e.g., formation of carbamates from amines).
- the compounds of the invention may also contain unnatural proportions of atomic isotopes at one or more of the atoms that constitute such compounds.
- the compounds may be radiolabeled with radioactive isotopes, such as for example tritium ( 3 H), iodine-125 ( 125 I) or carbon-14 ( 14 C). All isotopic variations of the compounds of the invention, whether radioactive or not, are intended to be encompassed within the scope of the present invention.
- pharmaceutically acceptable carrier or “pharmaceutically acceptable vehicle” refers to any formulation or carrier medium that provides the appropriate delivery of an effective amount of an active agent as defined herein, does not interfere with the effectiveness of the biological activity of the active agent, and that is sufficiently non-toxic to the host or patient.
- Representative carriers include water, oils, both vegetable and mineral, cream bases, lotion bases, ointment bases and the like. These bases include suspending agents, thickeners, penetration enhancers, and the like. Their formulation is well known to those in the art of cosmetics and topical pharmaceuticals. Additional information concerning carriers can be found in Remington: The Science and Practice of Pharmacy, 21st Ed., Lippincott, Williams & Wilkins (2005) which is incorporated herein by reference.
- “Pharmaceutically acceptable topical carrier” and equivalent terms refer to pharmaceutically acceptable carriers, as described herein above, suitable for topical application.
- An inactive liquid or cream vehicle capable of suspending or dissolving the active agent(s), and having the properties of being nontoxic and non-inflammatory when applied to the skin, nail, hair, claw or hoof is an example of a pharmaceutically- acceptable topical carrier. This term is specifically intended to encompass carrier materials approved for use in topical cosmetics as well.
- compositions refers to preservatives, antioxidants, fragrances, emulsif ⁇ ers, dyes and excipients known or used in the field of drug formulation and that do not unduly interfere with the effectiveness of the biological activity of the active agent, and that is sufficiently non-toxic to the host or patient.
- Additives for topical formulations are well-known in the art, and may be added to the topical composition, as long as they are pharmaceutically acceptable and not deleterious to the epithelial cells or their function. Further, they should not cause deterioration in the stability of the composition.
- inert fillers for example, inert fillers, anti- irritants, tackifiers, excipients, fragrances, opacifiers, antioxidants, gelling agents, stabilizers, surfactant, emollients, coloring agents, preservatives, buffering agents, other permeation enhancers, and other conventional components of topical or transdermal delivery formulations as are known in the art.
- the terms "enhancement,” “penetration enhancement” or “permeation enhancement” relate to an increase in the permeability of the skin, nail, hair, claw or hoof to a drug, so as to increase the rate at which the drug permeates through the skin, nail, hair, claw or hoof.
- the enhanced permeation effected through the use of such enhancers can be observed, for example, by measuring the rate of diffusion of the drug through animal skin, nail, hair, claw or hoof using a diffusion cell apparatus.
- a diffusion cell is described by Merritt et al. Diffusion Apparatus for Skin Penetration, J of Controlled Release, 1 (1984) pp. 161-162.
- the term "permeation enhancer” or “penetration enhancer” intends an agent or a mixture of agents, which, alone or in combination, act to increase the permeability of the skin, nail, hair or hoof to a drug.
- excipients is conventionally known to mean carriers, diluents and/or vehicles used in formulating drug compositions effective for the desired use.
- Topical administration refers to the application of a pharmaceutical agent to the external surface of the skin, nail, hair, claw or hoof, such that the agent crosses the external surface of the skin, nail, hair, claw or hoof and enters the underlying tissues.
- Topical administration includes application of the composition to intact skin, nail, hair, claw or hoof, or to a broken, raw or open wound of skin, nail, hair, claw or hoof.
- Topical administration of a pharmaceutical agent can result in a limited distribution of the agent to the skin and surrounding tissues or, when the agent is removed from the treatment area by the bloodstream, can result in systemic distribution of the agent.
- Transdermal delivery refers to the diffusion of an agent across the barrier of the skin, nail, hair, claw or hoof resulting from topical administration or other application of a composition.
- stratum corneum acts as a barrier and few pharmaceutical agents are able to penetrate intact skin.
- the epidermis and dermis are permeable to many solutes and absorption of drugs therefore occurs more readily through skin, nail, hair, claw or hoof that is abraded or otherwise stripped of the stratum corneum to expose the epidermis.
- Transdermal delivery includes injection or other delivery through any portion of the skin, nail, hair, claw or hoof or mucous membrane and absorption or permeation through the remaining portion.
- Absorption through intact skin, nail, hair, claw or hoof can be enhanced by placing the active agent in an appropriate pharmaceutically acceptable vehicle before application to the skin, nail, hair, claw or hoof.
- Passive topical administration may consist of applying the active agent directly to the treatment site in combination with emollients or penetration enhancers.
- transdermal delivery is intended to include delivery by permeation through or past the integument, i.e. skin, nail, hair, claw or hoof.
- an "effective amount” of one active of the combination is the amount of that active that is effective to provide the desired effect when used in combination with the other active of the combination.
- the amount that is “effective” will vary from subject to subject, depending on the age and general condition of the individual, the particular active agent or agents, and the appropriate “effective” amount in any individual case may be determined by one of ordinary skill in the art using routine experimentation.
- active ingredient means a chemical entity which can be effective in treating a targeted disorder, disease or condition.
- phrases "pharmaceutically acceptable” means moieties or compounds that are, within the scope of medical judgment, suitable for use in humans without causing undesirable biological effects such as undue toxicity, irritation, allergic response, and the like, for example.
- oral dosage form means any pharmaceutical composition administered to a subject via the oral cavity.
- exemplary oral dosage forms include tablets, capsules, films, powders, sachets, granules, solutions, solids, suspensions or as more than one distinct unit (e.g., granules, tablets, and/or capsules containing different actives) packaged together for co-administration, and other formulations known in the art.
- An oral dosage form can be one, two, three, four, five or six units. When the oral dosage form has multiple units, all of the units are contained within a single package, (e.g. a bottle or other form of packaging such as a blister pack).
- the oral dosage form When the oral dosage form is a single unit, it may or may not be in a single package. In a preferred embodiment, the oral dosage form is one, two or three units. In a particularly preferred embodiment, the oral dosage form is one unit.
- the dosage form includes a compound of the invention in one capsule. This is a single unit. In some embodiments, the dosage form includes a compound of the invention as part of a therapeutically effective dosage of a cream or ointment. This is also a single unit. In some embodiments, the dosage form includes a compound of the invention and another active ingredient contained within one capsule, or as part of a therapeutically effective dosage of a cream or ointment. This is a single unit, whether or not the interior of the capsule includes multiple discrete granules of the active ingredient.
- the dosage form includes a compound of the invention in one capsule, and the active ingredient in a second capsule.
- This is a two unit dosage form, such as two capsules or tablets, and so such units are contained in a single package.
- the term 'unit' refers to the object which is administered to the animal, not to the interior components of the object.
- prodrug is a derivative of a parent drug molecule that exerts its pharmacological effect only after chemical and/or enzymatic conversion to its active form in vivo.
- Prodrugs include those designed to circumvent problems associated with delivery of the parent drug. This may be due to poor physicochemical properties, such as poor chemical stability or low aqueous solubility, and may also be due to poor pharmacokinetic properties, such as poor bioavailability or poor half- life. Thus, certain advantages of prodrugs may include improved chemical stability, absorption, and/or PK properties of the parent carboxylic acids.
- Prodrugs may also be used to make drugs more "patient friendly,” by minimizing the frequency (e.g., once daily) or route of dosing (e.g., oral), or to improve the taste or odor if given orally, or to minimize pain if given parenterally .
- the prodrugs are chemically more stable than the active drug, thereby improving formulation and delivery of the parent drug, compared to the drug alone.
- Prodrugs for carboxylic acid analogs of the invention may include a variety of esters.
- the pharmaceutical compositions of the invention include a carboxylic acid ester.
- the prodrug is suitable for treatment /prevention of those diseases and conditions that require the drug molecule to cross the blood brain barrier.
- the prodrug enters the brain, where it is converted into the active form of the drug molecule.
- a prodrug is used to enable an active drug molecule to reach the inside of the eye after topical application of the prodrug to the eye.
- a prodrug can be converted to its parent compound by chemical or biochemical methods in an ex vivo environment.
- a prodrug can be slowly converted to its parent compound when placed in a transdermal patch reservoir with a suitable enzyme or chemical reagent.
- Antibiotic as used herein, is a compound which can kill or inhibit the growth of bacteria.
- the term antibiotic is broad enough to encompass acids, bases, salt forms (such as pharmaceutically acceptable salts), prodrugs, solvates and hydrates of the antibiotic compound.
- microbial infection or "infection by a microorganism” refers to any infection of a host by an infectious agent including, but not limited to, viruses, bacteria, mycobacteria, fungus and parasites (see, e.g., Harrison's Principles of Internal Medicine, pp. 93-98 (Wilson et al., eds., 12th ed. 1991); Williams et al, J. of Medicinal Chem. 42:1481-1485 (1999), herein each incorporated by reference in their entirety).
- Biological medium refers to both in vitro and in vivo biological milieus. Exemplary in vitro "biological media” include, but are not limited to, cell culture, tissue culture, homogenates, plasma and blood. In vivo applications are generally performed in mammals, preferably humans.
- Inhibiting and blocking are used interchangeably herein to refer to the partial or full blockade of an enzyme, such as a ⁇ -lactamase or a LeuRS.
- the term "leaving group” means a functional group or atom which can be displaced by another functional group or atom in a substitution reaction, such as a nucleophilic substitution reaction.
- representative leaving groups include triflate, chloro, bromo and iodo groups; sulfonic ester groups, such as mesylate, tosylate, brosylate, nosylate and the like; and acyloxy groups, such as acetoxy, trifluoroacetoxy and the like.
- amino-protecting group means a protecting group suitable for preventing undesired reactions at an amino nitrogen.
- Representative amino-protecting groups include, but are not limited to, formyl; acyl groups, for example alkanoyl groups, such as acetyl, trichloroacetyl or trifluoroacetyl; alkoxycarbonyl groups, such as tert-butoxycarbonyl (Boc); arylmethoxycarbonyl groups, such as benzyloxycarbonyl (Cbz) and 9-fluorenylmethoxycarbonyl (Fmoc); arylmethyl groups, such as benzyl (Bn), trityl (Tr), and l,l-di-(4'-methoxyphenyl)methyl; silyl groups, such as trimethylsilyl (TMS) and tert-butyldimethylsilyl (TBS); and the like.
- alkanoyl groups such as acetyl, trichloroacetyl or trifluoroacetyl
- hydroxy-protecting group means a protecting group suitable for preventing undesired reactions at a hydroxy group.
- Representative hydroxy- protecting groups include, but are not limited to, alkyl groups, such as methyl, ethyl, and tert-butyl; acyl groups, for example alkanoyl groups, such as acetyl; arylmethyl groups, such as benzyl (Bn), p-methoxybenzyl (PMB), 9-fluorenylmethyl (Fm), and diphenylmethyl (benzhydryl, DPM); silyl groups, such as trimethylsilyl (TMS) and tert-butyldimethylsilyl (TBS); and the like.
- alkyl groups such as methyl, ethyl, and tert-butyl
- acyl groups for example alkanoyl groups, such as acetyl
- arylmethyl groups such as benzyl (Bn), p-methoxy
- Dative bonds are usually weaker than covalent bonds.
- a boron is covalently bonded to at least one oxygen, sulfur or nitrogen, and is at the same time datively bonded to an oxygen, sulfur or nitrogen, respectively, the dative bond and covalent bond between the boron and the two identical heteroatoms can interconvert or be in the form of a resonance hybrid.
- the structures supplied are not intended to include any and all possible bonding scenarios between boron and the atom to which it is bound. Non limiting examples of these bonds are as follows:
- Salt counterion refers to positively charged ions that associate with a compound of the invention when the boron is fully negatively or partially negatively charged.
- salt counterions include H + , H 3 O + , ammonium, potassium, calcium, magnesium and sodium.
- the compounds comprising a boron bonded to a carbon and three heteroatoms (such as three oxygens described in this section) can optionally contain a fully negatively charged boron or partially negatively charged boron, due to the nature of the dative bond between the boron and one of the oxygens. Due to the negative charge, a positively charged counterion may associate with this compound, thus forming a salt.
- positively charged counterions include H + , H 3 O + , calcium, sodium, ammonium, potassium. The salts of these compounds are implicitly contained in descriptions of these compounds.
- the present invention also encompasses compounds that are poly- or multi-valent species, including, for example, species such as dimers, trimers, tetramers and higher homo logs of the compounds of use in the invention or reactive analogues thereof.
- dimers of oxaboroles can form under the following conditions:
- the present invention also encompasses compounds that are anhydrides of the cyclic boronic esters are synthesized by subjecting these compounds to dehydrating conditions. Examples of these anhydrides are provided below:
- trimers of the compounds of the invention are also produced.
- trimers of acyclic boronic esters can be formed as follows:
- trimers of acyclic boronic esters can be formed as follows:
- Also of use in the present invention are compounds that are poly- or multivalent species, including, for example, species such as dimers, trimers, tetramers and higher homo logs of the compounds of use in the invention or reactive analogues thereof.
- the poly- and multi-valent species can be assembled from a single species or more than one species of the invention.
- a dimeric construct can be "homo-dimeric" or "heterodimeric.”
- poly- and multi-valent constructs in which a compound of the invention or a reactive analogue thereof, is attached to an oligomeric or polymeric framework e.g., polylysine, dextran, hydroxyethyl starch and the like
- the framework is preferably polyfunctional (i.e. having an array of reactive sites for attaching compounds of use in the invention).
- the framework can be derivatized with a single species of the invention or more than one species of the invention.
- the present invention includes the use of compounds within the motif set forth in the formulae contained herein, which are functionalized to afford compounds having water-solubility that is enhanced relative to analogous compounds that are not similarly functionalized.
- any of the substituents set forth herein can be replaced with analogous radicals that have enhanced water solubility.
- additional water solubility is imparted by substitution at a site not essential for the activity towards the editing domain of the compounds set forth herein with a moiety that enhances the water solubility of the parent compounds.
- Methods of enhancing the water- solubility of organic compounds are known in the art. Such methods include, but are not limited to, functionalizing an organic nucleus with a permanently charged moiety, e.g., quaternary ammonium, or a group that is charged at a physiologically relevant pH, e.g. carboxylic acid, amine.
- Other methods include, appending to the organic nucleus hydroxyl- or amine- containing groups, e.g. alcohols, polyols, polyethers, and the like.
- Representative examples include, but are not limited to, polylysine, polyethyleneimine, poly(ethyleneglycol) and poly(propyleneglycol).
- Suitable functionalization chemistries and strategies for these compounds are known in the art. See, for example, Dunn, R. L., et al, Eds. POLYMERIC DRUGS AND DRUG DELIVERY SYSTEMS, ACS Symposium Series Vol. 469, American Chemical Society, Washington, D.C. 1991.
- the present invention provides novel boron compounds and methods for the preparation of these molecules.
- the invention further provides methods of treating bacterial infections, killing or inhibiting the growth of bacteria, and/or inhibiting ⁇ - lactamase in part or wholly through the use of the compounds described herein.
- the invention further provides methods of treating anti-inflammatory conditions and inhibiting biomolecules that are implicated with anti-inflammatory conditions in part or wholly through the use of the compounds described herein.
- the invention is a combination of a compound of the invention and an antibiotic.
- the invention is a pharmaceutical formulation comprising a pharmaceutically acceptable excipient and a compound of the invention.
- the invention is a pharmaceutical formulation comprising a compound of the invention, an antibiotic, and a pharmaceutically acceptable excipient.
- the invention provides a compound of the invention.
- the invention provides a compound described herein, or a salt thereof.
- the salt of a compound described herein is a pharmaceutically acceptable salt.
- the invention provides a compound described herein, or a pharmaceutically acceptable salt thereof.
- the invention provides a compound described in a formula provided herein.
- the invention provides a compound described herein.
- the invention provides a compound having a structure according to the formula:
- R* is a member selected from H, a negative charge and a positively charged counterion.
- A is a member selected from substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heteroaryl.
- Y is a member selected from O, S, unsubstituted C 1 -C 4 alkyl and -S(O) 2 NH-, wherein the sulfur in the -S(O) 2 NH- is covalently attached to the A ring.
- R is a member selected from H, cyano and substituted or unsubstituted alkyl.
- R a is a member selected from H, OR 10 , NR 10 R 11 , SR 10 , -S(O)R 10 , -S(O) 2 R 10 , -S(O) 2 NR 10 R 11 , -C(O)R 10 , -C(O)OR 10 , -C(O)NR 10 R 11 , nitro, cyano, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl, each R 10 and each R 11 is a member independently selected from H, nitro, halogen, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted
- R 10 and R 11 are optionally combined to form a 5- to 7-membered substituted or unsubstituted heterocycloalkyl ring.
- R 3 is H
- R a is not H or unsubstituted alkyl or halosubstituted alkyl.
- R 3 is a member selected from cyano and substituted alkyl.
- the invention provides a compound having a structure according to the formula:
- A is a member selected from cycloalkyl, heterocycloalkyl, aryl and heteroaryl; Y is a member selected from O and -S(O) 2 NH- wherein the sulfur in -S(O) 2 NH- is covalently attached to A; R 3 is a member selected from H, cyano and substituted alkyl; R a is a member selected from H, -OR 10 , -NR 10 R 11 , -SR 10 , -S(O)R 10 , -S(O) 2 R 10 , -S(O) 2 NR 10 R 11 , -C(O)R 10 , -C(O)OR 10 , -C(O)NR 10 R 11 , nitro, cyano, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted
- the compound has a structure according to the following formula:
- R b is halogen, or salts thereof.
- R b is F.
- R b is Cl.
- R b is Br.
- the compound has a structure according to the following formula:
- R c is hydroxyalkyl, or salts thereof.
- R c is
- ml is 1 or 2 or 3 or 4 or 5 or 6.
- ml is 1 or 2 or 3.
- R c is -CH 2 OH.
- the compound has a structure according to the following formula: wherein R d is aminoalkyl, or salts thereof.
- R d is -(CR 12 R 13 ) n NR 14 R 15 in which n is a member selected from 1 to 10; each R 12 and each R 13 is a member independently selected from H, OR 16 , NR 16 R 17 , SR 16 , -S(O)R 16 , -S(O) 2 R 16 , -S(O) 2 NR 16 R 17 , -C(O)R 17 , -C(O)OR 17 , -C(O)NR 16 R 17 , nitro, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl
- R 14 and R 15 are members independently selected from H, OR 18 , NR 18 R 19 , SR 18 , -S(O)R 18 , -S(O) 2 R 18 , -S(O) 2 NR 18 R 19 , -C(O)R 19 , -C(O)OR 19 , -C(O)NR 18 R 19 , nitro, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
- Each R 16 , each R 17 , each R 18 and each R 19 is a member independently selected from H, nitro, halogen, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
- R d is -(CR 12 R 13 ) n NH 2 , wherein n is 1 or 2 or 3 or 4 or 5 or 6, wherein R 12 and R 13 are as described herein.
- R d is -(CH 2 ) J1 NR 14 R 15 .
- R d is - CH 2 NR 14 R 15 .
- R d is -CH 2 NH 2 .
- the compound has a structure according to the following formula:
- R e is -C(O)OR 10 , or salts thereof, wherein R 10 is H or substituted or unsubstituted alkyl.
- R e is -C(O)OR 10 , wherein R 10 is unsubstituted Ci or C 2 or C 3 or C 4 or C 5 or C 6 alkyl.
- R 10 is unsubstituted Ci or C 2 or C 3 alkyl.
- R e is -COOH or -COOCH3 or -COOCH 2 CH 3 or -COOC(CH 3 ) 3 .
- the compound has a structure according to the following formula:
- R is H or substituted or unsubstituted alkyl, or salts thereof.
- R is H.
- R is unsubstituted Ci or C 2 or C 3 or C 4 or C 5 or C 6 alkyl.
- R f is methyl.
- R f is phenylsubstituted alkyl.
- R f is phenyl substituted Ci or C 2 or C3 or C 4 or C5 or C 6 alkyl.
- R f is phenylmethyl.
- the compound has a structure according to the following formula:
- R g and R is independently selected from H or substituted or unsubstituted alkyl, or salts thereof.
- R g is H.
- R h is H.
- R g is H and R h is H.
- R g is unsubstituted alkyl, and R h is as described herein.
- the compound has a structure according to the following formula:
- R 1 is cyano, or salts thereof.
- the compound has a structure according to the following formula: wherein R k is aminoalkyl, or a salts thereof.
- R k is -(CH 2 )IiIiNH 2 , wherein ml is 1 or 2 or 3 or 4 or 5 or 6.
- ml is 1 or 2 or 3.
- R k is -CH 2 NH 2 .
- the compound has a structure according to the following formula:
- R m is -C(O)OR 10 , or salts thereof, wherein R 10 is H or substituted or unsubstituted alkyl.
- R m is -C(O)OR 10 , wherein R 10 is unsubstituted Ci or C 2 or C 3 or C 4 or C 5 or C 6 alkyl.
- R 10 is unsubstituted Ci or C 2 or C 3 alkyl.
- R m is -COOH or -COOCH3 or -COOCH 2 CH 3 or -COOC(CH 3 ) 3 .
- the compound has a structure according to the following formula:
- R n is -C(O)NR 11 R 12 , or salts thereof, wherein each R 11 or R 12 is a member selected from H or substituted or unsubstituted alkyl.
- R 11 is H.
- R n is -C(O)NH 2 .
- the compound has a structure according to the following formula:
- R 0 is H or -C(O)OR 10 , or salts thereof, wherein R 10 is H or substituted or unsubstituted alkyl.
- R 0 is -C(O)OR 10 , wherein R 10 is unsubstituted Ci or C 2 or C3 or C 4 or C5 or C 6 alkyl.
- R 10 is unsubstituted Ci or C 2 or C 3 alkyl.
- R 0 is H or -COOH or -COOCH 3 or -COOCH 2 CH 3 or -COOC(CH 3 ) 3 .
- the compound has a structure according to the following formula:
- R p is H or -C(O)OR 10 , or salts thereof, wherein R 10 is H or substituted or unsubstituted alkyl.
- R p is -C(O)OR 10 , wherein R 10 is unsubstituted Ci or C 2 or C 3 or C 4 or C 5 or C 6 alkyl.
- R 10 is unsubstituted Ci or C 2 or C 3 alkyl.
- R p is H or -COOH or -COOCH 3 or -COOCH 2 CH 3 or -COOC(CH 3 ) 3 .
- the compound has a structure according to the following formula:
- R q is H or -C(O)OR , or salts thereof, wherein R is H or substituted or unsubstituted alkyl.
- R q is -C(O)OR 10 , wherein R 10 is unsubstituted Ci or C 2 or C 3 or C 4 or C 5 or C 6 alkyl.
- R 10 is unsubstituted Ci or C 2 or C 3 alkyl.
- R q is H or -COOH or -COOCH 3 or -COOCH 2 CH 3 or -COOC(CH 3 ) 3 .
- the compound is H or -COOH or -COOCH 3 or -COOCH 2 CH 3 or -COOC(CH 3 ) 3 .
- the compound is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N
- the compound is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N
- R r is H or -C(O)OR 10 , or salts thereof, wherein R 10 is H or substituted or unsubstituted alkyl.
- R r is -C(O)OR 10 , wherein R 10 is unsubstituted Ci or C 2 or C3 or C 4 or C5 or C 6 alkyl.
- R 10 is unsubstituted Ci or C 2 or C 3 alkyl.
- R r is H or -COOH or -COOCH 3 or -COOCH 2 CH 3 or -COOC(CH 3 ) 3 .
- the compound has a structure according to the formula:
- R a and A are as described herein, and R is a member selected from cyano and substituted or unsubstituted alkyl.
- the compound has a structure according to the formula:
- m is an integer which is 1 or 2 or 3 or 4 or 5 or 6 and R 3a is a member selected from -C(O)OR 20 or -C(O)NR 20 R 21 or -OR 20 or nitro or -S(O) 2 R 22 or -S(O) 2 OR 20 or -S(O) 2 NR 20 R 21 or -P(O)(OR 20 )(OR 20 ) wherein each R 20 is independently selected from H or unsubstituted alkyl, R 21 is selected from H or - S(O) 2 R 23 ; R 23 is unsubstituted alkyl.
- m is 1 or 2 or 3. In an exemplary embodiment, m is 1.
- the compound has a structure according to the formula:
- R 21 is selected from H or -S(O) 2 R 23 , R 22 is unsubstituted alkyl and R 23 is unsubstituted alkyl.
- the compound has a structure according to the formula:
- m is an integer selected from 1 or 2 or 3 or 4 or 5 or 6 and R 20 is selected from H or unsubstituted alkyl.
- m is 1 or 2 or 3.
- m is 1.
- the compound has a structure according to the formula:
- the compound has a structure according to the formula:
- the compound has a structure according to the formula:
- R a , A, Y, m, R 21 and R 22 are as described herein.
- the compound has a structure according to the formula:
- R a , A, Y, m and each R 20 are as described herein.
- the compound has a structure according to the formula:
- R a is a member selected from H, halogen, substituted or unsubstituted alkyl, OR 10 , NR 10 R 11 , wherein R 10 and each R 11 is a member independently selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
- R a is a member selected from H, F, Cl, -OR 20a and -C(O)OR 20b , wherein R 20a is alkyl, optionally substituted with a member selected from NH 2 and phenyl, and wherein R 20b is unsubstituted alkyl.
- R a is F or Cl.
- R a is OH.
- R a is NH 2 .
- R a is -O(CH 2 ) n Ph or -(CH 2 ) n NH(CH2) n i0(CH2) n2 CH 3 or -(CH 2 ) n X 5 or -O(CH 2 ) n NH 2 or -NH(CH 2 ) n Ph or -C(O)OR 10 , wherein n is 1 or 2 or 3 or 4 or 5 or 6, nl is 1 or 2 or 3 or 4 or 5 or 6, n2 is 0 or 1 or 2 or 3 or 4 or 5 or 6, R 1Oa is unsubstituted alkyl, and X 5 is unsubstituted morpholinyl or piperazinyl.
- n is 1 or 2 or 3, or nl is 1 or 2 or 3, or n2 is 0 or 1 or 2 or 3.
- R a is -C(O)OR 10a and R 1Oa is methyl or ethyl or propyl or isopropyl or tert-butyl.
- R a is -CH 2 NH(CH 2 ) 2 OCH 3 or -CH 2 X 5 or -O(CH 2 ) 3 NH 2 or -OCH 2 Ph or -NHCH 2 Ph.
- R a is
- the compound has a structure according to the formula:
- R 3a is a member selected from -C(O)OR 20 or -C(O)NR 20 R 21 or -OR 20 or nitro or -S(O) 2 R 22 or -S(O) 2 OR 20 or -S(O) 2 NR 20 R 21 or -P(O)(OR 20 )(OR 20 ) wherein each R 20 is independently selected from H or unsubstituted alkyl, R 21 is independently selected from H or -S(O) 2 R 22 , and R 22 is unsubstituted alkyl.
- the compound has a structure according to the formula:
- R 3a is a member selected from -C(O)OR 20 or -C(O)NR 20 R 21 or -OR 20 or nitro or -S(O) 2 R 22 or -S(O) 2 OR 20 or -S(O) 2 NR 20 R 21 or -P(O)(OR 20 )(OR 20 ) wherein each R 20 is independently selected from H or unsubstituted alkyl, R 21 is independently selected from H or -S(O) 2 R 22 ; and R 22 is unsubstituted alkyl.
- the compound has a structure according to the formula:
- m is an integer which is 1 or 2 or 3 or 4 or 5 or 6 and R 20 is H or unsubstituted alkyl.
- m is 1 or 2 or 3.
- R 20 is H.
- R 20 is unsubstituted Ci or C 2 or C 3 or C 4 or C 5 or C 6 alkyl.
- R 20 is methyl or ethyl or t- butyl.
- m is 1 or 2 or 3.
- m is 1.
- the compound has a structure according to the formula:
- m is an integer which is 1 or 2 or 3 or 4 or 5 or 6 and R 20 is H or unsubstituted alkyl.
- m is 1 or 2 or 3.
- R 20 is H.
- R 20 is unsubstituted Ci or C 2 or C 3 .
- the compound has a structure according to the formula:
- the compound has a structure according to the formula:
- R a , A, Y and R 20 are as defined herein.
- the compound has a structure according to the formula:
- R 20 is H.
- R 20 is unsubstituted Ci or C 2 or C3 or C 4 or C5 or C 6 alkyl.
- R 20 is methyl or ethyl or t-butyl.
- m is 1 or 2 or 3. In an exemplary embodiment, m is 1.
- the compound has a structure according to the formula:
- R a , Y and R 20 are as defined herein.
- the compound has a structure according to the formula:
- the compound has a structure according to the formula:
- R a and R 20 are as defined herein.
- the compound has a structure according to the formula:
- R ,20 wherein R 20 is as defined herein, and n5 is an integer selected from 1 or 2 or 3 or 4 or 5 or 6.
- n5 is an integer selected from 1 or 2 or 3 or 4 or 5 or 6.
- the compound has a structure according to the formula:
- the compound has a structure according to the formula:
- R ,20 wherein R 20 is as defined herein.
- R 20 is H.
- the compound is E38 or a salt thereof.
- the compound is E38 or a pharmaceutically acceptable salt thereof.
- the compound is E50 or a salt thereof.
- the compound is E50 or a pharmaceutically acceptable salt thereof.
- the compound has a structure according to the formula: wherein A 1 is H or unsubstituted alkyl, and R 3 is a member selected from cyano and substituted or unsubstituted alkyl.
- a 1 is H.
- a 1 is methyl.
- a 1 is ethyl. In an exemplary embodiment, A 1 is C 3 alkyl. In an exemplary embodiment, A 1 is C 4 alkyl. In an exemplary embodiment, A 1 is C 5 alkyl. In an exemplary embodiment, A 1 is C 6 alkyl.
- the compound has a structure according to the formula:
- a 1 is H or unsubstituted alkyl
- m is an integer which is 1 or 2 or 3 or 4 or 5 or
- R 6 and R 3a is a member selected from -C(O)OR 20 or -C(O)NR 20 R 21 or -OR 20 or nitro or -S(O) 2 R 22 or -S(O) 2 OR 20 or -S(O) 2 NR 20 R 21 or -P(O)(OR 20 )(OR 20 ) wherein each R 20 is independently selected from H or unsubstituted alkyl, R 21 is selected from H or -S(O) 2 R 23 ; R 23 is unsubstituted alkyl.
- m is 1 or 2 or 3.
- m is 1.
- a 1 is H.
- a 1 is methyl.
- a 1 is ethyl. In an exemplary embodiment, A 1 is C 3 alkyl. In an exemplary embodiment, A 1 is C 4 alkyl. In an exemplary embodiment, A 1 is C 5 alkyl. In an exemplary embodiment, A 1 is C 6 alkyl.
- the compound has a structure according to the formula:
- a 1 is H or unsubstituted alkyl
- m is an integer which is 1 or 2 or 3 or 4 or 5 or 6 and R 20 is H or unsubstituted alkyl.
- m is 1 or 2 or 3.
- m is 1.
- R 20 is H.
- R 20 is unsubstituted Ci or C 2 or C3 or C 4 or C5 or C 6 alkyl.
- R 20 is methyl or ethyl or t-butyl.
- a 1 is H.
- a 1 is methyl.
- a 1 is ethyl.
- a 1 is C 3 alkyl.
- a 1 is C 4 alkyl.
- a 1 is C 5 alkyl.
- a 1 is C 6 alkyl.
- the compound has a structure according to the formula:
- R 20 is H. In an exemplary embodiment, R 20 is methyl. In an exemplary embodiment, R 20 is ethyl. In an exemplary embodiment, A 1 is H. In an exemplary embodiment, A 1 is methyl. In an exemplary embodiment, A 1 is ethyl.
- the compound has a structure according to the formula:
- a 1 , m and R 20 are as defined herein.
- the compound has a structure according to the formula:
- R 20 is H. In an exemplary embodiment, R 20 is methyl. In an exemplary embodiment, R 20 is ethyl. In an exemplary embodiment, A 1 is H. In an exemplary embodiment, A 1 is methyl. In an exemplary embodiment, A 1 is ethyl. [0130] In another aspect, the invention provides a compound having a structure according to the formula:
- R* is a member selected from H and a negative charge
- A is a member selected from phenyl and pyridinyl
- R 3 is a member selected from H, cyano, substituted or unsubstituted nitroalkyl and substituted or unsubstituted aminoalkyl
- R a is a member selected from R 10 , OR 10 , NR 10 R 11 , SR 10 , -S(O)R 10 , -S(O) 2 R 10 , - S(O) 2 NR 10 R 11 , -C(O)R 10 , -C(O)OR 10 , -C(O)NR 10 R 11 , wherein each R 10 and each R 11 is a member independently selected from H, nitro, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted hetero
- the invention provides a compound having a structure according to the formula:
- R* is a member selected from H and a negative charge
- A is a member selected from phenyl and pyridinyl
- R 3 is a member selected from H, cyano, substituted or unsubstituted nitroalkyl and substituted or unsubstituted aminoalkyl
- R a is a member selected from R 12 , OR 10 , NR 10 R 11 , SR 10 , -S(O)R 10 , -S(O) 2 R 10 , -
- each R 10 and each R 11 is a member independently selected from H, nitro, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl, and wherein R 12 is a member selected from nitro, cyano, alkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, aryl and heteroaryl wherein said alkyl is substituted by one or more groups selected from OR 13 , NR 13 R 14 , SR 13 , -S(O)R 13 , -S(O) 2 R 13
- each R 15 and each R 16 is a member independently selected from H, nitro, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
- R a is a member selected from -Y 1 R 5 , -CN, -R 4 Y 2 , -C(O)OR 6 , -NH 2 and OH.
- Y 1 is a member selected from O and S.
- Y 2 is a member selected from NH 2 and OH.
- R 4 is a member selected from substituted or unsubstituted alkylene and substituted or unsubstituted heteroalkylene.
- R 5 is a member selected from H, substituted or unsubstituted alkyl.
- R 6 is a member selected from H, substituted or unsubstituted alkyl and substituted or unsubstituted heteroalkyl.
- the invention has a structure according to the formula:
- the compound has a structure according to the following formula:
- the invention has a structure according to the following formula: wherein C* is a carbon atom, with the proviso that when R is not H, C* is a stereocenter which has a configuration which is a member selected from (R) and (S).
- the invention has a structure according to the following formula:
- C* is a carbon atom, with the proviso that when R is not H, C* is a stereocenter which has a configuration which is a member selected from (R) and (S).
- the compound has a structure according to the following formula:
- R a is a member selected from -NH 2 , -CN, -OR 5 , -COOR 5 , -R 4 NH 2 and -R 4 OH, wherein R 4 is unsubstituted alkylene and R 5 is substituted or unsubstituted alkyl.
- R is H
- R a is a member selected from -NH 2 , -NO 2 , -CN, -OCH 3 , -OCF 3 , -COOH, -CH 2 NH 2 and -CH 2 OH.
- the compound is a member selected from
- R 3 is-(CR 20 R 21 ⁇ NR 22 R 23 in which the index n is an integer selected from 1 to 10; each R 20 and each R 21 is a member independently selected from H, R 26 ,OR 26 , NR 26 R 27 , SR 26 , -S(O)R 26 , -S(O) 2 R 26 , - S(O) 2 NR 26 R 27 , -C(O)R 27 , -C(O)OR 27 , -C(O)NR 26 R 27 ; R 22 and R 23 are members independently selected from H, -S(O)R 28 , -S(O) 2 R 28 , -S(O) 2 NR 28 R 29 , -C(O)R 28 , - C(O)OR 28 , -C(O)NR 28 R 29 , nitro, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl
- n is an integer selected from 1 to 5. In an exemplary embodiment, n is 1.
- R 20 is substituted or unsubstituted alkyl. In an exemplary embodiment, R 20 is unsubstituted alkyl. In an exemplary embodiment, R 20 is C 1 -C 4 unsubstituted alkyl. In an exemplary embodiment, R 20 is methyl.
- R 21 is H. In an exemplary embodiment, R 23 is H.
- R 3 is a member selected from cyano and -CH 2 NO 2 .
- R 22 is a member selected from -C(O)R 28 and -C(O)OR 28 .
- R 28 is a member selected from substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl and substituted or unsubstituted aryl.
- R 28 is a member selected from -(CR 30 R 31 ⁇ R 32 , wherein R 32 is a member selected from substituted or unsubstituted aryl, -NR 33 R 34 and OR 33 , wherein the index m is an integer selected from O to 10; each R 33 and each R 34 is a member independently selected from H, nitro, halogen, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
- R 28 is a member selected from substituted or unsubstituted alky
- the compound is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N
- R* is as described herein.
- the compound is a member selected from
- R* is as described herein.
- the compound is a member selected from
- R* is as described herein.
- the compound is a member selected from
- R* is as described herein.
- the compound is a member selected from wherein R* is as described herein.
- the compound is a member selected from
- R* is as described herein.
- the compound is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N
- R* is as described herein.
- the compound is a member selected from
- R* is as described herein.
- the compound is a member selected from
- R* is as described herein.
- the compound is a member selected from
- R* is as described herein.
- the compound is a member selected from
- R* is as described herein.
- the compound is a member selected from
- R* is as described herein.
- R* is H.
- the C* stereocenter is in a configuration which is a member selected from (R) and (S).
- the C* stereocenter is in a (S) configuration.
- the C* stereocenter is in a (S) configuration and R is -CH 2 NH 2 .
- the compound has a structure according to the formula:
- the compound has a structure according to the formula:
- R a is as described herein, with the proviso that R a is not H or unsubstituted alkyl or halosubstituted alkyl, and A is substituted phenyl or substituted pyridinyl or substituted or unsubstituted furanyl or substituted or unsubstituted thiophenyl or substituted or unsubstituted pyrazolyl or substituted or unsubstituted imidazolyl or substituted or unsubstituted thiazolyl or substituted or unsubstituted triazolyl or substituted or unsubstituted piperidinyl.
- A is substituted phenyl or substituted pyridinyl or furanyl or thiophenyl or pyrazolyl or imidazolyl or substituted or unsubstituted thiazolyl or triazolyl or piperidinyl.
- A is substituted phenyl.
- A is substituted pyridin-2-yl or substituted pyridin-3-yl or substituted pyridin-4-yl.
- the compound has a formula which is a member selected from:
- R a is a member selected ⁇
- each R 20 and each R 21 is a member independently selected from H, nitro, halogen, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl, each R 20 and each R 21 is a member independently selected from H, nitro, halogen, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl, with the proviso that R a is
- the compound is a member selected from
- R a is a member selected from cyano, nitro, aminoalkyl, hydroxyalkyl, -C(O)(CH 2 ) n CH 3 , COOH, -C(O)O(CH 2 ) n CH 3 , O(CH 2 ) n CH 3 , O(CH 2 ) n CF 3 , O(CH 2 ) n CHF 2 , OH, NH 2 , NHCH 3 , NHC(O)H, NHC(O)(CH 2 ) n CH 3 , NHOH, NHS(O) 2 NH 2 , -NH 2 S(O) 2 CH 3 , -S(O) 2 CH 3 , wherein n is O or 1 or 2 or 3.
- the compound is:
- R > a a l is as described herein, or a salt thereof.
- the compound is:
- the compound is:
- the compound is:
- the compound is:
- the compound is ElIl or a salt thereof. In an exemplary embodiment, the compound is ElIl or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound is E 119 or a salt thereof. In an exemplary embodiment, the compound is E 119 or a pharmaceutically acceptable salt thereof. [0151] In an exemplary embodiment, the compound has a structure according to the following formula:
- R a , A, R 3 and Y are as described herein, with the proviso that when R 3 is H or
- -CH 3 or -CH 2 CH 3 or benzyl is not a member selected from
- the compound has a structure according to the following formula:
- R a , A, R 3 and Y are as described herein, with the proviso that when R 3 is H, is not a member selected from
- the compound has a structure according to the following formula:
- R a , A, R 3 and Y are as described herein, with the proviso that when R 3 is -CH3
- R 3 is -CH 3 or benzyl, is not a member selected from
- H is not a member selected from
- R a is not cyano, halogen, H, -SCH 3 , -OCH 3 , -OCF 3 , -CF 3 , and -CH 3 .
- R a is not cyano, halogen, H, -SCH 3 , -SCH 2 CH 3 , -OCH 3 , - OCH 2 CH 3 , -OCF 3 , -OCH 2 CF 3 , -CF 3 , -CH 2 CF 3 , -CH 3 and -CH 2 CH 3 .
- R a is not halo, H, -OCH 2 CF 3 , - OCH 3 , -OCH 2 CH 3 , -SCH 3 , -SCH 2 CH 3 , -CF 3 , - CH 2 CF 3 , -CH 3 and -CH 2 CH 3 .
- R a is not halo, H, -OCH 2 CF 3 , - OCH 3 , -OCH 2 CH 3 , -SCH 3 , -SCH 2 CH 3 , -CF 3 , - CH 2 CF 3 , -CH 3 and -CH 2 CH 3 .
- R 3 is not -CH 2 -Ph.
- Y is O.
- A is a member selected from substituted or unsubstituted phenyl, substituted or unsubstituted pyridinyl, substituted or unsubstituted pyrimidinyl, substituted or unsubstituted pyrazinyl, substituted or unsubstituted thiazolyl, substituted or unsubstituted cyclopropyl, substituted or unsubstituted cyclobutyl, substituted or unsubstituted cyclopentyl, substituted or unsubstituted cyclohexyl and substituted or unsubstituted piperidinyl.
- A is a member selected from substituted or unsubstituted pyridin-2-yl, substituted or unsubstituted pyridin-3-yl and substituted or unsubstituted piperidin-4-yl.
- A is a member selected from
- R a is H and A is a member selected from In an exemplary embodiment, A is a member selected
- s ⁇ - - ' is a member selected from
- R a is cyano.
- R a is a member selected from aminomethyl, hydroxymethyl, -OH, -OCH 3 , -NH 2 , -
- R 21 is a member independently selected from H, methyl, ethyl, propyl, isopropyl, butyl, isobutyl, t-butyl, phenyl and benzyl.
- R a is a member selected from -C(O)OH, -C(O)OCH 3 , -C(O)OCH 2 CH 3 , -C(O)OC(CH 3 ) 3 and -C(O)NH 2 .
- R 3 is H.
- R 3 is a member selected from cyano.
- R 3 is substituted or unsubstituted Ci-C 3 alkyl.
- R 3 is substituted with a member selected from -OH, -NH 2 , nitro, -P(O)OR 11 OR 12 , -S(O) 2 R 11 , -C(O)OR 11 , -OSiR 11 R 12 R 13 , - NHC(O)R 11 , wherein each R 11 , R 12 and R 13 are members independently selected from H, -NH 2 , NHR 14 and substituted or unsubstituted alkyl, wherein R 14 is -C(O)OR 15 , wherein R 15 is unsubstituted alkyl.
- R 3 is -CH 2 R 9 , wherein R 9 is a member selected from -OH, -NH 2 , nitro, -P(O)OR 20 OR 20 , -S(O) 2 R 22 , -C(O)OR 20 ,
- each R 20 , each R 21 and each R 22 is a member independently selected from H, -NH 2 , NHR 14 and unsubstituted alkyl, wherein R 14 is -C(O)OR 15 , wherein R 15 is unsubstituted alkyl.
- R 3 is substituted with a member selected from -OH, -NH 2 , nitro, -P(O)(OCH 3 ) 2 , -S(O) 2 CH 3 , -S(O) 2 CH 2 CH 3 , -S(O) 2 NH 2 , -S(O) 2 NHC(O)C(CH 3 ) 3 , -C(O)OH,
- the alkyl group is a member selected from -CH 2 OH, -(CH 2 ) 2 OH, -(CH 2 ) 3 OH, -CH 2 NH 2 , -CH 2 NO 2 , -CH 2 P(O)(OCH 3 ) 2 , -CH 2 S(O) 2 CH 3 , -CH 2 S(O) 2 CH 2 CH 3 , -CH 2 S(O) 2 NH 2 , - CH 2 S(O) 2 NHC(O)C(CH 3 ) 3 , -CH 2 C(O)OH, -CH 2 C(O)OCH 2 CH 3 , -CH 2 C(O)OCH 3 , -(CH 2 ) 3 OSi(CH 3 ) 2 (
- R 3 is substituted with -OH and nitro.
- Y is a member selected from unsubstituted C 1 -C 4 alkyl and -S(O) 2 NH-
- R 3 is a member selected from H, aminomethyl, hydroxymethyl, -OH, -OCH 3 , -NH 2 , -NO 2 , -C(O)OR 20 , -C(O)NR 20 R 21 and , wherein each R 20 and each R 21 is a member independently selected from H, methyl, ethyl, propyl, isopropyl, butyl, isobutyl, t-butyl, phenyl and benzyl.
- the invention provides poly- or multivalent species of the compounds of the invention. In an exemplary embodiment, the invention provides a dimer of the compounds described herein. In an exemplary embodiment, the invention provides a dimer of the compounds described herein. [0164] In an exemplary embodiment, the invention provides an anhydride of the compounds described herein. In an exemplary embodiment, the invention provides an anhydride of the compounds described herein.
- the invention provides a trimer of the compounds described herein. In an exemplary embodiment, the invention provides a trimer of the compounds described herein.
- the compounds of the invention can form a hydrate with water, solvates with alcohols such as methanol, ethanol, propanol, and the like; adducts with amino compounds, such as ammonia, methylamine, ethylamine, and the like; adducts with acids, such as formic acid, acetic acid and the like; complexes with ethanolamine, quinoline, amino acids, and the like.
- alcohols such as methanol, ethanol, propanol, and the like
- amino compounds such as ammonia, methylamine, ethylamine, and the like
- acids such as formic acid, acetic acid and the like
- complexes with ethanolamine, quinoline, amino acids, and the like complexes with ethanolamine, quinoline, amino acids, and the like.
- the compound has a structure according to the formula:
- C* is a carbon atom which is a stereocenter which has a configuration of (R) or (S).
- the C* stereocenter is in a (S) configuration.
- the C* stereocenter is in a (S) configuration and R 3 is -CH 2 COOR 20 , wherein R , 20 is H or unsubstituted alkyl.
- the C * stereocenter is in a (S) configuration and R 3 is -CH 2 COOH.
- the C* stereocenter is in a (R) configuration.
- the C* stereocenter is in a (R) configuration and R 3 is -CH 2 COOR 20 , wherein R 20 is H or unsubstituted alkyl.
- the C* stereocenter is in a (R) configuration and R 3 is -CH 2 COOH.
- the invention provides a compound described herein, or a salt, hydrate or solvate thereof, or a combination thereof.
- the invention provides a compound described herein, or a salt, hydrate or solvate thereof.
- the invention provides a compound described herein, or a salt thereof.
- the salt is a pharmaceutically acceptable salt.
- the invention provides a compound described herein, or a hydrate thereof. In an exemplary embodiment, the invention provides a compound described herein, or a solvate thereof. In an exemplary embodiment, the invention provides a compound described herein, or a prodrug thereof. In an exemplary embodiment, the invention provides a salt of a compound described herein. In an exemplary embodiment, the invention provides a pharmaceutically acceptable salt of a compound described herein. In an exemplary embodiment, the invention provides a hydrate of a compound described herein. In an exemplary embodiment, the invention provides a solvate of a compound described herein. In an exemplary embodiment, the invention provides a prodrug of a compound described herein. In an exemplary embodiment, the invention provides a compound as described in FIG. 1, or a salt thereof. In an exemplary embodiment, the invention provides a compound as described in FIG. 1, or a pharmaceutically acceptable salt thereof.
- alkyl is a member selected from linear alkyl and branched alkyl.
- heteroalkyl is a member selected from linear heteroalkyl and branched heteroalkyl.
- the term “chiral”, “enantiomerically enriched” or “diastereomerically enriched” refers to a composition having an enantiomeric excess (ee) or a diastereomeric excess (de) of greater than about 50%, preferably greater than about 70% and more preferably greater than about 90%. In general, higher than about 90% enantiomeric or diastereomeric excess is particularly preferred, e.g., those compositions with greater than about 95%, greater than about 97% and greater than about 99% ee or de.
- the terms “enantiomeric excess” and “diastereomeric excess” are used interchangeably herein. Compounds with a single stereocenter are referred to as being present in “enantiomeric excess”, those with at least two stereocenters are referred to as being present in "diastereomeric excess”.
- ee a x WO
- the term "enantiomeric excess” is related to the older term “optical purity” in that both are measures of the same phenomenon.
- the value of ee will be a number from 0 to 100, zero being racemic and 100 being enantiomerically pure.
- a composition which in the past might have been called 98% optically pure is now more precisely characterized by 96% ee.
- a 90% ee reflects the presence of 95% of one enantiomer and 5% of the other(s) in the material in question.
- the invention provides a composition including a first stereoisomer and at least one additional stereoisomer of a compound of the invention.
- the first stereoisomer can be present in a diastereomeric or enantiomeric excess of at least about 80%, or at least about 90%, or at least about
- the first stereoisomer is present in a diastereomeric or enantiomeric excess of at least about 96%, at least about 97%, at least about 98%, at least about 99% or at least about 99.5%.
- the compound of the invention is enantiomerically or diastereomerically pure (diastereomeric or enantiomeric excess is about 100%). Enantiomeric or diastereomeric excess can be determined relative to exactly one other stereoisomer, or can be determined relative to the sum of at least two other stereoisomers. In an exemplary embodiment, enantiomeric or diastereomeric excess is determined relative to all other detectable stereoisomers, which are present in the mixture. Stereoisomers are detectable if a concentration of such stereoisomer in the analyzed mixture can be determined using common analytical methods, such as chiral HPLC.
- composition that is "substantially free" of a compound means that the composition contains less than about 20% by weight, or less than about 15% by weight, or less than about 10% by weight, or less than about 5% by weight, or less than about 3% by weight, or less than about 2% by weight, or less than about 1% by weight of the compound.
- the term "substantially free of the (or its) enantiomer” means that a composition containing a compound of the invention is made up of a significantly greater proportion of one enantiomer than of its optical antipode.
- the term “substantially free of the enantiomer” means that the compound is made up of at least about 90% by weight of the (R) enantiomer and about 10% by weight or less of the (S) stereoisomer.
- the term "substantially free of the enantiomer” means that the compound is made up of at least about 95% by weight of the (R) enantiomer and about 5% by weight or less of the (S) stereoisomer. In an even more preferred embodiment, the term “substantially free of the enantiomer” means that the compound is made up of at least about 98% by weight of the (R) enantiomer and about 2% or less of the (S) stereoisomer. In an even more preferred embodiment, the term “substantially free of the enantiomer” means that the compound is made up of at least about 99% by weight of the (R) enantiomer and about 1% or less of the (S) stereoisomer.
- the invention provides a composition comprising a) a first stereoisomer of a compound described herein, wherein R 3 is not H; b) at least one additional stereoisomer of the first stereoisomer, wherein the first stereoisomer is present in an enantiomeric excess of at least 80% relative to said at least one additional stereoisomer. In an exemplary embodiment, the enantiomeric excess is at least 92%.
- the C* stereocenter of the first stereoisomer is in a (R) configuration. In an exemplary embodiment, the C* stereocenter of the first stereoisomer is in a (R) configuration, and R 3 is -(CH 2 ) m COOR 20 .
- the C* stereocenter of the first stereoisomer is in a (R) configuration, and R 3 is -(CH 2 ) m COOH. In an exemplary embodiment, the C* stereocenter of the first stereoisomer is in a (R) configuration, and R 3 is -CH 2 COOR 20 . In an exemplary embodiment, the C* stereocenter of the first stereoisomer is in a (R) configuration, and R 3 is -CH 2 COOH.
- the invention provides a composition comprising a compound of the invention, wherein R 3 is not H and the C* stereocenter is in a (R) configuration, and said composition is substantially free of the enantiomer of the compound.
- the composition comprises E38, E50 or combinations thereof, wherein the composition is substantially free of the enantiomer of E38 or E50.
- the invention provides a composition comprising a compound described herein, wherein R 3 is not H and the C* stereocenter is in a (S) configuration. ///. c) Combinations comprising additional therapeutic agents
- the compounds of the invention may also be used in combination with additional therapeutic agents.
- the invention thus provides, in a further aspect, a combination comprising a compound of the invention together with at least one additional therapeutic agent, or a salt, prodrug, hydrate or solvate thereof.
- the compound of the invention is a compound described herein, or a salt thereof.
- the additional therapeutic agent is a compound of the invention.
- the additional therapeutic agent includes a boron atom.
- the additional therapeutic agent does not contain a boron atom.
- the additional therapeutic agent is a compound described in sections III a)-b).
- each compound of the invention When a compound of the invention is used in combination with a second therapeutic agent active against the same disease state, the dose of each compound may differ from that when the compound is used alone. Appropriate doses will be readily appreciated by those skilled in the art. It will be appreciated that the amount of a compound of the invention required for use in treatment will vary with the nature of the condition being treated and the age and the condition of the patient and will be ultimately at the discretion of the attendant physician or veterinarian.
- the invention provides a combination which includes a compound of the invention; and an antibiotic.
- the compound is described herein, or is a pharmaceutically acceptable salt thereof.
- the antibiotic comprises a ⁇ -lactam moiety.
- the antibiotic is described herein.
- the antibiotic is a member selected from penicillin G, amoxicillin, ampicillin, azlocillin, carbenicillin, cloxacillin, dicloxacillin, flucloxacillin, mezlocillin, nafcillin, pipericillin, ticarcillin, ceftazidime, cephalothin, cefotaxime, cefpirome, cefepime, and cefoxitin.
- the antibiotic is a member selected from tazobactam, sulbactam and clavulanic acid.
- the antibiotic is a member selected from Ceftazidime, Cephalothin, Cefotaxime, Cefpirome or Cefepime, Cefoxitin, Penicillin G, Amoxicillin, Ampicillin, Azlocillin, Carbenicillin, Cloxacillin, Dicloxacillin, Flucloxacillin, Mezlocillin, Nafcillin, Pipericillin, Ticarcillin, methicillin and temocillin.
- the antibiotic is a member selected from cefacetrile, cefadroxil, cefalexin, cefaloglycin, cefaloridine, cefalotin, cefapirin, cefatrizine, cefazedone, cefazolin, cefradine, cefroxadine, ceftezole, cephalothin and cefazolin.
- the antibiotic is a member selected from cefmetazole, cefonicid, ceforanide, cefotian, cefprozil, cefotetan, cefaclor, cefuroxime, cefamandole and cefoxitin.
- the antibiotic is a member selected from cefdinir, cefditoren, cefetamet, cef ⁇ xime, cefmenoxime, cefodizime, cefoperazone, cefotzime, cefpiramide, cefsulodin, ceftazidime, ceftibuten, ceftioxime, ceftriaxone, latamoxef, ceftriaxone, cefotaxime and cefpodoxime.
- the antibiotic is a member selected from cefquinome, cefepime and cefpirome.
- the antibiotic is a member selected from ceftobiprole.
- the antibiotic is a member selected from thienamycin, doripenem, panipenem (betamipron), imipenem, meropenem, ertapenem and faropenem.
- the antibiotic is a member selected from benzathine penicillin, benzylpenicillin (penicillin G), phenoxymethylpenicillin (penicillin V) and procaine penicillin.
- the combination of the invention is a boron- containing compound described herein or a salt thereof, and cefepime.
- the combination of the invention is a boron-containing compound described herein or a salt thereof, and cefepime.
- the combination of the invention is a boron- containing compound described herein or a salt thereof, and imipenem. In an exemplary embodiment, the combination of the invention is a boron-containing compound described herein or a salt thereof, and imipenem. [0184] In an exemplary embodiment, the combination of the invention is a boron- containing compound described herein or a salt thereof, and meropenem. In an exemplary embodiment, the combination of the invention is a boron-containing compound described herein or a salt thereof, and meropenem.
- the individual components of such combinations may be administered either simultaneously or sequentially in a unit dosage form.
- the unit dosage form may be a single or multiple unit dosage forms.
- the invention provides a combination in a single unit dosage form.
- An example of a single unit dosage form is a capsule wherein both the compound of the invention and the additional therapeutic agent are contained within the same capsule.
- the invention provides a combination in a two unit dosage form.
- An example of a two unit dosage form is a first capsule which contains the compound of the invention and a second capsule which contains the additional therapeutic agent.
- an exemplary embodiment of the invention is a pharmaceutical formulation comprising a) a compound of the invention; b) an additional therapeutic agent and c) a pharmaceutically acceptable excipient.
- the pharmaceutical formulation is a unit dosage form.
- the pharmaceutical formulation is a single unit dosage form.
- the pharmaceutical formulation is a single unit dosage form which includes a compound of the invention; an antibiotic and a pharmaceutically acceptable excipient.
- the pharmaceutical formulation is a single unit dosage form which includes a compound of the invention; an antibiotic and at least one pharmaceutically acceptable excipient.
- the pharmaceutical formulation is a two unit dosage form.
- the pharmaceutical formulation is a two unit dosage form comprising a first unit dosage form and a second unit dosage form, wherein the first unit dosage form includes a) a compound of the invention and b) a first pharmaceutically acceptable excipient; and the second unit dosage form includes c) an additional therapeutic agent and d) a second pharmaceutically acceptable excipient.
- the pharmaceutical formulation is a two unit dosage form comprising a first unit dosage form and a second unit dosage form, wherein the first unit dosage form includes a) a compound of the invention and b) a first pharmaceutically acceptable excipient; and the second unit dosage form includes c) an antibiotic and d) a second pharmaceutically acceptable excipient.
- Additional compounds of the invention include those formed between the 2 ',3' diol of the ribose ring of a nucleic acid, nucleoside or nucleotide, and a compound of the invention.
- the compound is described herein.
- the compound is a cyclic or acyclic boronic ester such as those described herein.
- These compounds can be used in an animal to kill or inhibit the growth of a microorganism described herein, as well as to treat the diseases described herein.
- These compounds can be formed in vitro as well as in vivo. Methods of making these compounds are provided in the Examples section.
- the invention provides a compound having a structure according to the following formula:
- L is a member selected from OR 7 , substituted or unsubstituted purine, substituted or unsubstituted pyrimidine, substituted or unsubstituted pyridine and substituted or unsubstituted imidazole.
- R 7 is a member selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heteroaryl.
- a 1 is a member selected from OH, substituted or unsubstituted monophosphate, substituted or unsubstituted diphosphate, substituted or unsubstituted triphosphate,
- O O O O A* O P O cytidine — o P O cytidine O P (X , O I- O I- O I- V A* is a nucleic acid sequence which comprises between 1 and 100 nucleotides.
- the compound has the following structure:
- compound 1 * can be converted to compound 2*.
- unsubstituted phenyl or unsubstituted pyridinyl sulfonyl chloride (1-1.2 equiv) and a base such as NMM, K2CO3, or pyridine 3-4 equiv
- a base such as NMM, K2CO3, or pyridine 3-4 equiv
- H 2 O can be added to the residue and the mixture adjusted to ⁇ pH 6 with dilute HCl.
- the aqueous layer can be then extracted with an organic solvent (such as EtOAc), and the combined organic fractions can be dried with a desiccant, such as Na 2 SO 4 or MgSO 4 , filtered, and concentrated in vacuo.
- an organic solvent such as EtOAc
- a desiccant such as Na 2 SO 4 or MgSO 4
- the product can be typically purified by either recrystallization from H 2 O, trituration with CH 2 Cl 2 or EtOAc, or flash chromatography.
- DIAD (1 equiv) can be added to a solution of the phenol (1 equiv) and PPh 3 (1 equiv) in anhydrous THF (200 mL/7 g phenol). The mixture can be stirred at rt until the reaction is complete (as determined by TLC). The mixture can be then concentrated in vacuo. Et 2 O can be added to the residue and the mixture can be then concentrated in vacuo. Et 2 O can be added again and the precipitate that formed can be removed by filtration. The filtrate can be extracted with 2 N NaOH and H 2 O. The organic layer can be dried (Na 2 SO 4 ) and concentrated in vacuo. The residue can be further purified by flash chromatography.
- X* leaving group, such as Br or OTf
- a solution of aryl bromide or triflate in anhydrous 1 ,4-dioxane or THF (20 mL/ 1 g) was added B 2 pin 2 (2 equiv) and KOAc (3 equiv) at rt, then degassed with N 2 for 10 to 40 min.
- PdCl 2 dppf>CH 2 Cl2 (4-8 mol%) can be added and the resulting solution can be stirred at 65-100 0 C until the reaction was complete (2 to 24 h).
- the solution can be cooled to rt, filtered through Celite ® or silica gel and concentrated in vacuo. The residue can be taken up in EtOAc.
- Trifluoromethanesulfonic anhydride (1.2 equiv) can be added dropwise to a solution of pyridine (1.2 equiv) and the phenol in CH 2 Cl 2 (40 mL/8.6 g) at 0 0 C (bath temp).
- the reaction mixture can be then allowed to warm to rt and can be stirred until complete consumption of starting material (as determined by TLC).
- Et 2 O and 2 N HCl were then added.
- the organic layer can be separated and washed with sat. NaHCO 3 then brine.
- the organic layer can be dried (Na 2 SO 4 ) and filtered through a short silica gel plug, washing with Et 2 O.
- the filtrate can be concentrated in vacuo to give the desired triflate that can be used directly in a subsequent general procedure.
- the reaction can be allowed to warm to rt and monitored by TLC.
- the mixture can be then acidified to ⁇ pH 3 using a 1 N NaHSO 4 or 2 M HCl and stirred O/N.
- the precipitate can be collected by filtration, washed repeatedly with H 2 O and dried in vacuo. Further purification can be carried out by flash chromatography when required.
- General Procedure 9 Henry Reaction of Substituted 2-f 4,4,5, 5-Tetramethyl- [1,3,2 ]dioxaborolan-2-yl)-benzaldehvdes
- NaOH aq. (1.0 equiv) can be added to the aldehyde (either in H 2 O or THF) at rt and the reaction mixture can be stirred at rt for 5 min.
- MeNO 2 (3 equiv) can be added dropwise and the mixture can be stirred at rt for 16 h.
- the reaction mixture can be acidified with 2 N HCl and extracted with EtOAc. The organic fraction can be washed with H 2 O then brine, dried (MgSO 4 ), and concentrated in vacuo. Purification can be typically accomplished by either flash chromatography or precipitation from the acidified reaction mixture.
- General Procedure 10 Henry Reaction using Phase Transfer Catalyst of Substituted 2- (4, 4, 5, 5-Tetramethyl-fl ,3,2 ]dioxaborolan-2-yl)-benzaldehydes
- CTAB or CTACl (5 mol%) can be added to a mixture of MeNO 2 and aldehyde, in aq. NaOH, and THF (1 mL/300 mg aldehyde) at rt.
- the reaction can be monitored by TLC.
- the mixture can be adjusted to pH 2-3 using 2 N HCl or 1 M NaHSO 4 and the mixture can be then stirred for 30 min.
- the solid can be filtered and dried to afford the desired nitro compound which can be used directly in next step. If there was no precipitation, the organic material can be extracted from the reaction mixture with EtOAc. The organic fraction can be then dried (MgSO 4 ) and concentrated in vacuo. The residue can be purified by flash chromatography.
- BoC 2 O (2 equiv) and MC1 2 *6H 2 O (1 equiv) can be added to a stirred solution of the alkyl nitro or alkyl nitrile in anhydrous MeOH (3 mL/mmol) at rt. Stirring can be continued until most of the NiCl 2 had dissolved in MeOH (typically ⁇ 10 min).
- the reaction mixture can be then cooled to O 0 C (bath temp) and NaBH 4 (6 equiv) was added portionwise over 10 min.
- the reaction can be exothermic, effervescent, and can result in the formation of a finely divided black precipitate.
- the reaction mixture can be allowed to warm to rt and left to stir O/N. The mixture can be then concentrated in vacuo and the residue diluted with EtOAc. The resulting suspension can be filtered through Celite and the filtrate concentrated in vacuo. The residue can be then further purified by flash chromatography if required.
- a mixture of the 3-nitromethyl-3H-benzo[c][l,2]oxaborol-l-ol, Raney Ni (2 equiv w/w), 2.0 M NH 3 in EtOH (5 niL/1 g), and absolute EtOH (20 niL/1 g) can be shaken under an atmosphere of H 2 (40-50 psi) for 3 h at rt.
- the resultant mixture can be filtered through a pad of Celite and washed with EtOH.
- the filtrate can be concentrated in vacuo to give the free amine.
- Remaining AcOH can be removed by co-evaporation with toluene (3 x) to give the amine, typically as a fluffy solid.
- remaining ammonia can be removed by diluting with an appropriate solvent like methanol or ether followed by concentration in vacuo. Purification can be typically accomplished by preparative HPLC.
- compound 17* can be separated into enantiomers 18* and 19*.
- the separation of the two enantiomers can be achieved by dissolving the material in a suitable solvent and applying to an appropriate chiral column and eluent system. The collected separated enantiomer samples can be then concentrated and used in the next step without further purification. Using this technique, it is possible to achieve a range of enantiomeric excesses of the separated enantiomers.
- reaction mixture is stirred for a further 45 minutes at -10 0 C before the addition of methanol (130 mL).
- the reaction mixture is concentrated under reduced pressure.
- the resultant residue is subjected to flash column chromatography to provide the substituted chiral 2-bromo- l-(2-bromophenyl)ethanol.
- sodium azide sodium azide at room temperature.
- the reaction mixture is then heated to 80 0 C for 24 hours. Water (150 mL) is added and this solution is extracted with diethyl ether. The combined organic phases are washed with brine (50 mL), dried over MgSO 4 , filtered and concentrated under reduced pressure.
- reaction mixture is then allowed to warm to room temperature where it is stirred for 3 hours before being quenched with 6 M HCl (30 mL).
- 6 M HCl (30 mL).
- the reaction mixture is concentrated under reduced pressure and the resulting residue is subjected to flash column chromatography to give the 6-R-substituted 3-(azidomethyl)benzo[c][l,2] oxaborol-1 (3H)-ol.
- the hydroxyl group of A* can be protected by subjecting the molecule to protecting group appropriate conditions, thereby producing B*.
- the hydroxyl group of B* can be protected by subjecting the molecule to protecting group appropriate conditions, thereby producing C*.
- D* can be produced by subjecting C* to conditions that will selectively deprotect PG 1 , but not PG 2 .
- E* can be produced by subjecting D* to conditions that will add R a -A. Step S E * conditions
- F* can be produced by subjecting E* to conditions that will selectively deprotect PG 2 .
- G* can be produced by subjecting F* to conditions that will selectively add a triflate, or a similar group.
- H* can be produced by subjecting G* to borylation conditions.
- I* can be produced by subjecting H* to R 3 addition/ring closure conditions.
- R 3 comprises an ester, for example, J*
- the compound can be subjected to hydrolysis conditions to produce K*.
- the mixture can be purified via precipitation, silica gel column purification or preparative HPLC.
- L* can be produced by subjecting C* to borylation conditions. Step 3.
- N* can be produced by subjecting M* to conditions that will deprotect
- O* can be produced by subjecting N* to appropriate coupling conditions.
- General Procedure for 6-substituted or unsubstituted alkyl- 3 -acetic acid benzoxaborole derivatives
- P* can be produced by subjecting N* to appropriate coupling conditions. Step 2.
- R 3 comprises an ester, for example, Q*
- the compound can be subjected to hydrolysis conditions to produce S*.
- the mixture can be purified via precipitation, silica gel column purification or preparative HPLC.
- U* can be produced by subjecting T* to succinylation conditions.
- V* can be produced by subjecting U* to esterification conditions.
- W* or X* can be produced by subjecting V* to alcohol deprotection conditions.
- AA** can be produced by subjecting W* to conditions that will selectively add a triflate, or a similar group.
- AB* can be produced by subjecting AA* to borylation conditions. Step 6:
- AC* can be produced by subjecting AB* to ring closure conditions.
- Racemates of compounds such as I* were separated into pure enantiomers via preparative chiral HPLC or preparative supercritical fluid chromatography.
- Chiral columns which can be utilized to separate compounds of the invention are commercially available from companies such as Chiral Tech (West Chester, PA).
- Exemplary chiral columns which can be utilized include CHIRALPAK® IC, and CHIRALP AK® 405.
- Solvent systems of use in this purification include CO 2 ZMeOH (approx 85/15), Hexane/IprOH/TFA Hexane/EtOH/TFA as solvent. EtOH can be replaced with other alcohols.
- R 3 comprises an ester, for example, AC* or AD*
- the compound can be subjected to hydrolysis conditions to produce compounds such as AE* or AF*.
- the mixture can be purified via precipitation, silica gel column purification or preparative HPLC.
- the compounds to be tested are present in the assays in ranges from about 1 pM to about 100 mM, preferably from about 1 pM to about 1 ⁇ M.
- Other compounds range from about 1 nM to about 100 nM, preferably from about 1 nM to about 1 ⁇ M.
- the effects of the test compounds upon the function of the enzymes can also be measured by any suitable physiological change.
- the functional consequences are determined using intact cells or animals, one can also measure a variety of effects such as transmitter release, hormone release, transcriptional changes to both known and uncharacterized genetic markers, changes in cell metabolism such as cell growth or pH changes, and changes in intracellular second messengers such as Ca 2+ , or cyclic nucleotides.
- High throughput screening is also of use in identifying promising candidates of the invention.
- HTS High throughput screening
- the invention provides a method for identifying a compound which binds a beta-lactamase comprising: a) contacting said beta-lactamase with a test compound under conditions suitable for binding; and b) detecting binding of said test compound to said beta-lactamase.
- detecting binding of said compound comprises use of at least one detectable element, isotope, or chemical label attached to said compound.
- the element, isotope or chemical label is detected by a fluorescent, luminescent, radioactive, or absorbance readout.
- said beta-lactamase comprises the amino acid sequence of a peptide sequence described herein.
- the invention provides a method for identifying a compound which binds to a beta-lactamase , said assay comprising: a) contacting said beta-lactamase with said compound under conditions suitable for binding of said compound with said beta-lactamase; b) comparing a biological activity of said beta- lactamase contacting said compound to said biological activity when not contacting said compound; and c) identifying said compound as binding to said beta-lactamase if said biological activity of said beta-lactamase is reduced when contacting said compound.
- mutants in E.coli showing resistance to the compound were isolated. Characterization of mutants showed that they have an 32-256 fold increase in resistance to the compound over wildtype. The mutants were furthermore shown to be sensitive to various antibacterial agents with known modes of action, suggesting that the cellular target of the compound is distinct from the target of the other antibacterial agents.
- the leuS gene from the mutants was cloned onto a plasmid and their resistance was confirmed by MIC. The editing domain from these mutants were sequenced and the mutations were all located in the editing domain of this enzyme.
- Assays to determine whether, and how effectively, a particular compound binds to and/or inhibits the editing domain of a selected tRNA synthetase are also set forth herein, and additional assays are readily available to those of skill in the art. Briefly, in an exemplary assay, an improperly charged tRNA and a tRNA synthetase that is capable of editing the improperly charged tRNA are combined. The resulting mixture is contacted with the putative inhibitor and the degree of editing inhibition is observed.
- Another assay uses genetics to show that a drug works via the editing domain.
- the compound is first tested against a strain of cells over- expressing copies of the tRNA synthetase gene. The compound's effect on the over- expressing strain is compared with a control strain to determine whether the compound is active against the synthetase. If the minimum inhibitory concentration (MIC) is 2-fold higher in the strain with extra copies of the synthetase gene than the MIC of the inhibitor against a wild type cell, a further genetic screen is conducted to determine whether the increased resistance is due to mutations in the editing domain. In this second screen, the control strain is challenged against a high concentration of the inhibitor. The colonies surviving the challenge are isolated and DNA from these cells is isolated.
- MIC minimum inhibitory concentration
- the editing domain is amplified using a proof-reading PCR enzyme and the appropriate primers.
- the PCR product can be purified using standard procedures.
- the sequence amplified mutant DNA is compared to wild-type. If the mutant DNA bears mutations in the editing domain, such results would suggest that the compound binds to the editing domain and affects the editing function of the molecule through this domain.
- the compounds to be tested are present in the assays in ranges from about 1 pM to about 100 mM, preferably from about 1 pM to about 1 ⁇ M.
- Other compounds range from about 1 nM to about 100 nM, preferably from about 1 nM to about 1 ⁇ M.
- the effects of the test compounds upon the function of the enzymes can also be measured by any suitable physiological change.
- the functional consequences are determined using intact cells or animals, one can also measure a variety of effects such as transmitter release, hormone release, transcriptional changes to both known and uncharacterized genetic markers, changes in cell metabolism such as cell growth or pH changes, and changes in intracellular second messengers such as Ca 2+ , or cyclic nucleotides.
- High throughput screening is also of use in identifying promising candidates of the invention.
- the invention provides a method for identifying a compound which binds to an editing domain of a tRNA synthetase comprising: a) contacting said editing domain with a test compound under conditions suitable for binding; and b) detecting binding of said test compound to said editing domain.
- detecting binding of said compound comprises use of at least one detectable element, isotope, or chemical label attached to said compound.
- the element, isotope or chemical label is detected by a fluorescent, luminescent, radioactive, or absorbance readout.
- the contacting of said test compound with said editing domain also includes further contacting said test compound and said editing domain with a member selected from AMP and a molecule with a terminal adenosine.
- the tRNA synthetase is derived from leucyl tRNA synthetase.
- the tRNA synthetase is derived from a mutated tRNA synthetase, wherein said mutated tRNA synthetase comprises amino acid mutations in an editing domain.
- said editing domain of a tRNA synthetase comprises the amino acid sequence of a peptide sequence described herein.
- the invention provides a method for identifying a compound which binds to an editing domain of a tRNA synthetase, said assay comprising: a) contacting said editing domain of a tRNA synthetase with said compound under conditions suitable for binding of said compound with said editing domain of a tRNA synthetase; b) comparing a biological activity of said editing domain of a tRNA synthetase contacting said compound to said biological activity when not contacting said compound; and c) identifying said compound as binding to said editing domain of a tRNA synthetase if said biological activity of said editing domain of a tRNA synthetase is reduced when contacting said compound.
- the biological activity is hydrolysis of noncognate amino acid.
- the hydrolysis of said noncognate amino acid is detected through the use of one or more labels.
- the labels include a radiolabel, a fluorescent marker, an antibody, or a combination thereof.
- said labels can be detected using spectroscopy.
- said editing domain of a tRNA synthetase is derived from leucyl tRNA synthetase.
- the invention provides a method of generating tRNA molecules with noncognate amino acid comprising: a) creating or isolating a mutated tRNA synthetase with altered amino acid editing domains; and b) contacting a tRNA molecule with said mutated tRNA synthetase and a noncognate amino acid.
- the mutated tRNA synthetase contains one or more amino acid mutations in an editing domain.
- the mutated tRNA synthetase is unable to bind with a compound of the invention.
- the mutated tRNA synthetase is unable to bind with a compound described herein, or a pharmaceutically acceptable salt thereof. In another exemplary embodiment, the mutated tRNA synthetase is unable to bind with a compound according to a formula described herein, or a pharmaceutically acceptable salt thereof.
- the invention provides a composition that comprises one or more tRNA molecules attached to noncognate amino acids, wherein said tRNA molecules are synthesized using one or more mutated tRNA synthetases isolated from a microorganism or a cell line derived from a microorganism.
- the microorganism is a bacteria.
- said mutated tRNA synthetases contain amino acid mutations in their editing domains.
- Each transfer RNA contains an anti-codon region that hybridizes with mRNA, and an amino acid which may be attached to the growing peptide.
- the structural gene of tRNA is about 72 to 90 nucleotides long and folds into a cloverleaf structure (Sharp S. J., Schaack J., Coolen L., Burke D. J. and Soil D., "Structure and transcription of eukaryotic tRNA genes", Crit. Rev. Biochem, 19: 107 144 (1985); Geiduschek E. O., and Tocchini-Valentini, "Transcription by RNA polymerase III", Annu. Rev. Biochem. 57:873 914 (1988)).
- a compound described herein contacts AMP and a tRNA synthetase, and the tRNA synthetase in turn contacts a tRNA molecule.
- a compound described herein contacts AMP from the tRNA molecules and a tRNA synthetase.
- the nucleotide sequence of the tRNA molecule can be determined by the identity of the tRNA synthetase involved.
- the cognate tRNA molecule bound will be tRNA-leucine (SEQ ID NO: 1), but a noncognate tRNA, such as isoleucine, (SEQ ID NO: 2) may be bound under certain conditions.
- the tRNA molecule is a leucyl t-RNA.
- the tRNA molecule is represented by a SEQ ID described herein.
- the tRNA molecule is represented by SEQ ID NO: 14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23 and SEQ ID NO:24.
- the term "noncognate” is meant to encompass both the singular and plural forms of the word, i.e. the phrase "noncognate amino acid" comprises one or more amino acids.
- SEQ ID NO: 1 corresponds to the nucleotide sequence of the tRNA-Leu gene from Saccharomyces cerevisiae: gggagtttgg ccgagtggtt taaggcgtca gatttaggct ctgatatctt cggatgcaagggttcgaatc ccttagctct caeca
- SEQ ID NO: 2 corresponds to the nucleotide sequence of the tRNA-Ile gene from Saccharomyces cerevisiae: gaaactataa ttcaattggt tagaatagta ttttgataag gtacaaatat aggttcaatc cctgttagtt tcatcca
- SEQ ID NO: 14 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. col ⁇ . gcgaaggtggcggaattggtagacgcgctagcttcaggtgttagtgtccttacggacgtgggggttcaagtcccccctc gcacca
- SEQ ID NO: 15 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. col ⁇ . gcgggagtggcgaaattggtagacgcaccagatttaggttctggcgccgcaaggtgtgcgagttcaagtctcgcctccg caeca
- SEQ ID NO: 16 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. col ⁇ .
- SEQ ID NO: 17 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. col ⁇ .
- SEQ ID NO: 18 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. col ⁇ . gcccggatggtggaatcggtagacacacaagggatttaaaatccctcggcgttcgcgctgtgcgggttcaagtcccgctccg ggtacca
- SEQ ID NO: 19 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. col ⁇ .
- SEQ ID NO: 20 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. col ⁇ .
- SEQ ID NO: 21 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. col ⁇ .
- SEQ ID NO: 22 corresponds to the nucleotide sequence of a tRNA-Leu gene from Pseudomonas aeruginosa gcggacgtggtggaattggtagacacactggatttaggttccagcgccgcaaggcgtgagagttcgagtctctccgtccgc acca
- SEQ ID NO: 23 corresponds to the nucleotide sequence of a tRNA-Leu gene from Staphylococcus aureus gccggggtggcggaactggcagacgcacaggacttaaaatcctgcggtgagagatcaccgtaccggttcgattccggtc ctcggcacca
- SEQ ID NO: 24 corresponds to the nucleotide sequence of a tRNA-Leu gene from Staphylococcus aureus gccggggtggcggaactggcagacgcacaggacttaaaatcctgcggtgagtgatcaccgtaccggttcgattccggtcc tcggcacca Polypeptides used in binding and inhibition assays
- polypeptides derived from tRNA synthetases are used in the experiment.
- polypeptide fragments corresponding to the editing domain of a tRNA synthetase molecule are used in assay and binding experiments. Such fragments are represented by SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6 and SEQ ID NO:7. In an exemplary embodiment, the fragments are represented by SEQ ID NO:5, SEQ ID NO: 6 and SEQ ID NO:7. [0279] SEQ ID NO 3:
- SEQ ID NO 8 corresponds to a peptide sequence for a leu-tRNA synthetase editing domain for Escherichia coli GRSEGVEITFNVNDYDNTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENN PELAAFIDECRNTKVAEAEMATMEKKGVDTGFKAVHPLTGEEIPVWAANFV LMEYGTGAVMAVPGHDQRDYEFASKYGLNIKPVILAADGSEPDLSQQALTE KGVLFNSGEFNGLDHEAAFNAIADKLTAMGVGERKVNYR
- SEQ ID NO 9 corresponds to a peptide sequence for a leu-tRNA synthetase editing domain for Pseudomonas
- SEQ ID NO 10 corresponds to a peptide sequence for a leu-tRNA synthetase editing domain for Staphylococcus aureus
- polypeptides corresponding to a tRNA synthetase molecule are used in assay and binding experiments.
- Such polypeptides are represented by SEQ ID NO: 11, SEQ ID NO: 12 and SEQ ID NO: 13.
- SEQ ID NO 11 corresponds to a peptide sequence for a leu-tRNA synthetase for Escherichia coli
- SEQ ID NO 12 corresponds to a peptide sequence for a leu-tRNA synthetase for Pseudomonas
- SEQ ID NO 13 corresponds to a peptide sequence for a leu-tRNA synthetase for Staphylococcus aureus
- the compounds of the invention can be utilized to inhibit an enzyme.
- the compounds of the invention and/or combinations of the invention exhibit potency against microorganisms, such as bacteria, and therefore have the potential to kill and/or inhibit the growth of microorganisms.
- the compounds of the invention and/or combinations of the invention exhibit potency against microorganisms, such as bacteria, and therefore have the potential to achieve therapeutic efficacy in the animals described herein.
- the compounds of the invention exhibit the ability to inhibit a beta-lactamase, and therefore have the potential to be used to treat bacterial infections in man which involve beta-lactamases.
- a method for binding to and/or inhibiting a beta-lactamase is provided which comprises contacting the beta-lactamase with an effective amount of a compound of the invention. Such conditions are known to those skilled in the art.
- the compound of use in the method is described herein, or a salt, hydrate or solvate thereof, or a combination thereof.
- the compound of use in the method is described herein, or a salt, hydrate or solvate thereof.
- the compound of use in the method is described herein, or a salt thereof. In an exemplary embodiment, the compound of use in the method is described herein, or a salt thereof.
- the beta-lactamase is contacted with an amount of a compound of the invention sufficient to result in a detectable amount of beta-lactamase inhibition.
- This method can be performed on a beta-lactamase that is contained within an organism or which is outside an organism. In an exemplary embodiment, the method is performed on a beta-lactamase that is contained within a microorganism that is in, or on the surface of, an animal. In an exemplary embodiment, the animal is a human.
- the inhibition takes place in a cell, such as a microorganism cell.
- the microorganism is a bacteria.
- the method is performed on a beta-lactamase that is outside of a microorganism.
- the method is performed on a beta-lactamase that is outside of a microorganism and is in an assay of the type described herein.
- the compound has a structure according to the following formula:
- the compound has a structure according to the following formula: 20 in which Y, A, R 20 and R a are described herein.
- the ⁇ - lactamase is a member selected from a Group 1 ⁇ -lactamase, a Group 2 ⁇ -lactamase, a Group 3 ⁇ -lactamase, and a Group 4 ⁇ -lactamase.
- the Group 1 ⁇ -lactamase is a cephalosporinase.
- said Group 2 ⁇ -lactamase is a member selected from penicillinase, a Group 2b, Group 2be, Group 2br, carbenicillinase, cloxacilanase, cephalosporinase and carbapenamase.
- said Group 3 ⁇ -lactamase is a metallo- ⁇ -lactamase.
- said Group 4 ⁇ -lactamase is a penicillinase.
- the ⁇ -lactamase is a member selected from a class A ⁇ -lactamase, a class B ⁇ -lactamase, a class C ⁇ -lactamase, and a class D ⁇ -lactamase.
- the class A ⁇ -lactamase is a member selected from a TEM ⁇ -lactamase, SHV ⁇ -lactamase, CTX-M ⁇ -lactamase and a KPC ⁇ -lactamase.
- ⁇ -lactamase is TEM ⁇ -lactamase.
- the ⁇ - lactamase is TEM-I ⁇ -lactamase.
- the ⁇ -lactamase is TEM-3 ⁇ -lactamase.
- the ⁇ -lactamase is KPC-2 ⁇ - lactamase.
- the ⁇ -lactamase is CMY-2 ⁇ -lactamase.
- the class C ⁇ -lactamase is a member selected from a CMY ⁇ -lactamase, a PER ⁇ -lactamase and an AmpC ⁇ -lactamase.
- the ⁇ -lactamase is AmpC ⁇ -lactamase.
- the class D ⁇ -lactamase is an OXA ⁇ -lactamase.
- the ⁇ - lactamase is a metallo ⁇ -lactamase.
- the metallo ⁇ - lactamase is a member selected from an IMP carbapenemase and a VIM ⁇ -lactamase.
- the ⁇ -lactamase is a member selected from a class A ⁇ - lactamase and a class C ⁇ -lactamase.
- the contacting takes place in vitro.
- the contacting takes place in vitro.
- the contacting takes place in an animal, such as a human. VI. b) LeuRS
- the compounds of the invention exhibit the ability of inhibiting the editing domain of tRNA synthetases, such as leucyl tRNA synthetase, of microorganisms, such as bacteria, and therefore have the potential to be used as editing domain inhibitors of microorganism tRNA synthetases.
- tRNA synthetases such as leucyl tRNA synthetase
- a method for binding to and/or inhibiting the editing domain of a tRNA synthetase comprises contacting a tRNA synthetase with a compound of the invention that inhibits the editing domain under conditions in which the tRNA synthetase interacts with its substrate to form an aminoacyl adenylate intermediate and, preferably, to form a charged tRNA.
- a compound of the invention that inhibits the editing domain under conditions in which the tRNA synthetase interacts with its substrate to form an aminoacyl adenylate intermediate and, preferably, to form a charged tRNA.
- the compound has a structure according to the following formula:
- the compound is ElIl or a salt thereof. In an exemplary embodiment, the compound is ElIl or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound is El 19 or a salt thereof. In an exemplary embodiment, the compound is El 19 or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound is described herein, or a salt, hydrate or solvate thereof, or a combination thereof. In an exemplary embodiment, the invention provides a compound described herein, or a salt, hydrate or solvate thereof. In an exemplary embodiment, the invention provides a compound described herein, or a salt thereof.
- the invention provides a compound described herein, or a salt thereof.
- the tRNA synthetase is contacted with an amount of compound of the invention sufficient to result in a detectable amount of tRNA synthetase inhibition.
- This method can be performed on a tRNA synthetase that is contained within an organism or which is outside an organism.
- the method is performed on a tRNA synthetase that is contained within a microorganism or a microbial cell that is in, or on the surface of, an animal.
- the animal is a human.
- the method results in a decrease in the amount of charged tRNA produced by the tRNA synthetase that has an inhibited editing domain.
- the inhibition takes place in a cell, such as a microorganism cell.
- the microorganism cell is a bacteria.
- the tRNA synthetase is leucyl tRNA synthetase.
- the invention provides a method of inhibiting conversion of a tRNA molecule into a charged tRNA molecule.
- the method involves contacting a tRNA synthetase with a compound of the invention effective to inhibit activity of an editing domain of said tRNA synthetase, under conditions sufficient to inhibit said activity, thereby inhibiting said conversion.
- the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof.
- the inhibition occurs within a cell, and the cell is a microorganism cell.
- the microorganism cell is a bacteria.
- the microorganism cell is a bacteria which is described herein.
- the enzyme is a leucyl tRNA synthetase of a bacteria described herein.
- the tRNA synthetase is leucyl tRNA synthetase.
- the compound has a K D , synthesis of greater than 100 ⁇ M against a synthetic domain of said tRNA synthetase.
- the mechanism of action of a compound of the invention is to inhibit the conversion of a tRNA molecule into a charged tRNA molecule by binding to and/or inhibiting at least the editing domain of the synthetase.
- the compounds of use in this method may also inhibit or otherwise interact with the synthetic domain (e.g., the active site of the synthetic domain).
- the editing domain is inhibited selectively in the presence of the synthetic domain.
- the synthetic domain is essentially uninhibited, while the editing domain is inhibited at least 50%, preferably at least 60%, more preferably at least 70%, still more preferably, at least 80% and even still more preferably at least 90% of the activity of the tRNA synthetase.
- the synthetic domain is inhibited by at most 50%, preferably at most 30%, preferably at most 20%, 10%, preferably at most 8%, more preferably at most 5%, still more preferably, at most 3% and even still more preferably at most 1%. Inhibition of the editing domain produces a decrease in the amount of the properly charged tRNA which results in retardation or cessation of cell growth and division.
- the ratio of a minimum concentration of said compound inhibiting said editing domain to a minimum concentration of said compound inhibiting said synthetic domain of said tRNA synthetase, represented as K D , edn/K-D, synthesis is less than one.
- the K Di edlt /EC Dj synthesis of the compound is a member selected from less than 0.5, less than 0.1 and less than 0.05.
- the invention provides a method for inhibiting a phosphodiesterase (PDE), the method comprising: contacting the phosphodiesterase with a compound of the invention, wherein the phosphodiesterase is inhibited.
- PDE phosphodiesterase
- the amount of the compound is a therapeutically effective amount.
- the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof.
- the compound of the invention a compound described in a formula provided herein.
- the compound of the invention is a compound described herein.
- the phosphodiesterase is a member selected from PDEl, PDE2, PDE3, PDE4, PDE5, PDE6, PDE7, PDE8, PDE9, PDElO and PDEl 1.
- the phosphodiesterase is PDE4.
- the PDE4 is a member selected from PDE4A, PDE4B, PDE4C and PDE4D.
- the PDE4 is PDE4B.
- the phosphodiesterase is PDE7.
- the invention provides a method for inhibiting a phosphodiesterase4 (PD E4), but not significantly inhibiting at least one PDE which is a member selected from PDEl, PDE2, PDE3, PDE5 and PDE6, involving contacting a cell with a compound of the invention, thereby providing said inhibition.
- the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof.
- the compound of the invention a compound described in a formula provided herein.
- the compound of the invention is a compound described herein.
- the compound of the invention is present in an amount which will inhibit a phosphodiesterase described herein by at least about 5 to about 100%, or at least about 30 to about 100%, 40 to about 100%, or at least about 50 to about 100%, or at least about 60 to about 100%, or at least about 70 to about 100%, or at least about 80 to about 100%, or at least about 90 to about 100%, or at least about 30 to about 70%, or at least about 40 to about 90%, or at least about 45 to about 80%, or at least about 55 to about 75%, or at least about 75 to about 98%, or at least about 55 to about 99%, or at least about 5% to about 20% or at least about 10% to about 25%.
- the invention provides a method for decreasing the production of a cytokine and/or a chemokine, the method comprising: contacting a cell with a compound of the invention, wherein production of the cytokine and/or chemokine by the cell is decreased.
- the cell is contacted with a therapeutically effective amount of the compound.
- the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof.
- the compound of the invention a compound described in a formula provided herein.
- the compound of the invention is a compound described herein.
- the method is for decreasing the production of a cytokine, which is a THl cytokine.
- a cytokine which is a THl cytokine.
- the THl cytokine is a member selected from IFN-g and IL-2.
- the method is for decreasing the production of a cytokine, which is a TH2 cytokine.
- a cytokine which is a TH2 cytokine.
- the TH2 cytokine is a member selected from IL-4, IL-5 and IL-10.
- the method is for decreasing the production of a cytokine, which is a member selected from IL- l ⁇ , IL- l ⁇ , IL-2, IL-3, IL-6, IL-7, IL-9, IL-12, IL-17, IL-18, IL-23, TNF- ⁇ , LT, LIF, Oncostatin, IFN ⁇ , IFN ⁇ and IFN ⁇ .
- the cytokine is a member selected from IL- l ⁇ , IL- 2, IL-3, IL-6, IL-7, IL-9, IL-12, IL-23, TNF- ⁇ , LT, LIF, Oncostatin, and IFN ⁇ .
- the cytokine is a member selected from IL-I ⁇ , IL-2, IL-23, TNF- ⁇ and IFN ⁇ .
- the cytokine is TNF- ⁇ .
- the method is for decreasing the release of a cytokine, which is a member selected from IL-l ⁇ , IL-2, IL-4, IL-5, IL-6, IL-8, IL-IO, IL- 12, IL-23, TNF- ⁇ and IFN ⁇ .
- a cytokine which is a member selected from IL-l ⁇ , IL-2, IL-4, IL-5, IL-6, IL-8, IL-IO, IL- 12, IL-23, TNF- ⁇ and IFN ⁇ .
- the method is for decreasing the production of a cytokine, which is a member selected from IL-4, IL-10, IL-11, W-13 and TGF- ⁇ .
- the method is for decreasing the production of a chemokine, which is a member selected from IL-8, Gro- ⁇ , MIP-I, MCP-I, PGE2, ENA-78, and RANTES.
- a chemokine which is a member selected from IL-8, Gro- ⁇ , MIP-I, MCP-I, PGE2, ENA-78, and RANTES.
- the chemokine is a member selected from MCP-I and PGE2.
- the compound of the invention is present in an amount which will inhibit the production of a cytokine and/or a chemokine by at least about 5 to about 100%, or at least about 30 to about 100%, 40 to about 100%, or at least about 50 to about 100%, or at least about 60 to about 100%, or at least about 70 to about 100%, or at least about 80 to about 100%, or at least about 90 to about 100%, or at least about 30 to about 70%, or at least about 40 to about 90%, or at least about 45 to about 80%, or at least about 55 to about 75%, or at least about 75 to about 98%, or at least about 55 to about 99%, or at least about 5% to about 20% or at least about 10% to about 25%.
- the invention provides a method for increasing the production of a cytokine and/or a chemokine, the method comprising: contacting a cell with a compound of the invention, wherein production of the cytokine and/or chemokine by the cell is increased.
- the cell is contacted with a therapeutically effective amount of the compound.
- the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof.
- the compound of the invention a compound described in a formula provided herein.
- the compound of the invention is a compound described herein.
- the method is for increasing the production of a cytokine, which is a THl cytokine.
- a cytokine which is a THl cytokine.
- the THl cytokine is a member selected from IHN-g and IL-2.
- the method is for increasing the production of a cytokine, which is a TH2 cytokine.
- a cytokine which is a TH2 cytokine.
- the TH2 cytokine is a member selected from IL-4, IL-5 and IL-IO.
- the method is for increasing the production of a cytokine, which is a member selected from IL-4, IL-10, IL-11, W-13 and TGF- ⁇ .
- the method is for increasing the production of a chemokine, which is a member selected from IL-8, Gro- ⁇ , MIP-I, MCP-I, PGE2, ENA-78, and RANTES.
- a chemokine which is a member selected from IL-8, Gro- ⁇ , MIP-I, MCP-I, PGE2, ENA-78, and RANTES.
- the chemokine is a member selected from MCP-I and PGE2.
- the of the invention is present in an amount which will increase the production of a cytokine and/or a chemokine by at least about 5 to about 100%, or at least about 30 to about 100%, 40 to about 100%, or at least about 50 to about 100%, or at least about 60 to about 100%, or at least about 70 to about 100%, or at least about 80 to about 100%, or at least about 90 to about 100%, or at least about 30 to about 70%, or at least about 40 to about 90%, or at least about 45 to about 80%, or at least about 55 to about 75%, or at least about 75 to about 98%, or at least about 55 to about 99%, or at least about 5% to about 20% or at least about 10% to about 25%.
- the invention provides a method for decreasing the release of a cytokine and/or a chemokine, the method comprising: contacting a cell with a compound of the invention, wherein the release of the cytokine and/or chemokine by the cell is decreased.
- the cell is contacted with a therapeutically effective amount of the compound.
- the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof.
- the compound of the invention a compound described in a formula provided herein.
- the compound of the invention is a compound described herein.
- the method is for decreasing the release of a cytokine, which is a THl cytokine.
- a cytokine which is a THl cytokine.
- the THl cytokine is a member selected from IHN-g and IL-2.
- the method is for decreasing the release of a cytokine, which is a TH2 cytokine.
- a cytokine which is a TH2 cytokine.
- the TH2 cytokine is a member selected from IL-4, IL-5 and IL-IO.
- the method is for decreasing the release of a cytokine, which is a member selected from IL- l ⁇ , IL- l ⁇ , IL-2, IL-3, IL-6, IL-7, IL-9, IL-12, IL-17, IL-18, IL-23, TNF- ⁇ , LT, LIF, Oncostatin, IFN ⁇ , IFN ⁇ and IFN ⁇ .
- the cytokine is a member selected from IL-I ⁇ , IL-2, IL-3, IL-6, IL-7, IL-9, IL-12, IL-23, TNF- ⁇ , LT, LIF, Oncostatin, and IFN ⁇ .
- the cytokine is a member selected from IL-I ⁇ , IL-2, IL-23, TNF- ⁇ and IFN ⁇ .
- the cytokine is TNF- ⁇ .
- the method is for decreasing the release of a cytokine, which is a member selected from IL-l ⁇ , IL-2, IL-4, IL-5, IL-6, IL-8, IL-10, IL-12, IL-23, TNF- ⁇ and IFN ⁇ .
- a cytokine which is a member selected from IL-l ⁇ , IL-2, IL-4, IL-5, IL-6, IL-8, IL-10, IL-12, IL-23, TNF- ⁇ and IFN ⁇ .
- the compound described herein decreases the release of IL-l ⁇ , IL-2, IL-4, IL-5, IL-6, IL-8, IL-10, IL-12, IL-23, TNF- ⁇ and IFN ⁇ .
- the method is for decreasing the release of a cytokine, which is a member selected from IL-4, IL-10, IL-11, W- 13 and TGF- ⁇ .
- the method is for decreasing the release of a chemokine, which is a member selected from IL-8, Gro- ⁇ , MIP-I, MCP-I, PGE2, ENA-78, and RANTES.
- the chemokine is a member selected from MCP-I and PGE2.
- the compound described herein decreases the release of TNF- ⁇ , IL-2, IFN ⁇ , IL-5, and IL-10, and does not substantially decrease the release of IL-l ⁇ , IL-6 and IL-8.
- the compound decreases the release of IL-12 and IL-23.
- the compound of the invention is present in an amount which will decrease the release of a cytokine and/or a chemokine by at least about 5 to about 100%, or at least about 30 to about 100%, 40 to about 100%, or at least about 50 to about 100%, or at least about 60 to about 100%, or at least about 70 to about 100%, or at least about 80 to about 100%, or at least about 90 to about 100%, or at least about 30 to about 70%, or at least about 40 to about 90%, or at least about 45 to about 80%, or at least about 55 to about 75%, or at least about 75 to about 98%, or at least about 55 to about 99%, or at least about 5% to about 20% or at least about 10% to about 25%.
- the invention provides a method for increasing the production of a cytokine and/or a chemokine, the method comprising: contacting a cell with a compound of the invention, wherein release of the cytokine and/or chemokine by the cell is increased.
- the cell is contacted with a therapeutically effective amount of the compound.
- the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof.
- the compound of the invention a compound described in a formula provided herein.
- the compound of the invention is a compound described herein.
- the method is for increasing the release of a cytokine, which is a THl cytokine.
- a cytokine which is a THl cytokine.
- the THl cytokine is a member selected from IFN- ⁇ and IL-2.
- the method is for increasing the release of a cytokine, which is a TH2 cytokine.
- the TH2 cytokine is a member selected from IL-4, IL-5 and IL-10.
- the method is for increasing the release of a cytokine, which is a member selected from IL-4, IL-10, IL-11, W- 13 and TGF- ⁇ .
- the method is for increasing the release of a chemokine, which is a member selected from IL-8, Gro- ⁇ , MIP-I, MCP-I, PGE2, ENA-78, and RANTES.
- a chemokine which is a member selected from IL-8, Gro- ⁇ , MIP-I, MCP-I, PGE2, ENA-78, and RANTES.
- the chemokine is a member selected from MCP-I and PGE2.
- the compound of the invention is present in an amount which will increase release of a cytokine and/or a chemokine by at least about 5 to about 100%, or at least about 30 to about 100%, 40 to about 100%, or at least about 50 to about 100%, or at least about 60 to about 100%, or at least about 70 to about 100%, or at least about 80 to about
- the compounds of the present invention and/or combinations of the invention exhibit potency against microorganisms, such as bacteria, and therefore have the potential to kill and/or inhibit the growth of microorganisms.
- Testing for the presence of a beta-lactamase in a bacteria can be accomplished using methods known to one of skill in the art. See, for example, Sturenburg et al., J. Antimic. Chemo.,
- the invention provides a method of killing and/or inhibiting the growth of a microorganism, said method comprising: contacting said microorganism with an effective amount of a compound of the invention, thereby killing and/or inhibiting the growth of the microorganism.
- the invention provides a method of killing and/or inhibiting the growth of a microorganism, said method comprising: contacting said microorganism with an effective amount of a combination of the invention, thereby killing and/or inhibiting the growth of the microorganism.
- the microorganism is a bacteria.
- the compound is described herein, or a salt, prodrug, hydrate or solvate thereof, or a combination thereof.
- the invention provides a compound described herein, or a salt, hydrate or solvate thereof.
- the invention provides a compound described herein, or a prodrug thereof.
- the invention provides a compound described herein, or a salt thereof.
- the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof.
- the compound is described by a formula listed herein, or a pharmaceutically acceptable salt thereof.
- the compound is part of a combination described herein.
- the compound is part of a pharmaceutical formulation described herein.
- the contacting occurs under conditions which permit entry of the compound into the organism. Such conditions are known to one skilled in the art and are described herein.
- the microorganism is inside, or on the surface of an animal.
- the animal is a member selected from human, cattle, deer, reindeer, goat, honey bee, pig, sheep, horse, cow, bull, dog, guinea pig, gerbil, rabbit, cat, camel, yak, elephant, ostrich, otter, chicken, duck, goose, guinea fowl, pigeon, swan, and turkey.
- the animal is a human.
- the microorganism is killed or its growth is inhibited through oral administration of the compound of the invention and/or the combination of the invention. In an exemplary embodiment, the microorganism is killed or its growth is inhibited through intravenous administration of the compound of the invention and/or the combination of the invention.
- the microorganism is a bacterium.
- the bacterium is a gram-positive bacteria.
- the gram-positive bacterium is a member selected from Staphylococcus species, Streptococcus species, Bacillus species, Mycobacterium species, Cory neb acterium species (Propionibacterium species), Clostridium species, Actinomyces species, Enterococcus species and Streptomyces species.
- the gram-positive bacterium is a member selected from Propionibacterium acnes; Staphylococcus aureus; Staphylococcus epidermidis, Staphylococcus saprophyticus; Staphylococcus haemolyticus; Streptococcus pyogenes; Streptococcus agalactiae; Streptococcus pneumoniae; Enterococcus faecalis; Enterococcus faecium; Bacillus anthracis; Mycobacterium avium- intracellulars, Mycobacterium tuberculosis, Acinetobacter baumanii;
- the gram-positive bacterium is a member selected from Staphylococcus aureus, Staphylococcus epidermidis, Streptococcus pneumoniae, Streptococcus pyogenes, Enterococcus faecalis, Enterococcus faecium, Clostridium difficile and Propionibacter acnes.
- the bacterium is a gram- negative bacterium.
- the gram-negative bacterium is a member selected from Acinetobacter species, Neisseria species, Pseudomonas species, Brucella species, Agrobacterium species, Bordetella species, Escherichia species, Shigella species, Yersinia species, Salmonella species, Klebsiella species, Enterobacter species, Haemophilus species, Pasteurella species, Streptobacillus species, spirochetal species, Campylobacter species, Vibrio species, Helicobacter species, Bacteroides species, Citrobacter species, Proteus species, Providencia species, Serratia species, Stenotrophomonas species and Burkholderia species.
- the gram-negative bacterium is a member selected from Acinetobacter species, Pseudomonas species, Escherichia species, Klebsiella species, Enterobacter species, Bacteroides species, Citrobacter species, Proteus species, Providencia species, Serratia species, Stenotrophomonas species and Burkholderia species.
- the gram-negative bacterium is a member selected from Neisseria gonorrhoeae; Neisseria meningitidis; Pseudomonas aeruginosa; Legionella pneumophila; Escherichia coli; Yersinia pestis; Haemophilus influenzae; Helicobacter pylori; Campylobacter fetus; Campylobacter jejuni; Vibrio cholerae; Vibrio parahemolyticus; Trepomena pallidum; Actinomyces israelii; Rickettsia prowazekii; Rickettsia rickettsii; Chlamydia trachomatis; Chlamydia psittaci; Brucella abortus; Agrobacterium tumefaciens; Francisella tularensis, Klebsiella pneumoniae, Enterobacter cloacae
- the gram-negative bacterium is a member selected from Pseudomonas aeruginosa; Escherichia coli; Haemophilus influenzae, Klebsiella pneumoniae, Enterobacter cloacae, Acinetobacter baumannii, Bacteroides fragilis, Citrobacter freundii, Proteus mirabilis, Providencia stuartii, Serratia marcescens, Stenotrophomonas maltophilia and Burkholderia cepacia.
- the gram-negative bacterium is a member selected from Enterobacter aerogenes; Enterobacter cloacae; Enterobacter sakazakii; Escherichia coli; Klebsiella pneumoniae; Proteus mirabilis; Serratia marcescens and Citrobacter freundii.
- the gram-negative bacterium is a Providencia spp..
- the gram-negative bacterium is an Enterobacter spp..
- the bacterium is a Pseudomonas species. In another exemplary embodiment, the bacterium is Pseudomonas aeruginosa. In another exemplary embodiment, the bacterium is a member selected from Pseudomonas aeruginosa; Acinetobacter baumannii, Stenotrophomonas maltophilia and Burkholderia cepacia. In another exemplary embodiment, the bacterium is Acinetobacter baumannii. In another exemplary embodiment, the bacterium is Stenotrophomonas maltophilia. In another exemplary embodiment, the bacterium is Burkholderia cepacia.
- the bacterium is Acinetobacter species. In another exemplary embodiment, the bacterium is Acinetobacter anitratus. In another exemplary embodiment, the bacterium is a member selected from Enterobacter aerogenes, Enterobacter cloacae, Enterobacter sakazakii, E. coli, K. pneumoniae, P. mirabilis, Serratia marcescens, Citrobacter freundii and Providencia spp. In another exemplary embodiment, the bacterium is a member selected from Enterobacter aerogenes, Enterobacter cloacae, Enterobacter sakazakii, E. coli, K. pneumoniae, P.
- the bacterium is a member selected from Pseudomonas aeruginosa; Acinetobacter baumannii; Stenotrophomonas maltophilia; Burkholderia cepacia.
- the bacterium is a member selected from S. aureus, S. pneumonia, S. pyogenes, E. faecalis, and E. faecium.
- the bacterium is a member selected from Viridans group Strep.. In another exemplary embodiment, the bacterium is a member selected from Strep, mitis, Strep, mutans, Strep, oralis, Strep, sanguis, Strep, sobrinus and Strep, millari. In another exemplary embodiment, the bacterium is S. pneumonia. In another exemplary embodiment, the bacterium is H. influenzae. In another exemplary embodiment, the bacterium is S. aureus. In another exemplary embodiment, the bacterium is M. catarrhalis. In another exemplary embodiment, the bacterium is M. pneumoniae. In another exemplary embodiment, the bacterium is L. pneumoniae.
- the bacterium is C. pneumoniae. In another exemplary embodiment, the bacterium is S. pyogenes. In another exemplary embodiment, the bacterium is an anaerobe. In another exemplary embodiment, the bacterium is an Alcaligenes species. In another exemplary embodiment, the bacterium is a B. cepacia. In another exemplary embodiment, the bacterium is a member selected from Enterobacter cloacae, Escherichia coli; Klebsiella pneumoniae, Proteus mirabilis, Providencia stuartii, Serratia marcescens, and
- the bacterium is resistant to methicillin. In another exemplary embodiment, the bacterium is methicillin-resistant staphylococcus aureus. In another exemplary embodiment, the bacterium is a member selected from Streptococcus pneumoniae; Haemophilus influenzae; Staphylococcus aureus; Mycobacterium catarrhalis; Mycobacterium pneumoniae; Legionella pneumophila and Chlamydia pneumoniae.
- the bacterium is a member selected from Enterobacter cloacae, Escherichia coli; Klebsiella pneumoniae, Proteus mirabilis, Serratia marcescens, Citrobacter freundii, Providencia stuartii, Pseudomonas aeruginosa; Acinetobacter baumannii, Stenotrophomonas maltophilia, Burkholderia cepacia, Staphylococcus aureus; Streptococcus pneumoniae; Streptococcus pyogenes; Enterococcus faecalis; and Enterococcus faecium.
- the bacterium is a member selected from Staphylococcus aureus; Staphylococcus epidermidis, Staphylococcus haemolyticus; Streptococcus pyogenes; Streptococcus agalactiae and Streptococcus pneumoniae .
- the microorganism is a bacterium, which is a member selected from acid-fast bacteria, including Mycobacterium species; bacilli, including Bacillus species, Corynebacterium species (also Propionibacterium) and Clostridium species; filamentous bacteria, including Actinomyces species and Streptomyces species; bacilli, such as Pseudomonas species, Brucella species,
- Agrobacterium species Bordetella species, Escherichia species, Shigella species, Yersinia species, Salmonella species, Klebsiella species, Enterobacter species, Haemophilus species, Pasteurella species, and Streptobacillus species; spirochetal species, Campylobacter species, Vibrio species; and intracellular bacteria including Rickettsiae species and Chlamydia species.
- the compounds of the present invention and/or combinations of the invention exhibit potency against microorganisms, such as bacteria, and therefore have the potential to be used to treat and/or prevent a microorganism infection, such as a bacterial infection.
- the invention provides a method of treating a bacterial infection comprising administering to an animal suffering from the infection an effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof, thereby treating the bacterial infection.
- the invention provides a method of treating a bacterial infection comprising administering to an animal suffering from the infection an effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof, and an effective amount of an antibiotic, or a pharmaceutically acceptable salt thereof, thereby treating the bacterial infection.
- the invention provides a method of preventing a bacterial infection comprising administering to an animal a prophylactic amount of a compound of the invention, or a pharmaceutically acceptable salt thereof, thereby treating the bacterial infection.
- the invention provides a method of preventing a bacterial infection comprising administering to an animal a prophylactic amount of a compound of the invention, or a pharmaceutically acceptable salt thereof, and an effective amount of an antibiotic, or a pharmaceutically acceptable salt thereof, thereby treating the bacterial infection.
- the compound used in the method is described herein, or a salt, prodrug, hydrate or solvate thereof, or a combination thereof.
- the compound used in the method is described herein, or a salt, hydrate or solvate thereof.
- compound used in the method is described herein, or a prodrug thereof.
- the compound used in the method is described herein, or a salt thereof.
- the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof.
- the compound is described by a formula listed herein, or a pharmaceutically acceptable salt thereof.
- the compound is part of a combination described herein.
- the compound is part of a pharmaceutical formulation described herein.
- the administering occurs under conditions which permit entry of the compound into the animal, and subsequently into the bacteria. Such conditions are known to one skilled in the art and specific conditions are set forth herein.
- the microorganism is inside, or on the surface of an animal.
- the animal is a member selected from human, cattle, deer, reindeer, goat, honey bee, pig, sheep, horse, cow, bull, dog, guinea pig, gerbil, rabbit, cat, camel, yak, elephant, ostrich, otter, chicken, duck, goose, guinea fowl, pigeon, swan, and turkey.
- the animal is a human.
- the bacterial infection is treated and/or prevented through oral administration of the compound of the invention and/or the combination of the invention. In an exemplary embodiment, the bacterial infection is treated and/or prevented through intravenous administration of the compound of the invention and/or the combination of the invention. In an exemplary embodiment, the bacterial infection is treated and/or prevented through topical administration of the compound of the invention and/or the combination of the invention.
- the bacterial infection is caused by and/or associated with a gram-positive bacteria.
- the gram-positive bacterium is a member selected from Staphylococcus species, Streptococcus species, Bacillus species, Mycobacterium species, Corynebacterium species (Propionibacterium species), Clostridium species, Actinomyces species,
- the gram-positive bacterium is a member selected from Propionibacterium acnes; Staphylococcus aureus; Staphylococcus epidermidis, Staphylococcus saprophyticus; Staphylococcus haemolyticus; Streptococcus pyogenes; Streptococcus agalactiae; Streptococcus pneumoniae; Enterococcus faecalis; Enterococcus faecium; Bacillus anthracis; Mycobacterium avium-intracellulare; Mycobacterium tuberculosis, Acinetobacter baumanii; Corynebacterium diphtheria; Clostridium perfringens; Clostridium botulinum; Clostridium tetani; Clostridium difficile.
- the gram-positive bacterium is a member selected from Sta
- the bacterial infection is caused by and/or associated with a gram-negative bacterium.
- the gram-negative bacterium is a member selected from Acinetobacter species, Neisseria species, Pseudomonas species, Brucella species, Agrobacterium species, Bordetella species, Escherichia species, Shigella species, Yersinia species, Salmonella species, Klebsiella species, Enterobacter species, Haemophilus species, Pasteurella species, Streptobacillus species, spirochetal species, Campylobacter species, Vibrio species, Helicobacter species, Bacteroides species, Citrobacter species, Proteus species, Providencia species, Serratia species, Stenotrophomonas species and Burkholderia species.
- the gram-negative bacterium is a member selected from Acinetobacter species, Pseudomonas species, Escherichia species, Klebsiella species, Enterobacter species, Bacteroides species, Citrobacter species, Proteus species, Providencia species, Serratia species, Stenotrophomonas species and Burkholderia species.
- the gram-negative bacterium is a member selected from Neisseria gonorrhoeae; Neisseria meningitidis; Pseudomonas aeruginosa; Legionella pneumophila; Escherichia coli; Yersinia pestis; Haemophilus influenzae; Helicobacter pylori; Campylobacter fetus; Campylobacter jejuni; Vibrio cholerae; Vibrio parahemolyticus; Trepomena pallidum; Actinomyces israelii; Rickettsia prowazekii; Rickettsia rickettsii; Chlamydia trachomatis; Chlamydia psittaci; Brucella abortus; Agrobacterium tumefaciens; Francisella tularensis, Klebsiella pneumoniae, Enterobacter cloacae
- the gram-negative bacterium is a member selected from Pseudomonas aeruginosa; Escherichia coli; Haemophilus influenzae, Klebsiella pneumoniae, Enterobacter cloacae, Acinetobacter baumannii, Bacteroides fragilis, Citrobacter freundii, Proteus mirabilis, Providencia stuartii, Serratia marcescens, Stenotrophomonas maltophilia and Burkholderia cepacia.
- the gram-negative bacterium is a member selected from Enterobacter aerogenes; Enterobacter cloacae; Enterobacter sakazakii; Escherichia coli;
- the gram-negative bacterium is a Providencia spp.. In another exemplary embodiment, the gram-negative bacterium is an Enterobacter spp.. [0348] In another exemplary embodiment, the bacterial infection is caused by and/or associated with a Pseudomonas species. In another exemplary embodiment, the bacterial infection is caused by and/or associated with Pseudomonas aeruginosa.
- the bacterial infection is caused by and/or associated with a member selected from Pseudomonas aeruginosa; Acinetobacter baumannii, Stenotrophomonas maltophilia and Burkholderia cepacia.
- the bacterial infection is caused by and/or associated with Acinetobacter baumannii.
- the bacterial infection is caused by and/or associated with Stenotrophomonas maltophilia.
- the bacterial infection is caused by and/or associated with Burkholderia cepacia.
- the bacterial infection is caused by and/or associated with Acinetobacter species.
- the bacterial infection is caused by and/or associated with Acinetobacter anitratus.
- the bacterial infection is caused by and/or associated with a member selected from Enterobacter aerogenes, Enterobacter cloacae, Enterobacter sakazakii, E. coli, K. pneumoniae, P. mirabilis, Serratia marcescens, Citrobacter freundii and Providencia spp.
- the bacterial infection is caused by and/or associated with a member selected from Enterobacter aerogenes, Enterobacter cloacae, Enterobacter sakazakii, E. coli, K. pneumoniae, P. mirabilis, Serratia marcescens, Citrobacter freundii,
- the bacterial infection is caused by and/or associated with a member selected from Pseudomonas aeruginosa; Acinetobacter baumannii; Stenotrophomonas maltophilia; Burkholderia cepacia.
- the bacterial infection is caused by and/or associated with a member selected from S. aureus, S. pneumonia, S. pyogenes, E. faecalis, and E. faecium.
- the bacterial infection is caused by and/or associated with Viridans group Strep.. In another exemplary embodiment, the bacterial infection is caused by and/or associated with a member selected from Strep. mitis, Strep, mutans, Strep, oralis, Strep, sanguis, Strep, sobrinus and Strep, millari. In another exemplary embodiment, the bacterial infection is caused by and/or associated with S. pneumonia. In another exemplary embodiment, the bacterial infection is caused by and/or associated with H. influenzae. In another exemplary embodiment, the bacterial infection is caused by and/or associated with S. aureus. In another exemplary embodiment, the bacterial infection is caused by and/or associated with M. catarrhalis.
- the bacterial infection is caused by and/or associated with M. pneumoniae. In another exemplary embodiment, the bacterial infection is caused by and/or associated with L. pneumoniae. In another exemplary embodiment, the bacterial infection is caused by and/or associated with C. pneumoniae. In another exemplary embodiment, the bacterial infection is caused by and/or associated with S. pyogenes. In another exemplary embodiment, the bacterial infection is caused by and/or associated with an anaerobe. In another exemplary embodiment, the bacterial infection is caused by and/or associated with A lcaligenes species. In another exemplary embodiment, the bacterial infection is caused by and/or associated with B. cepacia.
- the bacterial infection is caused by and/or associated with a member selected from Enterobacter cloacae, Escherichia coli; Klebsiella pneumoniae, Proteus mirabilis, Providencia stuartii, Serratia marcescens, and Citrobacter freundii.
- the bacterial infection is caused by and/or associated with a bacteria which is resistant to methicillin.
- the bacterial infection is caused by and/or associated with methicillin-resistant staphylococcus aureus.
- the bacterial infection is caused by and/or associated with a member selected from Streptococcus pneumoniae; Haemophilus influenzae; Staphylococcus aureus; Mycobacterium catarrhalis; Mycobacterium pneumoniae; Legionella pneumophila and Chlamydia pneumoniae.
- the bacterial infection is caused by and/or associated with a member selected from Enterobacter cloacae, Escherichia coli; Klebsiella pneumoniae, Proteus mirabilis, Serratia marcescens, Citrobacter freundii, Providencia stuartii, Pseudomonas aeruginosa; Acinetobacter baumannii, Stenotrophomonas maltophilia, Burkholderia cepacia, Staphylococcus aureus; Streptococcus pneumoniae; Streptococcus pyogenes; Enterococcus faecalis; and Enterococcus faecium.
- the bacterial infection is caused by and/or associated with a member selected from Staphylococcus aureus; Staphylococcus epidermidis, Staphylococcus haemolyticus; Streptococcus pyogenes; Streptococcus agalactiae and Streptococcus pneumoniae.
- the bacterial infection is caused by and/or associated with a member selected from acid- fast bacteria, including Mycobacterium species; bacilli, including Bacillus species, Corynebacterium species (also Propionibacterium) and Clostridium species; filamentous bacteria, including Actinomyces species and Streptomyces species; bacilli, such as Pseudomonas species, Brucella species, Agrobacterium species, Bordetella species, Escherichia species, Shigella species, Yersinia species, Salmonella species, Klebsiella species,
- acid- fast bacteria including Mycobacterium species
- bacilli including Bacillus species, Corynebacterium species (also Propionibacterium) and Clostridium species
- filamentous bacteria including Actinomyces species and Streptomyces species
- bacilli such as Pseudomonas species, Brucella species, Agrobacterium species, Bordetella species, Escherichia species, Shig
- Enterobacter species Haemophilus species, Pasteurella species, and Streptobacillus species; spirochetal species, Campylobacter species, Vibrio species; and intracellular bacteria including Rickettsiae species and Chlamydia species.
- the compounds of the invention and/or combinations of the present invention exhibit potency against microorganisms, such as bacteria, and therefore have the potential to achieve therapeutic efficacy in the animals described herein.
- the invention provides a method of treating and/or preventing a disease.
- the method includes administering to the animal a therapeutically effective amount of a compound of the invention, sufficient to treat and/or prevent the disease.
- the method includes administering to the animal a therapeutically effective amount of a combination of the invention, sufficient to treat and/or prevent the disease.
- the compound of the invention or the combination of the invention can be used in human or veterinary medical therapy, particularly in the treatment or prophylaxis of bacterial-associated disease.
- the compound is described herein, or a salt, prodrug, hydrate or solvate thereof, or a combination thereof.
- the invention provides a compound described herein, or a prodrug thereof.
- the invention provides a compound described herein, or a salt, hydrate or solvate thereof.
- the invention provides a compound described herein, or a salt thereof.
- the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof.
- the compound is a compound described herein, or a pharmaceutically acceptable salt thereof.
- the compound is according to a formula described herein, or a pharmaceutically acceptable salt thereof.
- the compound is part of a combination described herein.
- the compound is part of a pharmaceutical formulation described herein.
- the animal is a member selected from human, cattle, deer, reindeer, goat, honey bee, pig, sheep, horse, cow, bull, dog, guinea pig, gerbil, rabbit, cat, camel, yak, elephant, ostrich, otter, chicken, duck, goose, guinea fowl, pigeon, swan, and turkey.
- the animal is a human.
- the animal is a member selected from a human, cattle, goat, pig, sheep, horse, cow, bull, dog, guinea pig, gerbil, rabbit, cat, chicken and turkey.
- the disease is a member selected from a systemic disease.
- the disease is a topical disease.
- the disease is treated through oral administration of a compound of the invention and/or a combination of the invention.
- the disease is treated through intravenous administration of a compound of the invention and/or a combination of the invention.
- the invention provides a method of treating a systemic disease.
- the method involves contacting an animal with a compound of the invention and/or a combination of the invention.
- the disease is a member selected from candidiasis, aspergillosis, coccidioidomycosis, cryptococcosis, histoplasmosis, blastomycosis, paracoccidioidomycosis, zygomycosis, phaeohyphomycosis and rhinosporidiosis.
- the disease is associated with infection by a Gram-positive bacteria.
- the disease is associated with a Staphylococcus species.
- the disease is a member selected from pneumonia, gastroenteritis, toxic shock syndrome, community acquired pneumonia (CAP), meningitis, septic arthritis, urinary tract infection, bacteremia, endocarditis, osteomylitis, skin and skin-structure infection.
- the disease is associated with a Streptococcus species.
- the disease is a member selected from strep throat, skin infections, necrotizing fasciitis, toxic shock syndrome, pneumonia, otitis media and sinusitis.
- the disease is associated with an Actinomyces species. In another exemplary embodiment, the disease is actinomycosis. In an exemplary embodiment, the disease is associated with a Norcardia species. In another exemplary embodiment, the disease is pneumonia. In an exemplary embodiment, the disease is associated with a Corynebacterium species. In another exemplary embodiment, the disease is diptheria. In an exemplary embodiment, the disease is associated with a Listeria species. In another exemplary embodiment, the disease is meningitis. In an exemplary embodiment, the disease is associated with a Bacillus species. In another exemplary embodiment, the disease is a member selected from anthrax and food poisoning. In an exemplary embodiment, the disease is associated with a Clostridium species.
- the disease is a member selected from botulism, tetanus, gas gangrene and diarrhea. In an exemplary embodiment, the disease is associated with a Mycobacterium species. In another exemplary embodiment, the disease is a member selected from tuberculosis and leprosy.
- the disease is associated with infection by a Gram-negative bacteria.
- the disease is associated with a Neisseria species.
- the disease is a member selected from meningitis, gonorrhea, otitis externa and folliculitis.
- the disease is associated with an Escherichia species.
- the disease is a member selected from diarrhea, urinary tract infections, meningitis, sepsis and HAP.
- the disease is associated with a Shigella species.
- the disease is a member selected from diarrhea, bacteremia, endocarditis, meningitis and gastroenteritis.
- the disease is associated with a Salmonella species.
- the disease is a member selected from Typhoid fever, supsis, gastroenteritis, endocarditis, sinusitis and meningitis.
- the disease is associated with a Yersinia species.
- the disease is a member selected from Typhoid fever, bubonic plague, enteric fever and gastroenteritis.
- the disease is associated with a Klebsiella species.
- the disease is a member selected from sepsis and urinary tract infection.
- the disease is associated with a Proteus species.
- the disease is an urinary tract infection. In an exemplary embodiment, the disease is associated with an Enterobacter species. In another exemplary embodiment, the disease is a hospital-acquired infection. In an exemplary embodiment, the disease is associated with a Serratia species. In another exemplary embodiment, the disease is a member selected from a urinary tract infection, skin and skin-structure infection and pneumonia. In an exemplary embodiment, the disease is associated with a Vibrio species. In another exemplary embodiment, the disease is a member selected from cholera and gastroenteritis. In an exemplary embodiment, the disease is associated with a Campylobacter species. In another exemplary embodiment, the disease is gastroenteritis. In an exemplary embodiment, the disease is associated with a Helicobacter species.
- the disease is chronic gastritis.
- the disease is associated with a Pseudomonas species.
- the disease is a member selected from pneumonia, osteomylitis, burn-wound infections, sepsis, UTIs, endocarditis, otitis, corneal infections.
- the disease is associated with a Bacteroides species.
- the disease is a member selected from periodontal disease and aspriation pneumonia.
- the disease is associated with a Haemophilus species.
- the disease is a member selected from meningitis, epiglottitis, septic arthritis, sepsis, chancroid and vaginitis.
- the disease is associated with a Bordetella species.
- the disease is Whooping cough.
- the disease is associated with a Legionella species.
- the disease is a member selected from pneumonia and pontiac fever.
- the disease is associated with a Francis ella species.
- the disease is tularemia.
- the disease is associated with a Brucella species.
- the disease is brucellosis.
- the disease is associated with a Pasteur ella species. In another exemplary embodiment, the disease is a skin infection. In an exemplary embodiment, the disease is associated with a Gardner ella species. In another exemplary embodiment, the disease is vaginitis. In an exemplary embodiment, the disease is associated with a Spirochetes species. In another exemplary embodiment, the disease is syphilis and Lyme disease. In an exemplary embodiment, the disease is associated with a Chlamydia species. In another exemplary embodiment, the disease is chlamydia. In an exemplary embodiment, the disease is associated with a Rickettsiae species. In another exemplary embodiment, the disease is a member selected from Rocky Mountain spotted fever and typhus.
- the disease is associated with Mycoplasma pneumoniae.
- the disease is a member selected from tracheobronchitis and walking pneumonia.
- the disease is associated with Ureaplasma urealyticum.
- the disease is urethritis.
- the disease is pyelonephritis.
- the disease is an intraabdominal infection.
- the disease is febrile neutropenia.
- the disease is a pelvic infection.
- the disease is bacteraemia.
- the disease is septicaemia.
- the disease is an acute exacerbation of chronic obstructive pulmonary disease.
- the disease is chronic obstructive pulmonary disease.
- the disease is pharyngitis.
- the disease is tonsillitis.
- the disease is Acute Exacerbation of Chronic Bronchitis (AECB).
- the disease is cervicitis.
- the disease is genital ulcer disease. VI. k) Conditions and Effects
- the invention provides a method of treating and/or preventing a condition, or enhancing an effect, in an animal, the method comprising administering to the animal an amount of a compound of the invention, thereby treating or preventing the condition.
- the amount is a therapeutically effective amount.
- the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof.
- the compound of the invention a compound described in a formula provided herein.
- the compound of the invention is a compound described herein.
- the condition is a disease.
- the condition is an inflammatory-related condition.
- the condition involves the increase of production of a cytokine and/or a chemokine. In an exemplary embodiment, the condition involves the decrease of production of a cytokine and/or a chemokine. In an exemplary embodiment, the condition involves the increase of release of a cytokine and/or a chemokine. In an exemplary embodiment, the condition involves the decrease of release of a cytokine and/or a chemokine. In an exemplary embodiment, the condition involves the inhibition of a phosphodiesterase.
- the compound is in an amount sufficient to treat the inflammatory-related disease by inhibiting proinflammatory cytokine expression or by stimulating anti-inflammatory cytokine expression, but the amount is less than sufficient to substantially inhibit cyclin dependent kinases.
- the condition is mediated by a cytokine.
- the condition is mediated by a chemokine.
- the condition is mediated by a neutrophil.
- the condition is mediated by a phosphodiesterase.
- the condition is mediated by a phosphodiesterase ⁇
- the condition is mediated by a phosphodiesterase?.
- the condition is a member selected from periodontitis, dry eye disease, rheumatoid arthritis, osteoarthritis, Crohn's disease, ulcerative colitis, psoriatic arthritis, traumatic arthritis, rubella arthritis, inflammatory bowel disease, multiple sclerosis, psoriasis, graft versus host disease, systemic lupus erythematosus, toxic shock syndrome, irritable bowel syndrome, muscle degeneration, allograft rejections, pancreatitis, insulinitis, glomerulonephritis, diabetic nephropathy, renal fibrosis, chronic renal failure, gout, leprosy, acute synovitis, Reiter's syndrome, gouty arthritis, Behcet's disease, spondylitis, endometriosis, non-articular inflammatory conditions, such as intervertebral disk syndrome conditions, bursitis, tendonitis, tenosynovitis or
- cytokine mediated diseases are allergy, a metabolic disease, a chemotherapy/radiation related complication; diabetes type I; diabetes type II; a liver disease; a gastrointestinal disorder; an ophthamological disease; allergic conjunctivitis; diabetic retinopathy; Sjogren's syndrome; uveitis; a pulmonary disorder, a renal disease; dermatitis; HIV-related cachexia; cerebral malaria; ankylosing spondolytis; leprosy; anemia; fibromyalgia, kidney failure, stroke, chronic heart failure, endotoxemia, reperfusion injury, ischemia reperfusion, myocardial ischemia, restenosis, thrombosis, angiogenesis, Coronary Heart Disease, Coronary Artery Disease, acute coronary syndrome, Takayasu arteritis, cardiac failure such as heart failure, aortic valve stenosis, cardiomyopathy, myocarditis, vasculitis, vascular restenosis, valvular disease or
- the condition is a member selected from allergic conjunctivitis, uveitis, glaucoma, optic neuritis, retinal ischemia, diabetic retinopathy, laser induced optic damage, or surgery or trauma-induced proliferative vitreoretinopathy.
- the condition is a member selected from allergic rhinitis, asthma, adult respiratory distress syndrome, chronic pulmonary inflammation, chronic obstructive pulmonary disease, emphysema, bronchitis, mucus hypersecretion, silicosis, SARS infection and respiratory tract inflammation.
- the condition is a member selected from psoriasis, eczema, atopic dermatitis, contact dermatitis, or acne.
- the condition is a member selected from Guillain-Barre syndrome, Parkinson's disease, Huntington's disease, Alzheimer's disease, amyotrophic lateral sclerosis, multiple sclerosis and other demyelinating diseases, viral and bacterial meningitis, CNS trauma, spinal cord injury, seizures, convulsions, olivopontocerebellar atrophy, AIDS dementia complex, MERRF and MELAS syndromes, Leber's disease, Wernicke's encephalophathy, Rett syndrome, homocysteinuria, hyperprolinemia, hyperhomocysteinemia, nonketotic hyperglycinemia, hydroxybutyric aminoaciduria, sulfite oxidase deficiency, combined systems disease, lead ence
- the condition is a member selected from bone resorption diseases, osteopetrosis, osteoporosis, or osteoarthritis.
- the condition is a member selected from diabetes, systemic cachexia, cachexia secondary to infection or malignancy, cachexia secondary to acquired immune deficiency syndrome (AIDS), obesity, anorexia or bulimia nervosa.
- the condition is a member selected from sepsis, HIV, HCV, malaria, infectious arthritis, leishmaniasis, Lyme disease, cancer, including but not limited to breast cancer, colon cancer, lung cancer, prostatic cancer, multiple myeloma, acute myelogenous leukemia, myelodysplastic syndrome, non-Hodgkins lymphoma, or follicular lymphoma, Castleman's disease, or drug resistance.
- the condition is a member selected from is bronchial asthma, rhinitis, influenza, stroke, myocardial infarction, thermal injury, adult respiratory distress syndrome (ARDS), multiple organ injury secondary to trauma, acute glomerulonephritis, dermatoses with acute inflammatory components, acute purulent meningitis, hemodialysis, leukopheresis, granulocyte transfusion associated syndromes, or necrotizing enterocolitis.
- the condition is a member selected from inflammatory bowel disease (IBD), psoriasis, rheumatoid arthritis (RA), multiple sclerosis (MS), neurodegenerative disorder, cardiovascular disease (CVD) and atherosclerosis, and metabolic disease (the metabolic syndrome and diabetes) as well as infection-related inflammation.
- the condition is a neurodegenerative disorder which is a member selected from Alzheimer's disease and Parkinson disease.
- the condition is inflammatory bowel disease which is selected from the group consisting of: Crohn's disease or ulcerative colitis.
- the condition is a gastrointestinal complication.
- the condition is diarrhea.
- the condition is a member selected from celiac disease and non-specific colitis.
- the condition is a liver disease.
- the condition is a member selected from an autoimmune hepatitis, hepatitis C, primary biliary cirrhosis, primary sclerosing cholangitis, or fulminant liver failure.
- the condition is a bone disease.
- the condition is osteoporosis.
- the condition is a pulmonary disorder.
- condition is a member selected from: allergic rhinitis, asthma, chronic obstructive pulmonary disease, chronic granulomatous inflammation, cystic fibrosis, and sarcoidosis.
- condition is cardiovascular disease.
- the cardiovascular disease is a member selected from atheroscleotic cardiac disease, congestive heart failure and restenosis.
- the condition is a renal disease.
- the condition is a member selected from glomerulonephritis and vasculitis.
- the condition is a member selected from post-radiotherapy related disease or atherosclerosis.
- condition is atopic dermatitis.
- condition is actinic keratosis.
- the PDE4 inhibition is treating and/or preventing a disorder
- the disorder is a member selected from psoriasis, inflammatory arthritis, rheumatoid arthritis, asthma, chronic bronchitis, inflammatory bowel disease (IBD), chronic obstructive pulmonary disease (COPD), atopic dermatitis, urticaria, allergic rhinitis, allergic conjunctivitis, vernal conjunctivitis, colitis, esoniophilic granuloma, septic shock, reperfusion injury of the myocardium, reperfusion injury of the brain, chronic glomerulonephritis, endotoxic shock, adult respiratory distress syndrome, cystic fibrosis, arterial restenosis, atherosclerosis, keratosis, rheumatoid spondylitis, osteoarthritis, pyresis, diabetes mellitus, pneumoconiosis, chronic obstruct
- the colitis is a member selected from ulcerative colitis, Crohn's colitis, diversion colitis, ischemic colitis, infectious colitis, fulminant colitis, chemical colitis, microscopic colitis, lymphocytic colitis, and atypical colitis.
- the colitis is a member selected from ulcerative colitis and Crohn's colitis.
- the condition is psoriasis.
- psoriasis is a member selected from plaque psoriasis, flexural psoriasis (inverse psoriasis), guttate psoriasis, pustular psoriasis, nail psoriasis, psoriatic arthritis and erythrodermic psoriasis.
- the psoriasis is a member selected from plaque psoriasis and nail psoriasis.
- the disorder is a member selected from cognition impairment or decline and memory impairment.
- the memory impairment is due to dementia.
- the patient is suffering from memory impairment due to Alzheimer's disease, schizophrenia, Parkinson's disease, Huntington's disease, Pick's disease, Creutzfeld- Jakob disease, depression, aging, head trauma, stroke, CNS hypoxia, cerebral senility, multiinfarct dementia, an acute neuronal disease, age-related cognitive decline, HIV or a cardiovascular disease.
- the PDE4 inhibition is enhancing an effect, wherein the enhanced effect is cognition or memory.
- the invention provides a method for stimulating ovarian follicular growth in a female, comprising administering to a female a medicament comprising a compound described herein or a pharmaceutically acceptable salt thereof, whereby ovarian follicular growth is stimulated in the female.
- the female is undergoing ovulation induction.
- the female is undergoing controlled ovarian hyperstimulation.
- the medicament is administered simultaneously, separately or sequentially with follicle stimulating hormone (FSH), or an agent having FSH activity, or an agent that stimulates endogenous FSH release.
- FSH follicle stimulating hormone
- the invention also provides a method of treating an inflammatory-related disease associated with cytokine expression levels, which comprises administering to an animal in need of such treatment the compound described herein or a pharmaceutically acceptable salt thereof.
- the compound is according to a formula described herein.
- the invention provides a method of treating or preventing an inflammatory-related disease in an animal, the method comprising administering to the animal a therapeutically effective amount of a compound described herein or a pharmaceutically acceptable salt thereof, wherein the compound is in an amount sufficient to treat the inflammatory-related disease by inhibiting proinflammatory cytokine expression or by stimulating anti-inflammatory cytokine expression, but the amount is less than sufficient to substantially inhibit cyclin dependent kinases.
- the invention provides a method for inhibiting the production of an inflammatory cytokine by cells capable of producing the inflammatory cytokine, the method comprises contacting a cell with a therapeutic amount of the compound described herein or a pharmaceutically acceptable salt thereof, wherein production of the inflammatory cytokine by the cells is inhibited.
- the therapeutic amount is sufficient to inhibit the production of the inflammatory cytokine protein between about 50% and about 99%.
- the invention provides a method for inhibiting an inflammatory response in an animal, the method comprising: contacting the animal with a therapeutic amount of the compound described herein or a pharmaceutically acceptable salt thereof, wherein the inflammatory response is inhibited.
- the animal is a member selected from human, cattle, deer, reindeer, goat, honey bee, pig, sheep, horse, cow, bull, dog, guinea pig, gerbil, rabbit, cat, camel, yak, elephant, ostrich, otter, chicken, duck, goose, guinea fowl, pigeon, swan, and turkey.
- the animal is a member selected from a human, cattle, goat, pig, sheep, horse, cow, bull, dog, guinea pig, gerbil, rabbit, cat, chicken and turkey.
- the animal is a human.
- a compound of the invention for any of the methods described herein, a compound of the invention, a combination of the invention, a compound described herein or a pharmaceutically acceptable salt thereof, or combination described herein, and/or a pharmaceutical formulation described herein can be used.
- the invention provides a pharmaceutical formulation comprising: a) a compound of the invention; and b) a pharmaceutically acceptable excipient.
- the invention provides a pharmaceutical formulation comprising: a) a combination of the invention; and b) a pharmaceutically acceptable excipient.
- the compound is according to a formula described herein.
- the compound is according to an example described herein.
- the compound of the invention or combination of the invention is a compound described herein or combination described herein, or a pharmaceutically acceptable salt thereof.
- the compound of the invention is a compound described herein.
- the compound of the invention is present in the pharmaceutical formulation in an amount of between about 0.0001% to about 60% (w/w). In an exemplary embodiment, the amount is between about 0.01% to about 10% (w/w). In an exemplary embodiment, the amount is between about 0.1% to about 10% (w/w). In an exemplary embodiment, the amount is between about 0.25% to about 6% (w/w). In an exemplary embodiment, the amount is between about 0.5% to about 5% (w/w). In an exemplary embodiment, the amount is between about 0.1% and about 1.0% (w/w). In an exemplary embodiment, the amount is between about 1.0% and about 2.0% (w/w). In an exemplary embodiment, the amount is between about 2.0% and about 3.0% (w/w). In an exemplary embodiment, the amount is between about 3.0% and about 4.0% (w/w). In an exemplary embodiment, the amount is between about 4.0% and about 5.0% (w/w).
- the pharmaceutical formulations of the invention can take a variety of forms adapted to the chosen route of administration. Those skilled in the art will recognize various synthetic methodologies that may be employed to prepare non-toxic pharmaceutical formulations incorporating the compounds described herein. Those skilled in the art will recognize a wide variety of non-toxic pharmaceutically acceptable solvents that may be used to prepare solvates of the compounds of the invention, such as water, ethanol, propylene glycol, mineral oil, vegetable oil and dimethylsulfoxide (DMSO).
- DMSO dimethylsulfoxide
- compositions of the invention may be administered orally, topically, parenterally, by inhalation or spray or rectally in dosage unit formulations containing conventional non-toxic pharmaceutically acceptable carriers, adjuvants and vehicles. It is further understood that the best method of administration may be a combination of methods. Oral administration in the form of a pill, capsule, elixir, syrup, lozenge, troche, or the like is particularly preferred.
- parenteral as used herein includes subcutaneous injections, intradermal, intravascular (e.g., intravenous), intramuscular, spinal, intrathecal injection or like injection or infusion techniques.
- the pharmaceutical formulations containing compounds of the invention are preferably in a form suitable for oral use, for example, as tablets, troches, lozenges, aqueous or oily suspensions, dispersible powders or granules, emulsion, hard or soft capsules, or syrups or elixirs.
- compositions intended for oral use may be prepared according to any method known in the art for the manufacture of pharmaceutical formulations, and such compositions may contain one or more agents selected from the group consisting of sweetening agents, flavoring agents, coloring agents and preserving agents in order to provide pharmaceutically elegant and palatable preparations.
- Tablets may contain the active ingredient in admixture with non-toxic pharmaceutically acceptable excipients that are suitable for the manufacture of tablets.
- excipients may be for example, inert diluents, such as calcium carbonate, sodium carbonate, lactose, calcium phosphate or sodium phosphate; granulating and disintegrating agents, for example, corn starch, or alginic acid; binding agents, for example starch, gelatin or acacia; lubricating agents, for example magnesium stearate, stearic acid or talc; and extenders and bulking agents, such as microcrystalline cellulose.
- the tablets may be uncoated or they may be coated by known techniques to delay disintegration and absorption in the gastrointestinal tract and thereby provide a sustained action over a longer period.
- a time delay material such as glyceryl monostearate or glyceryl distearate may be employed.
- Formulations for oral use may also be presented as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluent, for example, calcium carbonate, calcium phosphate or kaolin, or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium, for example peanut oil, liquid paraffin or olive oil.
- an inert solid diluent for example, calcium carbonate, calcium phosphate or kaolin
- water or an oil medium for example peanut oil, liquid paraffin or olive oil.
- Aqueous suspensions contain the active materials in admixture with excipients suitable for the manufacture of aqueous suspensions.
- excipients are suspending agents, for example sodium carboxymethylcellulose, methylcellulose, hydroxypropylmethylcellulose, sodium alginate, polyvinylpyrrolidone, gum tragacanth and gum acacia; and dispersing or wetting agents, which may be a naturally-occurring phosphatide, for example, lecithin, or condensation products of an alkylene oxide with fatty acids, for example polyoxyethylene stearate, or condensation products of ethylene oxide with long chain aliphatic alcohols, for example heptadecaethyleneoxycetanol, or condensation products of ethylene oxide with partial esters derived from fatty acids and a hexitol such as polyoxyethylene sorbitol monooleate, or condensation products of ethylene oxide with partial esters derived from fatty acids and hexitol anhydrides, for example polyethylene sorbito
- the aqueous suspensions may also contain one or more preservatives, for example ethyl, or n-propyl p-hydroxybenzoate, one or more coloring agents, one or more flavoring agents, and one or more sweetening agents, such as sucrose or saccharin.
- preservatives for example ethyl, or n-propyl p-hydroxybenzoate
- coloring agents for example ethyl, or n-propyl p-hydroxybenzoate
- flavoring agents for example ethyl, or n-propyl p-hydroxybenzoate
- sweetening agents such as sucrose or saccharin.
- Oily suspensions may be formulated by suspending the active ingredients in a vegetable oil, for example arachis oil, olive oil, sesame oil or coconut oil, or in a mineral oil such as liquid paraffin.
- the oily suspensions may contain a thickening agent, for example beeswax, hard paraffin or cetyl alcohol.
- Sweetening agents such as those set forth above, and flavoring agents may be added to provide palatable oral preparations. These compositions may be preserved by the addition of an anti-oxidant such as ascorbic acid.
- Dispersible powders and granules suitable for preparation of an aqueous suspension by the addition of water provide the active ingredient in admixture with a dispersing or wetting agent, suspending agent and one or more preservatives.
- a dispersing or wetting agent e.g., kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, ka
- dispersing agents include hydrophilic polymers, electrolytes, TweenTM 60 or 80, PEG, polyvinylpyrrolidone (PVP; commercially known as PlasdoneTM), and the carbohydrate -based dispersing agents such as, for example, hydroxypropylcellulose and hydroxypropylcellulose ethers (e.g., HPC, HPC-SL, and HPC-L), hydroxypropylmethylcellulose and hydroxypropylmethylcellulose ethers (e.g.
- HPMC KlOO, HPMC K4M, HPMC Kl 5M, and HPMC KlOOM carboxymethylcellulose sodium, methylcellulose, hydroxyethylcellulose, hydroxypropylmethylcellulose phthalate, hydroxypropylmethylcellulose acetate stearate, noncrystalline cellulose, magnesium aluminum silicate, triethanolamine, polyvinyl alcohol (PVA), polyvinylpyrrolidone/vinyl acetate copolymer (PlasdoneTM, e.g., S-630), 4-(l,l,3,3-tetramethylbutyl)-phenol polymer with ethylene oxide and formaldehyde (also known as tyloxapol), poloxamers (e.g., Pluronics F68TM, F88TM, and F 108TM, which are block copolymers of ethylene oxide and propylene oxide); and poloxamines (e.g., Tetronic 9080, also known as Poloxamine 9080, which is a tetrafunctional block
- compositions of the invention may also be in the form of oil-in-water emulsions and water-in-oil emulsions.
- the oily phase may be a vegetable oil, for example olive oil or arachis oil, or a mineral oil, for example liquid paraffin or mixtures of these.
- Suitable emulsifying agents may be naturally-occurring gums, for example gum acacia or gum tragacanth; naturally-occurring phosphatides, for example soy bean, lecithin, and esters or partial esters derived from fatty acids and hexitol; anhydrides, for example sorbitan monooleate; and condensation products of the said partial esters with ethylene oxide, for example polyoxyethylene sorbitan monooleate.
- the emulsions may also contain sweetening and flavoring agents.
- Syrups and elixirs may be formulated with sweetening agents, for example glycerol, propylene glycol, sorbitol or sucrose.
- Such formulations may also contain a demulcent, a preservative, and flavoring and coloring agents.
- the pharmaceutical formulations may be in the form of a sterile injectable aqueous or oleaginous suspension. This suspension may be formulated according to the known art using those suitable dispersing or wetting agents and suspending agents, which have been mentioned above.
- the sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally acceptable diluent or solvent, for example as a solution in 1,3-butanediol.
- the acceptable vehicles and solvents that may be employed are water, Ringer's solution and isotonic sodium chloride solution.
- sterile, fixed oils are conventionally employed as a solvent or suspending medium.
- any bland fixed oil may be employed including synthetic mono- or diglycerides.
- fatty acids such as oleic acid find use in the preparation of injectables.
- composition of the invention may also be administered in the form of suppositories, e.g., for rectal administration of the drug.
- suppositories e.g., for rectal administration of the drug.
- These compositions can be prepared by mixing the drug with a suitable non-irritating excipient that is solid at ordinary temperatures but liquid at the rectal temperature and will therefore melt in the rectum to release the drug.
- suitable non-irritating excipient that is solid at ordinary temperatures but liquid at the rectal temperature and will therefore melt in the rectum to release the drug.
- Such materials are cocoa butter and polyethylene glycols.
- compositions can be administered parenterally in a sterile medium.
- the drug depending on the vehicle and concentration used, can either be suspended or dissolved in the vehicle.
- adjuvants such as local anesthetics, preservatives and buffering agents can be dissolved in the vehicle.
- the composition containing the therapeutic compound may be added to the animal's feed or drinking water. Also, it will be convenient to formulate animal feed and drinking water products so that the animal takes in an appropriate quantity of the compound in its diet. It will further be convenient to present the compound in a composition as a premix for addition to the feed or drinking water. The composition can also added as a food or drink supplement for humans.
- the amount of active ingredient that may be combined with the carrier materials to produce a single dosage form will vary depending upon the condition being treated and the particular mode of administration. Dosage unit forms will generally contain between from about 1 mg to about 500 mg of an active ingredient.
- Frequency of dosage may also vary depending on the compound used and the particular disease treated. However, for treatment of most disorders, a dosage regimen of 4 times daily or less is preferred. It will be understood, however, that the specific dose level for any particular patient will depend upon a variety of factors including the activity of the specific compound employed, the age, body weight, general health, sex, diet, time of administration, route of administration and rate of excretion, drug combination and the severity of the particular disease undergoing therapy.
- Preferred compounds of the invention will have desirable pharmacological properties that include, but are not limited to, oral bioavailability, low toxicity, low serum protein binding and desirable in vitro and in vivo half- lives. Penetration of the blood brain barrier for compounds used to treat CNS disorders is necessary, while low brain levels of compounds used to treat peripheral disorders are often preferred.
- Assays may be used to predict these desirable pharmacological properties. Assays used to predict bioavailability include transport across human intestinal cell monolayers, including Caco-2 cell monolayers. Toxicity to cultured hepatocyctes may be used to predict compound toxicity. Penetration of the blood brain barrier of a compound in humans may be predicted from the brain levels of laboratory animals that receive the compound intravenously.
- Serum protein binding may be predicted from albumin binding assays. Such assays are described in a review by Oravcova, et al. (Journal of Chromatography B (1996) volume 677, pages 1-27).
- Compound half- life is inversely proportional to the frequency of dosage of a compound. In vitro half- lives of compounds may be predicted from assays of microsomal half-life as described by Kuhnz and Gieschen (Drug Metabolism and Disposition, (1998) volume 26, pages 1120-1127). [0402] The amount of the composition required for use in treatment will vary not only with the particular compound selected but also with the route of administration, the nature of the condition being treated and the age and condition of the patient and will ultimately be at the discretion of the attendant physician or clinician.
- the pharmaceutical composition described herein includes an additional active ingredient.
- the additional active ingredient is a compound that has been approved for human use by the United States Food and Drug Administration.
- the additional active ingredient is an immunosuppressive agent.
- the additional active ingredient is a member selected from corticosteroids, aminosalicylates, azathioprine (6-mercaptopurine), methotrexate and ciclosporine, etanercept, infliximab, adalimumab, alefacept, efalizumab and anakinra.
- the additional active ingredient is a member selected from cilostazol, rolipram, roflumilast, piclamilast, CDP-840 and ariflo.
- the additional active ingredient is a member selected from betamethasone, tacrolimus and pimecrolimus.
- the additional active ingredient is a member selected from an activated vitamin D analog and an arotinoid (an aromatic retinoic acid analog).
- the additional active ingredient is a member selected from carcipotriol, such as Tazorac (tazarotene).
- the additional active ingredient is a member selected from penicillin G, amoxicillin, ampicillin, azlocillin, carbenicillin, cloxacillin, dicloxacillin, flucloxacillin, mezlocillin, nafcillin, pipericillin and ticarcillin.
- the additional active ingredient is a member selected from tazobactam, sulbactam and clavulanic acid.
- compositions of the present invention comprises fluid or semi-solid vehicles that may include but are not limited to polymers, thickeners, buffers, neutralizers, chelating agents, preservatives, surfactants or emulsifiers, antioxidants, waxes or oils, emollients, sunscreens, and a solvent or mixed solvent system.
- the solvent or mixed solvent system is important to the formation because it is primarily responsible for dissolving the drug.
- the best solvent or mixed solvent systems are also capable of maintaining clinically relevant levels of the drug in solution despite the addition of a poor solvent to the formulation.
- the topical compositions useful in the subject invention can be made into a wide variety of product types. These include, but are not limited to, lotions, creams, gels, sticks, sprays, ointments, pastes, foams, mousses, masks, eye ointments, eye or ear drops, impregnated dressings, wipes, cleansers including soaps, body washes and shampoos, and make-up products, such as bases, blushes, lipsticks, and eye shadows, among others.
- These product types can comprise several types of carrier systems including, but not limited to particles, nanoparticles, and liposomes.
- disintegrating agents can be added, such as the cross-linked polyvinyl pyrrolidone, agar or alginic acid or a salt thereof such as sodium alginate.
- disintegrating agents can be added, such as the cross-linked polyvinyl pyrrolidone, agar or alginic acid or a salt thereof such as sodium alginate.
- Techniques for formulation and administration can be found in Remington: The Science and Practice of Pharmacy, supra. The formulation can be selected to maximize delivery to a desired target site in the body.
- the formulations can also include various conventional colorants, fragrances, thickeners, preservatives, humectants, emollients, demulcents, solubilizing excipients, dispersants, penetration enhancers, plasticizing agents, preservatives, stabilizers, demulsif ⁇ ers, wetting agents, sunscreens, emulsifiers, moisturizers, astringents, deodorants, and the like, which can be added to provide additional benefits such as, for example, improving the feel and/or appearance of the topical preparation.
- Lotions which are preparations that are to be applied to the skin, nail, hair, claw or hoof surface without friction, are typically liquid or semi-liquid preparations in which finely divided solid, waxy, or liquid are dispersed. Lotions will typically contain suspending agents to produce better dispersions as well as compounds useful for localizing and holding the active agent in contact with the skin, nail, hair, claw or hoof, e.g., methylcellulose, sodium carboxymethyl-cellulose, or the like.
- Creams containing the active agent for delivery according to the present invention are viscous liquid or semisolid emulsions, either oil-in-water or water-in-oil.
- Cream bases are water- washable, and contain an oil phase, an emulsif ⁇ er and an aqueous phase.
- the oil phase is generally comprised of petrolatum or a fatty alcohol, such as cetyl- or stearyl alcohol; the aqueous phase usually, although not necessarily, exceeds the oil phase in volume, and generally contains a humectant.
- the emulsif ⁇ er in a cream formulation as explained in Remington: The Science and Practice of Pharmacy, supra, is generally a nonionic, anionic, cationic or amphoteric surfactant.
- a lotion or cream may include a relatively large aqueous phase and a relatively small oil phase. Furthermore, the lotions and creams of the invention may include the active compound "all-in-solution" in the oil phase so that substantially none of the active compound crystallizes out at room temperature.
- the lotion or cream may comprise a biphasic system, that is, a system wherein a portion (from about 30 to about 75% by weight) of the active compound is in solution in the oil phase and the remainder is in suspension in the aqueous phase.
- Gel formulations can also be used in connection with the present invention. As will be appreciated by those working in the field of topical drug formulation, gels are semisolid. Single-phase gels contain organic macromolecules distributed substantially uniformly throughout the carrier liquid, which is typically aqueous, but also may be a solvent or solvent blend. In various embodiments, conventional gelling agents can be used. In an exemplary embodiment, cellulose or its derivatives are used. In an exemplary embodiment, hydroxypropyl methyl cellulose, such as Methocel E4M, is used.
- gelling agents include methyl cellulose, hydroxypropyl cellulose, hydroxypropyl methyl cellulose, cellulose acetate, ethyl cellulose, methyl hydroxy ethyl cellulose, hydroxy ethyl cellulose, and cellulose gum.
- Cellulose based gelling agents particularly hydroxymethylcellulose and hydroxypropyl methyl cellulose, are also useful in some embodiments.
- cross-linked acrylic polymers including Carbopol may be used.
- the formulation of the invention is viscous enough to form a firm gel.
- the viscosity is in the range of 25,000-300,000 cps (centipoise) or 75,000-200,000 cps, based on Brookfield (LV) analysis.
- speed-gel a first gel composition
- a speed-gel may be prepared by mixing lecithin organogel (L.
- Ointments which are semisolid preparations, are typically based on petrolatum or other petroleum derivatives.
- the specific ointment base to be used is one that provides for optimum delivery for the active agent chosen for a given formulation, and, preferably, provides for other desired characteristics as well, e.g., emolliency or the like.
- an ointment base should be inert, stable, nonirritating and non- sensitizing. As explained in Remington: The Science and Practice of Pharmacy, 19th Ed.
- ointment bases may be grouped in four classes: oleaginous bases; emulsif ⁇ able bases; emulsion bases; and water-soluble bases.
- Oleaginous ointment bases include, for example, vegetable oils, fats obtained from animals, and semisolid hydrocarbons obtained from petroleum.
- oleaginous ointment bases examples include White Ointment USP, Yellow Ointment NF, Oleic Acid USP, Olive Oil USP, Paraffin USP, Petrolatum NF, White Petrolatum USP, Spermaceti Wax USP, Syntheticspermaceti NF, Starch Glycerite NF, White Wax USP, and Yellow Wax USP.
- Emulsif ⁇ able ointment bases also known as absorbent ointment bases, contain little or no water and include, for example, hydroxystearin sulfate, anhydrous lanolin and hydrophilic petrolatum.
- Emulsion ointment bases are either water-in-oil (W/O) emulsions or oil-in- water (O/W) emulsions, and include, for example, cetyl alcohol, glyceryl monostearate, lanolin and stearic acid.
- W/O water-in-oil
- O/W oil-in- water
- Preferred water-soluble ointment bases are prepared from polyethylene glycols of varying molecular weight; again, reference may be had to Remington: The Science and Practice of Pharmacy, supra, for further information.
- Useful formulations of the invention also encompass sprays and aerosols.
- Sprays generally provide the active agent in an aqueous and/or alcoholic solution which can be misted onto the skin, nail, hair, claw or hoof for delivery.
- Such sprays include those formulated to provide for concentration of the active agent solution at the site of administration following delivery, e.g., the spray solution can be primarily composed of alcohol or other like volatile liquid in which the drug or active agent can be dissolved.
- the carrier evaporates, leaving concentrated active agent at the site of administration.
- the topical pharmaceutical compositions may also comprise suitable solid or gel phase carriers.
- suitable solid or gel phase carriers include but are not limited to calcium carbonate, calcium phosphate, various sugars, starches, cellulose derivatives, gelatin, and polymers such as polyethylene glycols.
- the topical pharmaceutical compositions may also comprise a suitable emulsifier which refers to an agent that enhances or facilitates mixing and suspending oil-in- water or water-in-oil.
- a suitable emulsifier which refers to an agent that enhances or facilitates mixing and suspending oil-in- water or water-in-oil.
- the emulsifying agent used herein may consist of a single emulsifying agent or may be a nonionic, anionic, cationic or amphoteric surfactant or blend of two or more such surfactants; preferred for use herein are nonionic or anionic emulsifiers.
- Such surface-active agents are described in "McCutcheon's Detergent and Emulsifiers," North American Edition, 1980 Annual published by the McCutcheon Division, MC Publishing Company, 175 Rock Road, Glen Rock, N.J. 07452, USA.
- Examples of useful ionic surfactants include sodium caproate, sodium caprylate, sodium caprate, sodium laurate, sodium myristate, sodium myristolate, sodium palmitate, sodium palmitoleate, sodium oleate, sodium ricinoleate, sodium linoleate, sodium linolenate, sodium stearate, sodium lauryl sulfate (dodecyl), sodium tetradecyl sulfate, sodium lauryl sarcosinate, sodium dioctyl sulfosuccinate, sodium cholate, sodium taurocholate, sodium glycocholate, sodium deoxycholate, sodium taurodeoxycholate, sodium glycodeoxycholate, sodium ursodeoxycholate, sodium chenodeoxycholate, sodium taurochenodeoxycholate, sodium glyco cheno deoxycholate, sodium cholylsarcosinate, sodium N-methyl taurocholate, egg yolk phosphatides, hydrogenated soy
- Typical counterions are provided above. It will be appreciated by one skilled in the art, however, that any bioacceptable counterion may be used.
- the fatty acids are shown as sodium salts, other cation counterions can also be used, such as, for example, alkali metal cations or ammonium.
- Formulations of the invention may include one or more of the ionic surfactants above.
- Preferred for use herein are high molecular weight alcohols such as cetearyl alcohol, cetyl alcohol, stearyl alcohol, emulsifying wax, glyceryl monostearate, and oleyl alcohol.
- Other examples are ethylene glycol distearate, sorbitan tristearate, propylene glycol monostearate, sorbitan monooleate, sorbitan monostearate (SPAN 60), diethylene glycol monolaurate, sorbitan monopalmitate, sucrose dioleate, sucrose stearate (CRODESTA F- 160), polyoxyethylene lauryl ether (BRIJ 30), polyoxyethylene (2) stearyl ether (BRIJ 72), polyoxyethylene (21) stearyl ether (BRIJ 721), polyoxyethylene monostearate (Myrj 45), polyoxyethylene (20) sorbitan monolaurate (TWEEN 20, polysorbate 20), polyoxyethylene (20) sorbitan monopalmitate (TWEEN 40
- the emulsifier is octyldodecanol.
- xanthan gum or a xanthan gum blend is used. Cholesterol and cholesterol derivatives may also be employed in externally used emulsions and promote w/o emulsions.
- nonionic emulsifying agents are those with hydrophile- lipophile balances (HLB) of about 3 to 6 for w/o system and 8 to 18 for o/w system as determined by the method described by Paul L. Lindner in "Emulsions and
- Emulsion edited by Kenneth Lissant, published by Dekker, New York, N. Y., 1974, pages 188-190. More preferred for use herein are one or more nonionic surfactants that produce a system having HLB of about 8 to about 18.
- nonionic emulsif ⁇ ers include but are not limited to "BRIJ 72", the trade name for a polyoxyethylene (2) stearyl ether having an HLB of 4.9; "BRIJ 721 ", the trade name for a polyoxyethylene (21) stearyl ether having an HLB of 15.5, “Brij 30", the trade name for polyoxyethylene lauryl ether having an HLB of 9.7; "Polawax”, the trade name for emulsifying wax having an HLB of 8.0; "Span 60”, the trade name for sorbitan monostearate having an HLB of 4.7; “Crodesta F-160”, the trade name for sucrose stearate” having an HLB of 14.5.
- each emulsifying agent is present in amount from about 0.5 to about 2.5 wt%, preferably 0.5 to 2.0%, more preferably 1.0% or 1.8%.
- the emulsifying agent comprises a mixture of steareth 21 (at about 1.8 %) and steareth 2 (at about 1.0%).
- the topical pharmaceutical compositions may also comprise suitable emollients.
- Emollients are materials used for the prevention or relief of dryness, as well as for the protection of the skin, nail, hair, claw or hoof.
- Useful emollients include, but are not limited to, hydrocarbon oils, waxes, silicone, cetyl alcohol, isopropyl myristate, stearyl alcohol, oleyl alcohol, octyl hydroxystearate, glycerin, other fatty alcohols including short or medium chain fatty alcohols having a carbon length of up to 18, medium or short chain fatty acid triglycerides, esters such as fatty acid esters, lecithins and related polar compounds such as phosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, phosphatidylinositol, phosphatidic acid, lyso-phosphatidylcholine, lyso-phosphatidy
- emollients include triglyceride oils like vegetable oils such as wheat germ, maize, sunflower, karite, castor, sweet almond, macadamia, apricot, soybean, cottonseed, alfalfa, poppy, pumpkinseed, sesame, cucumber, rapeseed, avocado, hazelnut, grape seed, blackcurrant seed, evening primrose, millet, barley, quinoa, olive, rye, safflower, candlenut, soya, palm, passion flower, or musk rose oil; triglycerides of caprylic/capric acid, such as those sold under the tradenames
- MIGL YOLTM Condea Chemie, Germany
- CRODAMOL Clarka, Inc., Edison, N. J.
- fatty alcohols such as caprylic alcohol, lauryl alcohol, myristyl alcohol, cetyl alcohol, and stearyl alcohol
- fatty esters such as oleyl acetate, isotridecyl benzoate, diisooctyl sebacate, isopropyl myristate, cetyl octanoate, isopropyl palmitate, butyl stearate, hexyl laurate, myristyl myristate, decyl oleate, hexyldecyl dimethyloctanoate, cetyl lactate, myristyl lactate, lanoline acetate, isocetyl stearate, isocetyl isostearate, cholesteryl 12-hydroxystearate, dipentaerythritol fatty
- emollients are known and can be used herein. See e.g., Sagarin, Cosmetics, Science and Technology, 2nd Edition, Vol. 1, pp. 32-43 (1972), and U.S. Pat. No. 4,919,934, to Deckner et al, issued Apr. 24, 1990, both of which are incorporated herein by reference in their entirety. These materials are available from Ruger Chemical Co, (Irvington, NJ).
- each emollient is present in an amount from about 0.1 to 15%, preferably 0.1 to about 3.0, more preferably 0.5, 1.0, or 2.5 wt%.
- the emollient is a mixture of cetyl alcohol, isopropyl myristate and stearyl alcohol in a 1/5/2 ratio.
- the emollient may also be a mixture of cetyl alcohol and stearyl alcohol in a 1 /2 ratio.
- the topical pharmaceutical compositions may also comprise suitable antioxidants, substances known to inhibit oxidation.
- Antioxidants suitable for use in accordance with the present invention include, but are not limited to, butylated hydroxytoluene, ascorbic acid, sodium ascorbate, calcium ascorbate, ascorbic palmitate, butylated hydroxyanisole, 2,4,5-trihydroxybutyrophenone, 4- hydroxymethyl-2,6-di-te/t-butylphenol, erythorbic acid, gum guaiac, propyl gallate, thiodipropionic acid, dilauryl thiodipropionate, tert-butylhydroquinone and tocopherols such as vitamin E, and the like, including pharmaceutically acceptable salts and esters of these compounds.
- the antioxidant is butylated hydroxytoluene, butylated hydroxyanisole, propyl gallate, ascorbic acid, pharmaceutically acceptable salts or esters thereof, or mixtures thereof.
- the antioxidant is butylated hydroxytoluene.
- These materials are available from Ruger Chemical Co, (Irvington, NJ).
- Antioxidants that may be incorporated into the formulations of the invention include natural antioxidants prepared from plant extracts, such as extracts from aloe vera; avocado; chamomile; echinacea; ginko biloba; ginseng; green tea; heather; jojoba; lavender; lemon grass; licorice; mallow; oats; peppermint; St. John's wort; willow; wintergreen; wheat wild yam extract; marine extracts; and mixtures thereof.
- the topical formulations of the present invention contain at least one antioxidant
- the total amount of antioxidant present is from about 0.001 to 0.5 wt%, preferably 0.05 to about 0.5 wt%, more preferably 0.1%.
- the topical pharmaceutical compositions may also comprise suitable preservatives.
- Preservatives are compounds added to a pharmaceutical formulation to act as an anti-microbial agent.
- preservatives known in the art as being effective and acceptable in parenteral formulations are benzalkonium chloride, benzethonium, chlorohexidine, phenol, m-cresol, benzyl alcohol, methylparaben, propylparaben and other parabens, chlorobutanol, o-cresol, p-cresol, chlorocresol, phenylmercuric nitrate, thimerosal, benzoic acid, and various mixtures thereof. See, e.g., Wall Arbitr, K. -H., Develop.
- the preservative is selected from methylparaben, propylparaben and mixtures thereof. These materials are available from Inolex Chemical Co (Philadelphia, PA) or Spectrum Chemicals.
- the topical formulations of the present invention contain at least one preservative
- the total amount of preservative present is from about 0.01 to about 0.5 wt%, preferably from about 0.1 to 0.5%, more preferably from about 0.03 to about 0.15.
- the preservative is a mixture of methylparaben and propylparaben in a 5/1 ratio.
- the amount is usually 15 to 20%.
- the topical pharmaceutical compositions may also comprise suitable chelating agents to form complexes with metal cations that do not cross a lipid bilayer.
- suitable chelating agents include ethylene diamine tetraacetic acid (EDTA), ethylene glycol-bis(beta-aminoethyl ether)-N,N,N',N'-tetraacetic acid (EGTA) and 8- Amino-2- [(2-amino-5 -methylphenoxy)methyl] -6-methoxyquinoline- N 5 N 5 N', N '-tetraacetic acid, tetrapotassium salt (QUIN-2).
- the chelating agents are EDTA and citric acid.
- a chelating agent may comprise salts of the above, such as edetate disodium, for example. These materials are available from Spectrum Chemicals.
- the topical formulations of the present invention contain at least one chelating agent
- the total amount of chelating agent present is from about 0.005% to 2.0% by weight, preferably from about 0.05% to about 0.5 wt%, more preferably about 0.1% by weight.
- the topical pharmaceutical compositions may also comprise suitable neutralizing agents used to adjust the pH of the formulation to within a pharmaceutically acceptable range.
- neutralizing agents include but are not limited to trolamine, tromethamine, sodium hydroxide, hydrochloric acid, sodium carbonate, citric acid, acetic acid and corresponding acids or bases thereof. Such materials are available from are available from Spectrum Chemicals (Gardena, CA).
- the topical formulations of the present invention contain at least one neutralizing agent
- the total amount of neutralizing agent present is from about 0.1 wt to about 10 wt %, preferably 0.1 wt % to about 5.0 wt%, and more preferably about 1.0 wt %.
- the neutralizing agent is generally added in whatever amount is required to bring the formulation to the desired pH.
- the pH is about 6.0 to about 8.0.
- the pH is about 3.0 to about 4.0.
- the topical pharmaceutical compositions may also comprise suitable thickening or viscosity increasing agents. These components are diffusible compounds capable of increasing the viscosity of a polymer-containing solution through the interaction of the agent with the polymer.
- CARBOPOL ULTREZ 10 polymethyl methacrylate (PMMA), and fumed silica may be used as a viscosity-increasing agent. These materials are available from Noveon Chemicals, Cleveland, OH.
- Other examples of thickeners include monoglycerides and fatty alcohols, fatty acid esters of alcohols having from about 3 to about 16 carbon atoms. Examples of suitable monoglycerides are glyceryl monostearate and glyceryl monopalmitate. Examples of fatty alcohols are cetyl alcohol and stearyl alcohol. Examples of suitable esters are myristyl stearate and cetyl stearate. The monoglyceride also functions as an auxiliary emulsifier.
- emollients or oleaginous material which may be employed include petrolatum, glyceryl monooleate, myristyl alcohol, and isopropyl palmitate.
- the thickener is used in combination with an emulsifying agent.
- the total amount of viscosity increasing agent present is from about 0.25% to about 5.0% by weight, preferably from about 0.25% to about 1.0 wt%, and more preferably from about 0.4% to about 0.6% by weight.
- the topical pharmaceutical compositions may also comprise a disintegrating agent including starch, e.g., a natural starch such as corn starch or potato starch, a pregelatinized starch such as National 1551 or AmijeleTM, or sodium starch glycolate such as Promogel or Explotab ; a cellulose such as a wood product, microcrystalline cellulose, e.g., AvicelTM, AvicelTM PHlOl, AvicelTM PH102, AvicelTM PH 105, ElcemaTM PlOO, EmcocelTM, VivacelTM, Ming TiaTM, and Solka- FlocTM, methylcellulose, croscarmellose, or a cross-linked cellulose, such as cross- linked sodium carboxymethylcellulose (Ac-Di-SolTM), cross-linked carboxymethylcellulose, or cross-linked croscarmellose; a cross-linked starch such as sodium starch glycolate; a cross-linked polymer such as crosspovidone; a cross-
- the topical pharmaceutical compositions may also comprise suitable nail penetration enhancers.
- nail penetration enhancers include mercaptan compounds, sulfites and bisulfites, keratolytic agents and surfactants.
- nail penetration enhancers suitable for use in the invention are described in greater detail in Malhotra et al., J. Pharm. Sci., 91:2, 312-323 (2002), which is incorporated herein by reference in its entirety.
- the topical pharmaceutical compositions may also comprise an anti- foaming anti-whitening agent that increases the elegancy of the cream or lotion and inhibits the formation of a white soapy look upon rubbing the cream or lotion on the skin.
- an anti- foaming anti-whitening agent that increases the elegancy of the cream or lotion and inhibits the formation of a white soapy look upon rubbing the cream or lotion on the skin.
- An example of such material includes silicone fluid.
- Other anti-foaming agents include simethicone, polyglycol, and sorbitan sesquioleate.
- the topical pharmaceutical compositions may also comprise a post- foaming agent.
- Post-foaming refers to a gel that remains a gel as it is expelled from a container but foams up after it is spread over the skin.
- Post-foaming agents include saturated aliphatic hydrocarbons having from 4-6 carbon atoms, such as butane, pentane and hexane (in particular is opentane and isobutene).
- Other suitable post- foaming agents include partially, or wholly halogenated hydrocarbons, such as trichlorofluroethane.
- mixtures of aliphatic and halogenated hydrocarbon propellants, or post-foaming agents can be used.
- suitable post- foaming agents are those substances that have a low solubility in water, for example less than about 20 cc of gas in 100 grams of water at one atmosphere and 20 0 C.
- the topical pharmaceutical compositions may also comprise one or more suitable solvents.
- suitable solvents The ability of any solid substance (solute) to dissolve in any liquid substance (solvent) is dependent upon the physical properties of the solute and the solvent. When solutes and solvents have similar physical properties the solubility of the solute in the solvent will be the greatest. This gives rise to the traditional understanding that "like dissolves like.”
- Solvents can be characterized in one extreme as non-polar, lipophilic oils, while in the other extreme as polar hydrophilic solvents. Oily solvents dissolve other non-polar substances by Van der WaIs interactions while water and other hydrophilic solvents dissolve polar substances by ionic, dipole, or hydrogen bonding interactions.
- solvents can be listed along a continuum from the least polar, i.e. hydrocarbons such as decane, to the most polar solvent being water.
- a solute will have its greatest solubility in solvents having equivalent polarity.
- less polar solvents will provide improved solubility with the solvent having polarity nearly equivalent to the solute providing maximum solubility.
- Most drugs have intermediate polarity, and thus experience maximum solubility in solvents such as propylene glycol or ethanol, which are significantly less polar than water.
- the concentration of active ingredient in the formulation may be limited by the solubility of the active ingredient in the chosen solvent and/or carrier.
- Non-lipophilic drugs typically display very low solubility in pharmaceutically acceptable solvents and/or carriers.
- the solubility of some compounds in the invention in water is less than 0.00025% wt/wt.
- the solubility of the same compounds in the invention can be less than about 2% wt/wt in either propylene glycol or isopropyl myristate.
- solubilizing excipients include polyethoxylated fatty acids, PEG-fatty acid diesters, PEG-fatty acid mono-ester and di-ester mixtures, polyethylene glycol glycerol fatty acid esters, alcohol-oil transesterification products, polyglycerized fatty acids, propylene glycol fatty acid esters, mixtures of propylene glycol esters-glycerol esters, mono- and diglycerides, sterol and sterol derivatives, polyethylene glycol sorbitan fatty acid esters, polyethylene glycol alkyl ethers, sugar esters, polyethylene glycol alkyl phenols, polyoxyethylene-polyoxypropylene block copolymers, sorbitan fatty acid esters, lower alcohol fatty acid esters, ionic surfactants, tocopherol esters, and sterol esters.
- ethylhexyl hydroxystearate is the solvent used to dissolve the compounds described herein.
- diethylene glycol monoethyl ether DGME
- DGME diethylene glycol monoethyl ether
- the compounds in the invention useful in the present formulation are believed to have a solubility of from about 10% wt/wt to about 25% wt/wt in DGME.
- a DGME water cosolvent system is used to dissolve the compounds described herein.
- a DGME water cosolvent system is used to dissolve a compound of the invention.
- the solvent capacity of DGME drops when water is added; however, the DGME/water cosolvent system can be designed to maintain the desired concentration of from about 0.1 % to about 5% wt/wt active ingredient.
- the active ingredient is present from about 0.5 % to about 3% wt/wt, and more preferably at about 1% wt/wt, in the as-applied topical formulations.
- the active agent becomes more soluble in the cream formulation. This increased solubility reduces the likelihood of reduced bioavailability caused by the drug precipitating on the surface of the skin, nail, hair, claw or hoof.
- the vehicle is lipophilic.
- Lipophilic materials include oleaginous material such as petrolatum, mineral oil thickened or gelled with polyethylene, high molecular weight paraffin waxes, mono and diglycerides of fatty acids gelled with high molecular weight fatty acids or polyamide complex of hydroxystearate, propylene glycol isostearate or isostearyl alcohol gelled with high molecular weight fatty acids, and mixtures thereof.
- Liquid forms such as lotions suitable for topical administration or suitable for cosmetic application, may include a suitable aqueous or nonaqueous vehicle with buffers, suspending and dispensing agents, thickeners, penetration enhancers, and the like.
- Solid forms such as creams or pastes or the like may include, for example, any of the following ingredients, water, oil, alcohol or grease as a substrate with surfactant, polymers such as polyethylene glycol, thickeners, solids and the like.
- Liquid or solid formulations may include enhanced delivery technologies such as liposomes, microsomes, microsponges and the like.
- Liposomal formulations which help allow compounds to enter the skin, are described in US Patents 5,169,637; 5,000,958; 5,049,388; 4,975,282; 5,194,266; 5,023,087; 5,688,525; 5,874,104; 5,409,704; 5,552,155; 5,356,633; 5,032,582; 4,994,213; and PCT Publication No. WO 96/40061.
- the compounds can be delivered using a sustained-release system, such as semipermeable matrices of solid hydrophobic polymers containing the therapeutic agent.
- sustained-release materials have been established and are well known by those skilled in the art.
- at least two different dosage forms, each of which contains a compound of the invention may be formulated for topical administration by including such dosage forms in an oil-in- water emulsion, or a water-in-oil emulsion.
- the delayed release dosage forms are in the continuous phase
- the delayed sustained release dosage form is in a discontinuous phase.
- the formulation may also be produced in a manner for delivery of three dosage forms as hereinabove described.
- an oil-in-water-in-oil emulsion with oil being a continuous phase that contains the third delayed sustained release component, water dispersed in the oil containing a first delayed release dosage form, and oil dispersed in the water containing a second delayed release dosage form.
- Topical treatment regimens according to the practice of this invention comprise applying the composition directly to the skin, nail, hair, claw or hoof at the application site, from one to several times daily.
- Formulations of the present invention can be used to treat, ameliorate or prevent conditions or symptoms associated with bacterial infections, acne, inflammation and the like.
- the pharmaceutical formulation includes a simple solution.
- the simple solution includes a polyether.
- the polyether is polyethylene glycol or polypropylene glycol.
- the simple solution includes an alcohol.
- the alcohol is methanol, ethanol, propanol, isopropanol or butanol.
- the simple solution includes a polyether and an alcohol.
- the simple solution includes a polypropylene glycol and ethanol.
- the simple solution is a member selected from about 10% polypropylene glycol and about 90% ethanol; about 20% polypropylene glycol and about 80% ethanol; about 30% polypropylene glycol and about 70% ethanol; about 40% polypropylene glycol and about 60% ethanol; about 50% polypropylene glycol and about 50% ethanol; about 60% polypropylene glycol and about 40% ethanol; about 70% polypropylene glycol and about 30% ethanol; about 80% polypropylene glycol and about 20% ethanol; about 90% polypropylene glycol and about 10% ethanol.
- the simple solution includes acetone.
- the simple solution includes acetone and an alcohol.
- the simple solution includes acetone and a member selected from methanol, ethanol, propanol, isopropanol or butanol.
- the simple solution includes acetone, an alcohol and a polyether.
- the simple solution includes acetone, an alcohol and a member selected from polyethylene glycol and polypropylene glycol.
- the simple solution includes acetone and ethanol.
- the simple solution is a member selected from about 10% acetone and about 90% ethanol; about 20% acetone and about 80% ethanol; about 30% acetone and about 70% ethanol; about 40% acetone and about 60% ethanol; about 50% acetone and about 50% ethanol; about 60% acetone and about 40% ethanol; about 70% acetone and about 30% ethanol; about 80% acetone and about 20% ethanol; about 90% acetone and about 10% ethanol.
- the pharmaceutical formulation is a lacquer.
- Anti-inflammatory agents include, but are not limited to, bisabolol, mentholatum, dapsone, aloe, hydrocortisone, and the like.
- Vitamins include, but are not limited to, Vitamin B, Vitamin E, Vitamin A, Vitamin D, and the like and vitamin derivatives such as tazarotene, calcipotriene, tretinoin, adapalene and the like.
- Anti-aging agents include, but are not limited to, niacinamide, retinol and retinoid derivatives, AHA, Ascorbic acid, lipoic acid, coenzyme Q lO, beta hydroxy acids, salicylic acid, copper binding peptides, dimethylaminoethyl (DAEA), and the like.
- Sunscreens and or sunburn relief agents include, but are not limited to,
- UV light blockers include, for example, amino benzoic acids, benzophenones, camphors, cinnamates, dibenzoyl methanes, salicylates, metal oxides, and mixtures thereof.
- Psoriasis-treating agents and/or acne-treating agents include, but are not limited to, salicylic acid, benzoyl peroxide, coal tar, selenium sulfide, zinc oxide, pyrithione (zinc and/or sodium), tazarotene, calcipotriene, tretinoin, adapalene and the like.
- Agents that are effective to control or modify keratinization including without limitation: tretinoin, tazarotene, and adapalene.
- compositions comprising an compound/active agent described herein, and optionally at least one of these additional agents, are to be administered topically.
- this leads to the compounds of the invention and any other active agent working upon and treating the skin, nail, hair, claw or hoof.
- any one of the topically applied active agents may also be delivered systemically by transdermal routes.
- an additional cosmetically or pharmaceutically effective agent such as an anti-inflammatory agent, vitamin, anti-aging agent, sunscreen, and/or acne-treating agent, for example, is usually a minor component (from about 0.001 % to about 20% by weight or preferably from about 0.01 % to about 10% by weight) with the remainder being various vehicles or carriers and processing aids helpful for forming the desired dosing form.
- Preferred compounds for use in the present topical formulations will have certain pharmacological properties. Such properties include, but are not limited to, low toxicity, low serum protein binding and desirable in vitro and in vivo half-lives. Assays may be used to predict these desirable pharmacological properties. Assays used to predict bioavailability include transport across human intestinal cell monolayers, including Caco-2 cell monolayers. Serum protein binding may be predicted from albumin binding assays. Such assays are described in a review by Oravcova et al. (1996, J. Chromat. B677: 1-27). Compound half-life is inversely proportional to the frequency of dosage of a compound. In vitro half- lives of compounds may be predicted from assays of microsomal half- life as described by Kuhnz and Gleschen (Drug Metabolism and Disposition, (1998) volume 26, pages 1120-1127).
- Toxicity and therapeutic efficacy of such compounds can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population).
- the dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio between LD50 and ED50.
- Compounds that exhibit high therapeutic indices are preferred.
- the data obtained from these cell culture assays and animal studies can be used in formulating a range of dosage for use in humans.
- the dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity.
- the dosage can vary within this range depending upon the dosage form employed and the route of administration utilized.
- the therapeutically effective dose can be estimated initially from cell culture assays, as disclosed herein.
- a dose can be formulated in animal models to achieve a circulating concentration range that includes the EC50 (effective dose for 50% increase) as determined in cell culture, i.e., the concentration of the test compound which achieves a half-maximal inhibition of bacterial cell growth.
- EC50 effective dose for 50% increase
- concentration of the test compound which achieves a half-maximal inhibition of bacterial cell growth Such information can be used to more accurately determine useful doses in humans.
- the compounds prepared by the methods, and from the intermediates, described herein will be administered in a therapeutically or cosmetically effective amount by any of the accepted modes of administration for agents that serve similar utilities. It will be understood, however, that the specific dose level for any particular patient will depend upon a variety of factors including the activity of the specific compound employed, the age, body weight, general health, sex, diet, time of administration, route of administration, and rate of excretion, drug combination, the severity of the particular disease undergoing therapy and the judgment of the prescribing physician.
- the drug can be administered from once or twice a day, or up to 3 or 4 times a day.
- Dosage amount and interval can be adjusted individually to provide plasma levels of the active moiety that are sufficient to maintain bacterial cell growth inhibitory effects.
- Usual patient dosages for systemic administration range from 0.1 to 1000 mg/day, preferably, 1-500 mg/day, more preferably 10 - 200 mg/day, even more preferably 100 - 200 mg/day. Stated in terms of patient body surface areas, usual dosages range from 50-91 mg/m 2 /day.
- the amount of the compound in a formulation can vary within the full range employed by those skilled in the art.
- the formulation will contain, on a weight percent (wt%) basis, from about 0.01-10 wt% of the drug based on the total formulation, with the balance being one or more suitable pharmaceutical excipients.
- the compound is present at a level of about 0.1-3.0 wt%, more preferably, about 1.0 wt%.
- the pharmaceutical formulation is an ointment, and comprises a compound described herein or combination described herein or a pharmaceutically acceptable salt thereof.
- the pharmaceutical formulation includes a compound described herein or combination described herein or a pharmaceutically acceptable salt thereof and at least one surfactant described herein.
- the formulation comprises a hydroxystearate.
- the hydroxystearate is a member selected from glyceryl monostearate, ethylhexyl hydroxystearate and octyl hydroxystearate.
- the pharmaceutical formulation includes a compound described herein or a combination described herein or a pharmaceutically acceptable salt thereof and an alcohol.
- the alcohol is a long chain alcohol or a fatty alcohol.
- the alcohol is a member selected from benzyl alcohol, octyldodecanol, stearyl alcohol, cetyl alcohol, oleyl alcohol.
- the formulation comprises a member selected from benzyl alcohol
- octyl comprises at least one compound which is a member selected from hydrocarbon oils, waxes, silicone, cetyl alcohol, isopropyl myristate, stearyl alcohol, oleyl alcohol, ethylhexyl hydroxystearate, octyl hydroxystearate, glycerin, other fatty alcohols hydroxystearate .
- the pharmaceutical formulation comprises a compound of the invention and at least one emollient described herein.
- the pharmaceutical formulation includes a compound of the invention, and petrolatum.
- the pharmaceutical formulation comprises a compound described herein or combination described herein or a pharmaceutically acceptable salt thereof and petrolatum.
- the pharmaceutical formulation comprises a compound described herein or combination described herein or a pharmaceutically acceptable salt thereof and a member selected from hydrocarbon oils, waxes, silicone, cetyl alcohol, isopropyl myristate, stearyl alcohol, oleyl alcohol, ethylhexyl hydroxystearate, octyl hydroxystearate, glycerin, other fatty alcohols hydroxystearate.
- the pharmaceutical formulation comprises a compound described herein or combination described herein or a pharmaceutically acceptable salt thereof and ethylhexyl hydroxystearate and/or octyl hydroxystearate.
- the pharmaceutical formulation comprises a compound described herein or combination described herein or a pharmaceutically acceptable salt thereof, petrolatum and a member selected from hydrocarbon oils, waxes, silicone, cetyl alcohol, isopropyl myristate, stearyl alcohol, oleyl alcohol, ethylhexyl hydroxystearate, octyl hydroxystearate, glycerin, other fatty alcohols hydroxystearate.
- the pharmaceutical formulation comprises a compound described herein or described herein or a pharmaceutically acceptable salt thereof, petrolatum, oleyl alcohol and ethylhexyl hydroxystearate.
- the pharmaceutical formulation is a cream, and comprises a compound described herein or combination described herein or a pharmaceutically acceptable salt thereof.
- the pharmaceutical formulation comprises a compound described herein or combination described herein or a pharmaceutically acceptable salt thereof and a preservative.
- the preservative is a member selected from benzalkonium chloride, benzethonium, chlorohexidine, phenol, m-cresol, benzyl alcohol, methylparaben, propylparaben and other parabens, chlorobutanol, o-cresol, p-cresol, chlorocresol, phenylmercuric nitrate, thimerosal, benzoic acid, and various mixtures thereof.
- the preservative is a paraben.
- the preservative is a member selected from methyl paraben and propyl paraben.
- the pharmaceutical formulation comprises a compound described herein or combination described herein or a pharmaceutically acceptable salt thereof and a chelating agent.
- the chelating agent is edetate sodium.
- the invention provides a compound having a structure according to the formula:
- A is a member selected from cycloalkyl, heterocycloalkyl, aryl and heteroaryl; Y is a member selected from O and -S(O) 2 NH- wherein the sulfur in -S(O) 2 NH- is covalently attached to A; R 3 is a member selected from H, cyano and substituted alkyl; R a is a member selected from H, -OR 20 , -NR 20 R 21 , -SR 20 , -S(O)R 20 , -S(O) 2 R 20 , -S(O) 2 NR 20 R 21 , -C(O)R 20 , -C(O)OR 20 , -C(O)NR 20 R 21 , nitro, cyano, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted
- the compound has a structure which is a member selected from:
- R a is a member selected from H, F, Cl, -OR 20a and -C(O)OR 20b , wherein R 20a is alkyl, optionally substituted with a member selected from NH 2 and phenyl, wherein R 20b is unsubstituted alkyl.
- R a is -O(CH 2 ) n NH 2 , wherein n is an integer selected from 1 to 6.
- n is 2 or 3 or 4.
- the compound has a structure according to the formula:
- m is an integer selected from 1 to 6 and R , 20 is a member selected from H and unsubstituted alkyl. [0483] In an exemplary embodiment, according to any of the above paragraphs, m is 1 or 2 or 3.
- the compound has a structure according to the formula:
- R , 2 z 0 ⁇ is H.
- R , 20 is Ci or C 2 or C3 unsubstituted alkyl.
- R 3 is -CH 2 COOH or -CH 2 COOCH 3 or -CH 2 COOCH 2 CH 3 .
- the compound has a structure according to the formula:
- the compound has a structure according to the formula:
- C* is a carbon atom which is a stereocenter which has a configuration of (R) or (S).
- C* is a stereocenter which has a (R) configuration.
- the compound has a structure according to the formula:
- R , 20 is a member selected from H and unsubstituted alkyl.
- R , 2 z 0 ⁇ is H.
- the compound has a structure according to the formula:
- R a is -0(CH 2 )DNH 2 , wherein n is an integer selected from 1 to 6.
- the compound has a structure according to the formula:
- A is a member selected from phenyl, pyridinyl, furanyl, thiophenyl, pyrazolyl, imidazolyl, thiazolyl, triazolyl, and piperidinyl.
- R a is a member selected from cyano, nitro, aminoalkyl, hydroxyalkyl, -C(O)(CH 2 ) ml CH 3 , -COOH, -C(O)O(CH 2 ) ml CH 3 , -O(CH 2 ) ml CH 3 , -O(CH 2 ) ml CF 3 , -O(CH 2 ) m iCHF 2 , -OH, -NH 2 , -NHCH 3 , -NHC(O)H, -NHC(O)(CH 2 ) m iCH 3 , -NHOH, -NHS(O) 2 NH 2 , -NH 2 S(O) 2 CH 3 , -S(O) 2 CH 3 , wherein ml is an integer which is a member selected from 0 to 3.
- the compound has a structure according to the formula:
- the compound has a structure according to the formula:
- R a is a member selected from OH and NH 2 .
- the invention is a combination comprising: a) a compound according to any of the above paragraphs, or a pharmaceutically acceptable salt thereof; and b) a therapeutically active agent.
- the therapeutically active agent is an antibiotic which comprises a ⁇ -lactam moiety.
- the invention is a pharmaceutical formulation comprising: a) a compound or a combination according to any of the above paragraphs, or a pharmaceutically acceptable salt thereof; and b) a pharmaceutically acceptable excipient.
- the pharmaceutical formulation is a unit dosage form.
- the pharmaceutical formulation is a member selected from an oral unit dosage form and a topical unit dosage form.
- the invention is a method of treating a bacterial infection comprising: administering to an animal suffering from said infection an effective amount of a compound according to any of the above paragraphs, or a pharmaceutically-acceptable salt thereof, and an effective amount of an antibiotic, or a pharmaceutically acceptable salt thereof, wherein said antibiotic comprises a ⁇ -lactam moiety, thereby treating the bacterial infection.
- a bacteria involved with the infection is resistant to said antibiotic.
- the antibiotic is a member selected from a penicillin, cephalosporin, monobactam, carbapenem and derivatives thereof.
- the antibiotic is a penicillin or derivatives thereof.
- the penicillin is a member selected from narrow spectrum penicillins, narrow spectrum penicillinase-resistant penicillins, narrow spectrum ⁇ -lactamase-resistant penicillins, moderate spectrum penicillins, broad spectrum penicillins and extended spectrum penicillins
- the penicillin is a narrow spectrum penicillin which is a member selected from benzathine penicillin, benzylpenicillin (penicillin G), phenoxymethylpenicillin (penicillin V) and procaine penicillin.
- the penicillin is a narrow spectrum penicillinase-resistant penicillins which is a member selected from methicillin, dicloxacillin and flucloxacillin.
- the penicillin is a narrow spectrum ⁇ -lactamase-resistant penicillin which is temocillin.
- the penicillin is a moderate spectrum penicillin which is a member selected from amoxicillin and ampicillin.
- the penicillin is a broad spectrum penicillin which is a member selected from co- amoxiclav (amoxicillin and clavulanic acid).
- the penicillin is an extended spectrum penicillin, which is a member selected from azlocillin, carbenicillin, ticarcillin, mezlocillin and piperacillin.
- the antibiotic is a cephalosporin or a derivative thereof.
- the cephalosporin is a member selected from a first-generation cephalosporin, second- generation cephalosporin, second-generation cephamycin, third-generation cephalosporin and fourth-generation cephalosporin.
- the cephalosporin is a member selected from cefalexin, cephalothin and cefazolin.
- the cephalosporin is a member selected from cefaclor, cefuroxime and cefamandole. [0521] In an exemplary embodiment, according to any of the above paragraphs, the cephalosporin is a member selected from cefotetan and cefoxitin.
- the cephalosporin is a member selected from ceftriaxone, cefotaxime, cefpodoxime and ceftazidime.
- the cephalosporin is a member selected from cefepime and cefpirome.
- the antibiotic is a monobactam.
- the monobactam is aztreonam.
- the antibiotic is a carbapenem.
- the carbapenem is a member selected from imipenem, cilastatin, meropenem, ertapenem and faropenem.
- said animal is a human.
- the invention is a method of killing or inhibiting the growth of a bacteria, said method comprising: contacting said bacteria with an effective amount of a compound or a combination according to any of the above paragraphs, or a pharmaceutically acceptable salt thereof, thereby killing or inhibiting the growth of the bacteria.
- the method further comprises contacting said bacteria with an effective amount of an antibiotic, or a pharmaceutically acceptable salt thereof, wherein said antibiotic comprises a ⁇ -lactam moiety.
- the bacteria is resistant to said antibiotic.
- the invention is a method of inhibiting a ⁇ - lactamase, comprising contacting the ⁇ -lactamase with an effective amount of a compound according to any of the above paragraphs, or a pharmaceutically acceptable salt thereof, thereby inhibiting the ⁇ -lactamase.
- the ⁇ -lactamase is a member selected from a Group 1 ⁇ -lactamase, a Group 2 ⁇ - lactamase, a Group 3 ⁇ -lactamase, and a Group 4 ⁇ -lactamase.
- the Group 1 ⁇ -lactamase is a cephalosporinase.
- the Group 2 ⁇ -lactamase is a member selected from penicillinase, a Group 2b, Group 2be, Group 2br, carbenicillinase, cloxacilanase, cephalosporinase and carbapenamase.
- the Group 3 ⁇ -lactamase is a metallo- ⁇ -lactamase.
- the Group 4 ⁇ -lactamase is a penicillinase.
- the ⁇ -lactamase is a member selected from a class A ⁇ -lactamase, a class B ⁇ - lactamase, a class C ⁇ -lactamase, and a class D ⁇ -lactamase.
- the class A ⁇ -lactamase is a member selected from a TEM ⁇ -lactamase, SHV ⁇ - lactamase, CTX-M ⁇ -lactamase and a KPC ⁇ -lactamase.
- the class C ⁇ -lactamase is a member selected from a CMY ⁇ -lactamase and a AmpC ⁇ -lactamase.
- the class D ⁇ -lactamase is an OXA ⁇ -lactamase.
- the ⁇ -lactamase is a metallo ⁇ -lactamase.
- the metallo ⁇ -lactamase is a member selected from an IMP carbapenemase and a VIM ⁇ -lactamase.
- the invention is a method of treating a bacterial infection comprising: administering to an animal suffering from said infection an effective amount of a compound according to any of the above paragraphs, or a pharmaceutically-acceptable salt thereof, thereby treating the bacterial infection.
- the invention is a method of inhibiting the editing domain of a t-RNA synthetase, comprising: contacting the synthetase with an effective amount of a compound according to any of the above paragraphs, or a pharmaceutically-acceptable salt thereof, thereby inhibiting the synthetase.
- the synthetase is a leucyl t-RNA synthetase.
- the invention is the use of a compound or a combination according to any of the above paragraphs, or a pharmaceutically acceptable salt thereof, in the manufacture of a medicament for the treatment and/or prophylaxis of bacterial infection.
- Step 1 4-(4-Nitrophenoxy)-2-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yljbenzaldehyde
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Life Sciences & Earth Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
This invention relates to, among other items, 6-substituted benzoxaborole compounds and their use for treating bacterial infections.
Description
BORON-CONTAINING SMALL MOLECULES CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of U.S. Provisional Pat. App. No. 61/052,604, filed May 12, 2008 and U.S. Provisional Pat. App. No. 61/138,484, filed December 17, 2008, each of which is incorporated by reference in its entirety for all purposes.
BACKGROUND OF THE INVENTION
[0002] The global rise of bacteria and other microorganisms resistant to antibiotics and antimicrobials in general, poses a major threat. Deployment of massive quantities of antimicrobial agents into the ecosphere during the past 60 years has introduced a powerful selective pressure for the emergence and spread of antimicrobial-resistant pathogens. Thus, there is a need to discover new broad spectrum antimicrobials, such as antibiotics, useful in combating microorganisms, especially those with multidrug- resistance. There is also a need to discover compounds which are useful in inhibiting or deactivating the resistance mechanisms of microorganisms, such as beta-lactamase enzymes.
[0003] Boron-containing molecules, such as 1 -hydroxy- 1,3 -dihy dro- benzo[c][l,2]oxaborole (also sometimes known as l-hydroxy-benzo[c][l,2]oxaborole or oxaboroles or cyclic boronic esters), useful as antimicrobials have been described previously, such as in U.S. Pat. Apps. 12/142,692; 11/505,591 and 11/357,687. Generally speaking, a l-hydroxy-l,3-dihydro-benzo[c][l,2]oxaborole has the following structure and substituent numbering system:
It has been discovered that certain classes of 1 -hydroxy- 1,3 -dihy dro- benzo[c][l,2]oxaboroles which are substituted at the 6-position with an unsubstituted or monosubstituted aryloxy, heteroaryloxy, cycloalkoxy or heterocycloalkoxy moiety are surprisingly effective beta-lactamase inhibitors. It has also been discovered that
certain classes of 1 -hydroxy- l,3-dihydro-benzo[c][l,2]oxaboroles which are substituted at the 6-position with an aryloxy, heteroaryloxy, cycloalkoxy or heterocycloalkoxy moiety, and are also substituted at the 3-position, are surprisingly effective beta-lactamase inhibitors. It has also been discovered that certain classes of 1 -hydroxy- 1 ,3-dihydro-benzo[c] [ 1 ,2]oxaboroles which are substituted at the 6- position with an unsubstituted or monosubstituted aryl or heteroaryl sulfonamide moiety are surprisingly effective antibacterials. This, and other uses of these 1- hydroxy-l,3-dihydro-benzo[c][l,2]oxaboroles are described herein.
SUMMARY OF THE INVENTION [0004] In a first aspect, the invention provides a compound having a structure according to the formula:
wherein A is a member selected from cycloalkyl, heterocycloalkyl, aryl and heteroaryl; Y is a member selected from O and -S(O)2NH- wherein the sulfur in- S(O)2NH- is covalently attached to A; R3 is a member selected from H, cyano and substituted alkyl; Ra is a member selected from H, -OR10, -NR10R11, -SR10, -S(O)R10, -S(O)2R10, -S(O)2NR10R11, -C(O)R10, -C(O)OR10, -C(O)NR10R11, nitro, cyano, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl, wherein each R10 and each R11 is a member independently selected from H, nitro, halogen, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl, with the proviso that R10 and R11, together with the nitrogen to which they are attached, are optionally combined to form a 5- to 7-membered substituted or unsubstituted heterocycloalkyl ring; with the proviso that when Y is O, R3 is a member selected from cyano and substituted alkyl; with the proviso that when Y is -S(O)2NH-, R3 is H, and Ra is not H or unsubstituted alkyl or halosubstituted alkyl, and salts thereof.
[0005] In another aspect, the invention provides a combination comprising: a) a compound of the invention; and b) a therapeutically active agent.
[0006] In another aspect, the invention provides a pharmaceutical formulation comprising: a) a compound of the invention or a combination of the invention; and b) a pharmaceutically acceptable excipient.
[0007] In another aspect, the invention provides a method of treating a bacterial infection comprising: administering to an animal suffering from said infection an effective amount of a compound of the invention, and an effective amount of an antibiotic, wherein said antibiotic comprises a β-lactam moiety, thereby treating the bacterial infection.
[0008] In another aspect, the invention provides a method of killing or inhibiting the growth of a bacteria, said method comprising: contacting said bacteria with an effective amount of a compound of the invention or a combination of the invention, or a pharmaceutically acceptable salt thereof, thereby killing or inhibiting the growth of the bacteria.
[0009] In another aspect, the invention provides a method of inhibiting a β- lactamase, comprising contacting the β-lactamase with an effective amount of a compound of the invention, thereby inhibiting the β-lactamase.
[0010] In another aspect, the invention provides a method of treating a bacterial infection comprising: administering to an animal suffering from said infection an effective amount of a compound of the invention, thereby treating the bacterial infection.
[0011] In another aspect, the invention provides a method of inhibiting the editing domain of a t-RNA synthetase, comprising: contacting the synthetase with an effective amount of a compound of the invention, thereby inhibiting the synthetase.
[0012] In another aspect, the invention provides a use of a compound of the invention or a combination of the invention, in the manufacture of a medicament for the treatment and/or prophylaxis of bacterial infection.
BRIEF DESCRIPTION OF THE DRAWINGS [0013] FIG. 1 displays exemplary compounds of the invention.
[0014] FIG. 2 displays biological data for exemplary compounds of the invention.
[0015] FIG. 3 displays biological data for exemplary compounds of the invention. 'ND' stands for a value that was not determined.
DETAILED DESCRIPTION OF THE INVENTION /. Definitions and Abbreviations
[0016] The abbreviations used herein generally have their conventional meaning within the chemical and biological arts.
[0017] "Compound of the invention," as used herein refers to the compounds discussed herein, salts (e.g. pharmaceutically acceptable salts), prodrugs, solvates and hydrates of these compounds.
[0018] "Combination of the invention," as used herein refers to the compounds and antibiotics discussed herein as well as acids, bases, salt forms (such as pharmaceutically acceptable salts), prodrugs, solvates and hydrates of these compounds and antibiotics. [0019] "Boron containing compounds", as used herein, refers to the compounds of the invention that contain boron as part of their chemical formula.
[0020] MIC, or minimum inhibitory concentration, is the point where the compound stops more than 50% of cell growth, preferably 60% of cell growth, preferably 70% of cell growth, preferably 80% of cell growth, preferably 90% of cell growth, relative to an untreated control.
[0021] Where substituent groups are specified by their conventional chemical formulae, written from left to right, they equally encompass the chemically identical substituents, which would result from writing the structure from right to left, e.g., -CH2O- is intended to also recite -OCH2-. [0022] The term "poly" as used herein means at least 2. For example, a polyvalent metal ion is a metal ion having a valency of at least 2.
[0023] "Moiety" refers to a radical of a molecule that is attached to the remainder of the molecule.
[0024] The symbol VΛΛ/VP , whether utilized as a bond or displayed perpendicular to a bond, indicates the point at which the displayed moiety is attached to the remainder of the molecule.
[0025] The term "alkyl," by itself or as part of another substituent, means, unless otherwise stated, a straight or branched chain, or cyclic hydrocarbon radical, or combination thereof, which may be fully saturated, mono- or polyunsaturated and can include di- and multivalent radicals, having the number of carbon atoms designated (i.e. Ci-Cio means one to ten carbons). In some embodiments, the term "alkyl" means a straight or branched chain, or combinations thereof, which may be fully saturated, mono- or polyunsaturated and can include di- and multivalent radicals. Examples of saturated hydrocarbon radicals include, but are not limited to, groups such as methyl, ethyl, n-propyl, isopropyl, n-butyl, t-butyl, isobutyl, sec-butyl, cyclohexyl, (cyclohexyl)methyl, cyclopropylmethyl, homologs and isomers of, for example, n- pentyl, n-hexyl, n-heptyl, n-octyl, and the like. An unsaturated alkyl group is one having one or more double bonds or triple bonds. Examples of unsaturated alkyl groups include, but are not limited to, vinyl, 2-propenyl, crotyl, 2-isopentenyl, 2- (butadienyl), 2,4-pentadienyl, 3-(l,4-pentadienyl), ethynyl, 1- and 3-propynyl, 3- butynyl, and the higher homologs and isomers.
[0026] The term "alkylene" by itself or as part of another substituent means a divalent radical derived from an alkane, as exemplified, but not limited, by - CH2CH2CH2CH2-, and further includes those groups described below as "heteroalkylene." Typically, an alkyl (or alkylene) group will have from 1 to 24 carbon atoms, with those groups having 10 or fewer carbon atoms being preferred in the present invention. A "lower alkyl" or "lower alkylene" is a shorter chain alkyl or alkylene group, generally having eight or fewer carbon atoms.
[0027] The terms "alkoxy," "alkylamino" and "alkylthio" (or thioalkoxy) are used in their conventional sense, and refer to those alkyl groups attached to the remainder of the molecule via an oxygen atom, an amino group, or a sulfur atom, respectively.
[0028] The term "heteroalkyl," by itself or in combination with another term, means, unless otherwise stated, a stable straight or branched chain, or cyclic hydrocarbon radical, or combinations thereof, consisting of the stated number of carbon atoms and at least one heteroatom. In some embodiments, the term
"heteroalkyl," by itself or in combination with another term, means a stable straight or branched chain, or combinations thereof, consisting of the stated number of carbon atoms and at least one heteroatom. In an exemplary embodiment, the heteroatoms can be selected from the group consisting of B, O, N and S, and wherein the nitrogen and sulfur atoms may optionally be oxidized and the nitrogen heteroatom may optionally be quaternized. The heteroatom(s) B, O, N and S may be placed at any interior position of the heteroalkyl group or at the position at which the alkyl group is attached to the remainder of the molecule. Examples include, but are not limited to, -CH2- CH2-O-CH3, -CH2-CH2-NH-CH3, -CH2-CH2-N(CHs)-CH3, -CH2-S-CH2-CH3, -CH2- CH25-S(O)-CH3, -CH2-CH2-S(O)2-CH3, -CH=CH-O-CH3, -CH2-CH=N-OCH3, and - CH=CH-N(CH3)-CH3. Up to two heteroatoms may be consecutive, such as, for example, -CH2-NH-OCH3. Similarly, the term "heteroalkylene" by itself or as part of another substituent means a divalent radical derived from heteroalkyl, as exemplified, but not limited by, -CH2-CH2-S-CH2-CH2- and -CH2-S-CH2-CH2-NH-CH2-. For heteroalkylene groups, heteroatoms can also occupy either or both of the chain termini (e.g., alkyleneoxy, alkylenedioxy, alkyleneamino, alkylenediamino, and the like). Still further, for alkylene and heteroalkylene linking groups, no orientation of the linking group is implied by the direction in which the formula of the linking group is written. For example, the formula -C(O)2R'- represents both -C(O)2R'- and - R5C(O)2-.
[0029] The terms "cycloalkyl" and "heterocycloalkyl", by themselves or in combination with other terms, represent, unless otherwise stated, cyclic versions of "alkyl" and "heteroalkyl", respectively. Additionally, for heterocycloalkyl, a heteroatom can occupy the position at which the heterocycle is attached to the remainder of the molecule. Examples of cycloalkyl include, but are not limited to, cyclopentyl, cyclohexyl, 1-cyclohexenyl, 3-cyclohexenyl, cycloheptyl, and the like. Examples of heterocycloalkyl include, but are not limited to, 1 -(1,2,5,6- tetrahydropyridyl), 1-piperidinyl, 2-piperidinyl, 3-piperidinyl, 4-morpholinyl, 3- morpholinyl, tetrahydrofuran-2-yl, tetrahydrofuran-3-yl, tetrahydrothien-2-yl, tetrahydrothien-3-yl, 1 -piperazinyl, 2-piperazinyl, and the like.
[0030] The terms "halo" or "halogen," by themselves or as part of another substituent, mean, unless otherwise stated, a fluorine, chlorine, bromine, or iodine atom. Additionally, terms such as "haloalkyl," are meant to include monohaloalkyl
and polyhaloalkyl. For example, the term "halo(Ci-C4)alkyl" is mean to include, but not be limited to, trifluoromethyl, 2,2,2-trifluoroethyl, 4-chlorobutyl, 3-bromopropyl, and the like.
[0031] The term "aryl" means, unless otherwise stated, a polyunsaturated, aromatic, substituent that can be a single ring or multiple rings (preferably from 1 to 3 rings), which are fused together or linked covalently. The term "heteroaryl" refers to aryl groups (or rings) that contain from one to four heteroatoms. In an exemplary embodiment, the heteroatom is selected from B, N, O, and S, wherein the nitrogen and sulfur atoms are optionally oxidized, and the nitrogen atom(s) are optionally quaternized. A heteroaryl group can be attached to the remainder of the molecule through a heteroatom. Non- limiting examples of aryl and heteroaryl groups include phenyl, 1-naphthyl, 2-naphthyl, 4-biphenyl, 1-pyrrolyl, 2-pyrrolyl, 3-pyrrolyl, 3- pyrazolyl, 2-imidazolyl, 4-imidazolyl, pyrazinyl, 2-oxazolyl, 4-oxazolyl, 2-phenyl-4- oxazolyl, 5-oxazolyl, 3-isoxazolyl, 4-isoxazolyl, 5-isoxazolyl, 2-thiazolyl, 4-thiazolyl, 5-thiazolyl, 2-furyl, 3-furyl, 2-thienyl, 3-thienyl, 2-pyridyl, 3-pyridyl, 4-pyridyl, 2- pyrimidyl, 4-pyrimidyl, 5-benzothiazolyl, purinyl, 2-benzimidazolyl, 5-indolyl, 1- isoquinolyl, 5-isoquinolyl, 2-quinoxalinyl, 5-quinoxalinyl, 3-quinolyl, 6-quinolyl, dioxaborolane, dioxaborinane and dioxaborepane. Substituents for each of the above noted aryl and heteroaryl ring systems are selected from the group of acceptable substituents described below.
[0032] For brevity, the term "aryl" when used in combination with other terms (e.g. , aryloxy, arylthioxy, arylalkyl) includes both aryl and heteroaryl rings as defined above. Thus, the term "arylalkyl" is meant to include those radicals in which an aryl group is attached to an alkyl group (e.g. , benzyl, phenethyl, pyridylmethyl and the like) including those alkyl groups in which a carbon atom (e.g., a methylene group) has been replaced by, for example, an oxygen atom (e.g., phenoxymethyl, 2- pyridyloxymethyl, 3-(l-naphthyloxy)propyl, and the like).
[0033] Each of the above terms (e.g., "alkyl," "heteroalkyl," "aryl" and "heteroaryl") are meant to include both substituted and unsubstituted forms of the indicated radical. Preferred substituents for each type of radical are provided below.
[0034] Substituents for the alkyl and heteroalkyl radicals (including those groups often referred to as alkylene, alkenyl, heteroalkylene, heteroalkenyl, alkynyl,
cycloalkyl, heterocycloalkyl, cycloalkenyl, and heterocycloalkenyl) are generically referred to as "alkyl group substituents," and they can be one or more of a variety of groups selected from, but not limited to: -R', -OR', =0, =NR', =N-0R', -NR'R", - SR', -halogen, -SiR'R"R'", -OC(O)R', -C(O)R', -CO2R', -CONR'R", -0C(0)NR'R", -NR"C(0)R', -NR'-C(0)NR"R"', -NR"C(0)2R', -NR'""-C(NR'R"R'")=NR"",
-NR""-C(NR'R")=NR'", -S(O)R', -S(O)2R', -S(O)2NR5R", -NR"S02R', -CN, -NO2, -N3, -CH(Ph)2, fluoro(Ci-C4)alkoxy, and fluoro(Ci-C4)alkyl, in a number ranging from zero to (2m'+l), where m' is the total number of carbon atoms in such radical. R', R", R'", R"" and R'"" each preferably independently refer to hydrogen, substituted or unsubstituted heteroalkyl, substituted or unsubstituted aryl, e.g. , aryl substituted with 1-3 halogens, substituted or unsubstituted alkyl, alkoxy or thioalkoxy groups, or arylalkyl groups. When a compound of the invention includes more than one R group, for example, each of the R groups is independently selected as are each R', R", R'", R"" and R'"" groups when more than one of these groups is present. When R' and R" are attached to the same nitrogen atom, they can be combined with the nitrogen atom to form a 5-, 6-, or 7-membered ring. For example, -NR'R" is meant to include, but not be limited to, 1-pyrrolidinyl and 4-morpholinyl. From the above discussion of substituents, one of skill in the art will understand that the term "alkyl" is meant to include groups including carbon atoms bound to groups other than hydrogen groups, such as haloalkyl (e.g., -CF3 and -CH2CF3) and acyl (e.g., - C(O)CH3, -C(O)CF3, -C(O)CH2OCH3, and the like).
[0035] Similar to the substituents described for the alkyl radical, substituents for the aryl and heteroaryl groups are generically referred to as "aryl group substituents." The substituents are selected from, for example: -R', -OR', =0, =NR', =N-0R', - NR'R", -SR', -halogen, -SiR'R"R'", -OC(O)R', -C(O)R', -CO2R', -CONR'R", - 0C(0)NR'R", -NR"C(0)R', -NR'-C(0)NR"R"', -NR"C(0)2R', -NR"'"- C(NR'R"R'")=NR"", -NR""-C(NR'R")=NR'", -S(O)R', -S(O)2R', -S(O)2NR5R", -NR"S02R', -CN, -NO2, -N3, -CH(Ph)2, fluoro(Ci-C4)alkoxy, and fluoro(Ci-C4)alkyl, in a number ranging from zero to the total number of open valences on the aromatic ring system; and where R', R", R'", R"" and R'"" are preferably independently selected from hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heteroaryl. When a compound of the invention includes more than one
R group, for example, each of the R groups is independently selected as are each R', R", R'", R"" and R'"" groups when more than one of these groups is present.
[0036] Two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally be replaced with a substituent of the formula -T-C(O)-(CRR')q-U-, wherein T and U are independently -NR-, -O-, -CRR'- or a single bond, and q is an integer of from 0 to 3. Alternatively, two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally be replaced with a substituent of the formula - A-(CH2)r-B-, wherein A and B are independently -CRR'-, -O-, -NR-, -S-, -S(O)-, -S(O)2-, -S(O)2NR'- or a single bond, and r is an integer of from 1 to 4. One of the single bonds of the new ring so formed may optionally be replaced with a double bond. Alternatively, two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally be replaced with a substituent of the formula - (CRR')s-X-(CR"R'")d-, where s and d are independently integers of from 0 to 3, and X is -O-, -NR'-, -S-, -S(O)-, -S(O)2-, or -S(O)2NR'-. The substituents R, R', R" and R'" are preferably independently selected from hydrogen or substituted or unsubstituted (Ci-C6)alkyl.
[0037] "Ring" as used herein, means a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. A ring includes fused ring moieties. The number of atoms in a ring is typically defined by the number of members in the ring. For example, a "5- to 7-membered ring" means there are 5 to 7 atoms in the encircling arrangement. Unless otherwise specified, the ring optionally includes a heteroatom. Thus, the term "5- to 7-membered ring" includes, for example phenyl, pyridinyl and piperidinyl. The term "5- to 7-membered heterocycloalkyl ring", on the other hand, would include pyridinyl and piperidinyl, but not phenyl. The term "ring" further includes a ring system comprising more than one "ring", wherein each "ring" is independently defined as above.
[0038] As used herein, the term "heteroatom" includes atoms other than carbon (C) and hydrogen (H). Examples include oxygen (O), nitrogen (N) sulfur (S), silicon (Si), germanium (Ge), aluminum (Al) and boron (B).
[0039] The term "leaving group" means a functional group or atom which can be displaced by another functional group or atom in a substitution reaction, such as a
nucleophilic substitution reaction. By way of example, representative leaving groups include triflate, chloro, bromo and iodo groups; sulfonic ester groups, such as mesylate, tosylate, brosylate, nosylate and the like; and acyloxy groups, such as acetoxy, trifluoroacetoxy and the like. [0040] The symbol "R" is a general abbreviation that represents a substituent group that is selected from substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted cycloalkyl and substituted or unsubstituted heterocycloalkyl groups. [0041] By "effective" amount of a drug, formulation, or permeant is meant a sufficient amount of an active agent to provide the desired local or systemic effect. A "Topically effective," "Cosmetically effective," "pharmaceutically effective," or "therapeutically effective" amount refers to the amount of drug needed to effect the desired therapeutic result. [0042] "Topically effective" refers to a material that, when applied to the skin, nail, hair, claw or hoof produces a desired pharmacological result either locally at the place of application or systemically as a result of transdermal passage of an active ingredient in the material.
[0043] "Cosmetically effective" refers to a material that, when applied to the skin, nail, hair, claw or hoof, produces a desired cosmetic result locally at the place of application of an active ingredient in the material.
[0044] The term "pharmaceutically acceptable salt" is meant to include a salt of a compound of the invention which are prepared with relatively nontoxic acids or bases, depending on the particular substituents found on the compounds described herein. When compounds of the invention contain relatively acidic functionalities, base addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired base, either neat or in a suitable inert solvent. Examples of pharmaceutically acceptable base addition salts include sodium, potassium, calcium, ammonium, organic amino, or magnesium salt, or a similar salt. When compounds of the invention contain relatively basic functionalities, acid addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired acid, either neat or in a suitable inert solvent.
Examples of pharmaceutically acceptable acid addition salts include those derived from inorganic acids like hydrochloric, hydrobromic, nitric, carbonic, monohydrogencarbonic, phosphoric, monohydrogenphosphoric, dihydrogenphosphoric, sulfuric, monohydrogensulfuric, hydriodic, or phosphorous acids and the like, as well as the salts derived from relatively nontoxic organic acids like acetic, propionic, isobutyric, maleic, malonic, benzoic, succinic, suberic, fumaric, lactic, mandelic, phthalic, benzenesulfonic, p-tolylsulfonic, citric, tartaric, methanesulfonic, and the like. Also included are salts of amino acids such as arginate and the like, and salts of organic acids like glucuronic or galactunoric acids and the like (see, for example, Berge et al., "Pharmaceutical Salts", Journal of Pharmaceutical Science 66: 1-19 (1977)). Certain specific compounds of the invention contain both basic and acidic functionalities that allow the compounds to be converted into either base or acid addition salts.
[0045] The neutral forms of the compounds are preferably regenerated by contacting the salt with a base or acid and isolating the parent compounds in the conventional manner. The parent form of the compound differs from the various salt forms in certain physical properties, such as solubility in polar solvents.
[0046] In addition to salt forms, the present invention provides compounds which are in a prodrug form. Prodrugs of the compounds described herein readily undergo chemical changes under physiological conditions to provide the compounds of the invention. Additionally, prodrugs can be converted to the compounds of the invention by chemical or biochemical methods in an ex vivo environment.
[0047] Certain compounds of the invention can exist in unsolvated forms as well as solvated forms, including hydrated forms. In general, the solvated forms are equivalent to unsolvated forms and are encompassed within the scope of the present invention. Certain compounds of the invention may exist in multiple crystalline or amorphous forms.
[0048] Certain compounds of the invention possess asymmetric carbon atoms (optical centers) or double bonds; the racemates, diastereomers, geometric isomers and individual isomers are encompassed within the scope of the present invention. The graphic representations of racemic, ambiscalemic and scalemic or enantiomerically pure compounds used herein are taken from Maehr, J. Chem. Ed.
1985, 62: 114-120. Solid and broken wedges are used to denote the absolute configuration of a stereocenter unless otherwise noted. When the compounds described herein contain olefinic double bonds or other centers of geometric asymmetry, and unless specified otherwise, it is intended that the compounds include both E and Z geometric isomers. Likewise, all tautomeric forms are included.
[0049] Compounds of the invention can exist in particular geometric or stereoisomeric forms. The invention contemplates all such compounds, including cis- and trans -isomers, (-)- and (+)-enantiomers, (R)- and (S)-enantiomers, diastereomers, (D)-isomers, (L)-isomers, the racemic mixtures thereof, and other mixtures thereof, such as enantiomerically or diastereomerically enriched mixtures, as falling within the scope of the invention. Additional asymmetric carbon atoms can be present in a substituent such as an alkyl group. All such isomers, as well as mixtures thereof, are intended to be included in this invention.
[0050] Optically active (R)- and (5)-isomers and d and / isomers can be prepared using chiral synthons or chiral reagents, or resolved using conventional techniques. If, for instance, a particular enantiomer of a compound of the present invention is desired, it can be prepared by asymmetric synthesis, or by derivatization with a chiral auxiliary, where the resulting diastereomeric mixture is separated and the auxiliary group cleaved to provide the pure desired enantiomers. Alternatively, where the molecule contains a basic functional group, such as an amino group, or an acidic functional group, such as a carboxyl group, diastereomeric salts can be formed with an appropriate optically active acid or base, followed by resolution of the diastereomers thus formed by fractional crystallization or chromatographic means known in the art, and subsequent recovery of the pure enantiomers. In addition, separation of enantiomers and diastereomers is frequently accomplished using chromatography employing chiral, stationary phases, optionally in combination with chemical derivatization (e.g., formation of carbamates from amines).
[0051] The compounds of the invention may also contain unnatural proportions of atomic isotopes at one or more of the atoms that constitute such compounds. For example, the compounds may be radiolabeled with radioactive isotopes, such as for example tritium (3H), iodine-125 (125I) or carbon-14 (14C). All isotopic variations of
the compounds of the invention, whether radioactive or not, are intended to be encompassed within the scope of the present invention.
[0052] The term "pharmaceutically acceptable carrier" or "pharmaceutically acceptable vehicle" refers to any formulation or carrier medium that provides the appropriate delivery of an effective amount of an active agent as defined herein, does not interfere with the effectiveness of the biological activity of the active agent, and that is sufficiently non-toxic to the host or patient. Representative carriers include water, oils, both vegetable and mineral, cream bases, lotion bases, ointment bases and the like. These bases include suspending agents, thickeners, penetration enhancers, and the like. Their formulation is well known to those in the art of cosmetics and topical pharmaceuticals. Additional information concerning carriers can be found in Remington: The Science and Practice of Pharmacy, 21st Ed., Lippincott, Williams & Wilkins (2005) which is incorporated herein by reference.
[0053] "Pharmaceutically acceptable topical carrier" and equivalent terms refer to pharmaceutically acceptable carriers, as described herein above, suitable for topical application. An inactive liquid or cream vehicle capable of suspending or dissolving the active agent(s), and having the properties of being nontoxic and non-inflammatory when applied to the skin, nail, hair, claw or hoof is an example of a pharmaceutically- acceptable topical carrier. This term is specifically intended to encompass carrier materials approved for use in topical cosmetics as well.
[0054] The term "pharmaceutically acceptable additive" refers to preservatives, antioxidants, fragrances, emulsifϊers, dyes and excipients known or used in the field of drug formulation and that do not unduly interfere with the effectiveness of the biological activity of the active agent, and that is sufficiently non-toxic to the host or patient. Additives for topical formulations are well-known in the art, and may be added to the topical composition, as long as they are pharmaceutically acceptable and not deleterious to the epithelial cells or their function. Further, they should not cause deterioration in the stability of the composition. For example, inert fillers, anti- irritants, tackifiers, excipients, fragrances, opacifiers, antioxidants, gelling agents, stabilizers, surfactant, emollients, coloring agents, preservatives, buffering agents, other permeation enhancers, and other conventional components of topical or transdermal delivery formulations as are known in the art.
[0055] The terms "enhancement," "penetration enhancement" or "permeation enhancement" relate to an increase in the permeability of the skin, nail, hair, claw or hoof to a drug, so as to increase the rate at which the drug permeates through the skin, nail, hair, claw or hoof. The enhanced permeation effected through the use of such enhancers can be observed, for example, by measuring the rate of diffusion of the drug through animal skin, nail, hair, claw or hoof using a diffusion cell apparatus. A diffusion cell is described by Merritt et al. Diffusion Apparatus for Skin Penetration, J of Controlled Release, 1 (1984) pp. 161-162. The term "permeation enhancer" or "penetration enhancer" intends an agent or a mixture of agents, which, alone or in combination, act to increase the permeability of the skin, nail, hair or hoof to a drug.
[0056] The term "excipients" is conventionally known to mean carriers, diluents and/or vehicles used in formulating drug compositions effective for the desired use.
[0057] The term "topical administration" refers to the application of a pharmaceutical agent to the external surface of the skin, nail, hair, claw or hoof, such that the agent crosses the external surface of the skin, nail, hair, claw or hoof and enters the underlying tissues. Topical administration includes application of the composition to intact skin, nail, hair, claw or hoof, or to a broken, raw or open wound of skin, nail, hair, claw or hoof. Topical administration of a pharmaceutical agent can result in a limited distribution of the agent to the skin and surrounding tissues or, when the agent is removed from the treatment area by the bloodstream, can result in systemic distribution of the agent.
[0058] The term "transdermal delivery" refers to the diffusion of an agent across the barrier of the skin, nail, hair, claw or hoof resulting from topical administration or other application of a composition. The stratum corneum acts as a barrier and few pharmaceutical agents are able to penetrate intact skin. In contrast, the epidermis and dermis are permeable to many solutes and absorption of drugs therefore occurs more readily through skin, nail, hair, claw or hoof that is abraded or otherwise stripped of the stratum corneum to expose the epidermis. Transdermal delivery includes injection or other delivery through any portion of the skin, nail, hair, claw or hoof or mucous membrane and absorption or permeation through the remaining portion. Absorption through intact skin, nail, hair, claw or hoof can be enhanced by placing the active agent in an appropriate pharmaceutically acceptable vehicle before application to the
skin, nail, hair, claw or hoof. Passive topical administration may consist of applying the active agent directly to the treatment site in combination with emollients or penetration enhancers. As used herein, transdermal delivery is intended to include delivery by permeation through or past the integument, i.e. skin, nail, hair, claw or hoof.
[0059] The terms "effective amount" or a "therapeutically effective amount" of a drug or pharmacologically active agent refers to a nontoxic but sufficient amount of the drug or agent to provide the desired effect. In the oral dosage forms of the present disclosure, an "effective amount" of one active of the combination is the amount of that active that is effective to provide the desired effect when used in combination with the other active of the combination. The amount that is "effective" will vary from subject to subject, depending on the age and general condition of the individual, the particular active agent or agents, and the appropriate "effective" amount in any individual case may be determined by one of ordinary skill in the art using routine experimentation.
[0060] The phrases "active ingredient", "therapeutic agent", "active", or "active agent" mean a chemical entity which can be effective in treating a targeted disorder, disease or condition.
[0061] The phrase "pharmaceutically acceptable" means moieties or compounds that are, within the scope of medical judgment, suitable for use in humans without causing undesirable biological effects such as undue toxicity, irritation, allergic response, and the like, for example.
[0062] The phrase "oral dosage form" means any pharmaceutical composition administered to a subject via the oral cavity. Exemplary oral dosage forms include tablets, capsules, films, powders, sachets, granules, solutions, solids, suspensions or as more than one distinct unit (e.g., granules, tablets, and/or capsules containing different actives) packaged together for co-administration, and other formulations known in the art. An oral dosage form can be one, two, three, four, five or six units. When the oral dosage form has multiple units, all of the units are contained within a single package, (e.g. a bottle or other form of packaging such as a blister pack).
When the oral dosage form is a single unit, it may or may not be in a single package. In a preferred embodiment, the oral dosage form is one, two or three units. In a
particularly preferred embodiment, the oral dosage form is one unit.
[0063] The phrase "unit", as used herein, refers to the number of discrete objects to be administered which comprise the dosage form. In some embodiments, the dosage form includes a compound of the invention in one capsule. This is a single unit. In some embodiments, the dosage form includes a compound of the invention as part of a therapeutically effective dosage of a cream or ointment. This is also a single unit. In some embodiments, the dosage form includes a compound of the invention and another active ingredient contained within one capsule, or as part of a therapeutically effective dosage of a cream or ointment. This is a single unit, whether or not the interior of the capsule includes multiple discrete granules of the active ingredient. In some embodiments, the dosage form includes a compound of the invention in one capsule, and the active ingredient in a second capsule. This is a two unit dosage form, such as two capsules or tablets, and so such units are contained in a single package. Thus the term 'unit' refers to the object which is administered to the animal, not to the interior components of the object.
[0064] The term, "prodrug", as defined herein, is a derivative of a parent drug molecule that exerts its pharmacological effect only after chemical and/or enzymatic conversion to its active form in vivo. Prodrugs include those designed to circumvent problems associated with delivery of the parent drug. This may be due to poor physicochemical properties, such as poor chemical stability or low aqueous solubility, and may also be due to poor pharmacokinetic properties, such as poor bioavailability or poor half- life. Thus, certain advantages of prodrugs may include improved chemical stability, absorption, and/or PK properties of the parent carboxylic acids. Prodrugs may also be used to make drugs more "patient friendly," by minimizing the frequency (e.g., once daily) or route of dosing (e.g., oral), or to improve the taste or odor if given orally, or to minimize pain if given parenterally .
[0065] In some embodiments, the prodrugs are chemically more stable than the active drug, thereby improving formulation and delivery of the parent drug, compared to the drug alone. [0066] Prodrugs for carboxylic acid analogs of the invention may include a variety of esters. In an exemplary embodiment, the pharmaceutical compositions of the invention include a carboxylic acid ester. In an exemplary embodiment, the prodrug
is suitable for treatment /prevention of those diseases and conditions that require the drug molecule to cross the blood brain barrier. In an exemplary embodiment, the prodrug enters the brain, where it is converted into the active form of the drug molecule. In one embodiment, a prodrug is used to enable an active drug molecule to reach the inside of the eye after topical application of the prodrug to the eye. Additionally, a prodrug can be converted to its parent compound by chemical or biochemical methods in an ex vivo environment. For example, a prodrug can be slowly converted to its parent compound when placed in a transdermal patch reservoir with a suitable enzyme or chemical reagent. [0067] "Antibiotic", as used herein, is a compound which can kill or inhibit the growth of bacteria. The term antibiotic is broad enough to encompass acids, bases, salt forms (such as pharmaceutically acceptable salts), prodrugs, solvates and hydrates of the antibiotic compound.
[0068] The term "microbial infection" or "infection by a microorganism" refers to any infection of a host by an infectious agent including, but not limited to, viruses, bacteria, mycobacteria, fungus and parasites (see, e.g., Harrison's Principles of Internal Medicine, pp. 93-98 (Wilson et al., eds., 12th ed. 1991); Williams et al, J. of Medicinal Chem. 42:1481-1485 (1999), herein each incorporated by reference in their entirety). [0069] "Biological medium," as used herein refers to both in vitro and in vivo biological milieus. Exemplary in vitro "biological media" include, but are not limited to, cell culture, tissue culture, homogenates, plasma and blood. In vivo applications are generally performed in mammals, preferably humans.
[0070] "Inhibiting" and "blocking," are used interchangeably herein to refer to the partial or full blockade of an enzyme, such as a β-lactamase or a LeuRS.
[0071] The term "leaving group" means a functional group or atom which can be displaced by another functional group or atom in a substitution reaction, such as a nucleophilic substitution reaction. By way of example, representative leaving groups include triflate, chloro, bromo and iodo groups; sulfonic ester groups, such as mesylate, tosylate, brosylate, nosylate and the like; and acyloxy groups, such as acetoxy, trifluoroacetoxy and the like.
[0072] The term "amino-protecting group" means a protecting group suitable for preventing undesired reactions at an amino nitrogen. Representative amino-protecting groups include, but are not limited to, formyl; acyl groups, for example alkanoyl groups, such as acetyl, trichloroacetyl or trifluoroacetyl; alkoxycarbonyl groups, such as tert-butoxycarbonyl (Boc); arylmethoxycarbonyl groups, such as benzyloxycarbonyl (Cbz) and 9-fluorenylmethoxycarbonyl (Fmoc); arylmethyl groups, such as benzyl (Bn), trityl (Tr), and l,l-di-(4'-methoxyphenyl)methyl; silyl groups, such as trimethylsilyl (TMS) and tert-butyldimethylsilyl (TBS); and the like.
[0073] The term "hydroxy-protecting group" means a protecting group suitable for preventing undesired reactions at a hydroxy group. Representative hydroxy- protecting groups include, but are not limited to, alkyl groups, such as methyl, ethyl, and tert-butyl; acyl groups, for example alkanoyl groups, such as acetyl; arylmethyl groups, such as benzyl (Bn), p-methoxybenzyl (PMB), 9-fluorenylmethyl (Fm), and diphenylmethyl (benzhydryl, DPM); silyl groups, such as trimethylsilyl (TMS) and tert-butyldimethylsilyl (TBS); and the like.
[0074] Boron is able to form dative bonds with oxygen, sulfur or nitrogen under some circumstances in this invention. Dative bonds are usually weaker than covalent bonds. In situations where a boron is covalently bonded to at least one oxygen, sulfur or nitrogen, and is at the same time datively bonded to an oxygen, sulfur or nitrogen, respectively, the dative bond and covalent bond between the boron and the two identical heteroatoms can interconvert or be in the form of a resonance hybrid. There is potential uncertainty surrounding the exact nature and extent of electron sharing in these situations. The structures supplied are not intended to include any and all possible bonding scenarios between boron and the atom to which it is bound. Non limiting examples of these bonds are as follows:
[0075] "Salt counterion", as used herein, refers to positively charged ions that associate with a compound of the invention when the boron is fully negatively or partially negatively charged. Examples of salt counterions include H+, H3O+, ammonium, potassium, calcium, magnesium and sodium. [0076] The compounds comprising a boron bonded to a carbon and three heteroatoms (such as three oxygens described in this section) can optionally contain a fully negatively charged boron or partially negatively charged boron, due to the nature of the dative bond between the boron and one of the oxygens. Due to the negative charge, a positively charged counterion may associate with this compound, thus forming a salt. Examples of positively charged counterions include H+, H3O+, calcium, sodium, ammonium, potassium. The salts of these compounds are implicitly contained in descriptions of these compounds.
[0077] The present invention also encompasses compounds that are poly- or multi-valent species, including, for example, species such as dimers, trimers, tetramers and higher homo logs of the compounds of use in the invention or reactive analogues thereof. For example, dimers of oxaboroles can form under the following conditions:
[0078] The present invention also encompasses compounds that are anhydrides of the cyclic boronic esters are synthesized by subjecting these compounds to dehydrating conditions. Examples of these anhydrides are provided below:
[0079] Trimers of the compounds of the invention are also produced. For example, trimers of acyclic boronic esters can be formed as follows:
[0080] Polymers of the compounds of the invention are also produced through the removal of certain protecting groups in strong acid. For example, trimers of acyclic boronic esters can be formed as follows:
[0081] Also of use in the present invention are compounds that are poly- or multivalent species, including, for example, species such as dimers, trimers, tetramers and higher homo logs of the compounds of use in the invention or reactive analogues thereof. The poly- and multi-valent species can be assembled from a single species or more than one species of the invention. For example, a dimeric construct can be "homo-dimeric" or "heterodimeric." Moreover, poly- and multi-valent constructs in which a compound of the invention or a reactive analogue thereof, is attached to an oligomeric or polymeric framework (e.g., polylysine, dextran, hydroxyethyl starch and the like) are within the scope of the present invention. The framework is preferably polyfunctional (i.e. having an array of reactive sites for attaching compounds of use in the invention). Moreover, the framework can be derivatized with a single species of the invention or more than one species of the invention.
[0082] Moreover, the present invention includes the use of compounds within the motif set forth in the formulae contained herein, which are functionalized to afford compounds having water-solubility that is enhanced relative to analogous compounds that are not similarly functionalized. Thus, any of the substituents set forth herein can be replaced with analogous radicals that have enhanced water solubility. For example, it is within the scope of the invention to replace a hydroxyl group with a diol, or an amine with a quaternary amine, hydroxy amine or similar more water- soluble moiety. In a preferred embodiment, additional water solubility is imparted by substitution at a site not essential for the activity towards the editing domain of the
compounds set forth herein with a moiety that enhances the water solubility of the parent compounds. Methods of enhancing the water- solubility of organic compounds are known in the art. Such methods include, but are not limited to, functionalizing an organic nucleus with a permanently charged moiety, e.g., quaternary ammonium, or a group that is charged at a physiologically relevant pH, e.g. carboxylic acid, amine. Other methods include, appending to the organic nucleus hydroxyl- or amine- containing groups, e.g. alcohols, polyols, polyethers, and the like. Representative examples include, but are not limited to, polylysine, polyethyleneimine, poly(ethyleneglycol) and poly(propyleneglycol). Suitable functionalization chemistries and strategies for these compounds are known in the art. See, for example, Dunn, R. L., et al, Eds. POLYMERIC DRUGS AND DRUG DELIVERY SYSTEMS, ACS Symposium Series Vol. 469, American Chemical Society, Washington, D.C. 1991.
//. Introduction [0083] The present invention provides novel boron compounds and methods for the preparation of these molecules. The invention further provides methods of treating bacterial infections, killing or inhibiting the growth of bacteria, and/or inhibiting β- lactamase in part or wholly through the use of the compounds described herein. The invention further provides methods of treating anti-inflammatory conditions and inhibiting biomolecules that are implicated with anti-inflammatory conditions in part or wholly through the use of the compounds described herein. In another aspect, the invention is a combination of a compound of the invention and an antibiotic. In another aspect, the invention is a pharmaceutical formulation comprising a pharmaceutically acceptable excipient and a compound of the invention. In another aspect, the invention is a pharmaceutical formulation comprising a compound of the invention, an antibiotic, and a pharmaceutically acceptable excipient.
///. a.) Compounds
[0084] In one aspect the invention provides a compound of the invention. In an exemplary embodiment, the invention provides a compound described herein, or a salt thereof. In an exemplary embodiment, the salt of a compound described herein is a pharmaceutically acceptable salt. In an exemplary embodiment, the invention provides a compound described herein, or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the invention provides a compound described in a
formula provided herein. In an exemplary embodiment, the invention provides a compound described herein. In one aspect, the invention provides a compound having a structure according to the formula:
wherein R* is a member selected from H, a negative charge and a positively charged counterion. A is a member selected from substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heteroaryl. Y is a member selected from O, S, unsubstituted C1-C4 alkyl and -S(O)2NH-, wherein the sulfur in the -S(O)2NH- is covalently attached to the A ring. R is a member selected from H, cyano and substituted or unsubstituted alkyl. Ra is a member selected from H, OR10, NR10R11, SR10, -S(O)R10, -S(O)2R10, -S(O)2NR10R11, -C(O)R10, -C(O)OR10, -C(O)NR10R11, nitro, cyano, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl, each R10 and each R11 is a member independently selected from H, nitro, halogen, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl. There is a proviso that R10 and R11, together with the nitrogen to which they are attached, are optionally combined to form a 5- to 7-membered substituted or unsubstituted heterocycloalkyl ring. In an exemplary embodiment, there is a proviso that when Y is -S(O)2NH-, R3 is H, and Ra is not H or unsubstituted alkyl or halosubstituted alkyl. In an exemplary embodiment, there is a proviso that when Y is O, R3 is a member selected from cyano and substituted alkyl.
[0085] In an exemplary embodiment, the invention provides a compound having a structure according to the formula:
wherein A is a member selected from cycloalkyl, heterocycloalkyl, aryl and heteroaryl; Y is a member selected from O and -S(O)2NH- wherein the sulfur in
-S(O)2NH- is covalently attached to A; R3 is a member selected from H, cyano and substituted alkyl; Ra is a member selected from H, -OR10, -NR10R11, -SR10, -S(O)R10, -S(O)2R10, -S(O)2NR10R11, -C(O)R10, -C(O)OR10, -C(O)NR10R11, nitro, cyano, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl wherein each R10 and each R11 is a member independently selected from H, nitro, halogen, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl, with the proviso that R10 and R11, together with the nitrogen to which they are attached, are optionally combined to form a 5- to 7-membered substituted or unsubstituted heterocycloalkyl ring; with the proviso that when Y is O, R is a member selected from cyano and substituted alkyl; with the proviso that when Y is -S(O)2NH-, R3 is H, and Ra is not H or unsubstituted alkyl or halosubstituted alkyl, and salts thereof.
[0086] In an exemplary embodiment, the compound has a structure according to the following formula:
wherein Rb is halogen, or salts thereof. In an exemplary embodiment, Rb is F. In an exemplary embodiment, Rb is Cl. In an exemplary embodiment, Rb is Br.
[0087] In an exemplary embodiment, the compound has a structure according to the following formula:
-(CH2)mi0H, wherein ml is 1 or 2 or 3 or 4 or 5 or 6. In an exemplary embodiment, ml is 1 or 2 or 3. In an exemplary embodiment, Rc is -CH2OH.
[0088] In an exemplary embodiment, the compound has a structure according to the following formula:
wherein Rd is aminoalkyl, or salts thereof. In an exemplary embodiment, Rd is -(CR12R13)nNR14R15 in which n is a member selected from 1 to 10; each R12 and each R13 is a member independently selected from H, OR16, NR16R17, SR16, -S(O)R16, -S(O)2R16, -S(O)2NR16R17, -C(O)R17, -C(O)OR17, -C(O)NR16R17, nitro, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl. R14 and R15 are members independently selected from H, OR18, NR18R19, SR18, -S(O)R18, -S(O)2R18, -S(O)2NR18R19, -C(O)R19, -C(O)OR19, -C(O)NR18R19, nitro, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl. Each R16, each R17, each R18 and each R19 is a member independently selected from H, nitro, halogen, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
[0089] In an exemplary embodiment, Rd is -(CR12R13)nNH2, wherein n is 1 or 2 or 3 or 4 or 5 or 6, wherein R12 and R13 are as described herein. In an exemplary embodiment, Rd is -(CH2)J1NR14R15. In an exemplary embodiment, Rd is - CH2NR14R15. In an exemplary embodiment, Rd is -CH2NH2.
[0090] In an exemplary embodiment, the compound has a structure according to the following formula:
wherein Re is -C(O)OR10, or salts thereof, wherein R10 is H or substituted or unsubstituted alkyl. In an exemplary embodiment, Re is -C(O)OR10, wherein R10 is unsubstituted Ci or C2 or C3 or C4 or C5 or C6 alkyl. In an exemplary embodiment, wherein R10 is unsubstituted Ci or C2 or C3 alkyl. In an exemplary embodiment, Re is -COOH or -COOCH3 or -COOCH2CH3 or -COOC(CH3)3.
[0091] In an exemplary embodiment, the compound has a structure according to the following formula:
wherein R is H or substituted or unsubstituted alkyl, or salts thereof. In an exemplary embodiment, R is H. In an exemplary embodiment, R is unsubstituted Ci or C2 or C3 or C4 or C5 or C6 alkyl. In an exemplary embodiment, Rf is methyl. In an exemplary embodiment, Rf is phenylsubstituted alkyl. In an exemplary embodiment, Rf is phenyl substituted Ci or C2 or C3 or C4 or C5 or C6 alkyl. In an exemplary embodiment, Rf is phenylmethyl.
[0092] In an exemplary embodiment, the compound has a structure according to the following formula:
wherein Rg and R is independently selected from H or substituted or unsubstituted alkyl, or salts thereof. In an exemplary embodiment, Rg is H. In an exemplary embodiment, Rh is H. In an exemplary embodiment, Rg is H and Rh is H. In an exemplary embodiment, Rg is unsubstituted alkyl, and Rh is as described herein.
[0093] In an exemplary embodiment, the compound has a structure according to the following formula:
[0094] In an exemplary embodiment, the compound has a structure according to the following formula:
wherein Rk is aminoalkyl, or a salts thereof. In an exemplary embodiment, Rk is -(CH2)IiIiNH2, wherein ml is 1 or 2 or 3 or 4 or 5 or 6. In an exemplary embodiment, ml is 1 or 2 or 3. In an exemplary embodiment, Rk is -CH2NH2.
[0095] In an exemplary embodiment, the compound has a structure according to the following formula:
wherein Rm is -C(O)OR10, or salts thereof, wherein R10 is H or substituted or unsubstituted alkyl. In an exemplary embodiment, Rm is -C(O)OR10, wherein R10 is unsubstituted Ci or C2 or C3 or C4 or C5 or C6 alkyl. In an exemplary embodiment, wherein R10 is unsubstituted Ci or C2 or C3 alkyl. In an exemplary embodiment, Rm is -COOH or -COOCH3 or -COOCH2CH3 or -COOC(CH3)3.
[0096] In an exemplary embodiment, the compound has a structure according to the following formula:
wherein Rn is -C(O)NR11R12, or salts thereof, wherein each R11 or R12 is a member selected from H or substituted or unsubstituted alkyl. In an exemplary embodiment, R11 is H. In an exemplary embodiment, Rn is -C(O)NH2.
[0097] In an exemplary embodiment, the compound has a structure according to the following formula:
wherein R0 is H or -C(O)OR10, or salts thereof, wherein R10 is H or substituted or unsubstituted alkyl. In an exemplary embodiment, R0 is -C(O)OR10, wherein R10 is unsubstituted Ci or C2 or C3 or C4 or C5 or C6 alkyl. In an exemplary embodiment, wherein R10 is unsubstituted Ci or C2 or C3 alkyl. In an exemplary embodiment, R0 is H or -COOH or -COOCH3 or -COOCH2CH3 or -COOC(CH3)3.
[0098] In an exemplary embodiment, the compound has a structure according to the following formula:
wherein Rp is H or -C(O)OR10, or salts thereof, wherein R10 is H or substituted or unsubstituted alkyl. In an exemplary embodiment, Rp is -C(O)OR10, wherein R10 is unsubstituted Ci or C2 or C3 or C4 or C5 or C6 alkyl. In an exemplary embodiment, wherein R10 is unsubstituted Ci or C2 or C3 alkyl. In an exemplary embodiment, Rp is H or -COOH or -COOCH3 or -COOCH2CH3 or -COOC(CH3)3.
[0099] In an exemplary embodiment, the compound has a structure according to the following formula:
wherein Rq is H or -C(O)OR , or salts thereof, wherein R is H or substituted or unsubstituted alkyl. In an exemplary embodiment, Rq is -C(O)OR10, wherein R10 is unsubstituted Ci or C2 or C3 or C4 or C5 or C6 alkyl. In an exemplary embodiment, wherein R10 is unsubstituted Ci or C2 or C3 alkyl. In an exemplary embodiment, Rq is H or -COOH or -COOCH3 or -COOCH2CH3 or -COOC(CH3)3.
[0100] In an exemplary embodiment, the compound is
[0101] In an exemplary embodiment, the compound is
[0102] In an exemplary embodiment, the compound is
wherein Rr is H or -C(O)OR10, or salts thereof, wherein R10 is H or substituted or unsubstituted alkyl. In an exemplary embodiment, Rr is -C(O)OR10, wherein R10 is unsubstituted Ci or C2 or C3 or C4 or C5 or C6 alkyl. In an exemplary embodiment, wherein R10 is unsubstituted Ci or C2 or C3 alkyl. In an exemplary embodiment, Rr is H or -COOH or -COOCH3 or -COOCH2CH3 or -COOC(CH3)3.
[0103] In an exemplary embodiment, the compound has a structure according to the formula:
wherein Ra and A are as described herein, and R is a member selected from cyano and substituted or unsubstituted alkyl.
[0104] In an exemplary embodiment, the compound has a structure according to the formula:
wherein m is an integer which is 1 or 2 or 3 or 4 or 5 or 6 and R3a is a member selected from -C(O)OR20 or -C(O)NR20R21 or -OR20 or nitro or -S(O)2R22 or -S(O)2OR20 or -S(O)2NR20R21 or -P(O)(OR20)(OR20) wherein each R20 is independently selected from H or unsubstituted alkyl, R21 is selected from H or -
S(O)2R23; R23 is unsubstituted alkyl. In an exemplary embodiment, m is 1 or 2 or 3. In an exemplary embodiment, m is 1.
[0105] In an exemplary embodiment, the compound has a structure according to the formula:
wherein m is an integer which is 1 or 2 or 3 or 4 or 5 or 6, R21 is selected from H or -S(O)2R23, R22 is unsubstituted alkyl and R23 is unsubstituted alkyl.
[0106] In an exemplary embodiment, the compound has a structure according to the formula:
wherein m is an integer selected from 1 or 2 or 3 or 4 or 5 or 6 and R20 is selected from H or unsubstituted alkyl. In an exemplary embodiment, m is 1 or 2 or 3. In an exemplary embodiment, m is 1.
[0107] In an exemplary embodiment, the compound has a structure according to the formula:
wherein Ra, A, Y, m and R are as described herein.
[0108] In an exemplary embodiment, the compound has a structure according to the formula:
wherein Ra, A, Y, m and R 20 are as described herein. [0109] In an exemplary embodiment, the compound has a structure according to the formula:
[0110] In an exemplary embodiment, the compound has a structure according to the formula:
[0111] In an exemplary embodiment, the compound has a structure according to the formula:
wherein A and R3 are as described herein, and Ra is a member selected from H, halogen, substituted or unsubstituted alkyl, OR10, NR10R11, wherein R10 and each R11 is a member independently selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and
substituted or unsubstituted heteroaryl. In an exemplary embodiment, Ra is a member selected from H, F, Cl, -OR20a and -C(O)OR20b, wherein R20a is alkyl, optionally substituted with a member selected from NH2 and phenyl, and wherein R20b is unsubstituted alkyl. In an exemplary embodiment, Ra is F or Cl. In an exemplary embodiment, Ra is OH. In an exemplary embodiment, Ra is NH2. In an exemplary embodiment, Ra is -O(CH2)nPh or -(CH2)nNH(CH2)ni0(CH2)n2CH3 or -(CH2)nX5 or -O(CH2)nNH2 or -NH(CH2)nPh or -C(O)OR10, wherein n is 1 or 2 or 3 or 4 or 5 or 6, nl is 1 or 2 or 3 or 4 or 5 or 6, n2 is 0 or 1 or 2 or 3 or 4 or 5 or 6, R1Oa is unsubstituted alkyl, and X5 is unsubstituted morpholinyl or piperazinyl. In an exemplary embodiment, n is 1 or 2 or 3, or nl is 1 or 2 or 3, or n2 is 0 or 1 or 2 or 3. In an exemplary embodiment, Ra is -C(O)OR10a and R1Oa is methyl or ethyl or propyl or isopropyl or tert-butyl. In an exemplary embodiment, Ra is -CH2NH(CH2)2OCH3 or -CH2X5 or -O(CH2)3NH2 or -OCH2Ph or -NHCH2Ph. In an exemplary embodiment, Ra is
0^ or HN^
[0112] In an exemplary embodiment, the compound has a structure according to the formula:
wherein m is an integer which is 1 or 2 or 3 or 4 or 5 or 6 and R3a is a member selected from -C(O)OR20 or -C(O)NR20R21 or -OR20 or nitro or -S(O)2R22 or -S(O)2OR20 or -S(O)2NR20R21 or -P(O)(OR20)(OR20) wherein each R20 is independently selected from H or unsubstituted alkyl, R21 is independently selected from H or -S(O)2R22, and R22 is unsubstituted alkyl.
[0113] In an exemplary embodiment, the compound has a structure according to the formula:
wherein R3a is a member selected from -C(O)OR20 or -C(O)NR20R21 or -OR20 or nitro or -S(O)2R22 or -S(O)2OR20 or -S(O)2NR20R21 or -P(O)(OR20)(OR20) wherein each R20 is independently selected from H or unsubstituted alkyl, R21 is independently selected from H or -S(O)2R22; and R22 is unsubstituted alkyl.
[0114] In an exemplary embodiment, the compound has a structure according to the formula:
wherein m is an integer which is 1 or 2 or 3 or 4 or 5 or 6 and R20 is H or unsubstituted alkyl. In an exemplary embodiment, m is 1 or 2 or 3. In an exemplary embodiment, R20 is H. In an exemplary embodiment, R20 is unsubstituted Ci or C2 or C3 or C4 or C5 or C6 alkyl. In an exemplary embodiment, R20 is methyl or ethyl or t- butyl. In an exemplary embodiment, m is 1 or 2 or 3. In an exemplary embodiment, m is 1.
[0115] In an exemplary embodiment, the compound has a structure according to the formula:
wherein m is an integer which is 1 or 2 or 3 or 4 or 5 or 6 and R20 is H or unsubstituted alkyl. In an exemplary embodiment, m is 1 or 2 or 3. In an exemplary embodiment, R20 is H. In an exemplary embodiment, R20 is unsubstituted Ci or C2 or C3.
[0116] In an exemplary embodiment, the compound has a structure according to the formula:
[0117] In an exemplary embodiment, the compound has a structure according to the formula:
[0118] In an exemplary embodiment, the compound has a structure according to the formula:
wherein m, Ra, A and R20 are as defined herein. In an exemplary embodiment, R20 is H. In an exemplary embodiment, R20 is unsubstituted Ci or C2 or C3 or C4 or C5 or C6 alkyl. In an exemplary embodiment, R20 is methyl or ethyl or t-butyl. In an exemplary embodiment, m is 1 or 2 or 3. In an exemplary embodiment, m is 1.
[0119] In an exemplary embodiment, the compound has a structure according to the formula:
[0120] In an exemplary embodiment, the compound has a structure according to the formula:
wherein Ra, A and R20 are as defined herein.
[0121] In an exemplary embodiment, the compound has a structure according to the formula:
[0122] In an exemplary embodiment, the compound has a structure according to the formula:
R ,20 wherein R20 is as defined herein, and n5 is an integer selected from 1 or 2 or 3 or 4 or 5 or 6. In an exemplary embodiment, the compound has a structure according to the formula:
In an exemplary embodiment, the compound has a structure according to the formula:
R ,20 wherein R20 is as defined herein. In an exemplary embodiment, R20 is H. [0123] In an exemplary embodiment, the compound is E38 or a salt thereof. In an exemplary embodiment, the compound is E38 or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound is E50 or a salt thereof. In an exemplary embodiment, the compound is E50 or a pharmaceutically acceptable salt thereof. [0124] In an exemplary embodiment, the compound has a structure according to the formula:
wherein A1 is H or unsubstituted alkyl, and R3 is a member selected from cyano and substituted or unsubstituted alkyl. In an exemplary embodiment, A1 is H. In an exemplary embodiment, A1 is methyl. In an exemplary embodiment, A1 is ethyl. In an exemplary embodiment, A1 is C3 alkyl. In an exemplary embodiment, A1 is C4 alkyl. In an exemplary embodiment, A1 is C5 alkyl. In an exemplary embodiment, A1 is C6 alkyl.
[0125] In an exemplary embodiment, the compound has a structure according to the formula:
6 and R3a is a member selected from -C(O)OR20 or -C(O)NR20R21 or -OR20 or nitro or -S(O)2R22 or -S(O)2OR20 or -S(O)2NR20R21 or -P(O)(OR20)(OR20) wherein each R20 is independently selected from H or unsubstituted alkyl, R21 is selected from H or -S(O)2R23; R23 is unsubstituted alkyl. In an exemplary embodiment, m is 1 or 2 or 3. In an exemplary embodiment, m is 1. In an exemplary embodiment, A1 is H. In an exemplary embodiment, A1 is methyl. In an exemplary embodiment, A1 is ethyl. In an exemplary embodiment, A1 is C3 alkyl. In an exemplary embodiment, A1 is C4 alkyl. In an exemplary embodiment, A1 is C5 alkyl. In an exemplary embodiment, A1 is C6 alkyl.
[0126] In an exemplary embodiment, the compound has a structure according to the formula:
wherein A1 is H or unsubstituted alkyl, m is an integer which is 1 or 2 or 3 or 4 or 5 or 6 and R20 is H or unsubstituted alkyl. In an exemplary embodiment, m is 1 or 2 or 3. In an exemplary embodiment, m is 1. In an exemplary embodiment, R20 is H. In an
exemplary embodiment, R20 is unsubstituted Ci or C2 or C3 or C4 or C5 or C6 alkyl. In an exemplary embodiment, R20 is methyl or ethyl or t-butyl. In an exemplary embodiment, A1 is H. In an exemplary embodiment, A1 is methyl. In an exemplary embodiment, A1 is ethyl. In an exemplary embodiment, A1 is C3 alkyl. In an exemplary embodiment, A1 is C4 alkyl. In an exemplary embodiment, A1 is C5 alkyl. In an exemplary embodiment, A1 is C6 alkyl.
[0127] In an exemplary embodiment, the compound has a structure according to the formula:
wherein A1 and R20 are as defined herein. In an exemplary embodiment, R20 is H. In an exemplary embodiment, R20 is methyl. In an exemplary embodiment, R20 is ethyl. In an exemplary embodiment, A1 is H. In an exemplary embodiment, A1 is methyl. In an exemplary embodiment, A1 is ethyl.
[0128] In an exemplary embodiment, the compound has a structure according to the formula:
[0129] In an exemplary embodiment, the compound has a structure according to the formula:
wherein A1 and R20 are as defined herein. In an exemplary embodiment, R20 is H. In an exemplary embodiment, R20 is methyl. In an exemplary embodiment, R20 is ethyl. In an exemplary embodiment, A1 is H. In an exemplary embodiment, A1 is methyl. In an exemplary embodiment, A1 is ethyl.
[0130] In another aspect, the invention provides a compound having a structure according to the formula:
wherein R* is a member selected from H and a negative charge; A is a member selected from phenyl and pyridinyl; R3 is a member selected from H, cyano, substituted or unsubstituted nitroalkyl and substituted or unsubstituted aminoalkyl; Ra is a member selected from R10, OR10, NR10R11, SR10, -S(O)R10, -S(O)2R10, - S(O)2NR10R11, -C(O)R10, -C(O)OR10, -C(O)NR10R11, wherein each R10 and each R11 is a member independently selected from H, nitro, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl, with the proviso that Ra is not H or unsubstituted alkyl or halosubstituted alkyl.
[0131] In another aspect, the invention provides a compound having a structure according to the formula:
wherein R* is a member selected from H and a negative charge; A is a member selected from phenyl and pyridinyl; R3 is a member selected from H, cyano, substituted or unsubstituted nitroalkyl and substituted or unsubstituted aminoalkyl; Ra is a member selected from R12, OR10, NR10R11, SR10, -S(O)R10, -S(O)2R10, -
S(O)2NR10R11, -C(O)R10, -C(O)OR10, -C(O)NR10R11, wherein each R10 and each R11 is a member independently selected from H, nitro, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl, and wherein R12 is a member selected from nitro, cyano, alkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, aryl and heteroaryl wherein said alkyl is substituted by one or more groups selected from OR13, NR13R14, SR13, -S(O)R13, -S(O)2R13, -S(O)2NR13R14, -C(O)R13, -C(O)OR13 and -C(O)NR13R14, wherein each R13 and each R14 is a member independently selected from H, nitro,
cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl; and wherein said heteroalkyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl are optionally substituted with one or more groups selected from R15, OR15, NR15R16, SR15, -
S(O)R15, -S(O)2R15, -S(O)2NR15R16, -C(O)R15, -C(O)OR15, -C(O)NR15R16, wherein each R15 and each R16 is a member independently selected from H, nitro, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
[0132] In an exemplary embodiment, Ra is a member selected from -Y1R5, -CN, -R4Y2, -C(O)OR6, -NH2 and OH. Y1 is a member selected from O and S. Y2 is a member selected from NH2 and OH. R4 is a member selected from substituted or unsubstituted alkylene and substituted or unsubstituted heteroalkylene. R5 is a member selected from H, substituted or unsubstituted alkyl. R6 is a member selected from H, substituted or unsubstituted alkyl and substituted or unsubstituted heteroalkyl.
[0133] In an exemplary embodiment, the invention has a structure according to the formula:
In an exemplary embodiment, the invention has a structure according to the following formula:
wherein C* is a carbon atom, with the proviso that when R is not H, C* is a stereocenter which has a configuration which is a member selected from (R) and (S). In an exemplary embodiment, the invention has a structure according to the following formula:
wherein C* is a carbon atom, with the proviso that when R is not H, C* is a stereocenter which has a configuration which is a member selected from (R) and (S). In an exemplary embodiment, the compound has a structure according to the following formula:
wherein Ra is a member selected from -NH2, -CN, -OR5, -COOR5, -R4NH2 and -R4OH, wherein R4 is unsubstituted alkylene and R5 is substituted or unsubstituted alkyl. In an exemplary embodiment, R is H, Ra is a member selected from -NH2, -NO2, -CN, -OCH3, -OCF3, -COOH, -CH2NH2 and -CH2OH. In an exemplary embodiment, the compound is a member selected from
[0134] In an exemplary embodiment, R3 is-(CR20R21^NR22R23 in which the index n is an integer selected from 1 to 10; each R20 and each R21 is a member independently selected from H, R26,OR26, NR26R27, SR26, -S(O)R26, -S(O)2R26, - S(O)2NR26R27, -C(O)R27, -C(O)OR27, -C(O)NR26R27; R22 and R23 are members independently selected from H, -S(O)R28, -S(O)2R28, -S(O)2NR28R29, -C(O)R28, - C(O)OR28, -C(O)NR28R29, nitro, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl wherein each R26, each R27, each R28 and each R29 is a member independently selected from H, nitro, halogen, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl. In an exemplary embodiment, n is an integer selected from 1 to 5. In an exemplary embodiment, n is 1. In an exemplary embodiment, R20 is substituted or unsubstituted alkyl. In an exemplary embodiment, R20 is unsubstituted alkyl. In an exemplary embodiment, R20 is C1-C4 unsubstituted alkyl. In an exemplary embodiment, R20 is methyl. In an exemplary embodiment, R21 is H. In an exemplary embodiment, R23 is H. In an exemplary embodiment, R3 is a member selected from cyano and -CH2NO2. In an exemplary embodiment, R22 is a member selected from -C(O)R28 and -C(O)OR28. In an exemplary embodiment, R28 is a member selected from substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl and substituted or unsubstituted aryl. In an exemplary embodiment, R28 is a member selected from -(CR30R31^R32, wherein R32 is a member selected from substituted or unsubstituted aryl, -NR33R34 and OR33, wherein the index m is an integer selected from O to 10; each R33 and each R34 is a member independently selected from H, nitro, halogen, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or
unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl. In an exemplary embodiment, R28 is a member selected from
[0135] In another exemplary embodiment, the compound is
wherein R* is as described herein. In another exemplary embodiment, the compound is a member selected from
[0136] In another exemplary embodiment, the compound is a member selected from
wherein R* is as described herein. In another exemplary embodiment, the compound is a member selected from
wherein R* is as described herein. In another exemplary embodiment, the compound is a member selected from
wherein R* is as described herein.
[0137] In another exemplary embodiment, the compound is a member selected from
[0138] In another exemplary embodiment, the compound is
wherein R* is as described herein. In another exemplary embodiment, the compound is a member selected from
[0139] In another exemplary embodiment, the compound is a member selected from
wherein R* is as described herein. In another exemplary embodiment, the compound is a member selected from
wherein R* is as described herein. In another exemplary embodiment, the compound is a member selected from
[0140] In another exemplary embodiment, the compound is a member selected from
[0141] In an exemplary embodiment, R* is H. In an exemplary embodiment, the C* stereocenter is in a configuration which is a member selected from (R) and (S). In an exemplary embodiment, the C* stereocenter is in a (S) configuration. In an exemplary embodiment, the C* stereocenter is in a (S) configuration and R is -CH2NH2.
[0142] In an exemplary embodiment, the compound has a structure according to the formula:
wherein A, R3 are as described herein, and Ra is as described herein, with the proviso that Ra is not H or unsubstituted alkyl or halosubstituted alkyl. In an exemplary embodiment, the compound has a structure according to the formula:
wherein Ra is as described herein, with the proviso that Ra is not H or unsubstituted alkyl or halosubstituted alkyl, and A is substituted phenyl or substituted pyridinyl or substituted or unsubstituted furanyl or substituted or unsubstituted thiophenyl or substituted or unsubstituted pyrazolyl or substituted or unsubstituted imidazolyl or substituted or unsubstituted thiazolyl or substituted or unsubstituted triazolyl or substituted or unsubstituted piperidinyl. In an exemplary embodiment, A is substituted phenyl or substituted pyridinyl or furanyl or thiophenyl or pyrazolyl or imidazolyl or substituted or unsubstituted thiazolyl or triazolyl or piperidinyl. In an exemplary embodiment, A is substituted phenyl. In an exemplary embodiment, A is substituted pyridin-2-yl or substituted pyridin-3-yl or substituted pyridin-4-yl. [0143] In an exemplary embodiment, the compound has a formula which is a member selected from:
-S(O)2NR20R21, -C(O)R20, -C(O)OR20, -C(O)NR20R21, nitro, cyano, substituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl, each R20 and each R21 is a member independently selected from H, nitro, halogen, cyano, substituted or unsubstituted
alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl, with the proviso that Ra is not halosubstituted alkyl.
[0144] In an exemplary embodiment, the compound is a member selected from
wherein Ra is a member selected from cyano, nitro, aminoalkyl, hydroxyalkyl, -C(O)(CH2)nCH3, COOH, -C(O)O(CH2)nCH3, O(CH2)nCH3, O(CH2)nCF3, O(CH2)nCHF2, OH, NH2, NHCH3, NHC(O)H, NHC(O)(CH2)nCH3, NHOH, NHS(O)2NH2, -NH2S(O)2CH3, -S(O)2CH3, wherein n is O or 1 or 2 or 3.
[0145] In an exemplary embodiment, the compound is:
[0146] In an exemplary embodiment, the compound is:
[0148] In an exemplary embodiment, the compound is:
[0149] In an exemplary embodiment, the compound is:
, or a salt thereof. [0150] In an exemplary embodiment, the compound is ElIl or a salt thereof. In an exemplary embodiment, the compound is ElIl or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound is E 119 or a salt thereof. In an exemplary embodiment, the compound is E 119 or a pharmaceutically acceptable salt thereof. [0151] In an exemplary embodiment, the compound has a structure according to the following formula:
[0152] In an exemplary embodiment, the compound has a structure according to the following formula:
where Ra, A, R3 and Y are as described herein, with the proviso that when R3 is H,
is not a member selected from
[0154] In an exemplary embodiment, there is the further proviso that when R is
[0155] In an exemplary embodiment, there is a proviso that Ra is not cyano, halogen, H, -SCH3, -OCH3, -OCF3, -CF3, and -CH3. In an exemplary embodiment, there is a proviso that Ra is not cyano, halogen, H, -SCH3, -SCH2CH3, -OCH3, - OCH2CH3, -OCF3, -OCH2CF3, -CF3, -CH2CF3, -CH3 and -CH2CH3. In an exemplary
embodiment, there is a proviso that when Y is O and A is phenyl, Ra is not cyano, chloro, H, -OCF3, -OCH3, -CF3. In an exemplary embodiment, there is a proviso that when Y is S and A is phenyl, Ra is not halo, H, -OCF3, -OCH3, -SCH3, -CF3, -CH3. In an exemplary embodiment, there is a proviso that when Y is S and A is pyridinyl or thiazolyl, Ra is not H. In an exemplary embodiment, there is a proviso that when Y is -S(O)2NH- and A is phenyl, Ra is not H. In an exemplary embodiment, there is a proviso that when Y is O and A is phenyl, Ra is not cyano, chloro, H, -OCF3, - OCH2CF3, -OCH3, -OCH2CH3, -CF3 and -CH2CF3. In an exemplary embodiment, there is a proviso that when Y is S and A is phenyl, Ra is not halo, H, -OCH2CF3, - OCH3, -OCH2CH3, -SCH3, -SCH2CH3, -CF3, - CH2CF3, -CH3 and -CH2CH3. In an exemplary embodiment, there is a proviso that when Y is S, then A is not pyridinyl. In an exemplary embodiment, there is a proviso that when Y is S, then A is not thiazolyl.
[0156] In an exemplary embodiment, R3 is not -CH2-Ph. In an exemplary embodiment, Y is O. In an exemplary embodiment, A is a member selected from substituted or unsubstituted phenyl, substituted or unsubstituted pyridinyl, substituted or unsubstituted pyrimidinyl, substituted or unsubstituted pyrazinyl, substituted or unsubstituted thiazolyl, substituted or unsubstituted cyclopropyl, substituted or unsubstituted cyclobutyl, substituted or unsubstituted cyclopentyl, substituted or unsubstituted cyclohexyl and substituted or unsubstituted piperidinyl. In an exemplary embodiment, A is a member selected from substituted or unsubstituted pyridin-2-yl, substituted or unsubstituted pyridin-3-yl and substituted or unsubstituted piperidin-4-yl.
[0157] In an exemplary embodiment, A is a member selected from
and V "Jf21. In an exemplary embodiment, Ra is H and A is a member selected from
In an exemplary embodiment, A is a member selected
R\ In an exemplary embodiment, s^ - - ' is a member selected from
[0158] In an exemplary embodiment, Ra is cyano. In an exemplary embodiment, Ra is a member selected from aminomethyl, hydroxymethyl, -OH, -OCH3, -NH2, -
NO2, -C(O)OR20, -C(O)NR20R21 and
each R20 and each R21 is a member independently selected from H, methyl, ethyl, propyl, isopropyl, butyl, isobutyl, t-butyl, phenyl and benzyl. In an exemplary embodiment, Ra is a member selected from -C(O)OH, -C(O)OCH3, -C(O)OCH2CH3, -C(O)OC(CH3)3 and -C(O)NH2.
[0159] In an exemplary embodiment, R3 is H. In an exemplary embodiment, R3 is a member selected from cyano. In an exemplary embodiment, R3 is substituted or unsubstituted Ci-C3 alkyl.
[0160] In an exemplary embodiment, R3 is substituted with a member selected from -OH, -NH2, nitro, -P(O)OR11OR12, -S(O)2R11, -C(O)OR11, -OSiR11R12R13, - NHC(O)R11, wherein each R11, R12 and R13 are members independently selected from H, -NH2, NHR14 and substituted or unsubstituted alkyl, wherein R14 is -C(O)OR15, wherein R15 is unsubstituted alkyl.
[0161] In an exemplary embodiment, R3 is -CH2R9, wherein R9 is a member selected from -OH, -NH2, nitro, -P(O)OR20OR20, -S(O)2R22, -C(O)OR20,
-OSiR20R21R22, -NHC(O)R20, wherein each R20, each R21 and each R22 is a member independently selected from H, -NH2, NHR14 and unsubstituted alkyl, wherein R14 is -C(O)OR15, wherein R15 is unsubstituted alkyl. In an exemplary embodiment, R3 is substituted with a member selected from -OH, -NH2, nitro, -P(O)(OCH3)2, -S(O)2CH3, -S(O)2CH2CH3, -S(O)2NH2, -S(O)2NHC(O)C(CH3)3, -C(O)OH,
-C(O)OCH2CH3, -OSi(CH3)2(C(CH3)3), -NHC(O)(CH2)2CH(CH3)2. In an exemplary embodiment, the alkyl group is a member selected from -CH2OH, -(CH2)2OH, -(CH2)3OH, -CH2NH2, -CH2NO2, -CH2P(O)(OCH3)2, -CH2S(O)2CH3, -CH2S(O)2CH2CH3, -CH2S(O)2NH2, - CH2S(O)2NHC(O)C(CH3)3, -CH2C(O)OH, -CH2C(O)OCH2CH3, -CH2C(O)OCH3, -(CH2)3OSi(CH3)2(C(CH3)3) and
-CH2NHC(O)(CH2)2CH(CH3)2. In an exemplary embodiment, R3 is substituted with -OH and nitro.
[0162] In an exemplary embodiment, Y is a member selected from unsubstituted C1-C4 alkyl and -S(O)2NH-, R3 is a member selected from H, aminomethyl, hydroxymethyl, -OH, -OCH3, -NH2, -NO2, -C(O)OR20, -C(O)NR20R21 and
, wherein each R20 and each R21 is a member independently selected from H, methyl, ethyl, propyl, isopropyl, butyl, isobutyl, t-butyl, phenyl and benzyl.
[0163] In another exemplary embodiment, the invention provides poly- or multivalent species of the compounds of the invention. In an exemplary embodiment, the invention provides a dimer of the compounds described herein. In an exemplary embodiment, the invention provides a dimer of the compounds described herein.
[0164] In an exemplary embodiment, the invention provides an anhydride of the compounds described herein. In an exemplary embodiment, the invention provides an anhydride of the compounds described herein.
[0165] In an exemplary embodiment, the invention provides a trimer of the compounds described herein. In an exemplary embodiment, the invention provides a trimer of the compounds described herein.
[0166] The compounds of the invention can form a hydrate with water, solvates with alcohols such as methanol, ethanol, propanol, and the like; adducts with amino compounds, such as ammonia, methylamine, ethylamine, and the like; adducts with acids, such as formic acid, acetic acid and the like; complexes with ethanolamine, quinoline, amino acids, and the like.
[0167] In an exemplary embodiment, the compound has a structure according to the formula:
wherein Ra, A, and Y are as described herein, and R3 is not H, C* is a carbon atom which is a stereocenter which has a configuration of (R) or (S). In an exemplary embodiment, the C* stereocenter is in a (S) configuration. In an exemplary embodiment, the C* stereocenter is in a (S) configuration and R3 is -CH2COOR20, wherein R , 20 is H or unsubstituted alkyl. In an exemplary embodiment, the C * stereocenter is in a (S) configuration and R3 is -CH2COOH. In an exemplary embodiment, the C* stereocenter is in a (R) configuration. In an exemplary embodiment, the C* stereocenter is in a (R) configuration and R3 is -CH2COOR20, wherein R20 is H or unsubstituted alkyl. In an exemplary embodiment, the C* stereocenter is in a (R) configuration and R3 is -CH2COOH. [0168] In an exemplary embodiment, the invention provides a compound described herein, or a salt, hydrate or solvate thereof, or a combination thereof. In an exemplary embodiment, the invention provides a compound described herein, or a salt, hydrate or solvate thereof. In an exemplary embodiment, the invention provides a compound described herein, or a salt thereof. In an exemplary embodiment, the salt is a pharmaceutically acceptable salt. In an exemplary embodiment, the invention
provides a compound described herein, or a hydrate thereof. In an exemplary embodiment, the invention provides a compound described herein, or a solvate thereof. In an exemplary embodiment, the invention provides a compound described herein, or a prodrug thereof. In an exemplary embodiment, the invention provides a salt of a compound described herein. In an exemplary embodiment, the invention provides a pharmaceutically acceptable salt of a compound described herein. In an exemplary embodiment, the invention provides a hydrate of a compound described herein. In an exemplary embodiment, the invention provides a solvate of a compound described herein. In an exemplary embodiment, the invention provides a prodrug of a compound described herein. In an exemplary embodiment, the invention provides a compound as described in FIG. 1, or a salt thereof. In an exemplary embodiment, the invention provides a compound as described in FIG. 1, or a pharmaceutically acceptable salt thereof.
[0169] In an exemplary embodiment, alkyl is a member selected from linear alkyl and branched alkyl. In another exemplary embodiment, heteroalkyl is a member selected from linear heteroalkyl and branched heteroalkyl.
II Lb) Compositions involving stereoisomers
[0170] As used herein, the term "chiral", "enantiomerically enriched" or "diastereomerically enriched" refers to a composition having an enantiomeric excess (ee) or a diastereomeric excess (de) of greater than about 50%, preferably greater than about 70% and more preferably greater than about 90%. In general, higher than about 90% enantiomeric or diastereomeric excess is particularly preferred, e.g., those compositions with greater than about 95%, greater than about 97% and greater than about 99% ee or de. [0171] The terms "enantiomeric excess" and "diastereomeric excess" are used interchangeably herein. Compounds with a single stereocenter are referred to as being present in "enantiomeric excess", those with at least two stereocenters are referred to as being present in "diastereomeric excess".
[0172] The term "enantiomeric excess" is well known in the art and is defined as:
eea x WO
[0173] The term "enantiomeric excess" is related to the older term "optical purity" in that both are measures of the same phenomenon. The value of ee will be a number from 0 to 100, zero being racemic and 100 being enantiomerically pure. A composition which in the past might have been called 98% optically pure is now more precisely characterized by 96% ee. A 90% ee reflects the presence of 95% of one enantiomer and 5% of the other(s) in the material in question.
[0174] Hence, in one embodiment, the invention provides a composition including a first stereoisomer and at least one additional stereoisomer of a compound of the invention. The first stereoisomer can be present in a diastereomeric or enantiomeric excess of at least about 80%, or at least about 90%, or at least about
92% or at least about 95%. In another exemplary embodiment, the first stereoisomer is present in a diastereomeric or enantiomeric excess of at least about 96%, at least about 97%, at least about 98%, at least about 99% or at least about 99.5%. In another embodiment, the compound of the invention is enantiomerically or diastereomerically pure (diastereomeric or enantiomeric excess is about 100%). Enantiomeric or diastereomeric excess can be determined relative to exactly one other stereoisomer, or can be determined relative to the sum of at least two other stereoisomers. In an exemplary embodiment, enantiomeric or diastereomeric excess is determined relative to all other detectable stereoisomers, which are present in the mixture. Stereoisomers are detectable if a concentration of such stereoisomer in the analyzed mixture can be determined using common analytical methods, such as chiral HPLC.
[0175] As used herein, and unless otherwise indicated, a composition that is "substantially free" of a compound means that the composition contains less than about 20% by weight, or less than about 15% by weight, or less than about 10% by weight, or less than about 5% by weight, or less than about 3% by weight, or less than about 2% by weight, or less than about 1% by weight of the compound.
[0176] As used herein, the term "substantially free of the (or its) enantiomer" means that a composition containing a compound of the invention is made up of a significantly greater proportion of one enantiomer than of its optical antipode. In one embodiment of the invention, the term "substantially free of the enantiomer" means that the compound is made up of at least about 90% by weight of the (R) enantiomer and about 10% by weight or less of the (S) stereoisomer. In a more preferred embodiment of the invention, the term "substantially free of the enantiomer" means
that the compound is made up of at least about 95% by weight of the (R) enantiomer and about 5% by weight or less of the (S) stereoisomer. In an even more preferred embodiment, the term "substantially free of the enantiomer" means that the compound is made up of at least about 98% by weight of the (R) enantiomer and about 2% or less of the (S) stereoisomer. In an even more preferred embodiment, the term "substantially free of the enantiomer" means that the compound is made up of at least about 99% by weight of the (R) enantiomer and about 1% or less of the (S) stereoisomer.
[0177] In an exemplary embodiment, the invention provides a composition comprising a) a first stereoisomer of a compound described herein, wherein R3 is not H; b) at least one additional stereoisomer of the first stereoisomer, wherein the first stereoisomer is present in an enantiomeric excess of at least 80% relative to said at least one additional stereoisomer. In an exemplary embodiment, the enantiomeric excess is at least 92%. In an exemplary embodiment, the C* stereocenter of the first stereoisomer is in a (R) configuration. In an exemplary embodiment, the C* stereocenter of the first stereoisomer is in a (R) configuration, and R3 is -(CH2)mCOOR20. In an exemplary embodiment, the C* stereocenter of the first stereoisomer is in a (R) configuration, and R3 is -(CH2)mCOOH. In an exemplary embodiment, the C* stereocenter of the first stereoisomer is in a (R) configuration, and R3 is -CH2COOR20. In an exemplary embodiment, the C* stereocenter of the first stereoisomer is in a (R) configuration, and R3 is -CH2COOH.
[0178] In an exemplary embodiment, the invention provides a composition comprising a compound of the invention, wherein R3 is not H and the C* stereocenter is in a (R) configuration, and said composition is substantially free of the enantiomer of the compound. In an exemplary embodiment, the composition comprises E38, E50 or combinations thereof, wherein the composition is substantially free of the enantiomer of E38 or E50. In an exemplary embodiment, the invention provides a composition comprising a compound described herein, wherein R3 is not H and the C* stereocenter is in a (S) configuration. ///. c) Combinations comprising additional therapeutic agents
[0179] The compounds of the invention may also be used in combination with additional therapeutic agents. The invention thus provides, in a further aspect, a
combination comprising a compound of the invention together with at least one additional therapeutic agent, or a salt, prodrug, hydrate or solvate thereof. In an exemplary embodiment, the compound of the invention is a compound described herein, or a salt thereof. In an exemplary embodiment, the additional therapeutic agent is a compound of the invention. In an exemplary embodiment, the additional therapeutic agent includes a boron atom. In an exemplary embodiment, the additional therapeutic agent does not contain a boron atom. In an exemplary embodiment, the additional therapeutic agent is a compound described in sections III a)-b).
[0180] When a compound of the invention is used in combination with a second therapeutic agent active against the same disease state, the dose of each compound may differ from that when the compound is used alone. Appropriate doses will be readily appreciated by those skilled in the art. It will be appreciated that the amount of a compound of the invention required for use in treatment will vary with the nature of the condition being treated and the age and the condition of the patient and will be ultimately at the discretion of the attendant physician or veterinarian.
[0181] In another aspect, the invention provides a combination which includes a compound of the invention; and an antibiotic. In an exemplary embodiment, the compound is described herein, or is a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the antibiotic comprises a β-lactam moiety. In an exemplary embodiment, the antibiotic is described herein. In an exemplary embodiment, the antibiotic is a member selected from penicillin G, amoxicillin, ampicillin, azlocillin, carbenicillin, cloxacillin, dicloxacillin, flucloxacillin, mezlocillin, nafcillin, pipericillin, ticarcillin, ceftazidime, cephalothin, cefotaxime, cefpirome, cefepime, and cefoxitin. In an exemplary embodiment, the antibiotic is a member selected from tazobactam, sulbactam and clavulanic acid. In an exemplary embodiment, the antibiotic is a member selected from Ceftazidime, Cephalothin, Cefotaxime, Cefpirome or Cefepime, Cefoxitin, Penicillin G, Amoxicillin, Ampicillin, Azlocillin, Carbenicillin, Cloxacillin, Dicloxacillin, Flucloxacillin, Mezlocillin, Nafcillin, Pipericillin, Ticarcillin, methicillin and temocillin. In an exemplary embodiment, the antibiotic is a member selected from cefacetrile, cefadroxil, cefalexin, cefaloglycin, cefaloridine, cefalotin, cefapirin, cefatrizine, cefazedone, cefazolin, cefradine, cefroxadine, ceftezole, cephalothin and cefazolin. In an exemplary embodiment, the antibiotic is a member selected from cefmetazole, cefonicid, ceforanide, cefotian,
cefprozil, cefotetan, cefaclor, cefuroxime, cefamandole and cefoxitin. In an exemplary embodiment, the antibiotic is a member selected from cefdinir, cefditoren, cefetamet, cefϊxime, cefmenoxime, cefodizime, cefoperazone, cefotzime, cefpiramide, cefsulodin, ceftazidime, ceftibuten, ceftioxime, ceftriaxone, latamoxef, ceftriaxone, cefotaxime and cefpodoxime. In an exemplary embodiment, the antibiotic is a member selected from cefquinome, cefepime and cefpirome. In an exemplary embodiment, the antibiotic is a member selected from ceftobiprole. In an exemplary embodiment, the antibiotic is a member selected from thienamycin, doripenem, panipenem (betamipron), imipenem, meropenem, ertapenem and faropenem. In an exemplary embodiment, the antibiotic is a member selected from benzathine penicillin, benzylpenicillin (penicillin G), phenoxymethylpenicillin (penicillin V) and procaine penicillin.
[0182] In an exemplary embodiment, the combination of the invention is a boron- containing compound described herein or a salt thereof, and cefepime. In an exemplary embodiment, the combination of the invention is a boron-containing compound described herein or a salt thereof, and cefepime.
[0183] In an exemplary embodiment, the combination of the invention is a boron- containing compound described herein or a salt thereof, and imipenem. In an exemplary embodiment, the combination of the invention is a boron-containing compound described herein or a salt thereof, and imipenem. [0184] In an exemplary embodiment, the combination of the invention is a boron- containing compound described herein or a salt thereof, and meropenem. In an exemplary embodiment, the combination of the invention is a boron-containing compound described herein or a salt thereof, and meropenem.
[0185] The individual components of such combinations may be administered either simultaneously or sequentially in a unit dosage form. The unit dosage form may be a single or multiple unit dosage forms. In an exemplary embodiment, the invention provides a combination in a single unit dosage form. An example of a single unit dosage form is a capsule wherein both the compound of the invention and the additional therapeutic agent are contained within the same capsule. In an exemplary embodiment, the invention provides a combination in a two unit dosage form. An example of a two unit dosage form is a first capsule which contains the compound of the invention and a second capsule which contains the additional
therapeutic agent. Thus the term 'single unit' or 'two unit' or 'multiple unit' refers to the object which the animal (for example, a human) ingests, not to the interior components of the object. Appropriate doses of known therapeutic agents will be readily appreciated by those skilled in the art. [0186] The combinations referred to herein may conveniently be presented for use in the form of a pharmaceutical formulation. Thus, an exemplary embodiment of the invention is a pharmaceutical formulation comprising a) a compound of the invention; b) an additional therapeutic agent and c) a pharmaceutically acceptable excipient. In an exemplary embodiment, the pharmaceutical formulation is a unit dosage form. In an exemplary embodiment, the pharmaceutical formulation is a single unit dosage form. In an exemplary embodiment, the pharmaceutical formulation is a single unit dosage form which includes a compound of the invention; an antibiotic and a pharmaceutically acceptable excipient. In an exemplary embodiment, the pharmaceutical formulation is a single unit dosage form which includes a compound of the invention; an antibiotic and at least one pharmaceutically acceptable excipient. In an exemplary embodiment, the pharmaceutical formulation is a two unit dosage form. In an exemplary embodiment, the pharmaceutical formulation is a two unit dosage form comprising a first unit dosage form and a second unit dosage form, wherein the first unit dosage form includes a) a compound of the invention and b) a first pharmaceutically acceptable excipient; and the second unit dosage form includes c) an additional therapeutic agent and d) a second pharmaceutically acceptable excipient. In an exemplary embodiment, the pharmaceutical formulation is a two unit dosage form comprising a first unit dosage form and a second unit dosage form, wherein the first unit dosage form includes a) a compound of the invention and b) a first pharmaceutically acceptable excipient; and the second unit dosage form includes c) an antibiotic and d) a second pharmaceutically acceptable excipient.
HLd) Additional compounds of the invention
[0187] Additional compounds of the invention include those formed between the 2 ',3' diol of the ribose ring of a nucleic acid, nucleoside or nucleotide, and a compound of the invention. In an exemplary embodiment, the compound is described herein.. In an exemplary embodiment, the compound is a cyclic or acyclic boronic ester such as those described herein. These compounds can be used in an animal to kill or inhibit the growth of a microorganism described herein, as well as to treat the
diseases described herein. These compounds can be formed in vitro as well as in vivo. Methods of making these compounds are provided in the Examples section.
[0188] In another aspect, the invention provides a compound having a structure according to the following formula:
wherein Y, A, Ra and R3 are as described herein. L is a member selected from OR7, substituted or unsubstituted purine, substituted or unsubstituted pyrimidine, substituted or unsubstituted pyridine and substituted or unsubstituted imidazole. R7 is a member selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heteroaryl. A1 is a member selected from OH, substituted or unsubstituted monophosphate, substituted or unsubstituted diphosphate, substituted or unsubstituted triphosphate,
O O O A* O P O cytidine — o P O cytidine O P (X , O I- O I- O I- V A* is a nucleic acid sequence which comprises between 1 and 100 nucleotides.
[0189] In an exemplary embodiment, the compound has the following structure:
[0190] Compounds of use in the present invention can be prepared using commercially available starting materials, known intermediates, or by using the synthetic methods published in references described and incorporated by reference herein, such as U.S. Pat. Apps. 12/142,692 and U.S. Pat. Pubs. US20060234981, US20070155699 and US20070293457.
[0191] The following general procedures were used as indicated in generating the examples and can be applied, using the knowledge of one of skill in the art, to other appropriate compounds to obtain additional analogues. General Procedure 1: Synthesis of Amino 3H-benzo[c] fl,2Joxaborol-l-ols
[0192] Reference: JACS 1960, 82, 2172. Benzoxaboroles can be mixed with concentrated nitric acid at -40 0C. The mixture can be stirred for 30min then can be added to ice water to precipitate a solid that can be collected by filtration. This crude material can be recrystallized, such as from water, to produce the appropriately substituted 6-nitro 3H-benzo[c][l,2]oxaborol-l-ol. The nitro group can be reduced by dissolving in EtOH and combining with Raney-Ni. This mixture can be subjected to 1.6atm of hydrogen with agitation in a Parr apparatus for 16hrs. Nickel catalyst can be removed via filtration and the solvent can be removed under reduced pressure. The resulting residues can be purified by recrystallization from 25% EtOH.
General Procedure 2: Sulfonylation of Amino 3H-benzofc]fl,2Joxaborol-l-ols
[0193] Through subjecting it to sulfonylation conditions, compound 1 * can be converted to compound 2*. [0194] In some applications of this general procedure, unsubstituted phenyl or unsubstituted pyridinyl sulfonyl chloride (1-1.2 equiv) and a base (such as NMM, K2CO3, or pyridine 3-4 equiv) can be added sequentially to a solution of the amine in
MeCN (20 mL/g) at rt. After completion (typical duration O/N) the volatiles can be removed in vacuo. H2O can be added to the residue and the mixture adjusted to ~ pH 6 with dilute HCl. The aqueous layer can be then extracted with an organic solvent (such as EtOAc), and the combined organic fractions can be dried with a desiccant, such as Na2SO4 or MgSO4, filtered, and concentrated in vacuo. The product can be typically purified by either recrystallization from H2O, trituration with CH2Cl2 or EtOAc, or flash chromatography.
General Procedure 3: Deprotection of Benzyl Protected Alcohols
Pd(OH)2/C, AcOH H2 (40-50 psi), rt
ROBn *■ ROH [0195] A mixture of the benzylated alcohol (1 equiv) and 20% Pd(OH)2 on carbon
(50% weight- wet, 1 :2 w/w substrate to catalyst) in glacial AcOH (10 mL/g) can be shaken under an atmosphere of H2 (40-50 psi) in a Parr shaker. Once the reaction is complete (TLC), the mixture can be filtered through Celite®. The filtrate can be concentrated in vacuo and the remaining AcOH can be removed by co-evaporation with toluene (3 x) to give the alcohol. Further purification can be carried out by flash chromatography or preparative HPLC as required.
[0196] DIAD (1 equiv) can be added to a solution of the phenol (1 equiv) and PPh3 (1 equiv) in anhydrous THF (200 mL/7 g phenol). The mixture can be stirred at rt until the reaction is complete (as determined by TLC). The mixture can be then concentrated in vacuo. Et2O can be added to the residue and the mixture can be then concentrated in vacuo. Et2O can be added again and the precipitate that formed can be removed by filtration. The filtrate can be extracted with 2 N NaOH and H2O. The organic layer can be dried (Na2SO4) and concentrated in vacuo. The residue can be further purified by flash chromatography.
General Procedure 5:
[0197] A solution of the alkyl halide or mesylate (1-1.5 equiv), 2-bromo-3- hydroxy-benzaldehyde (1 equiv), and either K2CO3 (1-1.2 equiv) or CS2CO3 (1.5-2 equiv), in DMF can be stirred at 50-80 0C (bath temp) until the reaction is complete (typically O/N). The reaction mixture cooled to rt, diluted with H2O, and extracted with EtOAc. The organic fractions can be washed with H2O then brine, dried (MgSO4), and concentrated in vacuo. Further purification can be performed by flash chromatography if required. General Procedure 6: Borylation of Aromatic Compound CH2CI2
X* = leaving group, such as Br or OTf [0198] A solution of aryl bromide or triflate in anhydrous 1 ,4-dioxane or THF (20 mL/ 1 g) was added B2pin2 (2 equiv) and KOAc (3 equiv) at rt, then degassed with N2 for 10 to 40 min. PdCl2(dppf>CH2Cl2 (4-8 mol%) can be added and the resulting solution can be stirred at 65-100 0C until the reaction was complete (2 to 24 h). The solution can be cooled to rt, filtered through Celite® or silica gel and concentrated in vacuo. The residue can be taken up in EtOAc. The organic layer can be then washed with H2O then brine, dried (Na2SO4), filtered, and concentrated in vacuo. The product can be typically purified by flash chromatography. General Procedure 7: Borylation of Phenols via their Aryl Inflates
[0199] Trifluoromethanesulfonic anhydride (1.2 equiv) can be added dropwise to a solution of pyridine (1.2 equiv) and the phenol in CH2Cl2 (40 mL/8.6 g) at 0 0C (bath temp). The reaction mixture can be then allowed to warm to rt and can be stirred until complete consumption of starting material (as determined by TLC). Et2O and 2 N
HCl were then added. The organic layer can be separated and washed with sat. NaHCO3 then brine. The organic layer can be dried (Na2SO4) and filtered through a short silica gel plug, washing with Et2O. The filtrate can be concentrated in vacuo to give the desired triflate that can be used directly in a subsequent general procedure.
General Procedure 8: Ring Closure of Substituted 2-(4,4,5 ,5-Tetrametkyl- [1,3,2 ]dioxaborolan-2-yl)-benzaldehvdes
[0200] NaBH4 (1.5 equiv) can be added portionwise to an ice-cold solution of the aldehyde in alcohol (typically absolute EtOH or anhydrous MeOH (c = 0.1 M). The reaction can be allowed to warm to rt and monitored by TLC. The mixture can be then acidified to ~ pH 3 using a 1 N NaHSO4 or 2 M HCl and stirred O/N. The precipitate can be collected by filtration, washed repeatedly with H2O and dried in vacuo. Further purification can be carried out by flash chromatography when required. General Procedure 9: Henry Reaction of Substituted 2-f 4,4,5, 5-Tetramethyl- [1,3,2 ]dioxaborolan-2-yl)-benzaldehvdes
[0201] NaOH aq. (1.0 equiv) can be added to the aldehyde (either in H2O or THF) at rt and the reaction mixture can be stirred at rt for 5 min. MeNO2 (3 equiv) can be added dropwise and the mixture can be stirred at rt for 16 h. The reaction mixture can be acidified with 2 N HCl and extracted with EtOAc. The organic fraction can be washed with H2O then brine, dried (MgSO4), and concentrated in vacuo. Purification can be typically accomplished by either flash chromatography or precipitation from the acidified reaction mixture.
General Procedure 10: Henry Reaction using Phase Transfer Catalyst of Substituted 2- (4, 4, 5, 5-Tetramethyl-fl ,3,2 ]dioxaborolan-2-yl)-benzaldehydes
[0202] CTAB or CTACl (5 mol%) can be added to a mixture of MeNO2 and aldehyde, in aq. NaOH, and THF (1 mL/300 mg aldehyde) at rt. The reaction can be monitored by TLC. Upon completion (typically 1-1.5 h), the mixture can be adjusted to pH 2-3 using 2 N HCl or 1 M NaHSO4 and the mixture can be then stirred for 30 min. The solid can be filtered and dried to afford the desired nitro compound which can be used directly in next step. If there was no precipitation, the organic material can be extracted from the reaction mixture with EtOAc. The organic fraction can be then dried (MgSO4) and concentrated in vacuo. The residue can be purified by flash chromatography.
General Procedure 11: Reduction of Alkyl Nitro and/or Alkyl Nitrile compounds to N- Boc Protected Amines .
NiCI2, NaBH4 Boc2O, MeOH RNO2 Or RCN RNHBoc
[0203] BoC2O (2 equiv) and MC12*6H2O (1 equiv) can be added to a stirred solution of the alkyl nitro or alkyl nitrile in anhydrous MeOH (3 mL/mmol) at rt. Stirring can be continued until most of the NiCl2 had dissolved in MeOH (typically ~10 min). The reaction mixture can be then cooled to O 0C (bath temp) and NaBH4 (6 equiv) was added portionwise over 10 min. The reaction can be exothermic, effervescent, and can result in the formation of a finely divided black precipitate. The reaction mixture can be allowed to warm to rt and left to stir O/N. The mixture can be then concentrated in vacuo and the residue diluted with EtOAc. The resulting suspension can be filtered through Celite and the filtrate concentrated in vacuo. The residue can be then further purified by flash chromatography if required.
General Procedure 12: Deprotection of Boc-protected Amines
1 M HCI/Et2O or 4M HCI/dioxane
R-NHBoc ^ R-NH2 HCI
[0204] A mixture of the N-Boc protected amine and either 1 M HCl in Et2O or 4 M
HCl in dioxane (2 mL/mmol) can be stirred at rt. After the complete consumption of starting material (monitored by TLC, typically 3-16 h), the mixture can be
concentrated in vacuo and the crude residue triturated with Et2O and filtered. If necessary, the final product was purified by preparative HPLC.
General Procedure 13: Reduction of Alkyl Nitro and/or Alkyl Nitrile using Ranev Nickel
Raney Ni, H2 (40-50 psi) 2 M NH3 in EtOH, EtOH RNO2 or RCN - RNH2
[0205] A mixture of the 3-nitromethyl-3H-benzo[c][l,2]oxaborol-l-ol, Raney Ni (2 equiv w/w), 2.0 M NH3 in EtOH (5 niL/1 g), and absolute EtOH (20 niL/1 g) can be shaken under an atmosphere of H2 (40-50 psi) for 3 h at rt. The resultant mixture can be filtered through a pad of Celite and washed with EtOH. The filtrate can be concentrated in vacuo to give the free amine.
General Procedure 14: Reduction of Substituted-3-nitromethyl-3H- benzofc]fl,2]oxaborol-l-ols usins Pearlman 's Catalyst.
[0206] A mixture of the 3-nitromethyl-3H-benzo[c] [ 1 ,2]oxaborol- 1 -ol (1 equiv) and 20% Pd(OH)2 on carbon (50% weight-wet, 1 :2 w/w substrate to catalyst) in glacial AcOH (10 mL/g) or 2 M NH3 in MeOH can be shaken under an atmosphere of H2 (45-50 psi) in a Parr shaker. Once the reaction is complete (TLC), the mixture can be filtered through Celite®. The filtrate can be concentrated in vacuo to give a gummy material. Remaining AcOH can be removed by co-evaporation with toluene (3 x) to give the amine, typically as a fluffy solid. Alternatively remaining ammonia can be removed by diluting with an appropriate solvent like methanol or ether followed by concentration in vacuo. Purification can be typically accomplished by preparative HPLC.
General Procedure for Chiral HPLC Separation of Enantiomers
[0207] Through subjecting it to chiral HPLC separation conditions, compound 17* can be separated into enantiomers 18* and 19*.
[0208] The separation of the two enantiomers can be achieved by dissolving the material in a suitable solvent and applying to an appropriate chiral column and eluent system. The collected separated enantiomer samples can be then concentrated and used in the next step without further purification. Using this technique, it is possible to achieve a range of enantiomeric excesses of the separated enantiomers.
General Procedure for Chiral Synthesis of 6-R-substituted-3- aminomethylbenzoxaboroles
[0209] The direct stereospecifϊc synthesis of 6-R- substituted 3- aminomethylbenzoxaboroles can be achieved starting from the 5- or 6- substituted 2- bromoacetophenone. Bromine (1.0 eq) is added slowly to appropriately substituted 2'-bromoacetophenone (1.0 eq) in diethyl ether at room temperature and stirred for 2 hours. Water is added and the reaction mixture stirred until the color fades. The phases are separated and the aqueous layer extracted with diethyl ether. The combined organic phases are washed with brine, dried over MgSO4, filtered and concentrated under reduced pressure to give substituted 2-bromo-l-(2- bromophenyl)ethanone. 6-R-substituted (i?)-(+)-2-Methyl-CBS-oxazaborolidine [For R-isomer] or 6-R-substituted (S)-(-)-2-Methyl-CBS-oxazaborolidine [For S-isomer] (0.11 eq) is added to a stirred solution of substituted 2-bromo-l-(2- bromophenyl)ethanone (1.0 eq) in THF. The reaction mixture is cooled to -100C where BH3-THF (1.0 M in THF, 1.20 eq) is added over 4 hours. The reaction mixture
is stirred for a further 45 minutes at -100C before the addition of methanol (130 mL). The reaction mixture is concentrated under reduced pressure. The resultant residue is subjected to flash column chromatography to provide the substituted chiral 2-bromo- l-(2-bromophenyl)ethanol. To a solution of this alcohol (1.00 eq) in DMF is added sodium azide at room temperature. The reaction mixture is then heated to 800C for 24 hours. Water (150 mL) is added and this solution is extracted with diethyl ether. The combined organic phases are washed with brine (50 mL), dried over MgSO4, filtered and concentrated under reduced pressure. The residue is subjected to flash column chromatography to yield the substituted 2-azido-l-(2-bromophenyl)ethanol. To a solution of this material (1.00 eq) in toluene is added triisopropyl borate (1.50 eq). The reaction flask is equipped with a Dean and Stark condenser attached and the reaction mixture is refluxed to remove approximately 3A of the volume of solvent. The dark reaction mixture is cooled to room temperature where THF is added and then cooled to -78°C. n-Butyl lithium (2.5 M in hexanes, 1.15 eq) is added dropwise to the reaction mixture at -78°C and then stirred for 30 minutes at this temperature. The reaction mixture is then allowed to warm to room temperature where it is stirred for 3 hours before being quenched with 6 M HCl (30 mL). The reaction mixture is concentrated under reduced pressure and the resulting residue is subjected to flash column chromatography to give the 6-R-substituted 3-(azidomethyl)benzo[c][l,2] oxaborol-1 (3H)-ol.
[0210] To a solution of this compound (1.0 eq) in methanol is added triphenylphosphine (1.0 eq) and this is stirred for 3 hours at room temperature. Concentrated HCl is added and the reaction mixture stirred for a further 2 hours before being concentrated to dryness under reduced pressure. Dichloromethane is added and extracted with 2 M HCl. The combined aqueous layers are washed with dichloromethane before being contracted under reduced pressure. The residue is then recrystalised from hot water / acetonitrile (3 mL water / 50-80 mL acetonitrile per gram of compound) to give the substituted chiral (R or S) 6-R-substituted 3- (aminomethyl)benzo[c][l,2]oxaborol-l(3H)-ol as the hydrochloride salt.
General Procedure for 6-Substituted or unsubstituted phenoxy—3-acetic acid benzoxaborole derivatives
Step l
[0211] The hydroxyl group of A* can be protected by subjecting the molecule to protecting group appropriate conditions, thereby producing B*.
Step 2
[0212] The hydroxyl group of B* can be protected by subjecting the molecule to protecting group appropriate conditions, thereby producing C*.
C* conditions D*
[0213] D* can be produced by subjecting C* to conditions that will selectively deprotect PG1, but not PG2.
Step 4
[0215] F* can be produced by subjecting E* to conditions that will selectively deprotect PG2. Step 6
[0216] G* can be produced by subjecting F* to conditions that will selectively add a triflate, or a similar group.
Step 7
[0217] H* can be produced by subjecting G* to borylation conditions.
Step 8
[0219] When R3 comprises an ester, for example, J*, the compound can be subjected to hydrolysis conditions to produce K*. The mixture can be purified via precipitation, silica gel column purification or preparative HPLC.
General Procedure for 6-Substituted or unsubstituted heteroaryl—3-acetic acid benzoxaborole derivatives
Step 1.
[0220] L* can be produced by subjecting C* to borylation conditions. Step 3.
L*
[0221] The reaction was carried out using a procedure similar to that described in Step 8 of Strategy A.
Step 4
[0222] N* can be produced by subjecting M* to conditions that will deprotect
PG1. Step 5
[0223] O* can be produced by subjecting N* to appropriate coupling conditions.
General Procedure for 6-substituted or unsubstituted alkyl- 3 -acetic acid benzoxaborole derivatives
Step l
[0224] P* can be produced by subjecting N* to appropriate coupling conditions. Step 2.
[0225] When R3 comprises an ester, for example, Q*, the compound can be subjected to hydrolysis conditions to produce S*. The mixture can be purified via precipitation, silica gel column purification or preparative HPLC.
General Procedure for 6-substituted- 3 -propionic acid benzoxaborole derivatives
[0226] U* can be produced by subjecting T* to succinylation conditions.
Step 2:
[0228] W* or X* can be produced by subjecting V* to alcohol deprotection conditions. Step 4:
[0229] AA** can be produced by subjecting W* to conditions that will selectively add a triflate, or a similar group.
[0230] AB* can be produced by subjecting AA* to borylation conditions. Step 6:
[0231] AC* can be produced by subjecting AB* to ring closure conditions.
General Procedure for Chiral Separation
Step l
[0232] Racemates of compounds such as I* were separated into pure enantiomers via preparative chiral HPLC or preparative supercritical fluid chromatography. Chiral columns which can be utilized to separate compounds of the invention are commercially available from companies such as Chiral Tech (West Chester, PA). Exemplary chiral columns which can be utilized include CHIRALPAK® IC, and CHIRALP AK® 405. Solvent systems of use in this purification include CO2ZMeOH (approx 85/15), Hexane/IprOH/TFA Hexane/EtOH/TFA as solvent. EtOH can be replaced with other alcohols.
Step 2
[0233] When R3 comprises an ester, for example, AC* or AD*, the compound can be subjected to hydrolysis conditions to produce compounds such as AE* or AF*. The mixture can be purified via precipitation, silica gel column purification or preparative HPLC.
[0234] Compounds of the invention can be produced according to the strategies described herein.
General Procedure for production of 6-pyridinyloxy compounds
Alternate heterocyclic rings could be introduced through a different selection of 6.
[0235] The following general procedure describes a method of introducing a methyl ester moiety at the 3 position of the benzoxaborole. General Procedure
Different substitutions could be accomplished through the addition of a substituent to 1. Variations in the ester could be accomplished through variations of 5.
[0236] The following general procedure describes a method of hydro lyzing a methyl ester to a methyl carboxylic acid. General Procedure
[0237] The following general procedure describes a method of hydro lyzing a methyl carboxylic acid to an alkyl alcohol. General Procedure
[0238] The following general procedure describes a method of making a 6-benzyl substituted benzoxaborole : General Procedure
DCM,
[0239] The following general procedure describes a method of making a 3,6 benzoxaborole:
General Procedure
[0240] The following general procedure describes a method of making a 3,6 benzoxaborole:
General Procedure
HO^^v^OH cyclopentyl iodide, K2CO3 ^OH ^OSO2CF3
Tf2O, Py, DCM
CHO DMF, rt, O/N αc CHO O 0C CHO
[0241] Compounds described herein can be converted into hydrates and solvates by methods similar to those described herein.
IV. Assays
[0242] Art-recognized techniques of genetics and molecular biology are of use to identify compounds that bind to and/or inhibit an enzyme, such as a beta-lactamase or a tRNA synthetase. Moreover, these techniques are of use to distinguish whether a compound binds to and/or inhibits a particular domain of the enzyme. For example, for LeuRS, these techniques can distinguish whether a compound binds to and/or inhibits the synthetic domain, the editing domain, or both the editing and synthetic domains.
IV. a) Beta-lactamase
[0243] In an exemplary assay, activity of a representative compound against a beta- lactamase was confirmed.
[0244] Assays to determine whether, and how effectively, a particular compound binds to and/or inhibits a beta-lactamase are also set forth herein, and additional assays are readily available to those of skill in the art.
[0245] Generally, the compounds to be tested are present in the assays in ranges from about 1 pM to about 100 mM, preferably from about 1 pM to about 1 μM. Other compounds range from about 1 nM to about 100 nM, preferably from about 1 nM to about 1 μM.
[0246] The effects of the test compounds upon the function of the enzymes can also be measured by any suitable physiological change. When the functional consequences are determined using intact cells or animals, one can also measure a variety of effects such as transmitter release, hormone release, transcriptional changes to both known and uncharacterized genetic markers, changes in cell metabolism such as cell growth or pH changes, and changes in intracellular second messengers such as Ca2+, or cyclic nucleotides.
[0247] High throughput screening (HTS) is also of use in identifying promising candidates of the invention. [0248] Utilizing the assays set forth herein and others readily available in the art, those of skill in the art will be able to readily and routinely determine other compounds and classes of compounds that operate to bind to and/or inhibit a beta- lactamase.
[0249] In another aspect, the invention provides a method for identifying a compound which binds a beta-lactamase comprising: a) contacting said beta-lactamase with a test compound under conditions suitable for binding; and b) detecting binding of said test compound to said beta-lactamase. In an exemplary embodiment, detecting binding of said compound comprises use of at least one detectable element, isotope, or chemical label attached to said compound. In an exemplary embodiment, the element, isotope or chemical label is detected by a fluorescent, luminescent, radioactive, or absorbance readout. In another exemplary
embodiment, wherein said beta-lactamase comprises the amino acid sequence of a peptide sequence described herein.
[0250] In another aspect, the invention provides a method for identifying a compound which binds to a beta-lactamase , said assay comprising: a) contacting said beta-lactamase with said compound under conditions suitable for binding of said compound with said beta-lactamase; b) comparing a biological activity of said beta- lactamase contacting said compound to said biological activity when not contacting said compound; and c) identifying said compound as binding to said beta-lactamase if said biological activity of said beta-lactamase is reduced when contacting said compound.
IV. b) LeuRS
[0251] In an exemplary assay, activity of a representative compound against the editing domain was confirmed. To identify the target of a novel boron-containing antibacterial compound, mutants in E.coli showing resistance to the compound were isolated. Characterization of mutants showed that they have an 32-256 fold increase in resistance to the compound over wildtype. The mutants were furthermore shown to be sensitive to various antibacterial agents with known modes of action, suggesting that the cellular target of the compound is distinct from the target of the other antibacterial agents. The leuS gene from the mutants was cloned onto a plasmid and their resistance was confirmed by MIC. The editing domain from these mutants were sequenced and the mutations were all located in the editing domain of this enzyme.
[0252] Assays to determine whether, and how effectively, a particular compound binds to and/or inhibits the editing domain of a selected tRNA synthetase are also set forth herein, and additional assays are readily available to those of skill in the art. Briefly, in an exemplary assay, an improperly charged tRNA and a tRNA synthetase that is capable of editing the improperly charged tRNA are combined. The resulting mixture is contacted with the putative inhibitor and the degree of editing inhibition is observed.
[0253] Another assay uses genetics to show that a drug works via the editing domain. In this assay, the compound is first tested against a strain of cells over- expressing copies of the tRNA synthetase gene. The compound's effect on the over- expressing strain is compared with a control strain to determine whether the
compound is active against the synthetase. If the minimum inhibitory concentration (MIC) is 2-fold higher in the strain with extra copies of the synthetase gene than the MIC of the inhibitor against a wild type cell, a further genetic screen is conducted to determine whether the increased resistance is due to mutations in the editing domain. In this second screen, the control strain is challenged against a high concentration of the inhibitor. The colonies surviving the challenge are isolated and DNA from these cells is isolated. The editing domain is amplified using a proof-reading PCR enzyme and the appropriate primers. The PCR product can be purified using standard procedures. The sequence amplified mutant DNA is compared to wild-type. If the mutant DNA bears mutations in the editing domain, such results would suggest that the compound binds to the editing domain and affects the editing function of the molecule through this domain.
[0254] Generally, the compounds to be tested are present in the assays in ranges from about 1 pM to about 100 mM, preferably from about 1 pM to about 1 μM. Other compounds range from about 1 nM to about 100 nM, preferably from about 1 nM to about 1 μM.
[0255] The effects of the test compounds upon the function of the enzymes can also be measured by any suitable physiological change. When the functional consequences are determined using intact cells or animals, one can also measure a variety of effects such as transmitter release, hormone release, transcriptional changes to both known and uncharacterized genetic markers, changes in cell metabolism such as cell growth or pH changes, and changes in intracellular second messengers such as Ca2+, or cyclic nucleotides.
[0256] High throughput screening (HTS) is also of use in identifying promising candidates of the invention.
[0257] Utilizing the assays set forth herein and others readily available in the art, those of skill in the art will be able to readily and routinely determine other compounds and classes of compounds that operate to bind to and/or inhibit the editing domain of tRNA synthetases. [0258] In another aspect, the invention provides a method for identifying a compound which binds to an editing domain of a tRNA synthetase comprising:
a) contacting said editing domain with a test compound under conditions suitable for binding; and b) detecting binding of said test compound to said editing domain. In an exemplary embodiment, detecting binding of said compound comprises use of at least one detectable element, isotope, or chemical label attached to said compound. In an exemplary embodiment, the element, isotope or chemical label is detected by a fluorescent, luminescent, radioactive, or absorbance readout. In an exemplary embodiment, the contacting of said test compound with said editing domain also includes further contacting said test compound and said editing domain with a member selected from AMP and a molecule with a terminal adenosine. In an exemplary embodiment, the tRNA synthetase is derived from leucyl tRNA synthetase. In an exemplary embodiment, the tRNA synthetase is derived from a mutated tRNA synthetase, wherein said mutated tRNA synthetase comprises amino acid mutations in an editing domain. In another exemplary embodiment, wherein said editing domain of a tRNA synthetase comprises the amino acid sequence of a peptide sequence described herein.
[0259] In another aspect, the invention provides a method for identifying a compound which binds to an editing domain of a tRNA synthetase, said assay comprising: a) contacting said editing domain of a tRNA synthetase with said compound under conditions suitable for binding of said compound with said editing domain of a tRNA synthetase; b) comparing a biological activity of said editing domain of a tRNA synthetase contacting said compound to said biological activity when not contacting said compound; and c) identifying said compound as binding to said editing domain of a tRNA synthetase if said biological activity of said editing domain of a tRNA synthetase is reduced when contacting said compound. In an exemplary embodiment, the biological activity is hydrolysis of noncognate amino acid. In another exemplary embodiment, the hydrolysis of said noncognate amino acid is detected through the use of one or more labels. In another exemplary embodiment, the labels include a radiolabel, a fluorescent marker, an antibody, or a combination thereof. In another exemplary embodiment, said labels can be detected using spectroscopy. In another exemplary embodiment, said editing domain of a tRNA synthetase is derived from leucyl tRNA synthetase.
[0260] In another aspect, the invention provides a method of generating tRNA molecules with noncognate amino acid comprising: a) creating or isolating a mutated
tRNA synthetase with altered amino acid editing domains; and b) contacting a tRNA molecule with said mutated tRNA synthetase and a noncognate amino acid. In another exemplary embodiment, the mutated tRNA synthetase contains one or more amino acid mutations in an editing domain. In another exemplary embodiment, the mutated tRNA synthetase is unable to bind with a compound of the invention. In another exemplary embodiment, the mutated tRNA synthetase is unable to bind with a compound described herein, or a pharmaceutically acceptable salt thereof. In another exemplary embodiment, the mutated tRNA synthetase is unable to bind with a compound according to a formula described herein, or a pharmaceutically acceptable salt thereof.
[0261] In another aspect, the invention provides a composition that comprises one or more tRNA molecules attached to noncognate amino acids, wherein said tRNA molecules are synthesized using one or more mutated tRNA synthetases isolated from a microorganism or a cell line derived from a microorganism. In an exemplary embodiment, the microorganism is a bacteria. In an exemplary embodiment, wherein said mutated tRNA synthetases contain amino acid mutations in their editing domains.
V. Amino acid and nucleotide sequences used in assays tRNA sequences that interact with the tRNA svnthetase-compound of the invention- AMP complex [0262] Transfer RNAs (tRNAs) translate mRNA into a protein on a ribosome.
Each transfer RNA contains an anti-codon region that hybridizes with mRNA, and an amino acid which may be attached to the growing peptide. The structural gene of tRNA is about 72 to 90 nucleotides long and folds into a cloverleaf structure (Sharp S. J., Schaack J., Coolen L., Burke D. J. and Soil D., "Structure and transcription of eukaryotic tRNA genes", Crit. Rev. Biochem, 19: 107 144 (1985); Geiduschek E. O., and Tocchini-Valentini, "Transcription by RNA polymerase III", Annu. Rev. Biochem. 57:873 914 (1988)).
[0263] In one embodiment, a compound described herein contacts AMP and a tRNA synthetase, and the tRNA synthetase in turn contacts a tRNA molecule. In another embodiment, a compound described herein contacts AMP from the tRNA molecules and a tRNA synthetase. The nucleotide sequence of the tRNA molecule can be determined by the identity of the tRNA synthetase involved. For example, for leucyl tRNA synthetase, the cognate tRNA molecule bound will be tRNA-leucine
(SEQ ID NO: 1), but a noncognate tRNA, such as isoleucine, (SEQ ID NO: 2) may be bound under certain conditions. In another embodiment, the tRNA molecule is a leucyl t-RNA. In another embodiment, the tRNA molecule is represented by a SEQ ID described herein. In another embodiment, the tRNA molecule is represented by SEQ ID NO: 14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23 and SEQ ID NO:24. In this and other embodiments, the term "noncognate" is meant to encompass both the singular and plural forms of the word, i.e. the phrase "noncognate amino acid" comprises one or more amino acids. In the following sequences; s4U = S4U; 4-thiouridine; Gm = methylguanine; Y = pyrimidine; ms2i6A = ms2i6A; 2- methylthio-jV-6-isopentenyl adenosine and D = dihydrouridine.
[0264] SEQ ID NO: 1 corresponds to the nucleotide sequence of the tRNA-Leu gene from Saccharomyces cerevisiae: gggagtttgg ccgagtggtt taaggcgtca gatttaggct ctgatatctt cggatgcaagggttcgaatc ccttagctct caeca [0265] SEQ ID NO: 2 corresponds to the nucleotide sequence of the tRNA-Ile gene from Saccharomyces cerevisiae: gaaactataa ttcaattggt tagaatagta ttttgataag gtacaaatat aggttcaatc cctgttagtt tcatcca
[0266] SEQ ID NO: 14 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. colϊ. gcgaaggtggcggaattggtagacgcgctagcttcaggtgttagtgtccttacggacgtgggggttcaagtcccccccctc gcacca
[0267] SEQ ID NO: 15 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. colϊ. gcgggagtggcgaaattggtagacgcaccagatttaggttctggcgccgcaaggtgtgcgagttcaagtctcgcctcccg caeca
[0268] SEQ ID NO: 16 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. colϊ. gccgaagtggcgaaatcggtagacgcagttgattcaaaatcaaccgtagaaatacgtgccggttcgagtccggccttcgg caeca [0269] SEQ ID NO: 17 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. colϊ. gccgaggtggtggaattggtagacacgctaccttgaggtggtagtgcccaatagggcttacgggttcaagtcccgtcctcg
gtacca
[0270] SEQ ID NO: 18 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. colϊ. gcccggatggtggaatcggtagacacaagggatttaaaatccctcggcgttcgcgctgtgcgggttcaagtcccgctccg ggtacca
[0271] SEQ ID NO: 19 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. colϊ.
GCCCGGAs4UGGUGGAADCGmGDAGACACAAGGGAYUunkAAAms2i6AAY CCCUCGGCGUUCGCGCUGUGCGGGTYCAAGUCCCGCUCCGGGUACCA [0272] SEQ ID NO: 20 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. colϊ.
GCGAAGGUGGCGGAADDGmGDAGACGCGCUAGCUUCAGunkGYGYUAGU GUCCUUACGGACGUGGGGGTYCAAGUCCCCCCCCUCGCACCA [0273] SEQ ID NO: 21 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. colϊ.
GCCGAGGUGGUGGAADDGmGDAGACACGCUACCUUGAGunkGYGGUAGU GCCCAAUAGGGCUUACGGGTYCAAGUCCCGUCCUCGGUACCA
[0274] SEQ ID NO: 22 corresponds to the nucleotide sequence of a tRNA-Leu gene from Pseudomonas aeruginosa gcggacgtggtggaattggtagacacactggatttaggttccagcgccgcaaggcgtgagagttcgagtctctccgtccgc acca
[0275] SEQ ID NO: 23 corresponds to the nucleotide sequence of a tRNA-Leu gene from Staphylococcus aureus gccggggtggcggaactggcagacgcacaggacttaaaatcctgcggtgagagatcaccgtaccggttcgattccggtc ctcggcacca
[0276] SEQ ID NO: 24 corresponds to the nucleotide sequence of a tRNA-Leu gene from Staphylococcus aureus gccggggtggcggaactggcagacgcacaggacttaaaatcctgcggtgagtgatcaccgtaccggttcgattccggtcc tcggcacca
Polypeptides used in binding and inhibition assays
[0277] In some binding and inhibition assays, it is more effective to use a portion of a tRNA synthetase molecule rather than the whole protein itself. In such assays, polypeptides derived from tRNA synthetases are used in the experiment. [0278] In one preferred embodiment, polypeptide fragments corresponding to the editing domain of a tRNA synthetase molecule are used in assay and binding experiments. Such fragments are represented by SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6 and SEQ ID NO:7. In an exemplary embodiment, the fragments are represented by SEQ ID NO:5, SEQ ID NO: 6 and SEQ ID NO:7. [0279] SEQ ID NO 3:
TPQEYIGVKIEALEF ADDAAKIIDSSSDLDKSKKFYFVAATLRPETMYGQTCCF VSPTIEYGIFDAGDSYFITTERAFKNMSYQKLTPKRGFYKPIVTVPGKAFIGTKI HAPQSVYPELRILPMETVIATKGTGVVTCVPSNSPDDYITTKDLLHKPEYYGIK PEWIDHEIVPIMHTEKYGDLTAKAIVEEKKIQSPKDKNLLAEAKKIAYKEDYY TGTMIYGPYKGEKVEQAKNKVKADMIAAGEAFVYNEPESQDP
[0280] SEQ ID NO 4:
MTPQEYIGVKIEALEFADDAAKIIDSSSDLDKSKKFYFVAATLRPETMYGQTC CFVSPTIEYGIFDAGDSYFITTERAFKNMSYQKLTPKRGFYKPIVTVPGKAFIGT KIHAPQSVYPELRILPMETVIATKGTGVVTCVPSNSPDDYITTKDLLHKPEYYG IKPEWIDHEIVPIMHTEKYGDLTAKAIVEEKKIQSPKDKNLLAEAKKIAYKED YYTGTMIYGPYKGEKVEQAKNKVKADMIAAGEAFVYNEPESQDPQDPNSSS VDKLAAALEHHHHH
[0281] SEQ ID NO 5:
TCTPEYYRWEQKFFTELYKKGLVYKKTSAVNWCPNDQTVLANEQVIDGCC WRCDTKVERKEIPQWFIKITAYADELLNDLDKLDHWPDTVKTMQRNWIGRS EGVEITFNVNDYDNTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPEL AAFIDECRNTKVAEAEMATMEKKGVDTGFKAVHPLTGEEIPVWAANFVLME YGTGAVMAVPGHDQRDYEFASKYGLNIKPVILAADGSEPDLSQQALTEKGVL FNSGEFNGLDHEAAFNAIADKLTAMGVGERKVNYRLRDWGVSRQRYWG [0282] SEQ ID NO 6:
TCKPDYYRWEQWLFTRLFEKGVIYRKNGTVNWDPADQTVLANEQVIDGRG WRSGALIEKREIPMYYFRITDYADELLESLDELPGWPEQVKTMQRNWIGKSR GMEVQFPYDQASIGHEGTLKVFTTRPDTLMGATYVAVAAEHPLATQAAQGN AALQAFIDECKSGSVAEADMATQEKKGMATSLFVEHPLTGEKLPVWVANYV LMHYGDGAVMAVPAHDERDFEFAHKYNLPVKAVVRTSAGDDVGSEWLAA YGEHGQLINSGEFDGLDFQGAFDAIEAALIRKDLGKSRTQFRLRDWGISRQRY
WG
[0283] SEQ ID NO 7:
TTDPEYYKWTQWIFIQLYNKGLAYVDEVAVNWCPALGTVLSNEEVIDGVSE RGGHPVYRKPMKQWVLKITEYADQLLADLDDLDWPESLKDMQRNWIGRSE GAKVSFDVDNTEGKVEVFTTRPDTIYGASFLVLSPEHALVNSITTDEYKEKVK AYQTEASKKSDLERTDLAKDKSGVFTGAYAINPLSGEKVQIWIADYVLSTYG
TGAIMAVPAHDDRDYEFAKKFDLLIIEVIEGGNVEEAAYTGEGKHINSGELDG LENEAAITKAIQLLEQKGAGEKKVYKLRDWLFSRQRYWG
[0284] SEQ ID NO 8 corresponds to a peptide sequence for a leu-tRNA synthetase editing domain for Escherichia coli GRSEGVEITFNVNDYDNTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENN PELAAFIDECRNTKVAEAEMATMEKKGVDTGFKAVHPLTGEEIPVWAANFV LMEYGTGAVMAVPGHDQRDYEFASKYGLNIKPVILAADGSEPDLSQQALTE KGVLFNSGEFNGLDHEAAFNAIADKLTAMGVGERKVNYR
[0285] SEQ ID NO 9 corresponds to a peptide sequence for a leu-tRNA synthetase editing domain for Pseudomonas
GKSRGMEVQFPYDQASIGHEGTLKVFTTRPDTLMGATYVAVAAEHPLATQA AQGNAALQAFIDECKSGSVAEADMATQEKKGMATSLFVEHPLTGEKLPVWV ANYVLMHYGDGAVMAVPAHDERDFEFAHKYNLPVKAVVRTSAGDDVGSE WLAAYGEHGQLINSGEFDGLDFQGAFDAIEAALIRKDLGKSRTQFR [0286] SEQ ID NO 10 corresponds to a peptide sequence for a leu-tRNA synthetase editing domain for Staphylococcus aureus
GRSEGAKVSFDVDNTEGKVEVFTTRPDTIYGASFLVLSPEHALVNSITTDEYK EKVKAYQTEASKKSDLERTDLAKDKSGVFTGAYAINPLSGEKVQIWIADYVL STYGTGAIMAVPAHDDRDYEFAKKFDLLIIEVIEGGNVEEAAYTGEGKHINSG ELDGLENEAAITKAIQLLEQKGAGEKKVYK
[0287] In one preferred embodiment, polypeptides corresponding to a tRNA synthetase molecule are used in assay and binding experiments. Such polypeptides are represented by SEQ ID NO: 11, SEQ ID NO: 12 and SEQ ID NO: 13.
[0288] SEQ ID NO 11 corresponds to a peptide sequence for a leu-tRNA synthetase for Escherichia coli
MQEQYRPEEIESKVQLHWDEKRTFEVTEDESKEKYYCLSMLPYPSGRLHMGHVRNYT IGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAVKNNTAPAPWTYDNIAYMKNQLKM LGFGYDWSRELATCTPEYYRWEQKFFTELYKKGLVYKKTSAVNWCPNDQTVLANEQV IDGCCWRCDTKVERKEI PQWFIKITAYADELLNDLDKLDHWPDTVKTMQRNWIGRSE GVEITFNVNDYDNTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELAAFIDEC RNTKVAEAEMATMEKKGVDTGFKAVHPLTGEEIPVWAANFVLMEYGTGAVMAVPGHD QRDYEFASKYGLNIKPVILAADGSEPDLSQQALTEKGVLFNSGEFNGLDHEAAFNAI ADKLTAMGVGERKVNYRLRDWGVSRQRYWGAPIPMVTLEDGTVMPTPDDQLPVILPE DVVMDGITSPIKADPEWAKTTVNGMPALRETDTFDTFMESSWYYARYTCPQYKEGML DSEAANYWLPVDIYIGGIEHAIMHLLYFRFFHKLMRDAGMVNSDEPAKQLLCQGMVL ADAFYYVGENGERNWVSPVDAIVERDEKGRIVKAKDAAGHELVYTGMSKMSKSKNNG IDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFLKRVWKLVYEHTAKG DVAALNVDALTENQKALRRDVHKTIAKVTDDIGRRQTFNTAIAAIMELMNKLAKAPT DGEQDRALMQEALLAVVRMLNPFTPHICFTLWQELKGEGDIDNAPWPVADEKAMVED STLVVVQVNGKVRAKITVPVDATEEQVRERAGQEHLVAKYLDGVTVRKVIYVPGKLL
NLVVG
[0289] SEQ ID NO 12 corresponds to a peptide sequence for a leu-tRNA synthetase for Pseudomonas
MHEQYTPRDVEAAAQNAWDEQQSFAVTEQPGKETYYCLSMFPYPSGKLHMGHVRNYT IGDVIARYQRMLGKNVLQPMGWDAFGMPAENAAMKNNVAPAKWTYENIDYMKTQLKS LGLAIDWSREVTTCKPDYYRWEQWLFTRLFEKGVIYRKNGTVNWDPADQTVLANEQV IDGRGWRSGALIEKREIPMYYFRITDYADELLESLDELPGWPEQVKTMQRNWIGKSR GMEVQFPYDQASIGHEGTLKVFTTRPDTLMGATYVAVAAEHPLATQAAQGNAALQAF IDECKSGSVAEADMATQEKKGMATSLFVEHPLTGEKLPVWVANYVLMHYGDGAVMAV PAHDERDFEFAHKYNLPVKAVVRTSAGDDVGSEWLAAYGEHGQLINSGEFDGLDFQG AFDAIEAALIRKDLGKSRTQFRLRDWGI SRQRYWGCPI PI IHCPSCGDVPVPEDQLP VTLPENVVPDGAGSPLARMPEFYECTCPKCGTAAKRETDTMDTFVESSWYFARYASP NYDKGLVDPKAANHWLPVDQYIGGIEHAILHLLYARFFHKLMRDEGLVTSNEPFKNL LTQGMVVAETYYRVASNGGKDWFNPADVEIERDAKAKIIGARLKTDGLPVEIGGTEK MSKSKNNGVDPQSMIEQYGADTCRLFMMFASPPDMSLEWSDSGVEGASRFLRRVWRL AQAHVAQGLPGQLDIAALSDEQKVIRRAIHAAIKQASTDVGQFHKFNTAIAQVMTVM NVLEKAPQVTAQDRALLQEGLEAVTLLLAPITPHISHELWKQLGHEQAVIDATWPSV DESALVQDTVTLVVQVNGKLRGQVEMPAAASREEIEAAARNNENVLRFTDGLTIRKV IVVPGKLVNIVAN
[0290] SEQ ID NO 13 corresponds to a peptide sequence for a leu-tRNA synthetase for Staphylococcus aureus
MNYNHNQIEKKWQDYWDENKTFKTNDNLGQKKFYALDMFPYPSGAGLHVGHPEGYTA TDIISRYKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPREFTKKNIQTFKRQIKEL GFSYDWDREVNTTDPEYYKWTQWIFIQLYNKGLAYVDEVAVNWCPALGTVLSNEEVI DGVSERGGHPVYRKPMKQWVLKITEYADQLLADLDDLDWPESLKDMQRNWIGRSEGA KVSFDVDNTEGKVEVFTTRPDTIYGASFLVLSPEHALVNSITTDEYKEKVKAYQTEA SKKSDLERTDLAKDKSGVFTGAYAINPLSGEKVQIWIADYVLSTYGTGAIMAVPAHD DRDYEFAKKFDLLIIEVIEGGNVEEAAYTGEGKHINSGELDGLENEAAITKAIQLLE QKGAGEKKVNYKLRDWLFSRQRYWGEPIPVIHWEDGTMTTVPEEELPLLLPETDEIK PSGTGESPLANIDSFVNVVDEKTGMKGRRETNTMPQWAGSCWYYLRYIDPKNENMLA DPEKLKHWLPVDLYIGGVEHAVLHLLYARFWHKVLYDLGIVPTKEPFQKLFNQGMIL GEGNEKMSKSKGNVINPDDIVQSHGADTLRLYEMFMGPLDAAIAWSEKGLDGSRRFL DRVWRLIVNEDGTLSSKIVTTNNKSLDKVYNQTVKKVTDDFETLGFNTAISQLMVFI NECYKVDEVYKPYIEGFVKMLAPIAPHIGEELWSKLGHEESITYQPWPTYDEALLVD DEVEIVVQVNGKLRAKIKIAKDTSKEEMQEIALSNDNVKASIEGKDIMKVIAVPQKL VNIVAK
VL Methods
[0291] In another aspect, the compounds of the invention can be utilized to inhibit an enzyme. In another aspect, the compounds of the invention and/or combinations of the invention exhibit potency against microorganisms, such as bacteria, and therefore have the potential to kill and/or inhibit the growth of microorganisms. In another aspect, the compounds of the invention and/or combinations of the invention exhibit potency against microorganisms, such as bacteria, and therefore have the potential to achieve therapeutic efficacy in the animals described herein.
VI. a) Beta-Lactamase
[0292] In an exemplary embodiment, the compounds of the invention exhibit the ability to inhibit a beta-lactamase, and therefore have the potential to be used to treat bacterial infections in man which involve beta-lactamases. According to another aspect of the invention, a method for binding to and/or inhibiting a beta-lactamase is provided which comprises contacting the beta-lactamase with an effective amount of a compound of the invention. Such conditions are known to those skilled in the art. In an exemplary embodiment, the compound of use in the method is described herein, or a salt, hydrate or solvate thereof, or a combination thereof. In an exemplary embodiment, the compound of use in the method is described herein, or a salt, hydrate or solvate thereof. In an exemplary embodiment, the compound of use in the method is described herein, or a salt thereof. In an exemplary embodiment, the compound of use in the method is described herein, or a salt thereof. The beta-lactamase is contacted with an amount of a compound of the invention sufficient to result in a detectable amount of beta-lactamase inhibition. This method can be performed on a beta-lactamase that is contained within an organism or which is outside an organism. In an exemplary embodiment, the method is performed on a beta-lactamase that is contained within a microorganism that is in, or on the surface of, an animal. In an exemplary embodiment, the animal is a human. In an exemplary embodiment, the inhibition takes place in a cell, such as a microorganism cell. In another exemplary embodiment, the microorganism is a bacteria. In an exemplary embodiment, the method is performed on a beta-lactamase that is outside of a microorganism. In an exemplary embodiment, the method is performed on a beta-lactamase that is outside of a microorganism and is in an assay of the type described herein. [0293] In an exemplary embodiment, the compound has a structure according to the following formula:
in which Y, A, Ra, m and R3a is described herein. In an exemplary embodiment, the compound has a structure according to the following formula:
20
in which Y, A, R20 and Ra are described herein. In an exemplary embodiment, the β- lactamase is a member selected from a Group 1 β-lactamase, a Group 2 β-lactamase, a Group 3 β-lactamase, and a Group 4 β-lactamase. In an exemplary embodiment, the Group 1 β-lactamase is a cephalosporinase. In an exemplary embodiment, said Group 2 β-lactamase is a member selected from penicillinase, a Group 2b, Group 2be, Group 2br, carbenicillinase, cloxacilanase, cephalosporinase and carbapenamase. In an exemplary embodiment, said Group 3 β-lactamase is a metallo-β-lactamase. In an exemplary embodiment, said Group 4 β-lactamase is a penicillinase. In an exemplary embodiment, the β-lactamase is a member selected from a class A β-lactamase, a class B β-lactamase, a class C β-lactamase, and a class D β-lactamase. In an exemplary embodiment, the class A β-lactamase is a member selected from a TEM β-lactamase, SHV β-lactamase, CTX-M β-lactamase and a KPC β-lactamase. In an exemplary embodiment, β-lactamase is TEM β-lactamase. In an exemplary embodiment, the β- lactamase is TEM-I β-lactamase. In an exemplary embodiment, the β-lactamase is TEM-3 β-lactamase. In an exemplary embodiment, the β-lactamase is KPC-2 β- lactamase. In an exemplary embodiment, the β-lactamase is CMY-2 β-lactamase. In an exemplary embodiment, the class C β-lactamase is a member selected from a CMY β-lactamase, a PER β-lactamase and an AmpC β-lactamase. In an exemplary embodiment, the β-lactamase is AmpC β-lactamase. In an exemplary embodiment, the class D β-lactamase is an OXA β-lactamase. In an exemplary embodiment, the β- lactamase is a metallo β-lactamase. In an exemplary embodiment, the metallo β- lactamase is a member selected from an IMP carbapenemase and a VIM β-lactamase. In an exemplary embodiment, the β-lactamase is a member selected from a class A β- lactamase and a class C β-lactamase. In an exemplary embodiment, the contacting takes place in vitro. In an exemplary embodiment, the contacting takes place in vitro. In an exemplary embodiment, the contacting takes place in an animal, such as a human.
VI. b) LeuRS
[0294] In an exemplary embodiment, the compounds of the invention exhibit the ability of inhibiting the editing domain of tRNA synthetases, such as leucyl tRNA synthetase, of microorganisms, such as bacteria, and therefore have the potential to be used as editing domain inhibitors of microorganism tRNA synthetases.
[0295] According to another aspect of the invention, a method for binding to and/or inhibiting the editing domain of a tRNA synthetase is provided which comprises contacting a tRNA synthetase with a compound of the invention that inhibits the editing domain under conditions in which the tRNA synthetase interacts with its substrate to form an aminoacyl adenylate intermediate and, preferably, to form a charged tRNA. Such conditions are known to those skilled in the art. In an exemplary embodiment, the compound has a structure according to the following formula:
in which A and Ra is described herein. In an exemplary embodiment, the compound is ElIl or a salt thereof. In an exemplary embodiment, the compound is ElIl or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound is El 19 or a salt thereof. In an exemplary embodiment, the compound is El 19 or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound is described herein, or a salt, hydrate or solvate thereof, or a combination thereof. In an exemplary embodiment, the invention provides a compound described herein, or a salt, hydrate or solvate thereof. In an exemplary embodiment, the invention provides a compound described herein, or a salt thereof. In an exemplary embodiment, the invention provides a compound described herein, or a salt thereof. The tRNA synthetase is contacted with an amount of compound of the invention sufficient to result in a detectable amount of tRNA synthetase inhibition. This method can be performed on a tRNA synthetase that is contained within an organism or which is outside an organism. In an exemplary embodiment, the method is performed on a tRNA synthetase that is contained within a microorganism or a microbial cell that is in, or on the surface of, an animal. In an exemplary embodiment, the animal is a human. The method results in a decrease in the amount of charged tRNA produced
by the tRNA synthetase that has an inhibited editing domain. In an exemplary embodiment, the inhibition takes place in a cell, such as a microorganism cell. In another exemplary embodiment, the microorganism cell is a bacteria. In another exemplary embodiment, the tRNA synthetase is leucyl tRNA synthetase. [0296] In an exemplary embodiment, the invention provides a method of inhibiting conversion of a tRNA molecule into a charged tRNA molecule. The method involves contacting a tRNA synthetase with a compound of the invention effective to inhibit activity of an editing domain of said tRNA synthetase, under conditions sufficient to inhibit said activity, thereby inhibiting said conversion. In an exemplary embodiment, the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the inhibition occurs within a cell, and the cell is a microorganism cell. In another exemplary embodiment, the microorganism cell is a bacteria. In another exemplary embodiment, the microorganism cell is a bacteria which is described herein. In another exemplary embodiment, the enzyme is a leucyl tRNA synthetase of a bacteria described herein. In another exemplary embodiment, the tRNA synthetase is leucyl tRNA synthetase. In another exemplary embodiment, the compound has a KD, synthesis of greater than 100 μM against a synthetic domain of said tRNA synthetase.
[0297] In certain embodiments, the mechanism of action of a compound of the invention is to inhibit the conversion of a tRNA molecule into a charged tRNA molecule by binding to and/or inhibiting at least the editing domain of the synthetase. The compounds of use in this method may also inhibit or otherwise interact with the synthetic domain (e.g., the active site of the synthetic domain). In a presently preferred embodiment, the editing domain is inhibited selectively in the presence of the synthetic domain. In a preferred embodiment, the synthetic domain is essentially uninhibited, while the editing domain is inhibited at least 50%, preferably at least 60%, more preferably at least 70%, still more preferably, at least 80% and even still more preferably at least 90% of the activity of the tRNA synthetase. In another preferred embodiment, the synthetic domain is inhibited by at most 50%, preferably at most 30%, preferably at most 20%, 10%, preferably at most 8%, more preferably at most 5%, still more preferably, at most 3% and even still more preferably at most 1%. Inhibition of the editing domain produces a decrease in the amount of the properly charged tRNA which results in retardation or cessation of cell growth and division.
[0298] In another exemplary embodiment, the ratio of a minimum concentration of said compound inhibiting said editing domain to a minimum concentration of said compound inhibiting said synthetic domain of said tRNA synthetase, represented as KD, edn/K-D, synthesis, is less than one. In another exemplary embodiment, the KDi edlt /ECDj synthesis of the compound is a member selected from less than 0.5, less than 0.1 and less than 0.05.
VI. c) Inhibiting a phosphodiesterase
[0299] In another aspect, the invention provides a method for inhibiting a phosphodiesterase (PDE), the method comprising: contacting the phosphodiesterase with a compound of the invention, wherein the phosphodiesterase is inhibited. In an exemplary embodiment, the amount of the compound is a therapeutically effective amount. In an exemplary embodiment, the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound of the invention a compound described in a formula provided herein. In an exemplary embodiment, the compound of the invention is a compound described herein.
[0300] In an exemplary embodiment, the phosphodiesterase is a member selected from PDEl, PDE2, PDE3, PDE4, PDE5, PDE6, PDE7, PDE8, PDE9, PDElO and PDEl 1. In an exemplary embodiment, the phosphodiesterase is PDE4. In an exemplary embodiment, the PDE4 is a member selected from PDE4A, PDE4B, PDE4C and PDE4D. In an exemplary embodiment, the PDE4 is PDE4B. In an exemplary embodiment, the phosphodiesterase is PDE7.
[0301] In an exemplary embodiment, the invention provides a method for inhibiting a phosphodiesterase4 (PD E4), but not significantly inhibiting at least one PDE which is a member selected from PDEl, PDE2, PDE3, PDE5 and PDE6, involving contacting a cell with a compound of the invention, thereby providing said inhibition. In an exemplary embodiment, the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound of the invention a compound described in a formula provided herein. In an exemplary embodiment, the compound of the invention is a compound described herein.
[0302] In an exemplary embodiment, for any of the methods described herein, the compound of the invention, is present in an amount which will inhibit a phosphodiesterase described herein by at least about 5 to about 100%, or at least about 30 to about 100%, 40 to about 100%, or at least about 50 to about 100%, or at least about 60 to about 100%, or at least about 70 to about 100%, or at least about 80 to about 100%, or at least about 90 to about 100%, or at least about 30 to about 70%, or at least about 40 to about 90%, or at least about 45 to about 80%, or at least about 55 to about 75%, or at least about 75 to about 98%, or at least about 55 to about 99%, or at least about 5% to about 20% or at least about 10% to about 25%. VI. d) Decreasing the production of a cytokine and/or chemokine
[0303] In another aspect, the invention provides a method for decreasing the production of a cytokine and/or a chemokine, the method comprising: contacting a cell with a compound of the invention, wherein production of the cytokine and/or chemokine by the cell is decreased. In an exemplary embodiment, the cell is contacted with a therapeutically effective amount of the compound. In an exemplary embodiment, the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound of the invention a compound described in a formula provided herein. In an exemplary embodiment, the compound of the invention is a compound described herein.
[0304] In an exemplary embodiment, the method is for decreasing the production of a cytokine, which is a THl cytokine. In an exemplary embodiment, the THl cytokine is a member selected from IFN-g and IL-2.
[0305] In an exemplary embodiment, the method is for decreasing the production of a cytokine, which is a TH2 cytokine. In an exemplary embodiment, the TH2 cytokine is a member selected from IL-4, IL-5 and IL-10.
[0306] In an exemplary embodiment, the method is for decreasing the production of a cytokine, which is a member selected from IL- lα, IL- lβ, IL-2, IL-3, IL-6, IL-7, IL-9, IL-12, IL-17, IL-18, IL-23, TNF-α, LT, LIF, Oncostatin, IFNα, IFNβ and IFNγ. In another exemplary embodiment, the cytokine is a member selected from IL- lβ, IL- 2, IL-3, IL-6, IL-7, IL-9, IL-12, IL-23, TNF-α, LT, LIF, Oncostatin, and IFNγ. In
another exemplary embodiment, the cytokine is a member selected from IL-I β, IL-2, IL-23, TNF-α and IFNγ. In another exemplary embodiment, the cytokine is TNF-α.
[0307] In an exemplary embodiment, the method is for decreasing the release of a cytokine, which is a member selected from IL-lβ, IL-2, IL-4, IL-5, IL-6, IL-8, IL-IO, IL- 12, IL-23, TNF-α and IFNγ.
[0308] In an exemplary embodiment, the method is for decreasing the production of a cytokine, which is a member selected from IL-4, IL-10, IL-11, W-13 and TGF-β.
[0309] In an exemplary embodiment, the method is for decreasing the production of a chemokine, which is a member selected from IL-8, Gro-α, MIP-I, MCP-I, PGE2, ENA-78, and RANTES. In an exemplary embodiment, the chemokine is a member selected from MCP-I and PGE2.
[0310] In an exemplary embodiment, for any of the methods described herein, the compound of the invention is present in an amount which will inhibit the production of a cytokine and/or a chemokine by at least about 5 to about 100%, or at least about 30 to about 100%, 40 to about 100%, or at least about 50 to about 100%, or at least about 60 to about 100%, or at least about 70 to about 100%, or at least about 80 to about 100%, or at least about 90 to about 100%, or at least about 30 to about 70%, or at least about 40 to about 90%, or at least about 45 to about 80%, or at least about 55 to about 75%, or at least about 75 to about 98%, or at least about 55 to about 99%, or at least about 5% to about 20% or at least about 10% to about 25%.
VI. e) Increasing the production of a cytokine and/or a chemokine
[0311] In another aspect, the invention provides a method for increasing the production of a cytokine and/or a chemokine, the method comprising: contacting a cell with a compound of the invention, wherein production of the cytokine and/or chemokine by the cell is increased. In an exemplary embodiment, the cell is contacted with a therapeutically effective amount of the compound. In an exemplary embodiment, the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound of the invention a compound described in a formula provided herein. In an exemplary embodiment, the compound of the invention is a compound described herein.
[0312] In an exemplary embodiment, the method is for increasing the production of a cytokine, which is a THl cytokine. In an exemplary embodiment, the THl cytokine is a member selected from IHN-g and IL-2.
[0313] In an exemplary embodiment, the method is for increasing the production of a cytokine, which is a TH2 cytokine. In an exemplary embodiment, the TH2 cytokine is a member selected from IL-4, IL-5 and IL-IO.
[0314] In an exemplary embodiment, the method is for increasing the production of a cytokine, which is a member selected from IL-4, IL-10, IL-11, W-13 and TGF-β.
[0315] In an exemplary embodiment, the method is for increasing the production of a chemokine, which is a member selected from IL-8, Gro-α, MIP-I, MCP-I, PGE2, ENA-78, and RANTES. In an exemplary embodiment, the chemokine is a member selected from MCP-I and PGE2.
[0316] In an exemplary embodiment, for any of the methods described herein, the of the invention is present in an amount which will increase the production of a cytokine and/or a chemokine by at least about 5 to about 100%, or at least about 30 to about 100%, 40 to about 100%, or at least about 50 to about 100%, or at least about 60 to about 100%, or at least about 70 to about 100%, or at least about 80 to about 100%, or at least about 90 to about 100%, or at least about 30 to about 70%, or at least about 40 to about 90%, or at least about 45 to about 80%, or at least about 55 to about 75%, or at least about 75 to about 98%, or at least about 55 to about 99%, or at least about 5% to about 20% or at least about 10% to about 25%.
VI. β Decreasing the release of a cytokine and/or chemokine
[0317] In another aspect, the invention provides a method for decreasing the release of a cytokine and/or a chemokine, the method comprising: contacting a cell with a compound of the invention, wherein the release of the cytokine and/or chemokine by the cell is decreased. In an exemplary embodiment, the cell is contacted with a therapeutically effective amount of the compound. In an exemplary embodiment, the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound of the invention a compound described in a formula provided herein. In an exemplary embodiment, the compound of the invention is a compound described herein.
[0318] In an exemplary embodiment, the method is for decreasing the release of a cytokine, which is a THl cytokine. In an exemplary embodiment, the THl cytokine is a member selected from IHN-g and IL-2.
[0319] In an exemplary embodiment, the method is for decreasing the release of a cytokine, which is a TH2 cytokine. In an exemplary embodiment, the TH2 cytokine is a member selected from IL-4, IL-5 and IL-IO.
[0320] In an exemplary embodiment, the method is for decreasing the release of a cytokine, which is a member selected from IL- lα, IL- lβ, IL-2, IL-3, IL-6, IL-7, IL-9, IL-12, IL-17, IL-18, IL-23, TNF-α, LT, LIF, Oncostatin, IFNα, IFNβ and IFNγ. In another exemplary embodiment, the cytokine is a member selected from IL-I β, IL-2, IL-3, IL-6, IL-7, IL-9, IL-12, IL-23, TNF-α, LT, LIF, Oncostatin, and IFNγ. In another exemplary embodiment, the cytokine is a member selected from IL-I β, IL-2, IL-23, TNF-α and IFNγ. In another exemplary embodiment, the cytokine is TNF-α.
[0321] In an exemplary embodiment, the method is for decreasing the release of a cytokine, which is a member selected from IL-lβ, IL-2, IL-4, IL-5, IL-6, IL-8, IL-10, IL-12, IL-23, TNF-α and IFNγ.
[0322] In an exemplary embodiment, the compound described herein decreases the release of IL-lβ, IL-2, IL-4, IL-5, IL-6, IL-8, IL-10, IL-12, IL-23, TNF-α and IFNγ.
[0323] In an exemplary embodiment, the method is for decreasing the release of a cytokine, which is a member selected from IL-4, IL-10, IL-11, W- 13 and TGF-β.
[0324] In an exemplary embodiment, the method is for decreasing the release of a chemokine, which is a member selected from IL-8, Gro-α, MIP-I, MCP-I, PGE2, ENA-78, and RANTES. In an exemplary embodiment, the chemokine is a member selected from MCP-I and PGE2. [0325] In an exemplary embodiment, the compound described herein decreases the release of TNF-α, IL-2, IFNγ, IL-5, and IL-10, and does not substantially decrease the release of IL-lβ, IL-6 and IL-8. In an exemplary embodiment, the compound decreases the release of IL-12 and IL-23.
[0326] In an exemplary embodiment, for any of the methods described herein, the compound of the invention is present in an amount which will decrease the release of
a cytokine and/or a chemokine by at least about 5 to about 100%, or at least about 30 to about 100%, 40 to about 100%, or at least about 50 to about 100%, or at least about 60 to about 100%, or at least about 70 to about 100%, or at least about 80 to about 100%, or at least about 90 to about 100%, or at least about 30 to about 70%, or at least about 40 to about 90%, or at least about 45 to about 80%, or at least about 55 to about 75%, or at least about 75 to about 98%, or at least about 55 to about 99%, or at least about 5% to about 20% or at least about 10% to about 25%.
VI. g) Increasing the release of a cytokine and/or a chemokine
[0327] In another aspect, the invention provides a method for increasing the production of a cytokine and/or a chemokine, the method comprising: contacting a cell with a compound of the invention, wherein release of the cytokine and/or chemokine by the cell is increased. In an exemplary embodiment, the cell is contacted with a therapeutically effective amount of the compound. In an exemplary embodiment, the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound of the invention a compound described in a formula provided herein. In an exemplary embodiment, the compound of the invention is a compound described herein.
[0328] In an exemplary embodiment, the method is for increasing the release of a cytokine, which is a THl cytokine. In an exemplary embodiment, the THl cytokine is a member selected from IFN-γ and IL-2.
[0329] In an exemplary embodiment, the method is for increasing the release of a cytokine, which is a TH2 cytokine. In an exemplary embodiment, the TH2 cytokine is a member selected from IL-4, IL-5 and IL-10. [0330] In an exemplary embodiment, the method is for increasing the release of a cytokine, which is a member selected from IL-4, IL-10, IL-11, W- 13 and TGF-β.
[0331] In an exemplary embodiment, the method is for increasing the release of a chemokine, which is a member selected from IL-8, Gro-α, MIP-I, MCP-I, PGE2, ENA-78, and RANTES. In an exemplary embodiment, the chemokine is a member selected from MCP-I and PGE2.
[0332] In an exemplary embodiment, for any of the methods described herein, the compound of the invention is present in an amount which will increase release of a cytokine and/or a chemokine by at least about 5 to about 100%, or at least about 30 to about 100%, 40 to about 100%, or at least about 50 to about 100%, or at least about 60 to about 100%, or at least about 70 to about 100%, or at least about 80 to about
100%, or at least about 90 to about 100%, or at least about 30 to about 70%, or at least about 40 to about 90%, or at least about 45 to about 80%, or at least about 55 to about 75%, or at least about 75 to about 98%, or at least about 55 to about 99%, or at least about 5% to about 20% or at least about 10% to about 25%. VI. h) Inhibiting Microorganism Growth or Killing Microorganisms
[0333] The compounds of the present invention and/or combinations of the invention exhibit potency against microorganisms, such as bacteria, and therefore have the potential to kill and/or inhibit the growth of microorganisms. Testing for the presence of a beta-lactamase in a bacteria can be accomplished using methods known to one of skill in the art. See, for example, Sturenburg et al., J. Antimic. Chemo.,
(2004) 54, 134-138 and Tan et al, Antimicrob. Agents Chemother., (2009) 53(1): 146- 149.
[0334] In a further aspect, the invention provides a method of killing and/or inhibiting the growth of a microorganism, said method comprising: contacting said microorganism with an effective amount of a compound of the invention, thereby killing and/or inhibiting the growth of the microorganism. In a further aspect, the invention provides a method of killing and/or inhibiting the growth of a microorganism, said method comprising: contacting said microorganism with an effective amount of a combination of the invention, thereby killing and/or inhibiting the growth of the microorganism. In an exemplary embodiment, the microorganism is a bacteria. In an exemplary embodiment, the compound is described herein, or a salt, prodrug, hydrate or solvate thereof, or a combination thereof. In an exemplary embodiment, the invention provides a compound described herein, or a salt, hydrate or solvate thereof. In an exemplary embodiment, the invention provides a compound described herein, or a prodrug thereof. In an exemplary embodiment, the invention provides a compound described herein, or a salt thereof. In another exemplary embodiment, the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof. In another exemplary embodiment, the
compound is described by a formula listed herein, or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound is part of a combination described herein. In an exemplary embodiment, the compound is part of a pharmaceutical formulation described herein. In another exemplary embodiment, the contacting occurs under conditions which permit entry of the compound into the organism. Such conditions are known to one skilled in the art and are described herein.
[0335] In another aspect, the microorganism is inside, or on the surface of an animal. In an exemplary embodiment, the animal is a member selected from human, cattle, deer, reindeer, goat, honey bee, pig, sheep, horse, cow, bull, dog, guinea pig, gerbil, rabbit, cat, camel, yak, elephant, ostrich, otter, chicken, duck, goose, guinea fowl, pigeon, swan, and turkey. In another exemplary embodiment, the animal is a human.
[0336] In an exemplary embodiment, the microorganism is killed or its growth is inhibited through oral administration of the compound of the invention and/or the combination of the invention. In an exemplary embodiment, the microorganism is killed or its growth is inhibited through intravenous administration of the compound of the invention and/or the combination of the invention.
[0337] In an exemplary embodiment, the microorganism is a bacterium. In an exemplary embodiment, the bacterium is a gram-positive bacteria. In another exemplary embodiment, the gram-positive bacterium is a member selected from Staphylococcus species, Streptococcus species, Bacillus species, Mycobacterium species, Cory neb acterium species (Propionibacterium species), Clostridium species, Actinomyces species, Enterococcus species and Streptomyces species. In another exemplary embodiment, the gram-positive bacterium is a member selected from Propionibacterium acnes; Staphylococcus aureus; Staphylococcus epidermidis, Staphylococcus saprophyticus; Staphylococcus haemolyticus; Streptococcus pyogenes; Streptococcus agalactiae; Streptococcus pneumoniae; Enterococcus faecalis; Enterococcus faecium; Bacillus anthracis; Mycobacterium avium- intracellulars, Mycobacterium tuberculosis, Acinetobacter baumanii;
Coryneb acterium diphtheria; Clostridium perfringens; Clostridium botulinum; Clostridium tetani; Clostridium difficile. In another exemplary embodiment, the
gram-positive bacterium is a member selected from Staphylococcus aureus, Staphylococcus epidermidis, Streptococcus pneumoniae, Streptococcus pyogenes, Enterococcus faecalis, Enterococcus faecium, Clostridium difficile and Propionibacter acnes. In another exemplary embodiment, the bacterium is a gram- negative bacterium. In another exemplary embodiment, the gram-negative bacterium is a member selected from Acinetobacter species, Neisseria species, Pseudomonas species, Brucella species, Agrobacterium species, Bordetella species, Escherichia species, Shigella species, Yersinia species, Salmonella species, Klebsiella species, Enterobacter species, Haemophilus species, Pasteurella species, Streptobacillus species, spirochetal species, Campylobacter species, Vibrio species, Helicobacter species, Bacteroides species, Citrobacter species, Proteus species, Providencia species, Serratia species, Stenotrophomonas species and Burkholderia species. In another exemplary embodiment, the gram-negative bacterium is a member selected from Acinetobacter species, Pseudomonas species, Escherichia species, Klebsiella species, Enterobacter species, Bacteroides species, Citrobacter species, Proteus species, Providencia species, Serratia species, Stenotrophomonas species and Burkholderia species. In another exemplary embodiment, the gram-negative bacterium is a member selected from Neisseria gonorrhoeae; Neisseria meningitidis; Pseudomonas aeruginosa; Legionella pneumophila; Escherichia coli; Yersinia pestis; Haemophilus influenzae; Helicobacter pylori; Campylobacter fetus; Campylobacter jejuni; Vibrio cholerae; Vibrio parahemolyticus; Trepomena pallidum; Actinomyces israelii; Rickettsia prowazekii; Rickettsia rickettsii; Chlamydia trachomatis; Chlamydia psittaci; Brucella abortus; Agrobacterium tumefaciens; Francisella tularensis, Klebsiella pneumoniae, Enterobacter cloacae, Acinetobacter baumannii, Bacteroides fragilis, Citrobacter freundii, Proteus mirabilis, Providencia stuartii, Serratia marcescens, Stenotrophomonas maltophilia and Burkholderia cepacia. In another exemplary embodiment, the gram-negative bacterium is a member selected from Pseudomonas aeruginosa; Escherichia coli; Haemophilus influenzae, Klebsiella pneumoniae, Enterobacter cloacae, Acinetobacter baumannii, Bacteroides fragilis, Citrobacter freundii, Proteus mirabilis, Providencia stuartii, Serratia marcescens, Stenotrophomonas maltophilia and Burkholderia cepacia. In another exemplary embodiment, the gram-negative bacterium is a member selected from Enterobacter aerogenes; Enterobacter cloacae; Enterobacter sakazakii; Escherichia coli; Klebsiella pneumoniae; Proteus mirabilis; Serratia marcescens and Citrobacter
freundii. In another exemplary embodiment, the gram-negative bacterium is a Providencia spp.. In another exemplary embodiment, the gram-negative bacterium is an Enterobacter spp..
[0338] In another exemplary embodiment, the bacterium is a Pseudomonas species. In another exemplary embodiment, the bacterium is Pseudomonas aeruginosa. In another exemplary embodiment, the bacterium is a member selected from Pseudomonas aeruginosa; Acinetobacter baumannii, Stenotrophomonas maltophilia and Burkholderia cepacia. In another exemplary embodiment, the bacterium is Acinetobacter baumannii. In another exemplary embodiment, the bacterium is Stenotrophomonas maltophilia. In another exemplary embodiment, the bacterium is Burkholderia cepacia. In another exemplary embodiment, the bacterium is Acinetobacter species. In another exemplary embodiment, the bacterium is Acinetobacter anitratus. In another exemplary embodiment, the bacterium is a member selected from Enterobacter aerogenes, Enterobacter cloacae, Enterobacter sakazakii, E. coli, K. pneumoniae, P. mirabilis, Serratia marcescens, Citrobacter freundii and Providencia spp. In another exemplary embodiment, the bacterium is a member selected from Enterobacter aerogenes, Enterobacter cloacae, Enterobacter sakazakii, E. coli, K. pneumoniae, P. mirabilis, Serratia marcescens, Citrobacter freundii, Providencia spp., S. aureus, S. pneumonia, S. pyogenes, E. faecalis, and E. faecium. In another exemplary embodiment, the bacterium is a member selected from Pseudomonas aeruginosa; Acinetobacter baumannii; Stenotrophomonas maltophilia; Burkholderia cepacia. In another exemplary embodiment, the bacterium is a member selected from S. aureus, S. pneumonia, S. pyogenes, E. faecalis, and E. faecium. In another exemplary embodiment, the bacterium is a member selected from Viridans group Strep.. In another exemplary embodiment, the bacterium is a member selected from Strep, mitis, Strep, mutans, Strep, oralis, Strep, sanguis, Strep, sobrinus and Strep, millari. In another exemplary embodiment, the bacterium is S. pneumonia. In another exemplary embodiment, the bacterium is H. influenzae. In another exemplary embodiment, the bacterium is S. aureus. In another exemplary embodiment, the bacterium is M. catarrhalis. In another exemplary embodiment, the bacterium is M. pneumoniae. In another exemplary embodiment, the bacterium is L. pneumoniae. In another exemplary embodiment, the bacterium is C. pneumoniae. In another exemplary embodiment, the bacterium is S. pyogenes. In another exemplary
embodiment, the bacterium is an anaerobe. In another exemplary embodiment, the bacterium is an Alcaligenes species. In another exemplary embodiment, the bacterium is a B. cepacia. In another exemplary embodiment, the bacterium is a member selected from Enterobacter cloacae, Escherichia coli; Klebsiella pneumoniae, Proteus mirabilis, Providencia stuartii, Serratia marcescens, and
Citrobacter freundii. In another exemplary embodiment, the bacterium is resistant to methicillin. In another exemplary embodiment, the bacterium is methicillin-resistant staphylococcus aureus. In another exemplary embodiment, the bacterium is a member selected from Streptococcus pneumoniae; Haemophilus influenzae; Staphylococcus aureus; Mycobacterium catarrhalis; Mycobacterium pneumoniae; Legionella pneumophila and Chlamydia pneumoniae. In another exemplary embodiment, the bacterium is a member selected from Enterobacter cloacae, Escherichia coli; Klebsiella pneumoniae, Proteus mirabilis, Serratia marcescens, Citrobacter freundii, Providencia stuartii, Pseudomonas aeruginosa; Acinetobacter baumannii, Stenotrophomonas maltophilia, Burkholderia cepacia, Staphylococcus aureus; Streptococcus pneumoniae; Streptococcus pyogenes; Enterococcus faecalis; and Enterococcus faecium. In another exemplary embodiment, the bacterium is a member selected from Staphylococcus aureus; Staphylococcus epidermidis, Staphylococcus haemolyticus; Streptococcus pyogenes; Streptococcus agalactiae and Streptococcus pneumoniae .
[0339] In an exemplary embodiment, the microorganism is a bacterium, which is a member selected from acid-fast bacteria, including Mycobacterium species; bacilli, including Bacillus species, Corynebacterium species (also Propionibacterium) and Clostridium species; filamentous bacteria, including Actinomyces species and Streptomyces species; bacilli, such as Pseudomonas species, Brucella species,
Agrobacterium species, Bordetella species, Escherichia species, Shigella species, Yersinia species, Salmonella species, Klebsiella species, Enterobacter species, Haemophilus species, Pasteurella species, and Streptobacillus species; spirochetal species, Campylobacter species, Vibrio species; and intracellular bacteria including Rickettsiae species and Chlamydia species.
VI. i) Microorganism Infection
[0340] The compounds of the present invention and/or combinations of the invention exhibit potency against microorganisms, such as bacteria, and therefore
have the potential to be used to treat and/or prevent a microorganism infection, such as a bacterial infection.
[0341] In a further aspect, the invention provides a method of treating a bacterial infection comprising administering to an animal suffering from the infection an effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof, thereby treating the bacterial infection. In an exemplary embodiment, the invention provides a method of treating a bacterial infection comprising administering to an animal suffering from the infection an effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof, and an effective amount of an antibiotic, or a pharmaceutically acceptable salt thereof, thereby treating the bacterial infection.
[0342] In a further aspect, the invention provides a method of preventing a bacterial infection comprising administering to an animal a prophylactic amount of a compound of the invention, or a pharmaceutically acceptable salt thereof, thereby treating the bacterial infection. In an exemplary embodiment, the invention provides a method of preventing a bacterial infection comprising administering to an animal a prophylactic amount of a compound of the invention, or a pharmaceutically acceptable salt thereof, and an effective amount of an antibiotic, or a pharmaceutically acceptable salt thereof, thereby treating the bacterial infection. [0343] In an exemplary embodiment, the compound used in the method is described herein, or a salt, prodrug, hydrate or solvate thereof, or a combination thereof. In an exemplary embodiment, the compound used in the method is described herein, or a salt, hydrate or solvate thereof. In an exemplary embodiment, compound used in the method is described herein, or a prodrug thereof. In an exemplary embodiment, the compound used in the method is described herein, or a salt thereof. In another exemplary embodiment, the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof. In another exemplary embodiment, the compound is described by a formula listed herein, or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound is part of a combination described herein. In an exemplary embodiment, the compound is part of a pharmaceutical formulation described herein. In another exemplary embodiment, the administering occurs under conditions which permit entry
of the compound into the animal, and subsequently into the bacteria. Such conditions are known to one skilled in the art and specific conditions are set forth herein.
[0344] In another aspect, the microorganism is inside, or on the surface of an animal. In an exemplary embodiment, the animal is a member selected from human, cattle, deer, reindeer, goat, honey bee, pig, sheep, horse, cow, bull, dog, guinea pig, gerbil, rabbit, cat, camel, yak, elephant, ostrich, otter, chicken, duck, goose, guinea fowl, pigeon, swan, and turkey. In another exemplary embodiment, the animal is a human.
[0345] In an exemplary embodiment, the bacterial infection is treated and/or prevented through oral administration of the compound of the invention and/or the combination of the invention. In an exemplary embodiment, the bacterial infection is treated and/or prevented through intravenous administration of the compound of the invention and/or the combination of the invention. In an exemplary embodiment, the bacterial infection is treated and/or prevented through topical administration of the compound of the invention and/or the combination of the invention.
[0346] In an exemplary embodiment, the bacterial infection is caused by and/or associated with a gram-positive bacteria. In another exemplary embodiment, the gram-positive bacterium is a member selected from Staphylococcus species, Streptococcus species, Bacillus species, Mycobacterium species, Corynebacterium species (Propionibacterium species), Clostridium species, Actinomyces species,
Enterococcus species and Streptomyces species. In another exemplary embodiment, the gram-positive bacterium is a member selected from Propionibacterium acnes; Staphylococcus aureus; Staphylococcus epidermidis, Staphylococcus saprophyticus; Staphylococcus haemolyticus; Streptococcus pyogenes; Streptococcus agalactiae; Streptococcus pneumoniae; Enterococcus faecalis; Enterococcus faecium; Bacillus anthracis; Mycobacterium avium-intracellulare; Mycobacterium tuberculosis, Acinetobacter baumanii; Corynebacterium diphtheria; Clostridium perfringens; Clostridium botulinum; Clostridium tetani; Clostridium difficile. In another exemplary embodiment, the gram-positive bacterium is a member selected from Staphylococcus aureus, Staphylococcus epidermidis, Streptococcus pneumoniae,
Streptococcus pyogenes, Enterococcus faecalis, Enterococcus faecium, Clostridium difficile and Propionibacter acnes.
[0347] In an exemplary embodiment, the bacterial infection is caused by and/or associated with a gram-negative bacterium. In another exemplary embodiment, the gram-negative bacterium is a member selected from Acinetobacter species, Neisseria species, Pseudomonas species, Brucella species, Agrobacterium species, Bordetella species, Escherichia species, Shigella species, Yersinia species, Salmonella species, Klebsiella species, Enterobacter species, Haemophilus species, Pasteurella species, Streptobacillus species, spirochetal species, Campylobacter species, Vibrio species, Helicobacter species, Bacteroides species, Citrobacter species, Proteus species, Providencia species, Serratia species, Stenotrophomonas species and Burkholderia species. In another exemplary embodiment, the gram-negative bacterium is a member selected from Acinetobacter species, Pseudomonas species, Escherichia species, Klebsiella species, Enterobacter species, Bacteroides species, Citrobacter species, Proteus species, Providencia species, Serratia species, Stenotrophomonas species and Burkholderia species. In another exemplary embodiment, the gram-negative bacterium is a member selected from Neisseria gonorrhoeae; Neisseria meningitidis; Pseudomonas aeruginosa; Legionella pneumophila; Escherichia coli; Yersinia pestis; Haemophilus influenzae; Helicobacter pylori; Campylobacter fetus; Campylobacter jejuni; Vibrio cholerae; Vibrio parahemolyticus; Trepomena pallidum; Actinomyces israelii; Rickettsia prowazekii; Rickettsia rickettsii; Chlamydia trachomatis; Chlamydia psittaci; Brucella abortus; Agrobacterium tumefaciens; Francisella tularensis, Klebsiella pneumoniae, Enterobacter cloacae, Acinetobacter baumannii, Bacteroides fragilis, Citrobacter freundii, Proteus mirabilis, Providencia stuartii, Serratia marcescens, Stenotrophomonas maltophilia and Burkholderia cepacia. In another exemplary embodiment, the gram-negative bacterium is a member selected from Pseudomonas aeruginosa; Escherichia coli; Haemophilus influenzae, Klebsiella pneumoniae, Enterobacter cloacae, Acinetobacter baumannii, Bacteroides fragilis, Citrobacter freundii, Proteus mirabilis, Providencia stuartii, Serratia marcescens, Stenotrophomonas maltophilia and Burkholderia cepacia. In another exemplary embodiment, the gram-negative bacterium is a member selected from Enterobacter aerogenes; Enterobacter cloacae; Enterobacter sakazakii; Escherichia coli;
Klebsiella pneumoniae; Proteus mirabilis; Serratia marcescens and Citrobacter freundii. In another exemplary embodiment, the gram-negative bacterium is a Providencia spp.. In another exemplary embodiment, the gram-negative bacterium is an Enterobacter spp..
[0348] In another exemplary embodiment, the bacterial infection is caused by and/or associated with a Pseudomonas species. In another exemplary embodiment, the bacterial infection is caused by and/or associated with Pseudomonas aeruginosa. In another exemplary embodiment, the bacterial infection is caused by and/or associated with a member selected from Pseudomonas aeruginosa; Acinetobacter baumannii, Stenotrophomonas maltophilia and Burkholderia cepacia. In another exemplary embodiment, the bacterial infection is caused by and/or associated with Acinetobacter baumannii. In another exemplary embodiment, the bacterial infection is caused by and/or associated with Stenotrophomonas maltophilia. In another exemplary embodiment, the bacterial infection is caused by and/or associated with Burkholderia cepacia. In another exemplary embodiment, the bacterial infection is caused by and/or associated with Acinetobacter species. In another exemplary embodiment, the bacterial infection is caused by and/or associated with Acinetobacter anitratus. In another exemplary embodiment, the bacterial infection is caused by and/or associated with a member selected from Enterobacter aerogenes, Enterobacter cloacae, Enterobacter sakazakii, E. coli, K. pneumoniae, P. mirabilis, Serratia marcescens, Citrobacter freundii and Providencia spp. In another exemplary embodiment, the bacterial infection is caused by and/or associated with a member selected from Enterobacter aerogenes, Enterobacter cloacae, Enterobacter sakazakii, E. coli, K. pneumoniae, P. mirabilis, Serratia marcescens, Citrobacter freundii,
Providencia spp., S. aureus, S. pneumonia, S. pyogenes, E.faecalis, and E. faecium. In another exemplary embodiment, the bacterial infection is caused by and/or associated with a member selected from Pseudomonas aeruginosa; Acinetobacter baumannii; Stenotrophomonas maltophilia; Burkholderia cepacia. In another exemplary embodiment, the bacterial infection is caused by and/or associated with a member selected from S. aureus, S. pneumonia, S. pyogenes, E. faecalis, and E. faecium. In another exemplary embodiment, the bacterial infection is caused by and/or associated with Viridans group Strep.. In another exemplary embodiment, the bacterial infection is caused by and/or associated with a member selected from Strep. mitis, Strep, mutans, Strep, oralis, Strep, sanguis, Strep, sobrinus and Strep, millari. In another exemplary embodiment, the bacterial infection is caused by and/or associated with S. pneumonia. In another exemplary embodiment, the bacterial infection is caused by and/or associated with H. influenzae. In another exemplary embodiment, the bacterial infection is caused by and/or associated with S. aureus. In
another exemplary embodiment, the bacterial infection is caused by and/or associated with M. catarrhalis. In another exemplary embodiment, the bacterial infection is caused by and/or associated with M. pneumoniae. In another exemplary embodiment, the bacterial infection is caused by and/or associated with L. pneumoniae. In another exemplary embodiment, the bacterial infection is caused by and/or associated with C. pneumoniae. In another exemplary embodiment, the bacterial infection is caused by and/or associated with S. pyogenes. In another exemplary embodiment, the bacterial infection is caused by and/or associated with an anaerobe. In another exemplary embodiment, the bacterial infection is caused by and/or associated with A lcaligenes species. In another exemplary embodiment, the bacterial infection is caused by and/or associated with B. cepacia. In another exemplary embodiment, the bacterial infection is caused by and/or associated with a member selected from Enterobacter cloacae, Escherichia coli; Klebsiella pneumoniae, Proteus mirabilis, Providencia stuartii, Serratia marcescens, and Citrobacter freundii. In another exemplary embodiment, the bacterial infection is caused by and/or associated with a bacteria which is resistant to methicillin. In another exemplary embodiment, the bacterial infection is caused by and/or associated with methicillin-resistant staphylococcus aureus. In another exemplary embodiment, the bacterial infection is caused by and/or associated with a member selected from Streptococcus pneumoniae; Haemophilus influenzae; Staphylococcus aureus; Mycobacterium catarrhalis; Mycobacterium pneumoniae; Legionella pneumophila and Chlamydia pneumoniae. In another exemplary embodiment, the bacterial infection is caused by and/or associated with a member selected from Enterobacter cloacae, Escherichia coli; Klebsiella pneumoniae, Proteus mirabilis, Serratia marcescens, Citrobacter freundii, Providencia stuartii, Pseudomonas aeruginosa; Acinetobacter baumannii, Stenotrophomonas maltophilia, Burkholderia cepacia, Staphylococcus aureus; Streptococcus pneumoniae; Streptococcus pyogenes; Enterococcus faecalis; and Enterococcus faecium. In another exemplary embodiment, the bacterial infection is caused by and/or associated with a member selected from Staphylococcus aureus; Staphylococcus epidermidis, Staphylococcus haemolyticus; Streptococcus pyogenes; Streptococcus agalactiae and Streptococcus pneumoniae.
[0349] In an exemplary embodiment, the bacterial infection is caused by and/or associated with a member selected from acid- fast bacteria, including Mycobacterium
species; bacilli, including Bacillus species, Corynebacterium species (also Propionibacterium) and Clostridium species; filamentous bacteria, including Actinomyces species and Streptomyces species; bacilli, such as Pseudomonas species, Brucella species, Agrobacterium species, Bordetella species, Escherichia species, Shigella species, Yersinia species, Salmonella species, Klebsiella species,
Enterobacter species, Haemophilus species, Pasteurella species, and Streptobacillus species; spirochetal species, Campylobacter species, Vibrio species; and intracellular bacteria including Rickettsiae species and Chlamydia species.
VI. j) Diseases [0350] The compounds of the invention and/or combinations of the present invention exhibit potency against microorganisms, such as bacteria, and therefore have the potential to achieve therapeutic efficacy in the animals described herein.
[0351] In another aspect, the invention provides a method of treating and/or preventing a disease. In an exemplary embodiment, the method includes administering to the animal a therapeutically effective amount of a compound of the invention, sufficient to treat and/or prevent the disease. In an exemplary embodiment, the method includes administering to the animal a therapeutically effective amount of a combination of the invention, sufficient to treat and/or prevent the disease. In an exemplary embodiment, the compound of the invention or the combination of the invention can be used in human or veterinary medical therapy, particularly in the treatment or prophylaxis of bacterial-associated disease. In an exemplary embodiment, the compound is described herein, or a salt, prodrug, hydrate or solvate thereof, or a combination thereof. In an exemplary embodiment, the invention provides a compound described herein, or a prodrug thereof. In an exemplary embodiment, the invention provides a compound described herein, or a salt, hydrate or solvate thereof. In an exemplary embodiment, the invention provides a compound described herein, or a salt thereof. In another exemplary embodiment, the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound is a compound described herein, or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound is according to a formula described herein, or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound is part of a combination described herein. In an exemplary embodiment, the compound is part of
a pharmaceutical formulation described herein. In another exemplary embodiment, the animal is a member selected from human, cattle, deer, reindeer, goat, honey bee, pig, sheep, horse, cow, bull, dog, guinea pig, gerbil, rabbit, cat, camel, yak, elephant, ostrich, otter, chicken, duck, goose, guinea fowl, pigeon, swan, and turkey. In another exemplary embodiment, the animal is a human. In another exemplary embodiment, the animal is a member selected from a human, cattle, goat, pig, sheep, horse, cow, bull, dog, guinea pig, gerbil, rabbit, cat, chicken and turkey. In another exemplary embodiment, the disease is a member selected from a systemic disease. In another exemplary embodiment, the disease is a topical disease. [0352] In an exemplary embodiment, the disease is treated through oral administration of a compound of the invention and/or a combination of the invention. In an exemplary embodiment, the disease is treated through intravenous administration of a compound of the invention and/or a combination of the invention.
Systemic Diseases [0353] In another aspect, the invention provides a method of treating a systemic disease. The method involves contacting an animal with a compound of the invention and/or a combination of the invention.
[0354] In an exemplary embodiment, the disease is a member selected from candidiasis, aspergillosis, coccidioidomycosis, cryptococcosis, histoplasmosis, blastomycosis, paracoccidioidomycosis, zygomycosis, phaeohyphomycosis and rhinosporidiosis.
[0355] In another exemplary embodiment, the disease is associated with infection by a Gram-positive bacteria. In an exemplary embodiment, the disease is associated with a Staphylococcus species. In another exemplary embodiment, the disease is a member selected from pneumonia, gastroenteritis, toxic shock syndrome, community acquired pneumonia (CAP), meningitis, septic arthritis, urinary tract infection, bacteremia, endocarditis, osteomylitis, skin and skin-structure infection. In an exemplary embodiment, the disease is associated with a Streptococcus species. In another exemplary embodiment, the disease is a member selected from strep throat, skin infections, necrotizing fasciitis, toxic shock syndrome, pneumonia, otitis media and sinusitis. In an exemplary embodiment, the disease is associated with an Actinomyces species. In another exemplary embodiment, the disease is
actinomycosis. In an exemplary embodiment, the disease is associated with a Norcardia species. In another exemplary embodiment, the disease is pneumonia. In an exemplary embodiment, the disease is associated with a Corynebacterium species. In another exemplary embodiment, the disease is diptheria. In an exemplary embodiment, the disease is associated with a Listeria species. In another exemplary embodiment, the disease is meningitis. In an exemplary embodiment, the disease is associated with a Bacillus species. In another exemplary embodiment, the disease is a member selected from anthrax and food poisoning. In an exemplary embodiment, the disease is associated with a Clostridium species. In another exemplary embodiment, the disease is a member selected from botulism, tetanus, gas gangrene and diarrhea. In an exemplary embodiment, the disease is associated with a Mycobacterium species. In another exemplary embodiment, the disease is a member selected from tuberculosis and leprosy.
[0356] In another exemplary embodiment, the disease is associated with infection by a Gram-negative bacteria. In an exemplary embodiment, the disease is associated with a Neisseria species. In another exemplary embodiment, the disease is a member selected from meningitis, gonorrhea, otitis externa and folliculitis. In an exemplary embodiment, the disease is associated with an Escherichia species. In another exemplary embodiment, the disease is a member selected from diarrhea, urinary tract infections, meningitis, sepsis and HAP. In an exemplary embodiment, the disease is associated with a Shigella species. In another exemplary embodiment, the disease is a member selected from diarrhea, bacteremia, endocarditis, meningitis and gastroenteritis. In an exemplary embodiment, the disease is associated with a Salmonella species. In another exemplary embodiment, the disease is a member selected from Typhoid fever, supsis, gastroenteritis, endocarditis, sinusitis and meningitis. In an exemplary embodiment, the disease is associated with a Yersinia species. In another exemplary embodiment, the disease is a member selected from Typhoid fever, bubonic plague, enteric fever and gastroenteritis. In an exemplary embodiment, the disease is associated with a Klebsiella species. In another exemplary embodiment, the disease is a member selected from sepsis and urinary tract infection. In an exemplary embodiment, the disease is associated with a Proteus species. In another exemplary embodiment, the disease is an urinary tract infection. In an exemplary embodiment, the disease is associated with an Enterobacter species. In
another exemplary embodiment, the disease is a hospital-acquired infection. In an exemplary embodiment, the disease is associated with a Serratia species. In another exemplary embodiment, the disease is a member selected from a urinary tract infection, skin and skin-structure infection and pneumonia. In an exemplary embodiment, the disease is associated with a Vibrio species. In another exemplary embodiment, the disease is a member selected from cholera and gastroenteritis. In an exemplary embodiment, the disease is associated with a Campylobacter species. In another exemplary embodiment, the disease is gastroenteritis. In an exemplary embodiment, the disease is associated with a Helicobacter species. In another exemplary embodiment, the disease is chronic gastritis. In an exemplary embodiment, the disease is associated with a Pseudomonas species. In another exemplary embodiment, the disease is a member selected from pneumonia, osteomylitis, burn-wound infections, sepsis, UTIs, endocarditis, otitis, corneal infections. In an exemplary embodiment, the disease is associated with a Bacteroides species. In another exemplary embodiment, the disease is a member selected from periodontal disease and aspriation pneumonia. In an exemplary embodiment, the disease is associated with a Haemophilus species. In another exemplary embodiment, the disease is a member selected from meningitis, epiglottitis, septic arthritis, sepsis, chancroid and vaginitis. In an exemplary embodiment, the disease is associated with a Bordetella species. In another exemplary embodiment, the disease is Whooping cough. In an exemplary embodiment, the disease is associated with a Legionella species. In another exemplary embodiment, the disease is a member selected from pneumonia and pontiac fever. In an exemplary embodiment, the disease is associated with a Francis ella species. In another exemplary embodiment, the disease is tularemia. In an exemplary embodiment, the disease is associated with a Brucella species. In another exemplary embodiment, the disease is brucellosis. In an exemplary embodiment, the disease is associated with a Pasteur ella species. In another exemplary embodiment, the disease is a skin infection. In an exemplary embodiment, the disease is associated with a Gardner ella species. In another exemplary embodiment, the disease is vaginitis. In an exemplary embodiment, the disease is associated with a Spirochetes species. In another exemplary embodiment, the disease is syphilis and Lyme disease. In an exemplary embodiment, the disease is associated with a Chlamydia species. In another exemplary embodiment, the disease is chlamydia. In an exemplary embodiment, the disease is associated with a
Rickettsiae species. In another exemplary embodiment, the disease is a member selected from Rocky Mountain spotted fever and typhus.
[0357] In an exemplary embodiment, the disease is associated with Mycoplasma pneumoniae. In another exemplary embodiment, the disease is a member selected from tracheobronchitis and walking pneumonia. In an exemplary embodiment, the disease is associated with Ureaplasma urealyticum. In another exemplary embodiment, the disease is urethritis. In another exemplary embodiment, the disease is pyelonephritis. In another exemplary embodiment, the disease is an intraabdominal infection. In another exemplary embodiment, the disease is febrile neutropenia. In another exemplary embodiment, the disease is a pelvic infection. In another exemplary embodiment, the disease is bacteraemia. In another exemplary embodiment, the disease is septicaemia.
[0358] In an exemplary embodiment, the disease is an acute exacerbation of chronic obstructive pulmonary disease. In an exemplary embodiment, the disease is chronic obstructive pulmonary disease. In an exemplary embodiment, the disease is pharyngitis. In an exemplary embodiment, the disease is tonsillitis. In an exemplary embodiment, the disease is Acute Exacerbation of Chronic Bronchitis (AECB). In an exemplary embodiment, the disease is cervicitis. In an exemplary embodiment, the disease is genital ulcer disease. VI. k) Conditions and Effects
[0359] In another aspect, the invention provides a method of treating and/or preventing a condition, or enhancing an effect, in an animal, the method comprising administering to the animal an amount of a compound of the invention, thereby treating or preventing the condition. In an exemplary embodiment, the amount is a therapeutically effective amount. In an exemplary embodiment, the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound of the invention a compound described in a formula provided herein. In an exemplary embodiment, the compound of the invention is a compound described herein. [0360] In an exemplary embodiment, the condition is a disease. In an exemplary embodiment, the condition is an inflammatory-related condition. In an exemplary embodiment, the condition involves the increase of production of a cytokine and/or a
chemokine. In an exemplary embodiment, the condition involves the decrease of production of a cytokine and/or a chemokine. In an exemplary embodiment, the condition involves the increase of release of a cytokine and/or a chemokine. In an exemplary embodiment, the condition involves the decrease of release of a cytokine and/or a chemokine. In an exemplary embodiment, the condition involves the inhibition of a phosphodiesterase. In an exemplary embodiment, the compound is in an amount sufficient to treat the inflammatory-related disease by inhibiting proinflammatory cytokine expression or by stimulating anti-inflammatory cytokine expression, but the amount is less than sufficient to substantially inhibit cyclin dependent kinases. In an exemplary embodiment, the condition is mediated by a cytokine. In an exemplary embodiment, the condition is mediated by a chemokine. In an exemplary embodiment, the condition is mediated by a neutrophil. In an exemplary embodiment, the condition is mediated by a phosphodiesterase. In an exemplary embodiment, the condition is mediated by a phosphodiesterase^ In an exemplary embodiment, the condition is mediated by a phosphodiesterase?.
[0361] In an exemplary embodiment, the condition is a member selected from periodontitis, dry eye disease, rheumatoid arthritis, osteoarthritis, Crohn's disease, ulcerative colitis, psoriatic arthritis, traumatic arthritis, rubella arthritis, inflammatory bowel disease, multiple sclerosis, psoriasis, graft versus host disease, systemic lupus erythematosus, toxic shock syndrome, irritable bowel syndrome, muscle degeneration, allograft rejections, pancreatitis, insulinitis, glomerulonephritis, diabetic nephropathy, renal fibrosis, chronic renal failure, gout, leprosy, acute synovitis, Reiter's syndrome, gouty arthritis, Behcet's disease, spondylitis, endometriosis, non-articular inflammatory conditions, such as intervertebral disk syndrome conditions, bursitis, tendonitis, tenosynovitis or fϊbromyalgic syndrome; and acute or chronic pain, including but not limited to neurological pain, neuropathies, polyneuropathies, diabetes-related polyneuropathies, trauma, migraine, tension and cluster headache, Horton's disease, varicose ulcers, neuralgias, musculo-skeletal pain, osteo-traumatic pain, fractures, algodystrophy, spondylarthritis, fibromyalgia, phantom limb pain, back pain, vertebral pain, post-surgery pain, herniated intervertebral disc-induced sciatica, cancer-related pain, vascular pain, visceral pain, childbirth, or HIV-related pain. Other cytokine mediated diseases are allergy, a metabolic disease, a chemotherapy/radiation related complication; diabetes type I; diabetes type II; a liver
disease; a gastrointestinal disorder; an ophthamological disease; allergic conjunctivitis; diabetic retinopathy; Sjogren's syndrome; uveitis; a pulmonary disorder, a renal disease; dermatitis; HIV-related cachexia; cerebral malaria; ankylosing spondolytis; leprosy; anemia; fibromyalgia, kidney failure, stroke, chronic heart failure, endotoxemia, reperfusion injury, ischemia reperfusion, myocardial ischemia, restenosis, thrombosis, angiogenesis, Coronary Heart Disease, Coronary Artery Disease, acute coronary syndrome, Takayasu arteritis, cardiac failure such as heart failure, aortic valve stenosis, cardiomyopathy, myocarditis, vasculitis, vascular restenosis, valvular disease or coronary artery bypass; hypercholesteremia, diseases or conditions related to blood coagulation or fibrinolysis, such as for example, acute venous thrombosis, pulmonary embolism, thrombosis during pregnancy, hemorrhagic skin necrosis, acute or chronic disseminated intravascular coagulation (DIC), clot formation from surgery, long bed rest or long periods of immobilization, venous thrombosis, fulminant meningococcemia, acute thrombotic strokes, acute coronary occlusion, acute peripheral arterial occlusion, massive pulmonary embolism, axillary vein thrombosis, massive iliofemoral vein thrombosis, occluded arterial or venous cannulae, cardiomyopathy, venoocclusive disease of the liver, hypotension, decreased cardiac output, decreased vascular resistance, pulmonary hypertension, diminished lung compliance, leukopenia or thrombocytopenia; or atherosclerosis. [0362] In an exemplary embodiment, the condition is a member selected from allergic conjunctivitis, uveitis, glaucoma, optic neuritis, retinal ischemia, diabetic retinopathy, laser induced optic damage, or surgery or trauma-induced proliferative vitreoretinopathy.
[0363] In an exemplary embodiment, the condition is a member selected from allergic rhinitis, asthma, adult respiratory distress syndrome, chronic pulmonary inflammation, chronic obstructive pulmonary disease, emphysema, bronchitis, mucus hypersecretion, silicosis, SARS infection and respiratory tract inflammation.
[0364] In an exemplary embodiment, the condition is a member selected from psoriasis, eczema, atopic dermatitis, contact dermatitis, or acne. [0365] In an exemplary embodiment, the condition is a member selected from Guillain-Barre syndrome, Parkinson's disease, Huntington's disease, Alzheimer's disease, amyotrophic lateral sclerosis, multiple sclerosis and other demyelinating
diseases, viral and bacterial meningitis, CNS trauma, spinal cord injury, seizures, convulsions, olivopontocerebellar atrophy, AIDS dementia complex, MERRF and MELAS syndromes, Leber's disease, Wernicke's encephalophathy, Rett syndrome, homocysteinuria, hyperprolinemia, hyperhomocysteinemia, nonketotic hyperglycinemia, hydroxybutyric aminoaciduria, sulfite oxidase deficiency, combined systems disease, lead encephalopathy, Tourett's syndrome, hepatic encephalopathy, drug addiction, drug tolerance, drug dependency, depression, anxiety and schizophrenia, aneurism, or epilepsy.
[0366] In an exemplary embodiment, the condition is a member selected from bone resorption diseases, osteopetrosis, osteoporosis, or osteoarthritis.
[0367] In an exemplary embodiment, the condition is a member selected from diabetes, systemic cachexia, cachexia secondary to infection or malignancy, cachexia secondary to acquired immune deficiency syndrome (AIDS), obesity, anorexia or bulimia nervosa. In an exemplary embodiment, the condition is a member selected from sepsis, HIV, HCV, malaria, infectious arthritis, leishmaniasis, Lyme disease, cancer, including but not limited to breast cancer, colon cancer, lung cancer, prostatic cancer, multiple myeloma, acute myelogenous leukemia, myelodysplastic syndrome, non-Hodgkins lymphoma, or follicular lymphoma, Castleman's disease, or drug resistance. [0368] In an exemplary embodiment, the condition is a member selected from is bronchial asthma, rhinitis, influenza, stroke, myocardial infarction, thermal injury, adult respiratory distress syndrome (ARDS), multiple organ injury secondary to trauma, acute glomerulonephritis, dermatoses with acute inflammatory components, acute purulent meningitis, hemodialysis, leukopheresis, granulocyte transfusion associated syndromes, or necrotizing enterocolitis.
[0369] In an exemplary embodiment, the condition is a member selected from inflammatory bowel disease (IBD), psoriasis, rheumatoid arthritis (RA), multiple sclerosis (MS), neurodegenerative disorder, cardiovascular disease (CVD) and atherosclerosis, and metabolic disease (the metabolic syndrome and diabetes) as well as infection-related inflammation. In an exemplary embodiment, the condition is a neurodegenerative disorder which is a member selected from Alzheimer's disease and Parkinson disease. In an exemplary embodiment, the condition is inflammatory
bowel disease which is selected from the group consisting of: Crohn's disease or ulcerative colitis. In an exemplary embodiment, the condition is a gastrointestinal complication. In an exemplary embodiment, the condition is diarrhea. In an exemplary embodiment, the condition is a member selected from celiac disease and non-specific colitis. In an exemplary embodiment, the condition is a liver disease. In an exemplary embodiment, the condition is a member selected from an autoimmune hepatitis, hepatitis C, primary biliary cirrhosis, primary sclerosing cholangitis, or fulminant liver failure. In an exemplary embodiment, the condition is a bone disease. In an exemplary embodiment, the condition is osteoporosis. In an exemplary embodiment, the condition is a pulmonary disorder. In an exemplary embodiment, the condition is a member selected from: allergic rhinitis, asthma, chronic obstructive pulmonary disease, chronic granulomatous inflammation, cystic fibrosis, and sarcoidosis. In an exemplary embodiment, condition is cardiovascular disease. In an exemplary embodiment, the cardiovascular disease is a member selected from atheroscleotic cardiac disease, congestive heart failure and restenosis. In an exemplary embodiment, the condition is a renal disease. In an exemplary embodiment, the condition is a member selected from glomerulonephritis and vasculitis. In an exemplary embodiment, the condition is a member selected from post-radiotherapy related disease or atherosclerosis. In yet another embodiment the condition is atopic dermatitis. In yet another embodiment the condition is actinic keratosis.
[0370] In an exemplary embodiment, the PDE4 inhibition is treating and/or preventing a disorder, and the disorder is a member selected from psoriasis, inflammatory arthritis, rheumatoid arthritis, asthma, chronic bronchitis, inflammatory bowel disease (IBD), chronic obstructive pulmonary disease (COPD), atopic dermatitis, urticaria, allergic rhinitis, allergic conjunctivitis, vernal conjunctivitis, colitis, esoniophilic granuloma, septic shock, reperfusion injury of the myocardium, reperfusion injury of the brain, chronic glomerulonephritis, endotoxic shock, adult respiratory distress syndrome, cystic fibrosis, arterial restenosis, atherosclerosis, keratosis, rheumatoid spondylitis, osteoarthritis, pyresis, diabetes mellitus, pneumoconiosis, chronic obstructive airways disease, toxic contact eczema, allergic contact eczema, atopic eczema, seborrheic eczema, lichen simplex, sunburn, pruritus in the anogenital area, alopecia areata, hypertrophic scars, discoid lupus
erythematosus, systemic lupus erythematosus, follicular pyodermias, wide-area pyodermias, endogenous acne, exogenous acne, acne rosacea, Behcet's disease, anaphylactoid purpura nephritis, leukemia, multiple sclerosis, gastrointestinal disease and autoimmune disease. In an exemplary embodiment, the colitis is a member selected from ulcerative colitis, Crohn's colitis, diversion colitis, ischemic colitis, infectious colitis, fulminant colitis, chemical colitis, microscopic colitis, lymphocytic colitis, and atypical colitis. In an exemplary embodiment, the colitis is a member selected from ulcerative colitis and Crohn's colitis.
[0371] In an exemplary embodiment, the condition is psoriasis. In an exemplary embodiment, psoriasis is a member selected from plaque psoriasis, flexural psoriasis (inverse psoriasis), guttate psoriasis, pustular psoriasis, nail psoriasis, psoriatic arthritis and erythrodermic psoriasis. In an exemplary embodiment, the psoriasis is a member selected from plaque psoriasis and nail psoriasis.
[0372] In an exemplary embodiment, the disorder is a member selected from cognition impairment or decline and memory impairment. In an exemplary embodiment, the memory impairment is due to dementia. In an exemplary embodiment, the patient is suffering from memory impairment due to Alzheimer's disease, schizophrenia, Parkinson's disease, Huntington's disease, Pick's disease, Creutzfeld- Jakob disease, depression, aging, head trauma, stroke, CNS hypoxia, cerebral senility, multiinfarct dementia, an acute neuronal disease, age-related cognitive decline, HIV or a cardiovascular disease.
[0373] In an exemplary embodiment, the PDE4 inhibition is enhancing an effect, wherein the enhanced effect is cognition or memory.
[0374] In an exemplary embodiment, the invention provides a method for stimulating ovarian follicular growth in a female, comprising administering to a female a medicament comprising a compound described herein or a pharmaceutically acceptable salt thereof, whereby ovarian follicular growth is stimulated in the female. In an exemplary embodiment, the female is undergoing ovulation induction. In an exemplary embodiment, the female is undergoing controlled ovarian hyperstimulation. In an exemplary embodiment, the medicament is administered simultaneously, separately or sequentially with follicle stimulating hormone (FSH), or an agent having FSH activity, or an agent that stimulates endogenous FSH release.
[0375] The invention also provides a method of treating an inflammatory-related disease associated with cytokine expression levels, which comprises administering to an animal in need of such treatment the compound described herein or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound is according to a formula described herein.
[0376] In an exemplary embodiment, the invention provides a method of treating or preventing an inflammatory-related disease in an animal, the method comprising administering to the animal a therapeutically effective amount of a compound described herein or a pharmaceutically acceptable salt thereof, wherein the compound is in an amount sufficient to treat the inflammatory-related disease by inhibiting proinflammatory cytokine expression or by stimulating anti-inflammatory cytokine expression, but the amount is less than sufficient to substantially inhibit cyclin dependent kinases.
[0377] In an exemplary embodiment, the invention provides a method for inhibiting the production of an inflammatory cytokine by cells capable of producing the inflammatory cytokine, the method comprises contacting a cell with a therapeutic amount of the compound described herein or a pharmaceutically acceptable salt thereof, wherein production of the inflammatory cytokine by the cells is inhibited. In an exemplary embodiment, the therapeutic amount is sufficient to inhibit the production of the inflammatory cytokine protein between about 50% and about 99%.
[0378] In an exemplary embodiment, the invention provides a method for inhibiting an inflammatory response in an animal, the method comprising: contacting the animal with a therapeutic amount of the compound described herein or a pharmaceutically acceptable salt thereof, wherein the inflammatory response is inhibited.
[0379] In an exemplary embodiment, for any of the methods described herein, the animal is a member selected from human, cattle, deer, reindeer, goat, honey bee, pig, sheep, horse, cow, bull, dog, guinea pig, gerbil, rabbit, cat, camel, yak, elephant, ostrich, otter, chicken, duck, goose, guinea fowl, pigeon, swan, and turkey. In another exemplary embodiment, for any of the methods described herein, the animal is a member selected from a human, cattle, goat, pig, sheep, horse, cow, bull, dog, guinea
pig, gerbil, rabbit, cat, chicken and turkey. In another exemplary embodiment, for any of the methods described herein, the animal is a human.
[0380] In an exemplary embodiment, for any of the methods described herein, a compound of the invention, a combination of the invention, a compound described herein or a pharmaceutically acceptable salt thereof, or combination described herein, and/or a pharmaceutical formulation described herein can be used.
VII. Pharmaceutical Formulation
[0381] In another aspect, the invention provides a pharmaceutical formulation comprising: a) a compound of the invention; and b) a pharmaceutically acceptable excipient. In another aspect, the invention provides a pharmaceutical formulation comprising: a) a combination of the invention; and b) a pharmaceutically acceptable excipient. In an exemplary embodiment, the compound is according to a formula described herein. In an exemplary embodiment, the compound is according to an example described herein. In an exemplary embodiment, the compound of the invention or combination of the invention is a compound described herein or combination described herein, or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound of the invention is a compound described herein.
[0382] In an exemplary embodiment, the compound of the invention is present in the pharmaceutical formulation in an amount of between about 0.0001% to about 60% (w/w). In an exemplary embodiment, the amount is between about 0.01% to about 10% (w/w). In an exemplary embodiment, the amount is between about 0.1% to about 10% (w/w). In an exemplary embodiment, the amount is between about 0.25% to about 6% (w/w). In an exemplary embodiment, the amount is between about 0.5% to about 5% (w/w). In an exemplary embodiment, the amount is between about 0.1% and about 1.0% (w/w). In an exemplary embodiment, the amount is between about 1.0% and about 2.0% (w/w). In an exemplary embodiment, the amount is between about 2.0% and about 3.0% (w/w). In an exemplary embodiment, the amount is between about 3.0% and about 4.0% (w/w). In an exemplary embodiment, the amount is between about 4.0% and about 5.0% (w/w).
[0383] The pharmaceutical formulations of the invention can take a variety of forms adapted to the chosen route of administration. Those skilled in the art will
recognize various synthetic methodologies that may be employed to prepare non-toxic pharmaceutical formulations incorporating the compounds described herein. Those skilled in the art will recognize a wide variety of non-toxic pharmaceutically acceptable solvents that may be used to prepare solvates of the compounds of the invention, such as water, ethanol, propylene glycol, mineral oil, vegetable oil and dimethylsulfoxide (DMSO).
[0384] The compositions of the invention may be administered orally, topically, parenterally, by inhalation or spray or rectally in dosage unit formulations containing conventional non-toxic pharmaceutically acceptable carriers, adjuvants and vehicles. It is further understood that the best method of administration may be a combination of methods. Oral administration in the form of a pill, capsule, elixir, syrup, lozenge, troche, or the like is particularly preferred. The term parenteral as used herein includes subcutaneous injections, intradermal, intravascular (e.g., intravenous), intramuscular, spinal, intrathecal injection or like injection or infusion techniques. [0385] The pharmaceutical formulations containing compounds of the invention are preferably in a form suitable for oral use, for example, as tablets, troches, lozenges, aqueous or oily suspensions, dispersible powders or granules, emulsion, hard or soft capsules, or syrups or elixirs.
[0386] Compositions intended for oral use may be prepared according to any method known in the art for the manufacture of pharmaceutical formulations, and such compositions may contain one or more agents selected from the group consisting of sweetening agents, flavoring agents, coloring agents and preserving agents in order to provide pharmaceutically elegant and palatable preparations. Tablets may contain the active ingredient in admixture with non-toxic pharmaceutically acceptable excipients that are suitable for the manufacture of tablets. These excipients may be for example, inert diluents, such as calcium carbonate, sodium carbonate, lactose, calcium phosphate or sodium phosphate; granulating and disintegrating agents, for example, corn starch, or alginic acid; binding agents, for example starch, gelatin or acacia; lubricating agents, for example magnesium stearate, stearic acid or talc; and extenders and bulking agents, such as microcrystalline cellulose. The tablets may be uncoated or they may be coated by known techniques to delay disintegration and absorption in the gastrointestinal tract and thereby provide a sustained action over a
longer period. For example, a time delay material such as glyceryl monostearate or glyceryl distearate may be employed.
[0387] Formulations for oral use may also be presented as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluent, for example, calcium carbonate, calcium phosphate or kaolin, or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium, for example peanut oil, liquid paraffin or olive oil.
[0388] Aqueous suspensions contain the active materials in admixture with excipients suitable for the manufacture of aqueous suspensions. Such excipients are suspending agents, for example sodium carboxymethylcellulose, methylcellulose, hydroxypropylmethylcellulose, sodium alginate, polyvinylpyrrolidone, gum tragacanth and gum acacia; and dispersing or wetting agents, which may be a naturally-occurring phosphatide, for example, lecithin, or condensation products of an alkylene oxide with fatty acids, for example polyoxyethylene stearate, or condensation products of ethylene oxide with long chain aliphatic alcohols, for example heptadecaethyleneoxycetanol, or condensation products of ethylene oxide with partial esters derived from fatty acids and a hexitol such as polyoxyethylene sorbitol monooleate, or condensation products of ethylene oxide with partial esters derived from fatty acids and hexitol anhydrides, for example polyethylene sorbitan monooleate. The aqueous suspensions may also contain one or more preservatives, for example ethyl, or n-propyl p-hydroxybenzoate, one or more coloring agents, one or more flavoring agents, and one or more sweetening agents, such as sucrose or saccharin.
[0389] Oily suspensions may be formulated by suspending the active ingredients in a vegetable oil, for example arachis oil, olive oil, sesame oil or coconut oil, or in a mineral oil such as liquid paraffin. The oily suspensions may contain a thickening agent, for example beeswax, hard paraffin or cetyl alcohol. Sweetening agents such as those set forth above, and flavoring agents may be added to provide palatable oral preparations. These compositions may be preserved by the addition of an anti-oxidant such as ascorbic acid.
[0390] Dispersible powders and granules suitable for preparation of an aqueous suspension by the addition of water provide the active ingredient in admixture with a
dispersing or wetting agent, suspending agent and one or more preservatives. Suitable dispersing or wetting agents and suspending agents are exemplified by those already mentioned above. Other dispersing agents include hydrophilic polymers, electrolytes, Tween™ 60 or 80, PEG, polyvinylpyrrolidone (PVP; commercially known as Plasdone™), and the carbohydrate -based dispersing agents such as, for example, hydroxypropylcellulose and hydroxypropylcellulose ethers (e.g., HPC, HPC-SL, and HPC-L), hydroxypropylmethylcellulose and hydroxypropylmethylcellulose ethers (e.g. HPMC KlOO, HPMC K4M, HPMC Kl 5M, and HPMC KlOOM), carboxymethylcellulose sodium, methylcellulose, hydroxyethylcellulose, hydroxypropylmethylcellulose phthalate, hydroxypropylmethylcellulose acetate stearate, noncrystalline cellulose, magnesium aluminum silicate, triethanolamine, polyvinyl alcohol (PVA), polyvinylpyrrolidone/vinyl acetate copolymer (Plasdone™, e.g., S-630), 4-(l,l,3,3-tetramethylbutyl)-phenol polymer with ethylene oxide and formaldehyde (also known as tyloxapol), poloxamers (e.g., Pluronics F68™, F88™, and F 108™, which are block copolymers of ethylene oxide and propylene oxide); and poloxamines (e.g., Tetronic 9080, also known as Poloxamine 9080, which is a tetrafunctional block copolymer derived from sequential addition of propylene oxide and ethylene oxide to ethylenediamine (BASF Corporation, Parsippany, N.J.)). Additional excipients, for example sweetening, flavoring and coloring agents, may also be present.
[0391] Pharmaceutical formulations of the invention may also be in the form of oil-in-water emulsions and water-in-oil emulsions. The oily phase may be a vegetable oil, for example olive oil or arachis oil, or a mineral oil, for example liquid paraffin or mixtures of these. Suitable emulsifying agents may be naturally-occurring gums, for example gum acacia or gum tragacanth; naturally-occurring phosphatides, for example soy bean, lecithin, and esters or partial esters derived from fatty acids and hexitol; anhydrides, for example sorbitan monooleate; and condensation products of the said partial esters with ethylene oxide, for example polyoxyethylene sorbitan monooleate. The emulsions may also contain sweetening and flavoring agents. [0392] Syrups and elixirs may be formulated with sweetening agents, for example glycerol, propylene glycol, sorbitol or sucrose. Such formulations may also contain a demulcent, a preservative, and flavoring and coloring agents. The pharmaceutical formulations may be in the form of a sterile injectable aqueous or oleaginous
suspension. This suspension may be formulated according to the known art using those suitable dispersing or wetting agents and suspending agents, which have been mentioned above. The sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally acceptable diluent or solvent, for example as a solution in 1,3-butanediol. Among the acceptable vehicles and solvents that may be employed are water, Ringer's solution and isotonic sodium chloride solution. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose any bland fixed oil may be employed including synthetic mono- or diglycerides. In addition, fatty acids such as oleic acid find use in the preparation of injectables.
[0393] The composition of the invention may also be administered in the form of suppositories, e.g., for rectal administration of the drug. These compositions can be prepared by mixing the drug with a suitable non-irritating excipient that is solid at ordinary temperatures but liquid at the rectal temperature and will therefore melt in the rectum to release the drug. Such materials are cocoa butter and polyethylene glycols.
[0394] Alternatively, the compositions can be administered parenterally in a sterile medium. The drug, depending on the vehicle and concentration used, can either be suspended or dissolved in the vehicle. Advantageously, adjuvants such as local anesthetics, preservatives and buffering agents can be dissolved in the vehicle.
[0395] For administration to non-human animals, the composition containing the therapeutic compound may be added to the animal's feed or drinking water. Also, it will be convenient to formulate animal feed and drinking water products so that the animal takes in an appropriate quantity of the compound in its diet. It will further be convenient to present the compound in a composition as a premix for addition to the feed or drinking water. The composition can also added as a food or drink supplement for humans.
[0396] Dosage levels of the order of from about 5 mg to about 250 mg per kilogram of body weight per day and more preferably from about 25 mg to about 150 mg per kilogram of body weight per day, are useful in the treatment of the above- indicated conditions. The amount of active ingredient that may be combined with the carrier materials to produce a single dosage form will vary depending upon the
condition being treated and the particular mode of administration. Dosage unit forms will generally contain between from about 1 mg to about 500 mg of an active ingredient.
[0397] Frequency of dosage may also vary depending on the compound used and the particular disease treated. However, for treatment of most disorders, a dosage regimen of 4 times daily or less is preferred. It will be understood, however, that the specific dose level for any particular patient will depend upon a variety of factors including the activity of the specific compound employed, the age, body weight, general health, sex, diet, time of administration, route of administration and rate of excretion, drug combination and the severity of the particular disease undergoing therapy.
[0398] Preferred compounds of the invention will have desirable pharmacological properties that include, but are not limited to, oral bioavailability, low toxicity, low serum protein binding and desirable in vitro and in vivo half- lives. Penetration of the blood brain barrier for compounds used to treat CNS disorders is necessary, while low brain levels of compounds used to treat peripheral disorders are often preferred.
[0399] Assays may be used to predict these desirable pharmacological properties. Assays used to predict bioavailability include transport across human intestinal cell monolayers, including Caco-2 cell monolayers. Toxicity to cultured hepatocyctes may be used to predict compound toxicity. Penetration of the blood brain barrier of a compound in humans may be predicted from the brain levels of laboratory animals that receive the compound intravenously.
[0400] Serum protein binding may be predicted from albumin binding assays. Such assays are described in a review by Oravcova, et al. (Journal of Chromatography B (1996) volume 677, pages 1-27).
[0401] Compound half- life is inversely proportional to the frequency of dosage of a compound. In vitro half- lives of compounds may be predicted from assays of microsomal half-life as described by Kuhnz and Gieschen (Drug Metabolism and Disposition, (1998) volume 26, pages 1120-1127). [0402] The amount of the composition required for use in treatment will vary not only with the particular compound selected but also with the route of administration,
the nature of the condition being treated and the age and condition of the patient and will ultimately be at the discretion of the attendant physician or clinician.
[0403] In an exemplary embodiment, the pharmaceutical composition described herein includes an additional active ingredient. In another exemplary embodiment, the additional active ingredient is a compound that has been approved for human use by the United States Food and Drug Administration. In another exemplary embodiment, the additional active ingredient is an immunosuppressive agent. In still another exemplary embodiment, the additional active ingredient is a member selected from corticosteroids, aminosalicylates, azathioprine (6-mercaptopurine), methotrexate and ciclosporine, etanercept, infliximab, adalimumab, alefacept, efalizumab and anakinra.
[0404] In an exemplary embodiment, the additional active ingredient is a member selected from cilostazol, rolipram, roflumilast, piclamilast, CDP-840 and ariflo.
[0405] In still another exemplary embodiment, the additional active ingredient is a member selected from betamethasone, tacrolimus and pimecrolimus. In still another exemplary embodiment, the additional active ingredient is a member selected from an activated vitamin D analog and an arotinoid (an aromatic retinoic acid analog). In still another exemplary embodiment, the additional active ingredient is a member selected from carcipotriol, such as Tazorac (tazarotene). [0406] In still another exemplary embodiment, the additional active ingredient is a member selected from penicillin G, amoxicillin, ampicillin, azlocillin, carbenicillin, cloxacillin, dicloxacillin, flucloxacillin, mezlocillin, nafcillin, pipericillin and ticarcillin.
[0407] In still another exemplary embodiment, the additional active ingredient is a member selected from tazobactam, sulbactam and clavulanic acid.
VII. a) Topical formulations
[0408] In a preferred embodiment, the methods of the invention can be employed through the topical application of the compounds described herein. Topical administration includes for example, transmucosal, transdermal, ungual and transungual routes of administration.
[0409] The compositions of the present invention comprises fluid or semi-solid vehicles that may include but are not limited to polymers, thickeners, buffers, neutralizers, chelating agents, preservatives, surfactants or emulsifiers, antioxidants, waxes or oils, emollients, sunscreens, and a solvent or mixed solvent system. The solvent or mixed solvent system is important to the formation because it is primarily responsible for dissolving the drug. The best solvent or mixed solvent systems are also capable of maintaining clinically relevant levels of the drug in solution despite the addition of a poor solvent to the formulation. The topical compositions useful in the subject invention can be made into a wide variety of product types. These include, but are not limited to, lotions, creams, gels, sticks, sprays, ointments, pastes, foams, mousses, masks, eye ointments, eye or ear drops, impregnated dressings, wipes, cleansers including soaps, body washes and shampoos, and make-up products, such as bases, blushes, lipsticks, and eye shadows, among others. These product types can comprise several types of carrier systems including, but not limited to particles, nanoparticles, and liposomes. If desired, disintegrating agents can be added, such as the cross-linked polyvinyl pyrrolidone, agar or alginic acid or a salt thereof such as sodium alginate. Techniques for formulation and administration can be found in Remington: The Science and Practice of Pharmacy, supra. The formulation can be selected to maximize delivery to a desired target site in the body. The formulations can also include various conventional colorants, fragrances, thickeners, preservatives, humectants, emollients, demulcents, solubilizing excipients, dispersants, penetration enhancers, plasticizing agents, preservatives, stabilizers, demulsifϊers, wetting agents, sunscreens, emulsifiers, moisturizers, astringents, deodorants, and the like, which can be added to provide additional benefits such as, for example, improving the feel and/or appearance of the topical preparation.
[0410] Lotions, which are preparations that are to be applied to the skin, nail, hair, claw or hoof surface without friction, are typically liquid or semi-liquid preparations in which finely divided solid, waxy, or liquid are dispersed. Lotions will typically contain suspending agents to produce better dispersions as well as compounds useful for localizing and holding the active agent in contact with the skin, nail, hair, claw or hoof, e.g., methylcellulose, sodium carboxymethyl-cellulose, or the like.
[0411] Creams containing the active agent for delivery according to the present invention are viscous liquid or semisolid emulsions, either oil-in-water or water-in-oil.
Cream bases are water- washable, and contain an oil phase, an emulsifϊer and an aqueous phase. The oil phase is generally comprised of petrolatum or a fatty alcohol, such as cetyl- or stearyl alcohol; the aqueous phase usually, although not necessarily, exceeds the oil phase in volume, and generally contains a humectant. The emulsifϊer in a cream formulation, as explained in Remington: The Science and Practice of Pharmacy, supra, is generally a nonionic, anionic, cationic or amphoteric surfactant.
[0412] A lotion or cream may include a relatively large aqueous phase and a relatively small oil phase. Furthermore, the lotions and creams of the invention may include the active compound "all-in-solution" in the oil phase so that substantially none of the active compound crystallizes out at room temperature. In one embodiment, the lotion or cream may comprise a biphasic system, that is, a system wherein a portion (from about 30 to about 75% by weight) of the active compound is in solution in the oil phase and the remainder is in suspension in the aqueous phase.
[0413] Gel formulations can also be used in connection with the present invention. As will be appreciated by those working in the field of topical drug formulation, gels are semisolid. Single-phase gels contain organic macromolecules distributed substantially uniformly throughout the carrier liquid, which is typically aqueous, but also may be a solvent or solvent blend. In various embodiments, conventional gelling agents can be used. In an exemplary embodiment, cellulose or its derivatives are used. In an exemplary embodiment, hydroxypropyl methyl cellulose, such as Methocel E4M, is used. Other gelling agents include methyl cellulose, hydroxypropyl cellulose, hydroxypropyl methyl cellulose, cellulose acetate, ethyl cellulose, methyl hydroxy ethyl cellulose, hydroxy ethyl cellulose, and cellulose gum. Cellulose based gelling agents, particularly hydroxymethylcellulose and hydroxypropyl methyl cellulose, are also useful in some embodiments. In some embodiments, cross-linked acrylic polymers including Carbopol may be used.
[0414] In one embodiment, the formulation of the invention is viscous enough to form a firm gel. In one embodiment, the viscosity is in the range of 25,000-300,000 cps (centipoise) or 75,000-200,000 cps, based on Brookfield (LV) analysis. [0415] For ease of preparation, it may be convenient to prepare a first gel composition, named speed-gel herein, which can be used to add to other components in the formulation of a final composition for topical administration. There are several
possible formulations of the speed-gel. For example, a speed-gel may be prepared by mixing lecithin organogel (L. O.), as a 1 :1 (m/m) mixture of lecithin and isopropyl myristate, with LID oil (a 1 :1 [m/m] mixture of L. O. and docusate sodium), dissolving additional docusate sodium powder into this mixture, and then adding aqueous urea.
[0416] Ointments, which are semisolid preparations, are typically based on petrolatum or other petroleum derivatives. As will be appreciated by the ordinarily skilled artisan, the specific ointment base to be used is one that provides for optimum delivery for the active agent chosen for a given formulation, and, preferably, provides for other desired characteristics as well, e.g., emolliency or the like. As with other carriers or vehicles, an ointment base should be inert, stable, nonirritating and non- sensitizing. As explained in Remington: The Science and Practice of Pharmacy, 19th Ed. (Easton, Pa.: Mack Publishing Co., 1995), at pages 1399-1404, ointment bases may be grouped in four classes: oleaginous bases; emulsifϊable bases; emulsion bases; and water-soluble bases. Oleaginous ointment bases include, for example, vegetable oils, fats obtained from animals, and semisolid hydrocarbons obtained from petroleum. Examples of oleaginous ointment bases include White Ointment USP, Yellow Ointment NF, Oleic Acid USP, Olive Oil USP, Paraffin USP, Petrolatum NF, White Petrolatum USP, Spermaceti Wax USP, Synthetic Spermaceti NF, Starch Glycerite NF, White Wax USP, and Yellow Wax USP. Emulsifϊable ointment bases, also known as absorbent ointment bases, contain little or no water and include, for example, hydroxystearin sulfate, anhydrous lanolin and hydrophilic petrolatum. Emulsion ointment bases are either water-in-oil (W/O) emulsions or oil-in- water (O/W) emulsions, and include, for example, cetyl alcohol, glyceryl monostearate, lanolin and stearic acid. Preferred water-soluble ointment bases are prepared from polyethylene glycols of varying molecular weight; again, reference may be had to Remington: The Science and Practice of Pharmacy, supra, for further information.
[0417] Useful formulations of the invention also encompass sprays and aerosols. Sprays generally provide the active agent in an aqueous and/or alcoholic solution which can be misted onto the skin, nail, hair, claw or hoof for delivery. Such sprays include those formulated to provide for concentration of the active agent solution at the site of administration following delivery, e.g., the spray solution can be primarily composed of alcohol or other like volatile liquid in which the drug or active agent can
be dissolved. Upon delivery to the skin, nail, hair, claw or hoof, the carrier evaporates, leaving concentrated active agent at the site of administration. Examples of aerosol technology are disclosed in US Patents 6,682,716; 6,716,415; 6,716,417; 6,783,753; 7,029,658; and 7,033,575. [0418] The topical pharmaceutical compositions may also comprise suitable solid or gel phase carriers. Examples of such carriers include but are not limited to calcium carbonate, calcium phosphate, various sugars, starches, cellulose derivatives, gelatin, and polymers such as polyethylene glycols.
[0419] The topical pharmaceutical compositions may also comprise a suitable emulsifier which refers to an agent that enhances or facilitates mixing and suspending oil-in- water or water-in-oil. The emulsifying agent used herein may consist of a single emulsifying agent or may be a nonionic, anionic, cationic or amphoteric surfactant or blend of two or more such surfactants; preferred for use herein are nonionic or anionic emulsifiers. Such surface-active agents are described in "McCutcheon's Detergent and Emulsifiers," North American Edition, 1980 Annual published by the McCutcheon Division, MC Publishing Company, 175 Rock Road, Glen Rock, N.J. 07452, USA.
[0420] Examples of useful ionic surfactants include sodium caproate, sodium caprylate, sodium caprate, sodium laurate, sodium myristate, sodium myristolate, sodium palmitate, sodium palmitoleate, sodium oleate, sodium ricinoleate, sodium linoleate, sodium linolenate, sodium stearate, sodium lauryl sulfate (dodecyl), sodium tetradecyl sulfate, sodium lauryl sarcosinate, sodium dioctyl sulfosuccinate, sodium cholate, sodium taurocholate, sodium glycocholate, sodium deoxycholate, sodium taurodeoxycholate, sodium glycodeoxycholate, sodium ursodeoxycholate, sodium chenodeoxycholate, sodium taurochenodeoxycholate, sodium glyco cheno deoxycholate, sodium cholylsarcosinate, sodium N-methyl taurocholate, egg yolk phosphatides, hydrogenated soy lecithin, dimyristoyl lecithin, lecithin, hydroxylated lecithin, lysophosphatidylcholine, cardiolipin, sphingomyelin, phosphatidylcholine, phosphatidyl ethanolamine, phosphatidic acid, phosphatidyl glycerol, phosphatidyl serine, diethanolamine, phospholipids, polyoxyethylene-10 oleyl ether phosphate, esterification products of fatty alcohols or fatty alcohol ethoxylates, with phosphoric acid or anhydride, ether carboxylates (by oxidation of terminal OH group of, fatty
alcohol ethoxylates), succinylated monoglycerides, sodium stearyl fumarate, stearoyl propylene glycol hydrogen succinate, mono/diacetylated tartaric acid esters of mono- and diglycerides, citric acid esters of mono-, diglycerides, glyceryl-lacto esters of fatty acids, acyl lactylates, lactylic esters of fatty acids, sodium stearoyl-2-lactylate, sodium stearoyl lactylate, alginate salts, propylene glycol alginate, ethoxylated alkyl sulfates, alkyl benzene sulfones, α-olefm sulfonates, acyl isethionates, acyl taurates, alkyl glyceryl ether sulfonates, sodium octyl sulfosuccinate, sodium undecylenamideo-MEA-sulfosuccinate, hexadecyl triammonium bromide, decyl trimethyl ammonium bromide, cetyl trimethyl ammonium bromide, dodecyl ammonium chloride, alkyl benzyldimethylammonium salts, diisobutyl phenoxyethoxydimethyl benzylammonium salts, alkylpyridinium salts, betaines (trialkylglycine), lauryl betaine (N-lauryl,N,N-dimethylglycine), and ethoxylated amines (polyoxyethylene-15 coconut amine). For simplicity, typical counterions are provided above. It will be appreciated by one skilled in the art, however, that any bioacceptable counterion may be used. For example, although the fatty acids are shown as sodium salts, other cation counterions can also be used, such as, for example, alkali metal cations or ammonium. Formulations of the invention may include one or more of the ionic surfactants above.
[0421] Preferred for use herein are high molecular weight alcohols such as cetearyl alcohol, cetyl alcohol, stearyl alcohol, emulsifying wax, glyceryl monostearate, and oleyl alcohol. Other examples are ethylene glycol distearate, sorbitan tristearate, propylene glycol monostearate, sorbitan monooleate, sorbitan monostearate (SPAN 60), diethylene glycol monolaurate, sorbitan monopalmitate, sucrose dioleate, sucrose stearate (CRODESTA F- 160), polyoxyethylene lauryl ether (BRIJ 30), polyoxyethylene (2) stearyl ether (BRIJ 72), polyoxyethylene (21) stearyl ether (BRIJ 721), polyoxyethylene monostearate (Myrj 45), polyoxyethylene (20) sorbitan monolaurate (TWEEN 20, polysorbate 20), polyoxyethylene (20) sorbitan monopalmitate (TWEEN 40, polysorbate 40), polyoxyethylene (20) sorbitan monostearate (TWEEN 60, polysorbate 60), polyoxyethylene (20) sorbitan monooleate (TWEEN 80, polysorbate 80), other non-ionic polyoxyalkylene derivatives of hexitol anhydride partial long chain fatty acid esters, and sodium oleate. In an exemplary embodiment, the emulsifier is octyldodecanol. In an exemplary embodiment, xanthan gum or a xanthan gum blend is used. Cholesterol and
cholesterol derivatives may also be employed in externally used emulsions and promote w/o emulsions.
[0422] Especially suitable nonionic emulsifying agents are those with hydrophile- lipophile balances (HLB) of about 3 to 6 for w/o system and 8 to 18 for o/w system as determined by the method described by Paul L. Lindner in "Emulsions and
Emulsion", edited by Kenneth Lissant, published by Dekker, New York, N. Y., 1974, pages 188-190. More preferred for use herein are one or more nonionic surfactants that produce a system having HLB of about 8 to about 18.
[0423] Examples of such nonionic emulsifϊers include but are not limited to "BRIJ 72", the trade name for a polyoxyethylene (2) stearyl ether having an HLB of 4.9; "BRIJ 721 ", the trade name for a polyoxyethylene (21) stearyl ether having an HLB of 15.5, "Brij 30", the trade name for polyoxyethylene lauryl ether having an HLB of 9.7; "Polawax", the trade name for emulsifying wax having an HLB of 8.0; "Span 60", the trade name for sorbitan monostearate having an HLB of 4.7; "Crodesta F-160", the trade name for sucrose stearate" having an HLB of 14.5. All of these materials are available from Ruger Chemicals Inc.; Croda; ICI Americas, Inc.; Spectrum Chemicals; and BASF. When the topical formulations of the present invention contain at least one emulsifying agent, each emulsifying agent is present in amount from about 0.5 to about 2.5 wt%, preferably 0.5 to 2.0%, more preferably 1.0% or 1.8%. Preferably the emulsifying agent comprises a mixture of steareth 21 (at about 1.8 %) and steareth 2 (at about 1.0%).
[0424] The topical pharmaceutical compositions may also comprise suitable emollients. Emollients are materials used for the prevention or relief of dryness, as well as for the protection of the skin, nail, hair, claw or hoof. Useful emollients include, but are not limited to, hydrocarbon oils, waxes, silicone, cetyl alcohol, isopropyl myristate, stearyl alcohol, oleyl alcohol, octyl hydroxystearate, glycerin, other fatty alcohols including short or medium chain fatty alcohols having a carbon length of up to 18, medium or short chain fatty acid triglycerides, esters such as fatty acid esters, lecithins and related polar compounds such as phosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, phosphatidylinositol, phosphatidic acid, lyso-phosphatidylcholine, lyso-phosphatidylethanolamine, and sphingomyelin and the like. Other suitable emollients include triglyceride oils like vegetable oils such
as wheat germ, maize, sunflower, karite, castor, sweet almond, macadamia, apricot, soybean, cottonseed, alfalfa, poppy, pumpkinseed, sesame, cucumber, rapeseed, avocado, hazelnut, grape seed, blackcurrant seed, evening primrose, millet, barley, quinoa, olive, rye, safflower, candlenut, soya, palm, passion flower, or musk rose oil; triglycerides of caprylic/capric acid, such as those sold under the tradenames
MIGL YOL™ (Condea Chemie, Germany) and CRODAMOL (Croda, Inc., Edison, N. J.); fatty alcohols such as caprylic alcohol, lauryl alcohol, myristyl alcohol, cetyl alcohol, and stearyl alcohol; and fatty esters such as oleyl acetate, isotridecyl benzoate, diisooctyl sebacate, isopropyl myristate, cetyl octanoate, isopropyl palmitate, butyl stearate, hexyl laurate, myristyl myristate, decyl oleate, hexyldecyl dimethyloctanoate, cetyl lactate, myristyl lactate, lanoline acetate, isocetyl stearate, isocetyl isostearate, cholesteryl 12-hydroxystearate, dipentaerythritol fatty acid ester, and isostearyl malate. A wide variety of suitable emollients are known and can be used herein. See e.g., Sagarin, Cosmetics, Science and Technology, 2nd Edition, Vol. 1, pp. 32-43 (1972), and U.S. Pat. No. 4,919,934, to Deckner et al, issued Apr. 24, 1990, both of which are incorporated herein by reference in their entirety. These materials are available from Ruger Chemical Co, (Irvington, NJ).
[0425] When the topical formulations of the present invention contain at least one emollient, each emollient is present in an amount from about 0.1 to 15%, preferably 0.1 to about 3.0, more preferably 0.5, 1.0, or 2.5 wt%. Preferably the emollient is a mixture of cetyl alcohol, isopropyl myristate and stearyl alcohol in a 1/5/2 ratio. The emollient may also be a mixture of cetyl alcohol and stearyl alcohol in a 1 /2 ratio.
[0426] The topical pharmaceutical compositions may also comprise suitable antioxidants, substances known to inhibit oxidation. Antioxidants suitable for use in accordance with the present invention include, but are not limited to, butylated hydroxytoluene, ascorbic acid, sodium ascorbate, calcium ascorbate, ascorbic palmitate, butylated hydroxyanisole, 2,4,5-trihydroxybutyrophenone, 4- hydroxymethyl-2,6-di-te/t-butylphenol, erythorbic acid, gum guaiac, propyl gallate, thiodipropionic acid, dilauryl thiodipropionate, tert-butylhydroquinone and tocopherols such as vitamin E, and the like, including pharmaceutically acceptable salts and esters of these compounds. Preferably, the antioxidant is butylated hydroxytoluene, butylated hydroxyanisole, propyl gallate, ascorbic acid, pharmaceutically acceptable salts or esters thereof, or mixtures thereof. Most
preferably, the antioxidant is butylated hydroxytoluene. These materials are available from Ruger Chemical Co, (Irvington, NJ). Antioxidants that may be incorporated into the formulations of the invention include natural antioxidants prepared from plant extracts, such as extracts from aloe vera; avocado; chamomile; echinacea; ginko biloba; ginseng; green tea; heather; jojoba; lavender; lemon grass; licorice; mallow; oats; peppermint; St. John's wort; willow; wintergreen; wheat wild yam extract; marine extracts; and mixtures thereof.
[0427] When the topical formulations of the present invention contain at least one antioxidant, the total amount of antioxidant present is from about 0.001 to 0.5 wt%, preferably 0.05 to about 0.5 wt%, more preferably 0.1%.
[0428] The topical pharmaceutical compositions may also comprise suitable preservatives. Preservatives are compounds added to a pharmaceutical formulation to act as an anti-microbial agent. Among preservatives known in the art as being effective and acceptable in parenteral formulations are benzalkonium chloride, benzethonium, chlorohexidine, phenol, m-cresol, benzyl alcohol, methylparaben, propylparaben and other parabens, chlorobutanol, o-cresol, p-cresol, chlorocresol, phenylmercuric nitrate, thimerosal, benzoic acid, and various mixtures thereof. See, e.g., Wallhausser, K. -H., Develop. Biol. Standard, 24:9-28 (1974) (S. Krager, Basel). Preferably, the preservative is selected from methylparaben, propylparaben and mixtures thereof. These materials are available from Inolex Chemical Co (Philadelphia, PA) or Spectrum Chemicals.
[0429] When the topical formulations of the present invention contain at least one preservative, the total amount of preservative present is from about 0.01 to about 0.5 wt%, preferably from about 0.1 to 0.5%, more preferably from about 0.03 to about 0.15. Preferably the preservative is a mixture of methylparaben and propylparaben in a 5/1 ratio. When alcohol is used as a preservative, the amount is usually 15 to 20%.
[0430] The topical pharmaceutical compositions may also comprise suitable chelating agents to form complexes with metal cations that do not cross a lipid bilayer. Examples of suitable chelating agents include ethylene diamine tetraacetic acid (EDTA), ethylene glycol-bis(beta-aminoethyl ether)-N,N,N',N'-tetraacetic acid (EGTA) and 8- Amino-2- [(2-amino-5 -methylphenoxy)methyl] -6-methoxyquinoline- N5N5N', N '-tetraacetic acid, tetrapotassium salt (QUIN-2). Preferably the chelating
agents are EDTA and citric acid. A chelating agent may comprise salts of the above, such as edetate disodium, for example. These materials are available from Spectrum Chemicals.
[0431] When the topical formulations of the present invention contain at least one chelating agent, the total amount of chelating agent present is from about 0.005% to 2.0% by weight, preferably from about 0.05% to about 0.5 wt%, more preferably about 0.1% by weight.
[0432] The topical pharmaceutical compositions may also comprise suitable neutralizing agents used to adjust the pH of the formulation to within a pharmaceutically acceptable range. Examples of neutralizing agents include but are not limited to trolamine, tromethamine, sodium hydroxide, hydrochloric acid, sodium carbonate, citric acid, acetic acid and corresponding acids or bases thereof. Such materials are available from are available from Spectrum Chemicals (Gardena, CA).
[0433] When the topical formulations of the present invention contain at least one neutralizing agent, the total amount of neutralizing agent present is from about 0.1 wt to about 10 wt %, preferably 0.1 wt % to about 5.0 wt%, and more preferably about 1.0 wt %. The neutralizing agent is generally added in whatever amount is required to bring the formulation to the desired pH. In one embodiment, the pH is about 6.0 to about 8.0. In one embodiment, the pH is about 3.0 to about 4.0. [0434] The topical pharmaceutical compositions may also comprise suitable thickening or viscosity increasing agents. These components are diffusible compounds capable of increasing the viscosity of a polymer-containing solution through the interaction of the agent with the polymer. For example, CARBOPOL ULTREZ 10, polymethyl methacrylate (PMMA), and fumed silica may be used as a viscosity-increasing agent. These materials are available from Noveon Chemicals, Cleveland, OH. Other examples of thickeners include monoglycerides and fatty alcohols, fatty acid esters of alcohols having from about 3 to about 16 carbon atoms. Examples of suitable monoglycerides are glyceryl monostearate and glyceryl monopalmitate. Examples of fatty alcohols are cetyl alcohol and stearyl alcohol. Examples of suitable esters are myristyl stearate and cetyl stearate. The monoglyceride also functions as an auxiliary emulsifier. Other emollients or oleaginous material which may be employed include petrolatum, glyceryl
monooleate, myristyl alcohol, and isopropyl palmitate. In one embodiment, the thickener is used in combination with an emulsifying agent.
[0435] When the topical formulations of the present invention contain at least one viscosity increasing agent, the total amount of viscosity increasing agent present is from about 0.25% to about 5.0% by weight, preferably from about 0.25% to about 1.0 wt%, and more preferably from about 0.4% to about 0.6% by weight.
[0436] The topical pharmaceutical compositions may also comprise a disintegrating agent including starch, e.g., a natural starch such as corn starch or potato starch, a pregelatinized starch such as National 1551 or Amijele™, or sodium starch glycolate such as Promogel or Explotab ; a cellulose such as a wood product, microcrystalline cellulose, e.g., Avicel™, Avicel™ PHlOl, Avicel™ PH102, Avicel™ PH 105, Elcema™ PlOO, Emcocel™, Vivacel™, Ming Tia™, and Solka- Floc™, methylcellulose, croscarmellose, or a cross-linked cellulose, such as cross- linked sodium carboxymethylcellulose (Ac-Di-Sol™), cross-linked carboxymethylcellulose, or cross-linked croscarmellose; a cross-linked starch such as sodium starch glycolate; a cross-linked polymer such as crosspovidone; a cross-linked polyvinylpyrrolidone; alginate such as alginic acid or a salt of alginic acid such as sodium alginate; a clay such as Veegum™ HV (magnesium aluminum silicate); a gum such as agar, guar, locust bean, Karaya, pectin, or tragacanth; sodium starch glycolate; bentonite; a natural sponge; a surfactant; a resin such as a cation-exchange resin; citrus pulp; sodium lauryl sulfate; sodium lauryl sulfate in combination starch; and the like.
[0437] The topical pharmaceutical compositions may also comprise suitable nail penetration enhancers. Examples of nail penetration enhancers include mercaptan compounds, sulfites and bisulfites, keratolytic agents and surfactants. Nail penetration enhancers suitable for use in the invention are described in greater detail in Malhotra et al., J. Pharm. Sci., 91:2, 312-323 (2002), which is incorporated herein by reference in its entirety.
[0438] The topical pharmaceutical compositions may also comprise an anti- foaming anti-whitening agent that increases the elegancy of the cream or lotion and inhibits the formation of a white soapy look upon rubbing the cream or lotion on the
skin. An example of such material includes silicone fluid. Other anti-foaming agents include simethicone, polyglycol, and sorbitan sesquioleate.
[0439] The topical pharmaceutical compositions may also comprise a post- foaming agent. "Post-foaming" refers to a gel that remains a gel as it is expelled from a container but foams up after it is spread over the skin. Post-foaming agents include saturated aliphatic hydrocarbons having from 4-6 carbon atoms, such as butane, pentane and hexane (in particular is opentane and isobutene). Other suitable post- foaming agents include partially, or wholly halogenated hydrocarbons, such as trichlorofluroethane. Also, mixtures of aliphatic and halogenated hydrocarbon propellants, or post-foaming agents can be used. Generally suitable post- foaming agents are those substances that have a low solubility in water, for example less than about 20 cc of gas in 100 grams of water at one atmosphere and 20 0C.
[0440] The topical pharmaceutical compositions may also comprise one or more suitable solvents. The ability of any solid substance (solute) to dissolve in any liquid substance (solvent) is dependent upon the physical properties of the solute and the solvent. When solutes and solvents have similar physical properties the solubility of the solute in the solvent will be the greatest. This gives rise to the traditional understanding that "like dissolves like." Solvents can be characterized in one extreme as non-polar, lipophilic oils, while in the other extreme as polar hydrophilic solvents. Oily solvents dissolve other non-polar substances by Van der WaIs interactions while water and other hydrophilic solvents dissolve polar substances by ionic, dipole, or hydrogen bonding interactions. All solvents can be listed along a continuum from the least polar, i.e. hydrocarbons such as decane, to the most polar solvent being water. A solute will have its greatest solubility in solvents having equivalent polarity. Thus, for drugs having minimal solubility in water, less polar solvents will provide improved solubility with the solvent having polarity nearly equivalent to the solute providing maximum solubility. Most drugs have intermediate polarity, and thus experience maximum solubility in solvents such as propylene glycol or ethanol, which are significantly less polar than water. If the drug has greater solubility in propylene glycol (for example 8% (w/w)) than in water (for example 0.1 % (w/w)), then addition of water to propylene glycol should decrease the maximum amount of drug solubility for the solvent mixture compared with pure propylene glycol. Addition of a poor
solvent to an excellent solvent will decrease the maximum solubility for the blend compared with the maximum solubility in the excellent solvent.
[0441] When compounds are incorporated into topical formulations the concentration of active ingredient in the formulation may be limited by the solubility of the active ingredient in the chosen solvent and/or carrier. Non-lipophilic drugs typically display very low solubility in pharmaceutically acceptable solvents and/or carriers. For example, the solubility of some compounds in the invention in water is less than 0.00025% wt/wt. The solubility of the same compounds in the invention can be less than about 2% wt/wt in either propylene glycol or isopropyl myristate. [0442] Examples of solubilizing excipients include polyethoxylated fatty acids, PEG-fatty acid diesters, PEG-fatty acid mono-ester and di-ester mixtures, polyethylene glycol glycerol fatty acid esters, alcohol-oil transesterification products, polyglycerized fatty acids, propylene glycol fatty acid esters, mixtures of propylene glycol esters-glycerol esters, mono- and diglycerides, sterol and sterol derivatives, polyethylene glycol sorbitan fatty acid esters, polyethylene glycol alkyl ethers, sugar esters, polyethylene glycol alkyl phenols, polyoxyethylene-polyoxypropylene block copolymers, sorbitan fatty acid esters, lower alcohol fatty acid esters, ionic surfactants, tocopherol esters, and sterol esters. In one embodiment of the present invention, ethylhexyl hydroxystearate is the solvent used to dissolve the compounds described herein. In one embodiment of the present invention, diethylene glycol monoethyl ether (DGME) is the solvent used to dissolve the compounds described herein. In one embodiment of the present invention, diethylene glycol monoethyl ether (DGME) is the solvent used to dissolve a compound of the invention. The compounds in the invention useful in the present formulation are believed to have a solubility of from about 10% wt/wt to about 25% wt/wt in DGME. In another embodiment a DGME water cosolvent system is used to dissolve the compounds described herein. In another embodiment a DGME water cosolvent system is used to dissolve a compound of the invention. The solvent capacity of DGME drops when water is added; however, the DGME/water cosolvent system can be designed to maintain the desired concentration of from about 0.1 % to about 5% wt/wt active ingredient. Preferably the active ingredient is present from about 0.5 % to about 3% wt/wt, and more preferably at about 1% wt/wt, in the as-applied topical formulations. Because DGME is less volatile than water, as the topical formulation evaporates upon
application, the active agent becomes more soluble in the cream formulation. This increased solubility reduces the likelihood of reduced bioavailability caused by the drug precipitating on the surface of the skin, nail, hair, claw or hoof.
[0443] In one embodiment, the vehicle is lipophilic. Lipophilic materials include oleaginous material such as petrolatum, mineral oil thickened or gelled with polyethylene, high molecular weight paraffin waxes, mono and diglycerides of fatty acids gelled with high molecular weight fatty acids or polyamide complex of hydroxystearate, propylene glycol isostearate or isostearyl alcohol gelled with high molecular weight fatty acids, and mixtures thereof. [0444] Liquid forms, such as lotions suitable for topical administration or suitable for cosmetic application, may include a suitable aqueous or nonaqueous vehicle with buffers, suspending and dispensing agents, thickeners, penetration enhancers, and the like. Solid forms such as creams or pastes or the like may include, for example, any of the following ingredients, water, oil, alcohol or grease as a substrate with surfactant, polymers such as polyethylene glycol, thickeners, solids and the like. Liquid or solid formulations may include enhanced delivery technologies such as liposomes, microsomes, microsponges and the like. Liposomal formulations, which help allow compounds to enter the skin, are described in US Patents 5,169,637; 5,000,958; 5,049,388; 4,975,282; 5,194,266; 5,023,087; 5,688,525; 5,874,104; 5,409,704; 5,552,155; 5,356,633; 5,032,582; 4,994,213; and PCT Publication No. WO 96/40061.
[0445] Additionally, the compounds can be delivered using a sustained-release system, such as semipermeable matrices of solid hydrophobic polymers containing the therapeutic agent. Various sustained-release materials have been established and are well known by those skilled in the art. Thus, at least two different dosage forms, each of which contains a compound of the invention, may be formulated for topical administration by including such dosage forms in an oil-in- water emulsion, or a water-in-oil emulsion. In such a formulation, the delayed release dosage forms are in the continuous phase, and the delayed sustained release dosage form is in a discontinuous phase. The formulation may also be produced in a manner for delivery of three dosage forms as hereinabove described. For example, there may be provided an oil-in-water-in-oil emulsion, with oil being a continuous phase that contains the third delayed sustained release component, water dispersed in the oil containing a first
delayed release dosage form, and oil dispersed in the water containing a second delayed release dosage form.
[0446] Topical treatment regimens according to the practice of this invention comprise applying the composition directly to the skin, nail, hair, claw or hoof at the application site, from one to several times daily.
[0447] Formulations of the present invention can be used to treat, ameliorate or prevent conditions or symptoms associated with bacterial infections, acne, inflammation and the like.
[0448] In an exemplary embodiment, the pharmaceutical formulation includes a simple solution. In an exemplary embodiment, the simple solution includes a polyether. In an exemplary embodiment, the polyether is polyethylene glycol or polypropylene glycol. In an exemplary embodiment, the simple solution includes an alcohol. In an exemplary embodiment, the alcohol is methanol, ethanol, propanol, isopropanol or butanol. In an exemplary embodiment, the simple solution includes a polyether and an alcohol. In another exemplary embodiment, the simple solution includes a polypropylene glycol and ethanol. In another exemplary embodiment, the simple solution is a member selected from about 10% polypropylene glycol and about 90% ethanol; about 20% polypropylene glycol and about 80% ethanol; about 30% polypropylene glycol and about 70% ethanol; about 40% polypropylene glycol and about 60% ethanol; about 50% polypropylene glycol and about 50% ethanol; about 60% polypropylene glycol and about 40% ethanol; about 70% polypropylene glycol and about 30% ethanol; about 80% polypropylene glycol and about 20% ethanol; about 90% polypropylene glycol and about 10% ethanol.
[0449] In an exemplary embodiment, the simple solution includes acetone. In an exemplary embodiment, the simple solution includes acetone and an alcohol. In an exemplary embodiment, the simple solution includes acetone and a member selected from methanol, ethanol, propanol, isopropanol or butanol. In an exemplary embodiment, the simple solution includes acetone, an alcohol and a polyether. In another exemplary embodiment, the simple solution includes acetone, an alcohol and a member selected from polyethylene glycol and polypropylene glycol. In an exemplary embodiment, the simple solution includes acetone and ethanol. In another exemplary embodiment, the simple solution is a member selected from about 10%
acetone and about 90% ethanol; about 20% acetone and about 80% ethanol; about 30% acetone and about 70% ethanol; about 40% acetone and about 60% ethanol; about 50% acetone and about 50% ethanol; about 60% acetone and about 40% ethanol; about 70% acetone and about 30% ethanol; about 80% acetone and about 20% ethanol; about 90% acetone and about 10% ethanol.
[0450] In an exemplary embodiment, the pharmaceutical formulation is a lacquer.
VII. b) Additional Active Agents
[0451] The following are examples of the cosmetic and pharmaceutical agents that can be added to the topical pharmaceutical formulations of the present invention. The following agents are known compounds and are readily available commercially.
[0452] Anti-inflammatory agents include, but are not limited to, bisabolol, mentholatum, dapsone, aloe, hydrocortisone, and the like.
[0453] Vitamins include, but are not limited to, Vitamin B, Vitamin E, Vitamin A, Vitamin D, and the like and vitamin derivatives such as tazarotene, calcipotriene, tretinoin, adapalene and the like.
[0454] Anti-aging agents include, but are not limited to, niacinamide, retinol and retinoid derivatives, AHA, Ascorbic acid, lipoic acid, coenzyme Q lO, beta hydroxy acids, salicylic acid, copper binding peptides, dimethylaminoethyl (DAEA), and the like. [0455] Sunscreens and or sunburn relief agents include, but are not limited to,
PABA, jojoba, aloe, padimate-O, methoxycinnamates, proxamine HCl, lidocaine and the like. Sunless tanning agents include, but are not limited to, dihydroxyacetone (DHA). Ultraviolet (UV) light blockers include, for example, amino benzoic acids, benzophenones, camphors, cinnamates, dibenzoyl methanes, salicylates, metal oxides, and mixtures thereof.
[0456] Psoriasis-treating agents and/or acne-treating agents include, but are not limited to, salicylic acid, benzoyl peroxide, coal tar, selenium sulfide, zinc oxide, pyrithione (zinc and/or sodium), tazarotene, calcipotriene, tretinoin, adapalene and the like.
[0457] Agents that are effective to control or modify keratinization, including without limitation: tretinoin, tazarotene, and adapalene.
[0458] The compositions comprising an compound/active agent described herein, and optionally at least one of these additional agents, are to be administered topically. In a primary application, this leads to the compounds of the invention and any other active agent working upon and treating the skin, nail, hair, claw or hoof. Alternatively, any one of the topically applied active agents may also be delivered systemically by transdermal routes.
[0459] In such compositions an additional cosmetically or pharmaceutically effective agent, such as an anti-inflammatory agent, vitamin, anti-aging agent, sunscreen, and/or acne-treating agent, for example, is usually a minor component (from about 0.001 % to about 20% by weight or preferably from about 0.01 % to about 10% by weight) with the remainder being various vehicles or carriers and processing aids helpful for forming the desired dosing form. VII. c) Testine
[0460] Preferred compounds for use in the present topical formulations will have certain pharmacological properties. Such properties include, but are not limited to, low toxicity, low serum protein binding and desirable in vitro and in vivo half-lives. Assays may be used to predict these desirable pharmacological properties. Assays used to predict bioavailability include transport across human intestinal cell monolayers, including Caco-2 cell monolayers. Serum protein binding may be predicted from albumin binding assays. Such assays are described in a review by Oravcova et al. (1996, J. Chromat. B677: 1-27). Compound half-life is inversely proportional to the frequency of dosage of a compound. In vitro half- lives of compounds may be predicted from assays of microsomal half- life as described by Kuhnz and Gleschen (Drug Metabolism and Disposition, (1998) volume 26, pages 1120-1127).
[0461] Toxicity and therapeutic efficacy of such compounds can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio
between LD50 and ED50. Compounds that exhibit high therapeutic indices are preferred. The data obtained from these cell culture assays and animal studies can be used in formulating a range of dosage for use in humans. The dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity. The dosage can vary within this range depending upon the dosage form employed and the route of administration utilized. The exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient's condition. (See, e.g. Fingl et al., 1975, in "The Pharmacological Basis of Therapeutics", Ch. 1, p. 1). VII. d) Administration
[0462] For any compound used in the method of the invention, the therapeutically effective dose can be estimated initially from cell culture assays, as disclosed herein. For example, a dose can be formulated in animal models to achieve a circulating concentration range that includes the EC50 (effective dose for 50% increase) as determined in cell culture, i.e., the concentration of the test compound which achieves a half-maximal inhibition of bacterial cell growth. Such information can be used to more accurately determine useful doses in humans.
[0463] In general, the compounds prepared by the methods, and from the intermediates, described herein will be administered in a therapeutically or cosmetically effective amount by any of the accepted modes of administration for agents that serve similar utilities. It will be understood, however, that the specific dose level for any particular patient will depend upon a variety of factors including the activity of the specific compound employed, the age, body weight, general health, sex, diet, time of administration, route of administration, and rate of excretion, drug combination, the severity of the particular disease undergoing therapy and the judgment of the prescribing physician. The drug can be administered from once or twice a day, or up to 3 or 4 times a day.
[0464] Dosage amount and interval can be adjusted individually to provide plasma levels of the active moiety that are sufficient to maintain bacterial cell growth inhibitory effects. Usual patient dosages for systemic administration range from 0.1 to 1000 mg/day, preferably, 1-500 mg/day, more preferably 10 - 200 mg/day, even
more preferably 100 - 200 mg/day. Stated in terms of patient body surface areas, usual dosages range from 50-91 mg/m2/day.
[0465] The amount of the compound in a formulation can vary within the full range employed by those skilled in the art. Typically, the formulation will contain, on a weight percent (wt%) basis, from about 0.01-10 wt% of the drug based on the total formulation, with the balance being one or more suitable pharmaceutical excipients. Preferably, the compound is present at a level of about 0.1-3.0 wt%, more preferably, about 1.0 wt%.
[0466] In an exemplary embodiment, the pharmaceutical formulation is an ointment, and comprises a compound described herein or combination described herein or a pharmaceutically acceptable salt thereof.
[0467] In another exemplary embodiment, the pharmaceutical formulation includes a compound described herein or combination described herein or a pharmaceutically acceptable salt thereof and at least one surfactant described herein. In another exemplary embodiment, the formulation comprises a hydroxystearate. In another exemplary embodiment, the hydroxystearate is a member selected from glyceryl monostearate, ethylhexyl hydroxystearate and octyl hydroxystearate.
[0468] In another exemplary embodiment, the pharmaceutical formulation includes a compound described herein or a combination described herein or a pharmaceutically acceptable salt thereof and an alcohol. In another exemplary embodiment, the alcohol is a long chain alcohol or a fatty alcohol. In another exemplary embodiment, the alcohol is a member selected from benzyl alcohol, octyldodecanol, stearyl alcohol, cetyl alcohol, oleyl alcohol. In an exemplary embodiment, the formulation comprises a member selected from benzyl alcohol, octyl comprises at least one compound which is a member selected from hydrocarbon oils, waxes, silicone, cetyl alcohol, isopropyl myristate, stearyl alcohol, oleyl alcohol, ethylhexyl hydroxystearate, octyl hydroxystearate, glycerin, other fatty alcohols hydroxystearate .
[0469] In another exemplary embodiment, the pharmaceutical formulation comprises a compound of the invention and at least one emollient described herein.
[0470] In another exemplary embodiment, the pharmaceutical formulation includes a compound of the invention, and petrolatum.
[0471] In an exemplary embodiment, the pharmaceutical formulation comprises a compound described herein or combination described herein or a pharmaceutically acceptable salt thereof and petrolatum. In an exemplary embodiment, the pharmaceutical formulation comprises a compound described herein or combination described herein or a pharmaceutically acceptable salt thereof and a member selected from hydrocarbon oils, waxes, silicone, cetyl alcohol, isopropyl myristate, stearyl alcohol, oleyl alcohol, ethylhexyl hydroxystearate, octyl hydroxystearate, glycerin, other fatty alcohols hydroxystearate. In an exemplary embodiment, the pharmaceutical formulation comprises a compound described herein or combination described herein or a pharmaceutically acceptable salt thereof and ethylhexyl hydroxystearate and/or octyl hydroxystearate. In an exemplary embodiment, the pharmaceutical formulation comprises a compound described herein or combination described herein or a pharmaceutically acceptable salt thereof, petrolatum and a member selected from hydrocarbon oils, waxes, silicone, cetyl alcohol, isopropyl myristate, stearyl alcohol, oleyl alcohol, ethylhexyl hydroxystearate, octyl hydroxystearate, glycerin, other fatty alcohols hydroxystearate. In an exemplary embodiment, the pharmaceutical formulation comprises a compound described herein or described herein or a pharmaceutically acceptable salt thereof, petrolatum, oleyl alcohol and ethylhexyl hydroxystearate.
[0472] In an exemplary embodiment, the pharmaceutical formulation is a cream, and comprises a compound described herein or combination described herein or a pharmaceutically acceptable salt thereof. [0473] In another exemplary embodiment, the pharmaceutical formulation comprises a compound described herein or combination described herein or a pharmaceutically acceptable salt thereof and a preservative. In an exemplary embodiment, the preservative is a member selected from benzalkonium chloride, benzethonium, chlorohexidine, phenol, m-cresol, benzyl alcohol, methylparaben, propylparaben and other parabens, chlorobutanol, o-cresol, p-cresol, chlorocresol, phenylmercuric nitrate, thimerosal, benzoic acid, and various mixtures thereof. In an
exemplary embodiment, the preservative is a paraben. In an exemplary embodiment, the preservative is a member selected from methyl paraben and propyl paraben.
[0474] In another exemplary embodiment, the pharmaceutical formulation comprises a compound described herein or combination described herein or a pharmaceutically acceptable salt thereof and a chelating agent. In an exemplary embodiment, the chelating agent is edetate sodium.
[0475] Exemplary embodiments are summarized herein below.
[0476] In an exemplary embodiment, the invention provides a compound having a structure according to the formula:
wherein A is a member selected from cycloalkyl, heterocycloalkyl, aryl and heteroaryl; Y is a member selected from O and -S(O)2NH- wherein the sulfur in -S(O)2NH- is covalently attached to A; R3 is a member selected from H, cyano and substituted alkyl; Ra is a member selected from H, -OR20, -NR20R21, -SR20, -S(O)R20, -S(O)2R20, -S(O)2NR20R21, -C(O)R20, -C(O)OR20, -C(O)NR20R21, nitro, cyano, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl wherein each R20 and each R21 is a member independently selected from H, nitro, halogen, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl, with the proviso that R20 and R21, together with the nitrogen to which they are attached, are optionally combined to form a 5- to 7-membered substituted or unsubstituted heterocycloalkyl ring; with the proviso that when Y is O, R is a member selected from cyano and substituted alkyl; with the proviso that when Y is -S(O)2NH-, R3 is H, and Ra is not H or unsubstituted alkyl or halosubstituted alkyl, and salts thereof.
[0477] In an exemplary embodiment, according to the above paragraph, the compound has a structure according to the following formula:
[0478] In an exemplary embodiment, according to any of the above paragraphs, the compound has a structure which is a member selected from:
[0479] In an exemplary embodiment, according to any of the above paragraphs, Ra is a member selected from H, F, Cl, -OR20a and -C(O)OR20b, wherein R20a is alkyl, optionally substituted with a member selected from NH2 and phenyl, wherein R20b is unsubstituted alkyl.
[0480] In an exemplary embodiment, according to any of the above paragraphs, Ra is -O(CH2)nNH2, wherein n is an integer selected from 1 to 6.
[0481] In an exemplary embodiment, according to any of the above paragraphs, n is 2 or 3 or 4.
[0482] In an exemplary embodiment, according to any of the above paragraphs, the compound has a structure according to the formula:
wherein m is an integer selected from 1 to 6 and R , 20 is a member selected from H and unsubstituted alkyl.
[0483] In an exemplary embodiment, according to any of the above paragraphs, m is 1 or 2 or 3.
[0484] In an exemplary embodiment, according to any of the above paragraphs, the compound has a structure according to the formula:
[0485] In an exemplary embodiment, according to any of the above paragraphs,
R , 2z0υ is H.
[0486] In an exemplary embodiment, according to any of the above paragraphs,
R , 20 is Ci or C2 or C3 unsubstituted alkyl. [0487] In an exemplary embodiment, according to any of the above paragraphs, R3 is -CH2COOH or -CH2COOCH3 or -CH2COOCH2CH3.
[0488] In an exemplary embodiment, according to any of the above paragraphs, the compound has a structure according to the formula:
[0489] In an exemplary embodiment, according to any of the above paragraphs, the compound has a structure according to the formula:
[0490] In an exemplary embodiment, according to any of the above paragraphs, C* is a stereocenter which has a (R) configuration.
[0491] In an exemplary embodiment, according to any of the above paragraphs, the compound has a structure according to the formula:
[0492] In an exemplary embodiment, according to any of the above paragraphs,
R , 2z0υ is H.
[0493] In an exemplary embodiment, according to any of the above paragraphs, the compound has a structure according to the formula:
wherein Ra is -0(CH2)DNH2, wherein n is an integer selected from 1 to 6.
[0494] In an exemplary embodiment, according to any of the above paragraphs, the compound has a structure which is:
[0495] In an exemplary embodiment, according to any of the above paragraphs, the compound has a structure according to the formula:
[0496] In an exemplary embodiment, according to any of the above paragraphs, A is a member selected from phenyl, pyridinyl, furanyl, thiophenyl, pyrazolyl, imidazolyl, thiazolyl, triazolyl, and piperidinyl. [0497] In an exemplary embodiment, according to any of the above paragraphs, Ra is a member selected from cyano, nitro, aminoalkyl, hydroxyalkyl, -C(O)(CH2)mlCH3, -COOH, -C(O)O(CH2)mlCH3, -O(CH2)mlCH3, -O(CH2)mlCF3, -O(CH2)miCHF2, -OH, -NH2, -NHCH3, -NHC(O)H, -NHC(O)(CH2)miCH3, -NHOH, -NHS(O)2NH2, -NH2S(O)2CH3, -S(O)2CH3, wherein ml is an integer which is a member selected from 0 to 3.
[0498] In an exemplary embodiment, according to any of the above paragraphs, the compound has a structure according to the formula:
[0499] In an exemplary embodiment, according to any of the above paragraphs, the compound has a structure according to the formula:
[0500] In an exemplary embodiment, according to any of the above paragraphs, Ra is a member selected from OH and NH2.
[0501] In an exemplary embodiment, the invention is a combination comprising: a) a compound according to any of the above paragraphs, or a pharmaceutically acceptable salt thereof; and b) a therapeutically active agent.
[0502] In an exemplary embodiment, according to any of the above paragraphs, the therapeutically active agent is an antibiotic which comprises a β-lactam moiety.
[0503] In an exemplary embodiment, the invention is a pharmaceutical formulation comprising: a) a compound or a combination according to any of the above paragraphs, or a pharmaceutically acceptable salt thereof; and b) a pharmaceutically acceptable excipient. [0504] In an exemplary embodiment, according to any of the above paragraphs, the pharmaceutical formulation is a unit dosage form.
[0505] In an exemplary embodiment, according to any of the above paragraphs, the pharmaceutical formulation is a member selected from an oral unit dosage form and a topical unit dosage form. [0506] In an exemplary embodiment, the invention is a method of treating a bacterial infection comprising: administering to an animal suffering from said infection an effective amount of a compound according to any of the above paragraphs, or a pharmaceutically-acceptable salt thereof, and an effective amount of an antibiotic, or a pharmaceutically acceptable salt thereof, wherein said antibiotic comprises a β-lactam moiety, thereby treating the bacterial infection.
[0507] In an exemplary embodiment, according to any of the above paragraphs, a bacteria involved with the infection is resistant to said antibiotic.
[0508] In an exemplary embodiment, according to any of the above paragraphs, the antibiotic is a member selected from a penicillin, cephalosporin, monobactam, carbapenem and derivatives thereof.
[0509] In an exemplary embodiment, according to any of the above paragraphs, the antibiotic is a penicillin or derivatives thereof.
[0510] In an exemplary embodiment, according to any of the above paragraphs, the penicillin is a member selected from narrow spectrum penicillins, narrow spectrum penicillinase-resistant penicillins, narrow spectrum β-lactamase-resistant penicillins,
moderate spectrum penicillins, broad spectrum penicillins and extended spectrum penicillins
[0511] In an exemplary embodiment, according to any of the above paragraphs, the penicillin is a narrow spectrum penicillin which is a member selected from benzathine penicillin, benzylpenicillin (penicillin G), phenoxymethylpenicillin (penicillin V) and procaine penicillin.
[0512] In an exemplary embodiment, according to any of the above paragraphs, the penicillin is a narrow spectrum penicillinase-resistant penicillins which is a member selected from methicillin, dicloxacillin and flucloxacillin. [0513] In an exemplary embodiment, according to any of the above paragraphs, the penicillin is a narrow spectrum β-lactamase-resistant penicillin which is temocillin.
[0514] In an exemplary embodiment, according to any of the above paragraphs, the penicillin is a moderate spectrum penicillin which is a member selected from amoxicillin and ampicillin. [0515] In an exemplary embodiment, according to any of the above paragraphs, the penicillin is a broad spectrum penicillin which is a member selected from co- amoxiclav (amoxicillin and clavulanic acid).
[0516] In an exemplary embodiment, according to any of the above paragraphs, the penicillin is an extended spectrum penicillin, which is a member selected from azlocillin, carbenicillin, ticarcillin, mezlocillin and piperacillin.
[0517] In an exemplary embodiment, according to any of the above paragraphs, the antibiotic is a cephalosporin or a derivative thereof.
[0518] In an exemplary embodiment, according to any of the above paragraphs, the cephalosporin is a member selected from a first-generation cephalosporin, second- generation cephalosporin, second-generation cephamycin, third-generation cephalosporin and fourth-generation cephalosporin.
[0519] In an exemplary embodiment, according to any of the above paragraphs, the cephalosporin is a member selected from cefalexin, cephalothin and cefazolin.
[0520] In an exemplary embodiment, according to any of the above paragraphs, the cephalosporin is a member selected from cefaclor, cefuroxime and cefamandole.
[0521] In an exemplary embodiment, according to any of the above paragraphs, the cephalosporin is a member selected from cefotetan and cefoxitin.
[0522] In an exemplary embodiment, according to any of the above paragraphs, the cephalosporin is a member selected from ceftriaxone, cefotaxime, cefpodoxime and ceftazidime.
[0523] In an exemplary embodiment, according to any of the above paragraphs, the cephalosporin is a member selected from cefepime and cefpirome.
[0524] In an exemplary embodiment, according to any of the above paragraphs, the antibiotic is a monobactam. [0525] In an exemplary embodiment, according to any of the above paragraphs, the monobactam is aztreonam.
[0526] In an exemplary embodiment, according to any of the above paragraphs, the antibiotic is a carbapenem.
[0527] In an exemplary embodiment, according to any of the above paragraphs, the carbapenem is a member selected from imipenem, cilastatin, meropenem, ertapenem and faropenem.
[0528] In an exemplary embodiment, according to any of the above paragraphs, said animal is a human.
[0529] In an exemplary embodiment, the invention is a method of killing or inhibiting the growth of a bacteria, said method comprising: contacting said bacteria with an effective amount of a compound or a combination according to any of the above paragraphs, or a pharmaceutically acceptable salt thereof, thereby killing or inhibiting the growth of the bacteria.
[0530] In an exemplary embodiment, according to any of the above paragraphs, the method further comprises contacting said bacteria with an effective amount of an antibiotic, or a pharmaceutically acceptable salt thereof, wherein said antibiotic comprises a β-lactam moiety.
[0531] In an exemplary embodiment, according to any of the above paragraphs, the bacteria is resistant to said antibiotic.
[0532] In an exemplary embodiment, the invention is a method of inhibiting a β- lactamase, comprising contacting the β-lactamase with an effective amount of a compound according to any of the above paragraphs, or a pharmaceutically acceptable salt thereof, thereby inhibiting the β-lactamase. [0533] In an exemplary embodiment, according to any of the above paragraphs, the β-lactamase is a member selected from a Group 1 β-lactamase, a Group 2 β- lactamase, a Group 3 β-lactamase, and a Group 4 β-lactamase.
[0534] In an exemplary embodiment, according to any of the above paragraphs, the Group 1 β-lactamase is a cephalosporinase. [0535] In an exemplary embodiment, according to any of the above paragraphs, the Group 2 β-lactamase is a member selected from penicillinase, a Group 2b, Group 2be, Group 2br, carbenicillinase, cloxacilanase, cephalosporinase and carbapenamase.
[0536] In an exemplary embodiment, according to any of the above paragraphs, the Group 3 β-lactamase is a metallo-β-lactamase. [0537] In an exemplary embodiment, according to any of the above paragraphs, the Group 4 β-lactamase is a penicillinase.
[0538] In an exemplary embodiment, according to any of the above paragraphs, the β-lactamase is a member selected from a class A β-lactamase, a class B β- lactamase, a class C β-lactamase, and a class D β-lactamase. [0539] In an exemplary embodiment, according to any of the above paragraphs, the class A β-lactamase is a member selected from a TEM β-lactamase, SHV β- lactamase, CTX-M β-lactamase and a KPC β-lactamase.
[0540] In an exemplary embodiment, according to any of the above paragraphs, the class C β-lactamase is a member selected from a CMY β-lactamase and a AmpC β-lactamase.
[0541] In an exemplary embodiment, according to any of the above paragraphs, the class D β-lactamase is an OXA β-lactamase.
[0542] In an exemplary embodiment, according to any of the above paragraphs, the β-lactamase is a metallo β-lactamase.
[0543] In an exemplary embodiment, according to any of the above paragraphs, the metallo β-lactamase is a member selected from an IMP carbapenemase and a VIM β-lactamase.
[0544] In an exemplary embodiment, the invention is a method of treating a bacterial infection comprising: administering to an animal suffering from said infection an effective amount of a compound according to any of the above paragraphs, or a pharmaceutically-acceptable salt thereof, thereby treating the bacterial infection.
[0545] In an exemplary embodiment, the invention is a method of inhibiting the editing domain of a t-RNA synthetase, comprising: contacting the synthetase with an effective amount of a compound according to any of the above paragraphs, or a pharmaceutically-acceptable salt thereof, thereby inhibiting the synthetase.
[0546] In an exemplary embodiment, according to any of the above paragraphs, the synthetase is a leucyl t-RNA synthetase. [0547] In an exemplary embodiment, the invention is the use of a compound or a combination according to any of the above paragraphs, or a pharmaceutically acceptable salt thereof, in the manufacture of a medicament for the treatment and/or prophylaxis of bacterial infection.
[0548] The invention is further illustrated by the Examples that follow. The Examples are not intended to define or limit the scope of the invention.
EXAMPLES
[0549] Proton NMR are recorded on Varian AS 300 spectrometer and chemical shifts are reported as δ (ppm) down field from tetramethylsilane. Mass spectra are determined on Micromass Quattro II.
ABBREVIATIONS
AcOH acetic acid
ACTBr cetyltrimethylammonium bromide
Cs2CO3 cesium carbonate
DCM dichloromethane
DIEA diisopropylethylamine
DMAP 4-(dimethylamino)pyridine
DME 1 ,2-dimethoxyethane
DMF N,N-dimethylformamide
DMSO dimethylsulfoxide
EtOAc ethyl acetate
EtOH ethanol
Et2O diethyl ether h hour(s)
HATU O-(7-azabenzotriazol-l-yl)-N,N,N',N'- tetramethyluronium hexafluorophosphate
HCl hydrochloric acid
HPLC high pressure liquid chromatography
ISCO Companion automated flash chromatography equipment with fraction analysis by UV absorption available from Presearch.
K2OAc potassium acetate
K2CO3 potassium carbonate
LiAlH4 Or LAH lithium aluminum hydride
LDA lithium diisopropylamide
LHMDS lithium bis(trimethylsilyl) amide
KHMDS potassium bis(trimethylsilyl) amide
LiOH lithium hydroxide
MeCN acetonitrile
MeOH methanol
MgSO4 magnesium sulfate mins or min minutes
Mp or MP melting point
NaOH sodium hydroxide
Na2SO4 sodium sulfate
NH4Cl ammonium chloride
N2 nitrogen
NMM N-methyl morpholine n-BuLi n-butyllithium
PdCl2(pddf) [ 1 , 1 ' -bis(diphenylphosphino)ferrocene]palladium(II) chloride 1 : 1 complex with dichloro-methane
RT or rt room temperature
TFA trifluoroacetic acid
Tf2O trifluoromethanesulfonic anhydride
THF tetrahydrofuran
H2O water
EXAMPLE 1 El. 3H-Benzotcltl,21oxaborole-l,6-diol
[0550] To a solution of 2-hydroxy-4-methoxy-benzaldehyde (30.0 g, 0.197 mol) and pyridine (77.98 g, 0.986 mol) in dichloromethane (120 rnL) was slowly added Tf2O (83.44 g, 0.296 mol) at -10 to 0 0C over a 2.5 h period. The mixture was stirred at 0 0C for 30 min. Ice-water (150 mL) was added, and the mixture was acidified with diluted hydrochloric acid to pH 2. The resulting mixture was extract with 50% EtOAc/hexanes (2 x 400 mL). The extract was washed with brine, dried and concentrated to dryness to give 51.01 g (91.1% yield) of product as pale-yellow oil. 1H NMR (400 MHz, CDCl3) ^ 10.13 (s, 1 H), 7.95 (d, J= 8.79 Hz, 1 H), 7.03 (dd, J = 8.79, 2.34 Hz, 1 H), 6.88 (d, J= 2.34 Hz, 1 H), 3.93 (s, 3 H). MS (ESI) m/z = 285 [M + H]+.
Step 2 4-Methoxy-2- (4, 4, 5, 5-tetramethyl-[l, 3, 2]dioxaborolan-2-yl)-benzaldehyde
[0551] To a solution of bis(pinacolato)diborane (58.66 g, 0.231 mol) in dioxane (600 mL) was added KOAc (52.33 g, 0.533 mol). After degassed for 15 min with nitrogen, PdCl2(dppf) (13.0 g, 0.0178 mol) and trifluoro-methanesulfonic acid 2- formyl-5-methoxy-phenyl ester (50.51 g, 0.178 mol) were added to the reaction mixture. The mixture was stirred at 80 0C for 45 min. The reaction was quenched by adding ice-water (400 mL). The resulting mixture was extract with 50% EtOAc/hexanes (2 x 600 mL). The extract was washed with brine, dried and concentrated to dryness. The residue was purified by chromatography on silica gel (EtOAc/hexanes = 1 :3) to give 43.48 g (93.2% yield) of product as pale-yellow waxy solid. 1H NMR (400 MHz, CDCl3) δ 10.88 (s, 1 H), 8.40 - 8.48 (m, 1 H), 8.44 (d, J =
8.50 Hz, 1 H), 7.80 (d, J= 2.64 Hz, 1 H), 7.54 (dd, J= 8.50, 2.64 Hz, 1 H), 4.41 (s, 3 H), 1.91 (s, 12 H). MS (ESI) m/z = 263 [M + H]+.
Step 3 6-Methoxy-3H-benzo[c] [l,2]oxaborol-l-ol
[0552] To a solution of 4-methoxy-2-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2- yl)-benzaldehyde (25.0 g, 95.4 mmol) in methanol (160 niL) was slowly added NaBH4 powder (10.82 g, 0.286 mol) at 0-10 0C. After stirred for 1 h at room temperature, the mixture was concentrated to remove one-third of methanol. The resulting mixture was cooled to 0 0C, acidified to pH 3 using diluted hydrochloric acid and diluted to two fold with cold water. The white precipitate was collected, washed with 30% MeOH/H2O, water, and dried to give 11.5 g (73.5% yield) of product as white solid. 1H NMR (400 MHz, DMSO-J6) δ 9.11 (s, 1 H), 7.29 (d, J= 8.21 Hz, 1 H), 7.23 (d, J= 2.34 Hz, 1 H), 7.03 (dd, J= 8.21, 2.34 Hz, 1 H), 4.90 (s, 2 H), 3.75 (s, 3 H). E2. 3H-Benzofclfl.21oxaborole-1.6-diol
[0553] To a solution of 6-methoxy-3H-benzo[c][l,2]oxaborol-l-ol (10.0 g, 61.0 mmol) in dichloromethane (400 mL) was slowly added boron tribromide (134 mL, 1 M in DCM, 0.134 mol) at -10 to -5 0C. The mixture was stirred at 0 0C to room temperature for 3 h. The reaction mixture was poured into ice-water (300 mL). The resulting mixture was extract with EtOAc (600 mL). The extract was washed with brine, dried and concentrated to dryness to give 9.11 g (99.6% yield) of product as off-white foam. 1U NMR (400 MHz, DMSO-J6) δ 9.27 (br. s., 1 H), 9.03 (br. s., 1 H), 7.16 (d, J= 8.20 Hz, 1 H), 7.08 (d, J= 2.34 Hz, 1 H), 6.86 (dd, J= 8.20, 2.34 Hz, 1 H). MS (ESI) m/z = 151 [M + H]+.
E3. 6-(3-Methoxy-phenoxy)-3H-benzofcloxaborol-l-ol
Step 1. 2-Bromo-4-(3-methoxy-phenoxy)-benzaldehyde
[0554] A mixture of 3-methoxy-phenol (5.00 g, 40.32 mmol), 2-bromo-4-fluoro- benzaldehyde (8.18 g, 40.32 mmol) and K2CO3 (8.34 g, 60.48 mmol) in DMF (40 mL) was heated at 80 0C for 16 h, cooled to RT , diluted with water (100 mL), the solid formed was collected and washed with water, dried to give compound 2-bromo- 4-(3-methoxy-phenoxy)-benzaldehyde (11.3 g, 91% yield) as a brown solid. 1HNMR (400MHz, CDCl3) δ 10.25 (s, IH), 7.90 (d, J= 7.2 Hz, IH), 7.35 (m, 1 H), 7.20 (s, 1 H), 7.00 (d, J= 7.1 Hz, 1 H), 6.81 (m, 1 H), 6.70 - 6.60 (m, 2 H), 3.80 (s, 3 H).
Step 2. 4- (3-Methoxy-phenoxy)-2-(4, 4, 5, 5-tetramethyl-[l, 3, 2] dioxaborolan-2- yl)benzaldehyde
[0555] A mixture of 2-bromo-4-(3-methoxy-phenoxy)-benzaldehyde (2.40 g, 7.82 mmol), bis(pinacolato)diborane (2.98 g, 11.73 mmol) Pd(dppf)Cl2 (0.57 g, 0.78 mmol) and KOAc (2.30 g, 23.46 mmol) in dioxane (30 mL) was degassed for 10 min, heated at 90 0C for 2 h, diluted with EtOAc (100 mL), filtered through a pad of Celite and concentrated. The residue was purified by chromatography to give compound 4- (3-methoxy-phenoxy)-2-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2-yl)benzaldehyde (1.90 g, 68% yield) as an off-yellow oil. 1HNMR (400MHz, CDCl3) δ 10.40 (s, IH), 7.93 (d, J= 8.1 Hz, 1 H), 7.44 (s, 1 H), 7.25 (m, 1 H), 7.03 (m, 1 H), 6.75 (m, IH), 6.60 (m, 2 H), 3.80 (s, 3 H), 1.40 (s, 12 H).
Step 3. 6-(3-Methoxy-phenoxy)-3H-benzo[c]oxaborol-l-ol
[0556] To a cooled (0 0C) solution of 4-(3-methoxy-phenoxy)-2-(4,4,5,5- tetramethyl-[l,3,2]-dioxaborolan-2-yl)benzaldehyde (3.2 g, 9.01 mmol) in MeOH (20 niL) and THF (20 niL) was added NaBH4 (0.75 g, 19.83 mol) in portions. After the addition was over, the mixture was stirred at 0 0C for 30 min, quenched with 6 N HCl until pH 3, stirred at pH 3 for 20 min, neutralized with NaHCO3, extracted with dichloromethane, dried and concentrated. The residue was purified by chromatography to give 6-(3-methoxy-phenoxy)-3H-benzo[c]oxaborol-l-ol (1.6 g, 69% yield) as an oil. 1H NMR (DMSO-J6, 400MHz) δ 9.17 (s, 1 H), 7.40 (d, J= 8.2 Hz, 1 H), 7.30 - 7.20 (m, 2 H), 7.18 (m, 1 H), 6.71 (m, 1 H), 6.56 (s, 1 H), 6.50 (m, 1 H), 4.98 (s, 2 H), 3.70 (s, 3 H). MS (ESI) m/z = 257 [M + I]+.
E4. 6-(3-Benzyloxy-phenoxy) - 3H-benzotcl tl,21oxaborol-l-ol
[0557] A mixture of 3-benzyloxy-phenol (5.00 g, 23.81 mmol), 2-bromo-4-fluoro- benzaldehyde (4.84 g, 25 mmol) and K2CO3 (5.18 g, 37.5 mmol) in DMF (30 mL) was heated at 8O0C for 16 h, cooled to RT , diluted with EtOAc, filtered through a pad of Celite and concentrated. The residue was purified by chromatography to give compound 4-(3-benzyloxy-phenoxy)-2-bromo-benzaldehyde (7.7 g, 100% yield). 1HNMR (400MHz, CDCl3) δ 10.23 (s, 1 H), 7.90 (d, J= 2.4 Hz, 1 H), 7.50 - 7.30 (m, 6 H), 7.20 (s, 1 H), 6.98 (m, 1 H), 6.85 (m, 1 H), 6.70 (m, 2 H), 5.03 (s, 2 H).
Step 2. 4- (3-Benzyloxy-phenoxy)-2- (4, 4, 5, 5-tetramethyl-[l, 3, 2] dioxaborolan-2- yljbenzaldehyde
[0558] A mixture of 4-(3-benzyloxy-phenoxy)-2-bromo-benzaldehyde (4.30 g, 13.30 mmol), bis(pinacolato)diborane (5.07 g, 19.97 mmol), Pd(dppf)Cl2 (0.97 g, 1.33 mmol) and KOAc (3.91 g, 39.90 mmol) in dioxane (40 mL) was degassed for 10 min, heated at 9O0C for 2 h, diluted with EtOAc (100 mL), filtered through a pad of Celite and concentrated. The residue was purified by chromatography to give 4-(3- benzyloxy-phenoxy)-2-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2-yl)benzaldehyde (4.31 g, 87% yield) as an off-white solid. 1HNMR (400MHz, CDCl3) δ 10.40 (s, 1 H), 7.92 (d, J= 2.4 Hz, 1 H), 7.50 - 7.20 (m, 8 H), 7.03 (m, 1 H), 6.80 (m, 1 H), 6.70 - 6.60 (m, 1 H), 5.03 (s, 2 H), 1.40 (s, 12 H).
Step 3. 6-(3-Benzyloxy-phenoxy) - 3H-benzo[c] [1 ,2] oxaborol-1 -ol
[0559] To a cooled (0 0C) solution of 4-(3-benzyloxy-phenoxy)-2-(4,4,5,5- tetramethyl-[l,3,2]dioxaborolan-2-yl)benzaldehyde (2.08 g, 2.18 mmol) in MeOH (10 mL) and THF (8 mL) was added NaBH4 (0.47 g, 12.33 mol) in portions. After the addition was over, the mixture was stirred at 0 0C for 10 min, quenched with 3 N HCl until pH 3, stirred at pH 3 for 20 min, extracted with EtOAc, dried and concentrated. The residue was recrystallized from dichloromethane and hexane to give 6-(3- benzyloxy-phenoxy) - 3H-benzo[c][l,2]oxaborol-l-ol (660 mg, 35% yield). Mp 168 - 170 0C. 1H NMR (400 MHz, DMSO-J6) δ 9.20 (s, 1 H), 7.50 - 7.23 (m, 8 H), 7.20 (m, 1 H), 6.80 (m, 1 H), 6.63 (s, 1 H), 6.52 (m, 1 H), 5.10 (s, 2 H), 4.98 (s, 2 H). MS (ESI) m/z = 333 [M + I]+
E5. 6-(3-Hydroxy-phenoxy) - 3H-benzotcltl,21oxaborol-l-ol
[0560] A solution of 6-(3-benzyloxy-phenoxy) - 3H-benzo[c][l,2]oxaborol-l-ol (260 mg) in EtOAc was hydrogenated under 50 psi with H2 in the presence of 10% 5 Pd-C (50 mg) for 2 h, filtered through a pad of Celite and concentrated. The residue was purified by prep-HPLC to give 6-(3-hydroxy-phenoxy) - 3H- benzo[c][l,2]oxaborol-l-ol (40 mg). Mp 159 -1610C. 1H NMR (DMSO-J6, 400MHz) δ 9.50 (br s, 1 H), 9.17 (s, 1 H), 7.49 (m, 1 H), 7.27 (s, IH), 7.10 (m, 2 H), 6.50 (d, J= 6.7 Hz, 1 H), 6.40 (d, J= 6.6 Hz, 1 H), 6.30 (s, 1 H), 4.96 (s, 2 H). MS 10 (ESI) m/z = 243 [M + H]+.
E6. 3-(l-Hydroxy-l,3-dihydro-benzo fell 1,2 }oxaborol-6-yloxy)-benzoic acid methyl ester
[0561] A stirred solution of 2-bromo-4-fluorobenzaldehyde (5.0 g, 24.6 mmol), methyl 3-hydroxybenzoate (3.74 g , 24.6 mmol) and K2CO3 (5.09 g, 36.9 mmol) in DMF (40 mL) was heated at 100 0C for 12 h. The reaction mixture was cooled to room temperature and water (100 mL) was added, extracted with EtOAc (3 x 25 mL), 0 dried over MgSO4, concentrated and column chromatographed over silica gel afforded 3-(3-bromo-4-formyl-phenoxy)-benzoic acid methyl ester (7.8 g, 94% yield). 1H NMR (400 MHz, CDCl3) δ 10.26 (s, 1 H), 7.95-7.90 (m, 2 H), 7.75-7.74 (m, 1 H), 7.52 (t, J= 8 Hz, 1 H), 7.30 (dd, J= 2.8, 8 Hz, 1 H), 7.17 (d, J= 2.4 Hz, 1 H), 6.98 (dd, J= 4, 12 Hz, 1 H), 3.92 (s, 3 H). MS (ESI) m/z = 335 [M+H]+ .
Step 2. 3-[4-Formyl-3-(4, 4, 5, 5-tetramethyl-[l, 3, 2] dioxaborolan-2-yl)-phenoxy] - benzoic acid methyl ester
[0562] A solution of 3-(3-bromo-4-formyl-phenoxy)-benzoic acid methyl ester (3.0 g, 8.95 mmol) in anhydrous 1,4-dioxane (100 rnL) was degassed for 15 minutes, to this was added bis(pinacolato)diborane (4.54 g, 17.9 mmol), PdCl2(dppf) (0.65 g, 0.89 mmol), KOAc (2.63 g, 26.8 mmol) and the resulting solution was warmed at 80 0C for 3h. The reaction mixture was then cooled and filtered through a Celite pad. The filtrate was evaporated, and the residue was dissolved in EtOAc (100 mL), washed with water (2 x 20 mL), dried, concentrated and purified by column chromatography over silica gel to provide 3-[4-Formyl-3-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2- yl)-phenoxy]-benzoic acid methyl ester (2.0 g, 59% yield). 1H NMR (400 MHz, CDCl3) δ 10.42 (s, 1 H), 7.95 (d, J= 8.8 Hz, 1 H), 7.87 (d, J= 8 Hz, 1 H), 7.70 (t, J = 2Hz, 1 H), 7.48-7.43 (m, 2 H), 7.24 (dd, J= 4, 8 Hz, 1 H), 7.05 (dd, J= 4, 10 Hz, 1 H), 3.91 (s, 3 H), 1.38 (s, 12 H). MS (ESI) m/z = 383 [M + H]+.
Step 3. 3-(l-Hydroxy-l,3-dihydro-benzo[c] [ 1 ,2] oxaborol-6-yloxy)-benzoic acid methyl ester
[0563] To a stirred solution of 3-[4-formyl-3-(4,4,5,5-tetramethyl- [l,3,2]dioxaborolan-2-yl)-phenoxy]-benzoic acid methyl ester (0.48 g, 1.26 mmol) in MeOH (10 mL) at 0 0C was added NaBH4 (0.024 g, 0.63 mmol) and the resulting solution was stirred for 2 h slowly warming to room temperature. Solvent was concentrated to 2 mL and 5 mL of 3N HCl was added at 0 0C and stirred for 16 h. Volatiles were evaporated off and the residue was extracted with EtOAc (2 x 10 mL), washed with water (10 mL), dried over MgSO4 and purified by column chromatography over silica gel furnished 3 -(I -hydroxy- 1,3 -dihy dro- benzo[c][l,2]oxaborol-6-yloxy)-benzoic acid methyl ester (0.2 g, 55% yield) as a viscous oil. 1H NMR (400 MHz, CDCl3) δ 9.21 (s, 1 H), 7.69 (dd, J= 1.2, 5.4 Hz, 1
H), 7.53 (t, J= 8 Hz, 1 H), 7.46 - 7.39 (m, 2 H), 7.33 - 7.31 (m, 2 H), 7.21 (dd, J = 2.4, 8.4 Hz, 1 H), 4.97 (s, 2 H), 3.80 (s, 3 H). MS (ESI) m/z = 285 [M + H]+.
E7. S-d-Hydroxy-U-dihydro-benzotcimioxaborol-ό-yloxyi-benzoic acid
[0564] To a stirred solution of 3-(l-hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-6- yloxy)-benzoic acid methyl ester (0.085 g, 0.29 mmol) in THF:H2O (10 mL, 5:1) at room temperature was added LiOH and the reaction mixture was stirred for 12 h at room temperature. Acidified to pH 3 with 6 N HCl, extracted with EtOAc (2 x 10 mL), washed with water, dried and purified by column chromatography over silica gel furnished 3-(l-Hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-6-yloxy)-benzoic acid
(0.075 g, 93% yield) as a white solid. Mp 192 - 194 0C. 1H NMR (400 MHz, CDCl3) δ 9.25 (s, 1 H), 7.70 (d, J= 8 Hz, 1 H), 7.54 - 7.47 (m, 2 H), 7.38 (dd, J= 2, 16.4 Hz, 2 H), 7.30 (dd, J= 2, 7.8 Hz, 1 H), 7.24 (dd, J= 2, 8 Hz, 1 H), 5.0 (s, 2 H). MS (ESI) m/z = 269 [M - H]". E8. Ethyl 4-(l-hvdroxy-l,3-dihvdrobenzofclfl,2]oxaborol-6-yloxy)benzoate
[0565] Bromo-4-fluoro benzaldehyde 10 g (49.26 mmol) and Ethyl 4- hydroxybenzoate 8.19 (49.26 mmol) were mixed in a solution of DMF (50 mL). To this was added potassium carbonate 10.2 Ig (73.89 mmol). The reaction mixture was stirred at 1000C (oil bath) for 17 hour under N2. Cooled to room temperature, mixture of EtOAc and water was added. Stirred for 30 min, concentrated via rotary evaporation to remove most of organic solvent. Filtered, washed with water, dried to get the target molecule, 17 g (98.8% yield) as white solid. 1H NMR (DMSO-J6, 300MHz) δ ppm 10.13 (s, 1 H), 8.03 (d, 2 H, J= 8.7Hz) , 7.89 (d, 1 H, J= 8.7 Hz), 7. 45 (m, IH), 7.26 (d, 2 H, J= 8.7 Hz), 7.19 (m, 1 H), 4.30 (q, 2 H) and 1.30 (t, 3 H).
Step 2. Ethyl 4- (4-formyl-3- (4, 4, 5, 5-tetramethyl-l, 3, 2-dioxaborolan-2- yl)phenoxy)benzoate
[0566] To a solution of ethyl 4-(3-bromo-4-formylphenoxy)benzoate (6.98 g, 20 mmol), KOAc (5.88 g, βOOmmol), bis(pinacolato)diboron (6.1Og, 24 mmol,) in anhydrous 1,4-dioxane (8OmL) was added PdCl2(dppf)2 (408 mg; 2.5 mol%). The reaction mixture was degassed with N2, and then heated at 8O0C with magnetic stirring. The reaction was monitored with TLC and was completed after 8 hours. The mixture was cooled to room temperature, filtered through celite and washed with ethyl acetate and then evaporated. The residue was dissolved in minimum EtOAc and passed through a very short but big silica gel column eluted with a mixed solvent of hexane : EtOAc (3:1, v/v) to remove dark color giving a light yellow oil. Chromatography on silica gel again (Hexane/EtOAc 7:3). The product was collected and concentrated as colorless oil 9 g (100% yield). 1U NMR (DMSO-J6, 300MHz) δ ppm 10.24 (s, IH), 7.99 (m, 3 H), 7.29 (m, 2 H), 7.17 (d, J= 9 Hz, 2 H), 4.30 (q, 2 H), 1.29 (s, 12 H) and 1.31 (t, 3 H).
Step 3. Ethyl 4-(l-hydroxy-l,3-dihydrobenzo[c] [l,2]oxaborol-6-yloxy)benzoate
[0567] To a solution of ethyl 4-(4-foπnyl-3-(4 ,4,5,5-tetramethyl-l ,3,2- dioxaborolan-2-yl)phenoxy)benzoate in MeOH was added NaBH4 portion wise at O0C. Stirred at O0C to rt for 6 hr. Added 3N HCl aqueous solution till pH = 2. Concentrated by rota vapor to remove solvent. No solid precipitated out. Extracted with EtOAc, dried, and concentrated. Chromatography (Hexane/EtOAc) was employed to get the target molecule. 1H NMR (DMSO-J6, 300MHz) δ ppm 9.21 (s, IH), 7.94 (d, J= 8.1 Hz, , 2 H), 7.48 (d, J= 8.1 Hz, 1 H), 7.38 (d, J= 2.4 Hz, I H),
7.25 (dd, J= 8.1, 2.4 Hz, 1 H), 7.03 (d, J= 7.8 Hz, 2 H), 4.99 (s, 2 H), 4.27 (t, 2 H) and 1.29 (t, 3 H). MS (ESI) m/z 269.1 [M-H]".
E9. 4-d-Hydϊ oxy-1, 3-dihydrobenzotcltl, 2) 'oxaborol-6-yloxy)benzoic acid
[0568] E9 was synthesized using the similar procedure in E55 using ethyl 4-(l- hydroxy-l,3-dihydrobenzo[c][l,2]oxaborol-6-yloxy)benzoate as starting material. Mp 197-200 0C. 1H NMR (DMSO-J6, 300MHz) δ 12.83 (s, 1 H), 9.22 (s, 1 H), 7.93 (m, 2 H) , 7.48 (d, 1 H, J= 8.4 Hz), 7.38 (d, I H, J= 2.1 Hz), 7.25 (dd, 1 H, J= 2.1, 7.8 Hz), 7.01 (m, 1 H), 4.98 (s, 2 H). MS (ESI) m/z 269.1 [M-H]" . ElO. 6-(3-Hvdwxymethyl-phenoxy)-3H-benzofcJfl,2Joxabowl-l-ol
[0569] To a stirred solution of 3-(l-hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-6- yloxy)-benzoic acid methyl ester (0.18 g, 0.63 mmol) in THF (10 mL) at 0 0C was added LiAlH4 (0.036 g, 0.95 mmol) and the reaction mixture was stirred for 3 h slowly warming to room temperature. The reaction was quenched by the addition of IN HCl (5 mL) at 0 0C, extracted with EtOAc (2 x 10 mL), washed with water, dried and purified by column chromatography over silica gel furnished 6-(3- hydroxymethyl-phenoxy)-3H-benzo[c][l,2]oxaborol-l-ol ( 0.14 g, 86% yield) as a white solid. Mp: 256 - 258 0C. 1H NMR (400 MHz, CDCl3) δ 9.2 (s, 1 H), 7.41 (d, J == 8 Hz, I H), 7.31 - 7.26 (m, 2 H), 7.15 (dd, J= 2.4, 8.4 Hz, 1 H), 7.0 (d, J= 8 Hz, 1 H), 6.91 - 6.84 (m, 2 H), 5.23 (t, J= 6 Hz, 1 H), 4.95 (s, 2 H), 4.45 (d, J= 6 Hz, 2 H). MS (ESI) m/z = 255 [M - H]".
Ell. 6-(3-Nitro-phenoxy)-3H-benzofclfl,21oxaborol-l-ol
Step 1. 2-Bromo-4-(3-nitro-phenoxy)-benzaldehyde
[0570] An orange suspension of 2-bromo-4-fluoro-benzaldehyde (5.00 g, 24.62 mmol), 3-nitro-phenol (3.76 g, 27.02 mmol) and potassium carbonate (5.1O g, 36.90 mmol) in Λ/,N'-dimethylformamide (20 mL) was heated at 80 0C for 4 hours. The mixture was cooled to room temperature, then diluted with water and extracted with ethyl acetate. The extracts were dried (Na2SO4), filtered, and concentrated to afford 2-bromo-4-(3-nitro-phenoxy)-benzaldehyde (7.9 g, crude, quantitative), as a light beige solid. 1H NMR (400 MHz, CDCl3) δ 10.29 (s, IH), 8.12 (d, J= 8.21 Hz, IH), 7.98-7.92 (m, 2H), 7.62 (t, J= 8.21 Hz, IH), 7.42 (dd, J= 8.21, 1.95 Hz, IH), 7.25 (d, J= 2.35 Hz, IH), 7.05 (dd, J= 8.60, 2.35 Hz, IH).
Step 2. 4- (3-Nitro-phenoxy)-2- (4, 4, 5, 5-tetramethyl-[l, 3, 2] dioxaborolan-2-yl)- benzaldehyde
[0571] A yellow suspension of 2-bromo-4-(3-nitro-phenoxy)-benzaldehyde (3.00 g, 9.31 mmol), bis(pinacolato)diborane (3.55 g, 13.98 mmol), and potassium acetate (2.74 g, 27.93 mmol) in 1,4-dioxane (30 mL) was degassed with nitrogen gas for 15 minutes, then treated with [l,r-bis(diphenylphosphino)ferrocene]palladium(II) chloride 1 :1 complex with dichloro-methane (1.36 g, 1.86 mmol). The resulting mixture was heated at 80 0C overnight. The mixture was cooled to room temperature, then diluted with ethyl acetate. The suspension was filtered through a pad of Celite and the pad was washed with ethyl acetate. The filtrate was concentrated to a brown residue, then purified by column chromatography (silica gel, 10-20% ethyl acetate/hexanes gradient elution) to afford 4-(3-nitro-phenoxy)-2-(4,4,5,5-tetramethyl-
[l,3,2]dioxaborolan-2-yl)-benzaldehyde (2.70 g, 79 % yield) as a light beige solid. 1H NMR (400 MHz, CDCl3) δ 10.49 (s, 1 H), 8.06-8.00 (m, 2 H), 7.87 (br s, 1 H), 7.55 (t, J= 8.21 Hz, 1 H), 7.49 (d, J= 2.35 Hz, 1 H), 7.37 (d, J= 7.03 Hz, 1 H), 7.15 (dd, J = 8.21, 2.35 Hz, 1 H), 1.39 (s, 12 H).
Step 3. 6-(3-Nitro-phenoxy)-3H-benzo [c] [ 1 ,2] oxaborol- l-ol
[0572] An ice-cold light yellow solution of 4-(3-nitro-phenoxy)-2-(4,4,5,5- tetramethyl-[l,3,2]dioxaborolan-2-yl)-benzaldehyde, (2.70 g, 7.30 mmol) in methanol (20 niL) was treated with sodium borohydride (0.28 g, 7.40 mmol) in portions. The mixture was stirred for 30 minutes, then quenched with 6 M HCl. The mixture was stirred for 30 minutes then extracted with ethyl acetate. The organic extracts were dried (Na2SO4), filtered, and concentrated in vacuum to give a yellow oil. The residue was absorbed onto silica gel then loaded onto a column and eluted with hexanes/ethyl acetate (5:1 to 1 :2 gradient) to afford a white foam. The foam was triturated with methanol and water. The white solid was collected by vacuum filtration and dried under high vacuum to afford 6-(3-nitro-phenoxy)-3H- benzo[c][l,2]oxaborol-l-ol (1.11 g, 56 % yield). 1H NMR (400 MHz, DMSO-J6) δ 9.24 (s, 1 H), 7.99 (d, J= 8.21 Hz, 1 H), 7.71-7.65 (m, 2 H), 7.54-7.47 (m, 2 H), 7.42 (d, J= 2.35 Hz, 1 H), 7.30 (dd, J= 8.21, 2.34 Hz, 1 H), 5.02 (s, 2 H). E12. 6-(3-Amino-phenoxy)-3H-benzofcJfl,2Joxaborol-l-ol
6-(3-Amino-phenoxy)-3H-benzo [c] [1,2] oxaborol- l-ol
[0573] A colorless solution of 6-(3-nitro-phenoxy)-3H-benzo[c][l,2]oxaborol-l-ol (1.11 g, 4.10 mmol) in ethyl acetate (60 mL) was treated with palladium (10 % wet on
charcoal, 0.28 g), then hydrogenation at 50 psi hydrogen gas for 2 hours. The mixture was filtered through a Celite pad and rinsed with ethyl acetate. The filtrate was concentrated to afford a white foam. The foam was triturated with methanol and water to afford 6-(3-amino-phenoxy)-3H-benzo[c][l,2]oxaborol-l-ol (0.74 g, 76 % yield), as a white solid. Mp 142-143 0C. 1H NMR (400 MHz, DMSO-J6) δ 9.18 (s, 1 H), 7.40 (d, J= 8.21 Hz, 1 H), 7.30 (d, J= 2.35 Hz, 1 H), 7.15 (dd, J= 8.21, 2.35 Hz, I H), 6.99 (t, J= 7.82 Hz, 1 H), 6.31 (dd, J= 7.82, 1.17 Hz, 1 H), 6.18-6.10 (m, 2 H), 5.21 (s, 2 H), 4.96 (s, 2 H); MS (ESI) m/z = 242 [M + H]+.
Step 1. 4-(4-Nitrophenoxy)-2-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yljbenzaldehyde
[0574] This was made according to the procedure for 4-phenoxy-2-(4,4,5,5- tetramethyl-l,3,2-dioxaborolan-2-yl)benzaldehyde with the exception of using 4- nitrophenol instead of phenol as starting material. 1H NMR (DMSO-^, 300MHz) δ ppm 10.26 (s, IH) 8.29 (d, J= 9 Hz, 2 H) 8.01 (d, J= 7.8 Hz, 1 H) 7.40-7.37 (m, 2 H) 7.25 (d, J= 9 Hz, 2 H) 1.31 (s, 12 H).
Step 2. 6-(4-Nitrophenoxy)benzo [c] [ 1 ,2] oxaborol- 1 (3H)-ol
[0575] To a suspension of 4-(4-nitrophenoxy)-2-(4,4,5,5-tetramethyl-l,3,2- dioxaborolan-2-yl)benzaldehyde (2 g, 5.42 mmol) in 10 ml MeOH in ice bath was added NaBH4 (288 mg, 7.59 mmol) potion wise. After stirring at room temperature for 1 hour, the reaction was quenched with water, acidified with IN HCl until pH 3
then extracted with ethyl acetate. The combined organic layer was dried over Na2SO4, filtered and evaporated under reduced pressure to afford a light yellow solid. Product was recrystallized from acetone and water as a white powder (460 mg, 31% yield). MS (ESI) m/z 270 [M-H]" .
6-(4-Aminophenoxy)benzo[c] [l,2]oxaborol-l(3H)-ol
[0576] 6-(4-nitrophenoxy)benzo[c][l,2]oxaborol-l(3H)-ol (197 mg, 0.73 mmol)was dissolved in a mixture of 10 ml MeOH and 2M EtOH, then about 1.5 ml of Raney Nickel slurry in water was added. This was subjected to hydrogenation (45 psi) for 4 hours on a Parr-Shaker. The mixture was then filtered through Celite and the filtrate was concentrated. The residue was purified by column to give the title compound as an off-white solid (108 mg, 62% yield). 1H NMR (DMSO-J6, 300MHz) δ ppm 9.11 (s, IH), 7.32 (d, J= 8.40 Hz, 1 H), 7.12 (d, J= 2.40 Hz,l H), 7.20 (dd, J = 8.40, 2.7 Hz, 1 H), 6.74 (d, J= 6.30 Hz, 2 H), 6.57 (d, J= 6.6 Hz, 2 H), 4.96 (s, 2 H), 4.90 (s, 2 H). MS (ESI) m/z 242 [M+H]+.
E15. (3-(l-Hvdroxy-l,3-dihvdrobenzofc]fl,2]oxaborol-6-yloxy)phenyl) methanaminium chloride
[0577] The title compound was synthesized by the same procedure as described above for the preparation of its para-analog. Yield 59.9%. Mp 180-1880C. 1H NMR (DMSO-J6, 300 MHz): δ 9.23 (br. s, IH), 8.38 (br. s, 3H), 7.44 (d, J=8.4 Hz, 2H), 7.40 (t, j=8.4 Hz, IH), 7.35 (d, J=2.4 Hz, IH), 7.22 (dm, j=8.1 Hz, IH), 7.18-7.15 (m, 2H), 6.98 (ddd, J=8.1 & 2.4 & 0.9 Hz, IH), 4.97 (s, 2H) and 3.99 (br. s, 2H) ppm.
Purity (HPLC): 94.4% at 220 nm and 98.5% at 254 nm. MS: m/z=256 (M+ 1, ESI+) and m/z=254 (M-I, ESI-).
E16. (4-(l-Hvdroxy-l,3-dihvdrobenzotcπi,21oxaborol-6-yloxy)phenyl) methanaminium chloride
[0578] To the solution of 4-(l-hydroxy-l,3-dihydrobenzo[c][l,2]oxaborol-6- yloxy)benzonitrile (6-(4-Cyanophenoxy)-l-hydroxy-2,l-benzoxaborole, 1 g, 3.98 mmol) in a mixed solvent of EtOH (100 mL) and THF (25 rnL) under N2 was added Pd/C (10 wt.%, 0.169 g). The reaction mixture was hydrogenated with a H2 balloon at room temperature with stirring for 19 h. The mixture was filtered, rotary evaporated and purified by silica gel column eluted with MeOH containing 0.6% v. NH4OH (3 mL 28-30% NH4OH to 500 mL MeOH). The white solid obtained was dissolved in water (80 mL) and 6N HCl (2 mL) was added, filtered and the filtrate was freeze-dried to give the desired salt (4-(l-hydroxy-l,3-dihydrobenzo[c][l,2] oxaborol-6-yloxy)phenyl)methanaminium chloride as white solid (0.663 g, 2.27 mmol, yield 57.1%). Mp >230°C. 1H NMR (DMSO-J6, 300 MHz): δ 9.23 (br. s, IH), 8.38 (br. s, 3H), 7.49 (d, J=8.4 Hz, 2H), 7.43 (d, J=8.4 Hz, IH), 7.31 (d, J=2.4 Hz, IH), 7.16 (dd, J=8.1 & 2.4 Hz, IH), 7.02 (d, J=8.4 Hz, 2H), 4.97 (s, 2H) and 3.97 (q, J=5.4 Hz, 2H) ppm. Purity (HPLC): 91.1% at 220 nm and 86.1% at 254 nm. MS: m/z=256 (M+l, ESI+) and m/z=254 (M-I, ESI-).
E17. 6-(Pyridine-3-voxyl)-3H-benzofclfl,21oxaborol-l-ol
Step 1. 2-Bromo-4-(pyridine-3-yloxy)-benzaldehyde
[0579] A mixture of pyridin-3-ol (4.18 g, 44 mmol), 2-bromo-4-fluoro- benzaldehyde (8.13 g, 40 mmol) and K2CO3 (8.28 g, 60 mmol) in DMF (30 mL) was heated at 80 0C for 16 h, cooled to RT , diluted with water (100 mL), the solid formed was collected and washed with water, dried to give 2-bromo-4-(pyridine-3-yloxy)- benzaldehyde (8.5 g, 100% yield) as a brown solid. 1HNMR (400MHz, DMSO-d6) δ 10.50 (s, 1 H), 8.50 (m, 2 H), 7.87 (d, 1 H), 7.70 (m, 1 H), 7.50 (m, 1 H), 7.40 (s, 1 H), 7.10 (d, I H).
Step 2. 4-(Pyridine-3-yloxy)-2-(4, 4, 5, 5-tetramethyl-[l, 3, 2] dioxaborolan-2- yljbenzaldehyde
[0580] A mixture of 2-bromo-4-(pyridine-3-yloxy)-benzaldehyde (2.08 g, 9.53 mmol), bis(pinacolato)diborane (3.63 g, 14.29 mmol) PdCl2(dppf) (0.70 g, 0.95 mmol) and KOAc (2.80 g, 28.59 mmol) in dioxane (30 mL) was degassed for 10 min, heated at 900C for 2 h, diluted with EtOAc (100 mL), filtered through a pad of Celite and concentrated. The residue was purified by chromatography to give 4-(pyridine-3- yloxy)-2-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2-yl)benzaldehyde (1.91 g, 75% yield) as an off-yellow oil. 1HNMR (400MHz, CDCl3) δ 10.40 (s, 1 H), 8.42 (m, 2 H), 7.98 (d, 1 H), 7.43 (s, 1 H), 7.30 (m, 2 H), 7.07 (d, 1 H), 1.40 (s, 12 H).
Step 3. 6-(Pyridine-3-yoxyl)-3H-benzo [c] [ 1 ,2] oxaborol- l-ol
[0581] To a cooled (0 0C) solution of 4-(pyridine-3-yloxy)-2-(4,4,5,5-tetramethyl- [l,3,2]dioxaborolan-2-yl)benzaldehyde (0.71 g, 2.18 mmol) in MeOH (6 niL) was added NaBH4 (0.22 g, 5.87 mol) in portions. After the addition was over, the mixture was stirred at 0 0C for 10 min, quenched with 3 N HCl until pH 3, stirred at pH 3 for 20 min, neutralized with NaHCO3, extracted with dichloromethane, dried and concentrated. The residue was treated with 1 N HCl (3 mL), concentrated, diluted with THF. The solid was collected to give 6-(pyridine-3-yoxyl)-3H- benzo[c]oxaborol-l-ol (230 mg, 46% yield). Mp 172-174 0C. 1U NMR (400 MHz, DMSO-J6) δ 8.54 (m, 1 H), 8.47 (m, 1 H), 7.66 (m, 2 H), 7.49 (d, J= 8.0 Hz, 1 H), 7.39 (d, J= 2.4 Hz), 7.28 (m, 1 H), 4.99 (s, 2 H).; MS (ESI) m/z = 228 [M + H]+; Elemental Analysis cacld for C12H11BNO3-HCl-O.! H2O: C, 54.33; H, 4.26; N, 5.28. Found: C, 54.02; H, 4.18; N, 5.41. E18. 6-(l-Hvdroxy-l,3-dihvdro-benzofcJfl,2Joxaborol-6-yloxy)-pyridine-2- carboxylic acid
6- (1 -Hydroxy- 1 ,3-dihydro-benzo[c] [1 ,2] 'oxaborol-6-yloxy)-pyridine-2-carbonitrile
[0582] To a solution of 3H-benzo[c][l,2]oxaborole-l,6-diol (2.0 g, 13.33 mmol) in anhydrous DMF (8 mL) were added Cs2CO3 (10.86 g, 33.33 mmol) and 6-chloro- pyridine-2-carbonitrile (1.71 g, 14.0 mmol) at room temperature. After stirring at 70 0C for 8 h, the reaction mixture was cooled to 0 0C diluted with water (20 mL) and acidified to pH 3 using diluted hydrochloric acid. The mixture was extracted with EtOAc. The extract was washed with brine and dried to give the crude product which was purified by chromatography on silica gel (DCM/MeOH = 40:2) to give 2.20 g of product. 1HNMR (400 MHz, DMSO-d6) δ 9.23 (br. s., 1 H), 8.08 (m, 1 H), 7.78 (d, J
= 7.33 Hz, 1 H), 7.35 - 7.56 (m, 3 H), 7.29 (dd, J= 8.20, 2.05 Hz, 1 H), 5.01 (s, 2 H). MS (ESI) m/z = 251 [M - H]".
E19. 6-(l-Hvdroxy-l,3-dihvdro-benzotcltl,21oxaborol-6-yloxy)-pyridine-2- carboxylic acid
[0583] A mixture of 6-(l-hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-6-yloxy)- pyridine -2-carbonitrile (0.40 g, 1.59 mmol) in 6 N hydrochloric acid (5 mL) was stirred at reflux for 12 h. The mixture was concentrated to give the crude product which was purified by prep-HPLC (C 18-SiO2, acetonitrile/water/TFA) to give 0.192 g of product which is 91.84% pure. This material was purified by recrystallization from acetonitrile/water to give 58 mg of pure product as a white solid. Mp 279-281 0C. 1HNMR (400 MHz, DMSO-d6) δ 8.02 (m, 1 H), 7.80 (d, J= 7.03 Hz, 1 H), 7.48 (d, J = 8.20 Hz, 1 H), 7.44 (d, J= 2.05 Hz, 1 H), 7.29 (dd, J= 8.20, 2.34 Hz, 1 H), 7.24 (d, J= 8.20 Hz, 1 H), 5.02 (s, 2 H). MS (ESI) m/z = 272 [M + H]+.
E20. ό-β-Hvdroxy-l^-dihydro-benzofcJfl^Joxaborol-ό-yloxyϊ-nicotinic acid ethyl ester
[0584] To a solution of 3H-benzo[c][l,2]oxaborole-l,6-diol (1.2 g, 8.0 mmol) in anhydrous dioxane (100 mL) was slowly added KHMDS (48 mL, 0.5 M solution in toluene, 24.0 mmol) at 0 0C. After stirring for 15 min at room temperature, 6-chloro- nicotinic acid ethyl ester (2.97 g, 16.0 mmol) was added slowly to the reaction mixture at 0 0C. The resulting mixture was stirred at 80 0C for 22 h. The reaction quenched by adding cold brine at 0 0C and the mixture was acidified to pH 3 using diluted hydrochloric acid. The resulting mixture was extract with EtOAc. The extract was washed with brine, dried and concentrated to dryness. The residue was purified by chromatography on silica gel (DCM/methanol = 40:1) to give 0.521 g of material.
This material was purified by prep-TLC (silica gel, THF/hexanes/AcOH = 2:4:trace) to give 0.261 g of purer material which was purified again by chromatography on silica gel (DCM/methanol = 40:1) to give 0.109 g of pure product as a pale-yellow solid. Mp 84-85 0C. 1H NMR (400 MHz, DMSO-J6) δ 9.23 (s, 1 H), 8.68 (d, J= 2.34 Hz, 1 H), 8.31 (dd, J= 8.50, 2.34 Hz, 1 H), 7.41 - 7.54 (m, 2 H), 7.30 (dd, J= 8.20, 2.34 Hz, 1 H), 7.15 (d, J= 8.50 Hz, 1 H), 5.02 (s, 2 H), 4.32 (q, J= 7.03 Hz, 2 H), 1.31 (t, J= 7.03 Hz, 3 H). MS (ESI) m/z = 300 [M + H]+.
E21. ό-β-Hvdroxy-l^-dihvdro-benzofcJfl^Joxaborol-ό-yloxyϊ-nicotinonitrile
[0585] To a solution of 3H-benzo[c][l,2]oxaborole-l,6-diol (0.47 g, 3.13 mmol) in anhydrous DMF (15 mL) were added K2CO3 (1.30 g, 9.4 mmol) and 6-chloro- nicotinonitrile (0.868 g, 6.27 mmol) at room temperature. After stirring for 18 h at 85 0C, the reaction mixture was cooled to room temperature. The solid was filtered out and dissolved into water (20 mL) and acidified to pH 3 using diluted hydrochloric acid. The precipitate was collected and washed with water and dried to give 0.612 g of crude product which was purified by recrystallization from EtOAc/hexanes to give 0.361 g of pure product as a white solid. Mp 156-157 0C. 1HNMR (400 MHz, DMSO-de) δ 9.25 (s, 1 H), 8.64 (d, J= 2.05 Hz, 1 H), 8.33 (dd, J= 8.50, 2.34 Hz, 1 H), 7.40 - 7.53 (m, 2 H), 7.19 - 7.32 (m, 2 H), 5.02 (s, 2 H). MS (ESI) m/z = 253 [M + H]+.
E22. ό-d-Hydroxy-U-dihydro-benzotcimioxaborol-ό-yloxyi-nicotinamide
[0586] To a solution of 6-(l-hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-6-yloxy)- nicotinonitrile (0.79 g, 3.13 mmol) in MeOH (10 mL)/dioxane (10 mL) was added aqueous NaOH(1.25 g in 5 mL of water). After stirring at 60 0C for 3 h, the reaction mixture was cooled to 0 0C and acidified to pH 3 using diluted hydrochloric acid. The precipitate was collected and washed with water and dried to give the crude product which was purified by chromatography on silica gel (DCM/methanol = 40:1) to give 0.123 g of product. This material was purified again by recrystallization from
EtOAc/hexanes to give 0.048 g of pure product as a white solid. Mp 196-198 0C. 1HNMR (400 MHz, DMSO-d6) δ 9.20 (s, IH), 8.60 (d, J= 2.34 Hz, 1 H), 8.27 (dd, J = 8.50, 2.34 Hz, 1 H), 8.02 (s, IH), 7.43 - 7.53 (m, 3 H), 7.28 (dd, J= 8.20, 2.34 Hz, 1 H) 7.11 (d, J= 8.50 Hz, 1 H), 5.03 (s, 2 H). MS (ESI) m/z = 271 [M + H]+.
E23. 6-(6-Λminomethyl-pyridin-2-yloxy)-3H-benzofclH,21oxaborol-l-ol
[0587] To a solution of 6-(l-hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-6-yloxy)- pyridine-2-carbonitrile (0.4 g, 1.59 mmol) in anhydrous THF (20 rnL) was slowly added LiAlH4 (0.151 g, 3.97 mmol) at 0 0C under nitrogen. The resulting mixture was stirred at 0 0C to room temperature for 4 h. The reaction was quenched by adding water at -20 0C and the mixture was acidified to pH 2 using diluted hydrochloric acid. The mixture was extracted with 33% ethanol in EtOAc. The extract was washed with brine and dried to give the crude product which was purified by chromatography on silica gel (EtOAc/MeOH/conc. NH3-H2O = 5:5:1) to give the product. This material was stirred with water and acidified to pH 2 using diluted hydrochloric acid and lyophilized to afford 0.202 g of product which was stirred with 50 mL of hot EtOAc and the un-dissolved solid was collected and washed with EtOAc to give 0.146 g of pure product as a white powder. Mp 182-183 0C. 1U NMR (400 MHz, DMSO-J6) δ 9.24 (br. s, 1 H), 8.34 (br. s., 3 H), 7.91 (t, J= 7.77 Hz, 1 H), 7.41 - 7.58 (m, 2 H), 7.18 - 7.34 (m, 3 H), 6.90 (d, J= 8.21 Hz, 1 H), 5.01 (s, 2 H), 4.08 (q, J= 5.76 Hz, 2 H). MS (ESI) m/z = 257 [M + H]+.
E24. 2-(l-Hvdroxy-l,3-dihvdro-benzofcJfl,2Joxaborol-6-yloxy)-pyrimidine-5- carboxylic acid methyl ester
[0588] To a solution of 3H-benzo[c][l,2]oxaborole-l,6-diol (0.5 g, 3.33 mmol) in anhydrous DMF (15 mL) were added K2CO3 (1.382 g, 10.0 mmol) and 2-chloro- pyrimidine-5-carboxylic acid methyl ester (0.575 g, 3.33 mmol) at room temperature. After stirring at room temperature for 25 h, the reaction mixture was cooled to 0 0C diluted with water (20 mL) and acidified to pH 2 using diluted hydrochloric acid. The
white precipitate was collected, washed with water and dried to give 0.678 g of pure product. Mp 117-118 0C. 1HNMR (400 MHz, DMSO-d6) δ 9.26 (s, 1 H), 9.08 (s, 2 H), 7.44 - 7.57 (m, 2 H), 7.31 - 7.40 (m, 1 H), 5.03 (s, 2 H), 3.88 (s, 3 H). MS (ESI) m/z = 287 [M + H]+.
E25. 2-(l-Hvdroxy-l,3-dihvdro-benzotcltl,21oxaborol-6-yloxy)-pyrimidine-5- carboxylic acid
[0589] To a solution of 2-(l-hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-6-yloxy)- pyrimidine-5-carboxylic acid methyl ester (0.5 g, 1.75 mmol) in methanol (20 mL) was added aqueous LiOH (0.419 g in 15 mL of water, 17.5 mmol) at 0 0C. The resulting mixture was stirred at room temperature for 1.5 h. After removed most of the methanol, the reaction mixture was cooled to 0 0C and acidified to pH 2 using diluted hydrochloric acid. The white precipitate was collected, washed with water and dried to give the crude product which was purified by chromatography on silica gel (hexane/THF/AcOH = 2:l :trace) to give 0.102 g of product which is 92% pure by HPLC. This material was again purified by prep-HPLC to give 39 mg of pure product. Mp 195-196 0C. 1HNMR (400 MHz, DMSO-d6) δ 9.27 (br. s., IH), 9.04 (s, 2 H), 7.51-7.49 (m, 2 H), 7.35 (dd, J= 8.4 Hz, 2.0 Hz, 1 H), 5.03 (s, 2 H). MS (ESI) m/z = 273 [M + H]+.
E26. 5-(l-Hvdroxy-l,3-dihvdro-benzofcJfl,2Joxaborol-6-yloxy)-pyrazine-2- carboxylic acid
5-(l -Hydroxy- l,3-dihydro-benzo[c] [1, 2] oxaborol-6-yloxy)-pyrazine-2-carboxylic acid methyl ester
[0590] To a solution of 3H-benzo[c][l,2]oxaborole-l,6-diol (0.37 g, 2.47 mmol) in anhydrous DMF (8 mL) were added Cs2CO3 (2.01 g, 2.71 mmol) and 5-chloro-
pyrazine-2-carboxylic acid methyl ester (0.468 g, 2.71 mmol) at room temperature. After stirring at 90 0C for 1.5 h, the reaction mixture was cooled to 0 0C, diluted with water (10 mL) and acidified to pH 3 using diluted hydrochloric acid. The off- white precipitate was collected, washed with water and dried to give the crude product which was purified by chromatography on silica gel (DCM/MeOH = 40:3) to give 0.47Og (66.5% yield) of product. MS (ESI) m/z = 287 [M + H]+.
E27. 5-(l-Hvdroxy-l,3-dihvdro-benzofcJfl,2Joxaborol-6-yloxy)-pyrazine-2- carboxylic acid
[0591] To a solution of 5-(l-hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-6-yloxy)- pyrazine-2-carboxylic acid methyl ester (0.47 g, 1.64 mmol) in methanol (16 mL) was added aqueous LiOH-H2O (0.345 g in 12 mL of water, 8.21 mmol) at 0 0C. The resulting mixture was stirred at 0 0C for 1 h. The reaction mixture was acidified to pH 2 using diluted hydrochloric acid. The white precipitate was collected, washed with water and 30% of EtOAc/hexanes and dried to give 0.392 g (87.9% yield) of pure product. Mp 202-204 0C. 1HNMR (400 MHz, DMSO-d6) δ 9.28 (s, 1 H), 8.74 (d, J = 1.2 Hz, 1 H), 8.66 (d, J= 1.2 Hz, 1 H), 7.53-7.50 (m, 2 H), 7.37 (dd, J= 8.4 Hz, 2.0 Hz, 1 H), 5.03 (s, 2 H). MS (ESI) m/z = 271 [M - H]".
E28. 2-(l-Hvdroxy-l,3-dihvdro-benzotcltl,21oxaborol-6-yloxy)-thiazole-4- carboxylic acid methyl ester
[0592] To a solution of 3H-benzo[c][l,2]oxaborole-l,6-diol (0.5 g, 3.33 mmol) in anhydrous DMF (15 mL) was added potassium carbonate (1.38 g, 9.99 mmol) followed by the addition of 2-bromo-thiazole-4-carboxylic acid methyl ester (0.74 g, 3.33 mmol). The resulting mixture was heated at 80 0C for 24 h. The reaction mixture was cooled and extracted with EtOAc, washed with water, brine, dried over Na2SO4, filtered, and concentrated to give crude product which was purified by prep HPLC using CH3CN/H2O (0.1% AcOH) as the eluent to yield 2-(l-hydroxy-l,3-
dihydro-benzo[c][l,2]oxaborol-6-yloxy)-thiazole-4-carboxylic acid methyl ester (0.01 g) as a white solid after lyophilization. Mp 109.2-111.5 0C. 1U NMR (400 MHz, DMSO-J6) δ 9.34 (s, IH), 8.08 (s, 1 H), 7.62 (d, J= 1.6 Hz, 1 H), 7.56 (d, J= 8.4 Hz, 1 H), 7.47 (dd, J= 8.4, 2.6 Hz, 1 H), 5.03 (s, 2 H), 3.78 (s, 3 H). MS (ESI) m/z = 292 [M + H]+.
E29 6-aL3JlThiadiazol-2-yloxy)-3H-benzo[cm.21oxaborol-l-ol
Step 1. 2-Hydroxy-4-([l,3,4]thiadiazol-2-yloxy)-benzoic acid methyl ester
[0593] A solution of 2,4-dihydroxy-benzoic acid methyl ester (1.0 g, 6 mmol), 5- bromothiadiazole (1.0 g, 6 mmol) and K2CO3 (1.25 g, 9mmol) in DMF (15 mL) was heated at 80 0C for 16 hours. Water (25 mL) was added and the mixture extracted with EtOAc ( 2 x 10 mL). The organic extracts were washed with water (10 mL), dried and concentrated in vacuo. The residue was purified by silica gel flash column chromatography (hexane:EtOAc 80:20) to give 2-hydroxy-4-([l,3,4]thiadiazol-2- yloxy)-benzoic acid methyl ester (0.23 g, 16%). 1H NMR (400 MHz, CDCl3): δ 10.98 (s, IH), 8.82 (s, IH), 7.91 (d, J = 8.8 Hz, IH), 6.89 (dd, J = 2.4, 12 Hz, 2H), 3.96 (s, 3H). MS (ESI) m/z = 253 [M+H]+ .
[0594] To a solution of 2-hydroxy-4-([l,3,4]thiadiazol-2-yloxy)-benzoic acid methyl ester (0.41 g, 1.62 mmol) in DCM (20 mL) at -20 0C was added pyridine (0.65 mL, 8.13 mmol) followed by Tf2O (0.41 mL, 2.43 mmol). The resulting solution was allowed to warm to room temperature over 2 hours then quenched by the addition of ice-water (10 mL) and extracted with DCM (2x10 mL). The organic extracts were washed with 2N HCl (5 mL), dried and concentrated in vacuo. The residue was purified by silica gel flash column chromatography (hexane:EtOAc 70:30) to give 4- ([l,3,4]thiadiazol-2-yloxy)-2-trifluoromethanesulfonyloxy-benzoic acid methyl ester
(0.45 g, 97%). 1H NMR (400 MHz, CDCl3): δ 8.79 (s, IH), 8.12 (d, J = 9.2 Hz, IH), 7.51 (dd, J = 2.4, 8.4 Hz, IH), 7.38 (d, J = 1.6Hz, IH), 3.90 (s, 3H). MS (ESI) m/z = 385 [M+H]+ .
Step 3. 2- (4, 4, 5, 5- Tetramethyl-fl, 3, 2] dioxaborolan-2-yl)-4- ([1, 3, 4Jthiadiazol-2- yloxy) -benzoic acid methyl ester
[0595] A solution of 4-([ 1 ,3 ,4]thiadiazol-2-yloxy)-2-trifluoromethanesulfonyloxy- benzoic acid methyl ester (0.36 g, 1.19 mmol) in dioxane (15 rnL) was degassed for 15 minutes with bubbling N2. Bispinacolatodiboron (0.49 g, 1.42 mmol), PdCl2(dppf)2 (0.087 g, 0.1 lmmol) and KOAc (0.35 g, 3.59 mmol) were added and the solution stirred at 80 0C for 20 hours. After cooling to room temperature the mixture was filtered through a pad of celite and concentrated in vacuo. The residue was dissolved in EtOAc (20 mL), washed with water (2x10 mL), dried and concentrated in vacuo. The residue was purified by silica gel flash column chromatography (hexane:EtOAc 70:30) to give 2-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2-yl)-4- ([l,3,4]thiadiazol-2-yloxy)-benzoic acid methyl ester (0.38 g, 3:1 mixture with SM). 1H NMR (400 MHz, CDCl3): δ 8.76 (s, IH), 7.99 (d, J = 6.4 Hz, IH), 7.42-7.38 (m, 2H), 3.89 (s, 3H), 1.38 (s, 12H). MS (ESI) m/z = 363 [M+H]+ .
Step 4. 6-([ 1 ,3 ,4] Thiadiazol-2-yloxy)-3H-benzo[c] [1 ,2] oxaborol-1-ol
[0596] To a solution of 2-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2-yl)-4- ([l,3,4]thiadiazol-2-yloxy)-benzoic acid methyl ester (0.26 g, 0.72 mmol) in THF (15 mL) at - 10 0C was added LiAlH4 (0.04 g, 1.07 mmol). The reaction mixture was allowed to warm to room temperature over 6 hours then quenched by the addition of 3N HCl (3 mL) at 0 0C. The mixture was stirred for 2 hours, extracted with EtOAc
(2x10 mL), washed with water (10 mL), dried and concentrated in vacuo. The residue was purified by silica gel flash column chromatography (DCM; MeOH 95:5) to give 6-([l,3,4]thiadiazol-2-yloxy)-3H-benzo[c][l,2]oxaborol-l-ol (0.05 g, 35%). 1H NMR
(400 MHz, DMSO): δ 9.15 (s, IH), 7.65 (d, J = 1.6Hz, IH), 7.54-7.50 (m, 2H), 5.00 (s, 2H). MS (ESI) m/z = 235 [M+H]+ .
[0597] To a solution of 2,4-dihydroxy-benzaldehyde (5.0 g, 36.0 mmol) in DMF (60 niL), potassium carbonate (7.46 g, 54.0 mmol) was added at 0 0C, followed by addition of cyclopentyl iodide(6.35 g, 32.4mmol). The resulting mixture was stirred at rt overnight. The reaction mixture was extracted with EtOAc and washed with water, brine, dried over Na2SO4, and concentrated under reduced pressure. The crude product was dissolved in 200 mL of hexane and stirred at rt for 30 min. Solid (unreacted starting material) precipitated out was filtered, hexane layer was concentrated and purified by Biotage (20% DCM/Hexane) to get 4-cyclopentyloxy- 2-hydroxy-benzaldehyde as a colorless oil (1.74 g, 23% yield). 1H NMR (400 MHz, CDCl3) δ 11.49 (s, IH), 9.69 (s, IH), 7.40 (d, J= 8.8 Hz, IH), 6.50 (dd, J= 8.8, 2.4 Hz, IH), 6.39 (d, J= 2.0 Hz, IH), 4.82 (m, IH), 1.99 - 1.79 (m, 6H), 1.78 - 1.59 (m, 2H). (ESI) m/z = 205 [M - H]".
[0598] To a solution of 4-cyclopentyloxy-2-hydroxy-benzaldehyde (1.74 g, 8.46 mmol) and pyridine (3.3 g, 42.0 mmol) in dichloromethane (20 mL) was slowly added Tf2O (3.57 g, 12.66 mol) at -10 to 0 0C over a period of 30 min. The reaction mixture was stirred at 0 0C for 30 min. Ice-water was added, and the mixture was acidified with 6M hydrochloric acid to pH 2. The resulting mixture was extracted with 50%
EtOAc/hexanes (2 x 75 mL), washed with brine, dried over Na2SO4, and concentrated to give (1.8 g, 64% yield) as a pale-yellow oil. 1H NMR (400 MHz, CDCl3) δ 10.11 (s, 1 H), 7.90 (d, J= 9.2 Hz, 1 H), 6.98 (dd, J= 9.2, 2.4 Hz, 1 H), 6.82 (d, J= 2.4 Hz, 1 H), 4.85 (m, 1 H), 2.00 - 1.80 (m, 6 H), 1.78 - 1.65 (m, 2 H).
Step 3. 4-Cyclopentyloxy-2-(4, 4, 5, 5-tetramethyl-[l, 3, 2] dioxaborolan-2-yl)- benzaldehvde
[0599] 5-(Cyclopentyloxy)-2-formylphenyl trifluoromethanesulfonate (1.1 g, 3.25 mmol) in 1,4-dioxane (20 niL) was degassed for 30 min under nitrogen gas.
Bis(pinacolato)diboron (1.65 g, 6.50 mmol), potassium acetate (1.3 g, 13.0 mmol), and [l,r-bis(diphenylphosphino)ferrocene]palladium(II)chloride (0.24 g, 0.033 mmol) were added. The reaction mixture was heated at 80 0C for 1 h, extracted with EtOAc and washed with water, brine, dried over Na2SO4, and concentrated under reduced pressure to give crude product, which was purified by Biotage (1-25% EtOAc in hexane) to afford 4-cyclopentyloxy-2-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2- yl)-benzaldehyde (0.9 g, 88% yield) as a white semi solid. 1H NMR (400 MHz, CDCl3) δ 10.30 (s, 1 H), 7.90 (d, J= 8.8 Hz, 1 H), 7.25 (d, J= 2.4 Hz, 1 H), 6.99 (dd, J= 9.2, 2.8 Hz, 1 H), 4.88 (m, 1 H), 2.00 - 1.80 (m, 6 H), 1.75 - 1.60 (m, 2 H), 1.39 (s, 12 H). MS (ESI) m/z = 317 [M + H]+.
Step 4. 6-Cyclopentyloxy-3H -benzofcj '[1 ,2] 'oxaborol-1-ol
[0600] To a solution of 4-cyclopentyloxy-2-(4,4,5,5-tetramethyl- [l,3,2]dioxaborolan-2-yl)-benzaldehyde (0.5 g, 1.58 mmol) in methanol (20 mL) was slowly added NaBH4 powder (0.18 g, 4.75 mmol) at 0-10 0C. After stirred at room temperature for 1 h, the mixture was concentrated to remove one-third of methanol. The resulting mixture was cooled to 0 0C, acidified to pH 3 using 6M hydrochloric acid. The reaction mixture was extracted with EtOAc and washed with water, brine, dried over Na2SO4, and concentrated under reduced pressure to give crude product, which was purified by Biotage (50% EtOAc in hexane) to afford 6-cyclopentyloxy- 3H -benzo[c][l,2]oxaborol-l-ol (0.11 g, 32% yield) as a red sticky solid. 1U NMR (400 MHz, DMSO-de) δ 9.10 (s, 1 H), 7.28 (d, J= 8.4 Hz, 1 H), 7.21(s, 1 H), 7.00 (d, J= 7.2 Hz, 1 H), 4.90 (s, 2H), 4.79 (m, 1 H), 1.97 - 1.85 (m, 2 H), 1.78 - 1.65 (m, 4 H), 1.62 - 1.55 (m, 2 H). MS (ESI) m/z = 217 [M - H]".
E31. 4-(l-Hvdroxy-l,3-dihvdro-benzofclH,21oxaborol-6-yloxy)-pweridine-l- carboxylic acid tert-butyl ester
Step 1. 4-(4-Formyl-3-hydroxy-phenoxy)-piperidine- 1 -carboxylic acid tert-butyl ester
[0601] To a solution of 2,4-dihydroxy-benzaldehyde (10.0 g, 72.0 mmol) in THF (70 niL) was added triphenylphosphine (22.66 g, 86.4 mmol) and cooled to 0 0C, 4- hydroxy-piperidine-1 -carboxylic acid tert-butyl ester (16.0 g, 79.7 mmol) was added dropwise, followed by the addition of diisopropyl azo-dicarboxylate (17.47 g, 86.4 mmol). The resulting mixture was stirred at rt overnight. The reaction mixture was extracted with EtOAc and washed with water, brine, dried over Na2SO4, and concentrated under reduced pressure. The crude product was dissolved in 10% EtOAc/Hexane (200 mL) and stirred at rt for 30 min. Solid (unreacted starting material and triphenylphosphineoxide) precipitated out was filtered, and the organic layer was concentrated and purified by Biotage (20% EtOAc/Hexane) to 4-(4-formyl- 3 -hydroxy-phenoxy)-piperidine-l -carboxylic acid tert-butyl ester (7.5 g, mixture of product and 2,4-dihydroxy-benzaldehyde, 2:1). 1H NMR (400 MHz, CDCl3) ^ 11.46 (s, 1 H), 9.70 (s, 1 H), 7.44 (d, J= 8.8 Hz, 1 H), 6.52 (dd, J= 8.8, 2.0 Hz, 1 H), 6.42 (d, J= 2.0 Hz, 1 H), 4.55 (m, 1 H), 3.69 - 3.64 (m, 2 H), 3.40 - 3.30 (m, 2 H), 2.04 - 1.94 (m, 2 H), 1.80 - 1.72 (m, 2 H), 1.47 (s, 9 H). MS (ESI) m/z = 320 [M - H]".
Step 2. 4-(4-Formyl-3-trifluoromethanesulfonyloxy-phenoxy)-piperidine-l -carboxylic acid tert-butyl ester
[0602] To a solution of 4-(4-formyl-3-hydroxy-phenoxy)-piperidine-l -carboxylic acid tert-butyl ester (7.0 g, 22.0 mmol) and pyridine (8.7 g, 110 mmol) in dichloromethane (100 mL) was slowly added Tf2O (12.30 g, 44.0 mol) at -10 to 0 0C over a period of 45 min. The reaction mixture was stirred at 0 0C for 1.5 h. Ice-water was added, extracted with EtOAc, washed with saturated sodium bisulfite, and cold
brine, dried over Na2SO4, and concentrated, purified by column chromatography (20- 40% EtOAc/Hexane) to get 4-(4-formyl-3-trifluoromethanesulfonyloxy-phenoxy)- piperidine-1-carboxylic acid tert-butyl ester (7.5 g, 75% yield) as a pale -yellow oil. 1H NMR (400 MHz, CDCl3) «5 10.12 (s, 1 H), 7.95 (d, J= 8.8 Hz, 1 H), 7.00 (dd, J = 8.8, 2.4 Hz, 1 H), 6.87 (d, J= 2.0 Hz, 1 H), 4.60 (m, 1 H), 3.72 - 3.66 (m, 2 H), 3.43 - 3.36 (m, 2 H), 2.03 - 1.94 (m, 2 H), 1.83 - 1.75 (m, 2 H), 1.47 (s, 9 H).
Step 3. 4-[4-Formyl-3-(4, 4, 5, 5-tetramethyl-[l, 3, 2] dioxaborolan-2-yl)-phenoxy] - piperidine-1-carboxylic acid tert-butyl ester
800C [0603] 4-(4-Formyl-3-trifluoromethanesulfonyloxy-phenoxy)-piperidine- 1 - carboxylic acid tert-butyl ester (7.0 g, 15.0 mmol) in 1,4-dioxane (80 mL) was degassed for 30 min under nitrogen gas. Bis(pinacolato)diboron (4.7 g, 18.5 mmol), potassium acetate (4.4 g, 45.0 mmol), and [l,l '-bis(diphenylphosphino)ferrocene] palladium(II)chloride (0.55 g, 0.075 mmol) were added. The reaction mixture was heated at 80 0C for 40 min, extracted with EtOAc and washed with water, brine, dried over Na2SO4, and concentrated under reduced pressure to give crude product, which was purified by column chromatography (10 - 20% EtOAc in hexane) to afford the 4- [4-formyl-3-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2-yl)-phenoxy]-piperidine-l- carboxylic acid tert-butyl ester (4.5 g, 70% yield) as a white solid. 1H NMR (400 MHz, CDCl3) δ 10.36 (s, 1 H), 7.93 (d, J= 8.8 Hz, 1 H), 7.30 (d, J= 2.4 Hz, 1 H), 7.01 (dd, J= 8.8, 2.8 Hz, 1 H), 4.60 (m, 1 H), 3.70 - 3.62 (m, 2 H), 3.45 - 3.35 (m, 2 H), 2.00 - 1.90 (m, 2 H), 1.82 - 1.75 (m, 2 H), 1.47 (s, 9 H), 1.40 (s, 12 H).
Step 4. 4-(l -Hydroxy- 1 ,3-dihydro-benzo [c] [1,2] oxaborol-6-yloxy)-piperidine-l- carboxylic acid tert-butyl ester
[0604] To a solution of 4-[4-formyl-3-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2- yl)- phenoxy]-piperidine-l -carboxylic acid tert-butyl ester (1.5 g, 3.5 mmol) in methanol (60 mL) was slowly added NaBH4 powder (0.19 g, 5.22 mmol) at 0-10 0C.
After stirred at room temperature for 2.5 h, the mixture was concentrated to remove one-third of methanol. The resulting mixture was cooled to 0 0C, acidified to pH 1 using 6M hydrochloric acid. The reaction mixture was stirred at rt, extracted with EtOAc and washed with water, brine, dried over Na2SO4, and concentrated under reduced pressure to give crude product, which was purified by Biotage (50% EtOAc in hexane) to afford 4-( 1 -hydroxy- 1,3 -dihydro-benzo [c][l, 2]oxaborol-6-yloxy)- piperidine-1-carboxylic acid tert-butyl ester (0.54 g, 51% yield) as a white solid. Mp HO -I I l 0C. 1H NMR 400 MHz (DMSO-d6) ^ 9.10 (s, 1 H), 7.30 (d, J= 8.0 Hz, 1 H), 7.27 (d, J= 2.0 Hz, 1 H), 7.09 (dd, J= 8.0, 2.0 Hz, 1 H), 4.90 (s, 2 H), 4.55 (m, 1 H), 3.70 - 3.60 (m, 2 H), 3.20 - 3.15 (m, 2 H), 1.98 - 1.85 (m, 2 H), 1.60 - 1.51 (m, 2 H), 1.40 (s, 9 H). MS (ESI) m/z = 334 [M - H]".
E32. 6-(Pweridin-4-yloxy)-3H-benzofclH,21oxaborol-l-ol
[0605] To a solution of 4-(l-hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-6-yloxy)- piperidine-1-carboxylic acid tert-butyl ester (0.54 g, 1.62 mmol) in methanol (7 mL) was added IM HCl in ether (5.4 mL, 5.41 mmol). The reaction mixture was stirred at room temperature for 5 h, and concentrated to get 6-(piperidin-4-yloxy)-3H- benzo[c][l,2]oxaborol-l-ol hydrochloric salt (0.4 g, 92% yield) as a white solid. Mp 218 -220 0C. 1H NMR (400 MHz, DMSO-d6) δ 9.14 (s, 1 H), 8.78 (br s, 1 H), 7.34 (d, J= 8.4 Hz, 1 H), 7.30 (d, J= 2.0 Hz, 1 H), 7.12 (dd, J= 8.4, 2.4 Hz, 1 H), 4.90 (s, 2 H), 4.64 (m, 1 H), 3.33 - 3.22 (m, 2 H), 3.16 - 3.08 (m, 2 H), 2.12 - 2.07 (m, 2 H), 1.88 - 1.80 (m, 2 H). MS (ESI) m/z = 324 [M - H]".
E33 (l,6-Dihvdroxy-l,3-dihvdro-benzotcπi,21oxaborol-3-yl)-acetic acid
[0606] A solution of (1,6-dihydroxy-l, 3 -dihydro-benzo [c][l, 2]oxaborol-3-yl)- acetic acid ethyl ester (0.20 g, 0.85 mmol) in methanol (7 mL) was treated with lithium hydroxide (0.10 g, 4.18 mmol) in water (7 mL) at 0 0C. The solution was stirred at 0 0C for 2 hours then quenched with 2N HCl to pH 2. The mixture was diluted with brine and extracted with ethyl acetate. The organic extracts were dried
(Na2SO4), filtered and concentrated to a light yellow solid. The residue was purified by silica gel flash column chromatography (AcOH:acetone:hexane; trace: 1 :2) and lyophilized to give (l,6-dihydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl)-acetic acid as a white solid (0.06 g, 34 %). 1H NMR (400 MHz, DMSO-d6) δ 7.22 (d, J = 8.20 Hz, IH), 7.52 (d, J = 2.34 Hz, IH), 6.86 (dd, J = 8.20, 1.95 Hz, IH), 5.33 (dd, J = 8.98, 3.90 Hz, IH), 2.83 (dd, J = 15.61, 3.90 Hz, IH), 2.26 (dd, J = 15.61, 8.98 Hz, IH). MS (ESI) m/z: 207[M-I].
E34 (l-Hvdroxy-6-pyridin-3-yloxy)-l,3-dihvdro-benzofcJfl,2Joxabowl-3-yl)- acetic acid
Step 1: [l-Hydroxy-6methoxy-l,3-dihydro-benzo[c] [1,2] oxaborol-3-yl] -acetic acid ethyl ester
[0607] To a suspension of zinc dust (1.46 g, 22.5 mmol) in THF (10 mL) was added trimethylsilyl chloride (0.28 mL, 2.25 mmol) at 40 0C. The mixture was heated to 55 0C and stirred for 15 minutes. After cooling down to 37 0C, ethyl bromoacetate (2.16 mL, 19.5 mmol) was slowly added to the reaction mixture at 37 - 40 0C. After addition, the resulting mixture was allowed to cool to room temperature over 30 minutes. This solution was added to a solution of 4-methoxy-2-(4,4,5,5)tetramethyl- [l,3,2]dioxaborolan-2-yl)benzaldehyde (1.15 g, 4 mmol) in THF (6 mL) at 0 0C. The mixture was stirred for 10 minutes before treating with saturated NH4Cl (10 mL) and extracted with EtOAc (2x25 mL). The organic extracts were washed with brine, dried and concentrated in vacuo. The residue was diluted with H2O and lyophilized to give [l-hydroxy-όmethoxy-l^-dihydro-benzofcJfl^Joxaborol-S-ylJ-acetic acid ethyl ester (1.1 g , 100%). 1H NMR (400 MHz, CD3OD-d6) δ 7.25 (m, IH), 7.10 (s, IH), 7.00 (m, IH), 5.50 (m, IH), 4.19 (q, J = 6.6 Hz, 2 H), 3.80 (s, 3H), 2.90 (m, IH), 2.50 (m, IH), 1.20 (t, J = 6.6 Hz, 3H).
Step 2: (l-Hydroxy-ό-methoxy)-l ,3-dihydro-benzo [c] [1 ,2] Oxaborol-3-yl) -acetic acid
[0608] To a solution of [l-hydroxy-6methoxy-l,3-dihydro-benzo[c][l,2]oxaborol- 3-yl]-acetic acid ethyl ester (0.320 g, 1.36 mmol) in MeOH (12 mL) and water (3 mL) was added LiOH (0.040 g) at 0 0C. The resulting mixture was stirred at room temperature for 24 hours then cooled to 0 0C. The reaction mixture was acidified to pH 3 using 6M HCl then concentrated in vacuo. The residue was purified by silica gel flash column chromatography to give (l-hydroxy-6-methoxy)-l,3-dihydro- benzo[c][l,2]oxaborol-3-yl)-acetic acid (0.200 g, 66%). mp 110 - 112 0C. 1H NMR (400 MHz, DMSO-dδ 12.38 (s, IH), 9.18 (s, IH), 7.36 (d, J = 8.4 Hz, IH), 7.20 (s, IH), 7.05 (m, IH), 5.38 (m, IH), 3.76 (s, 3H), 2.90 (m, IH), 2.28 (m, IH). MS (ESI) m/z = 221 [M - H]-. HPLC: 98.05% (220 nm); 98.79% (Maxplot).
E35 (l-Hydroxy-ό-phenoxy-l^-dihydw-benzofcIfUIoxaborol-S-vD-acetic acid ethyl ester
[0609] To a solution of phenol (6.732 g, 73.9 mmol) and 2-bromo-4-fluoro- benzaldehyde (15.0 g, 73.9 mmol) in anhydrous DMF (90 mL) was added K2CO3 (20.42 g, 148 mmol) at room temperature. The mixture was then stirred at 100 0C for 16.5 h. After filtration, the filtrate was concentrated to dryness. The residue was dissolved in EtOAc and washed with brine to pH 7, dried and concentrated to give the crude product which was recrystallized from EtOAc/hexanes to afford 16.821 g (82.1% yield) of pure product as a white crystal. 1HNMR (400 MHz, CDCl3) δ 10.25 (s, 1 H), 7.90 (d, J = 8.50 Hz, 1 H), 7.44 (t, J = 7.91 Hz, 2 H), 7.20 - 7.33 (m, 1 H),
7.17 (d, J = 2.34 Hz, 1 H), 7.09 (d, J = 7.91 Hz, 2 H) 6.98 (dd, J = 8.64, 2.34 Hz, 1 H).
Step 2. 4-Phenoxy-2- (4, 4, 5, 5-tetramethyl-[l, 3, 2]dioxaborolan-2-yl)-benzaldehyde
[0610] To a solution of 2-bromo-4-phenoxy-benzaldehyde (3.0 g, 10.8 mmol) and bis(pinacolato)diborane (3.573 g, 14.1 mmol) in dioxane (600 mL) was added KOAc (3.188 g, 32.5 mmol). After degassed with nitrogen for 15 min, PdCl2(dppf) (0.792 g, 1.08 mol) was added to the reaction mixture. The mixture was stirred at 80 0C for 1.5 h. The reaction was quenched by adding ice-water (50 mL). The resulting mixture was extract with 50% EtOAc/hexanes (2 x 50 mL). The extract was washed with brine, dried and concentrated to dryness. The residue was purified by chromatography on silica gel (EtOAc/hexanes = 3:40) to give 3.50 g (100% yield) of product as pale-yellow waxy solid. 1HNMR (400 MHz, CDCl3) δ 10.39 (s, 1 H), 7.92 (d, J= 8.50 Hz, 1 H), 7.33 - 7.50 (m, 3 H), 7.19 (t, J= 7.47 Hz, 1 H), 6.95 - 7.11 (m, 3 H), 1.38 (s, 12 H).
Step 3. ( l-Hydroxy-6-phenoxy- 1 ,3-dihydro-benzo [c] [ 1 ,2] oxaborol-3-yl)-acetic acid ethyl ester
[0611] A mixture of 4-phenoxy-2-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2-yl)- benzaldehyde (2.0 g, 6.17 mmol), ethyl bromoacetate (3.091 g, 18.5 mmol), zinc dust (6.07 g) and NH4Cl (2.43 g) was thoroughly grounded in a mortar and pestle. The resulting mixture was kept at room temperature (20 0C) for 3.5 h. The mixture was treated with saturated NH4Cl (50 mL) and extracted with ether (3 x 50 mL). The extract was washed with brine, dried and concentrated to dryness. The residue was purified by chromatography on silica gel (EtOAc/hexanes = 2:5) to give 1.351 g (70.1% yield) of product as a colorless oil. 1HNMR (400 MHz, DMSO-d6) δ 9.24 (s, 1 H), 7.46 (d, J= 8.20 Hz, 1 H), 7.39 (t, J= 7.76 Hz, 2 H), 7.22 (d, J= 2.05 Hz, 1 H), 7.10 - 7.17 (m, 2 H), 7.00 (d, J= 8.20 Hz, 2 H), 5.44 (dd, J= 8.78, 3.81 Hz, 1 H), 4.08 (q, J= 7.22 Hz, 2 H), 3.03 (dd, J= 15.81, 3.81 Hz, 1 H), 2.42 (dd, J= 15.66, 8.93 Hz, 1 H), 1.17 (t, J= 7.22 Hz, 3 H). MS (ESI) m/z = 313 [M + H]+.
E36 (l-Hydroxy-ό-vhenoxy-U-dihydro-benzofcUUloxaborolS-vD-acetic acid
[0612] To a solution of (l-hydroxy-6-phenoxy-l,3-dihydro-benzo[c][l,2]oxaborol- 3-yl)-acetic acid ethyl ester (0.3 g, 0.960 mmol) in methanol (9 rnL) was added aqueous LiOH-H2O (0.202 g in 7 rnL of water, 4.80 mmol) at 0 0C. The resulting mixture was stirred at 0 0C for 5 h. The reaction mixture was acidified to pH 2 using diluted hydrochloric acid. The mixture was extracted with EtOAc (2 x 20 mL). The extract was washed with brine and dried to give the crude product which was purified by chromatography on silica gel (acetone/hexanes = 1 :2) to give 0.20 Ig (73.3% yield) of pure product as white powder. Mp 132-134 °c. 1HNMR (400 MHz, DMSO-d6) δ 9.27 (s, 1 H), 7.52 (d, J= 8.0 Hz, 1 H) 7.46-7.42 (m, 2 H), 7.28 (d, J= 2.4 Hz, 1 H), 7.23-7.17 (m, 2 H), 7.08-7.05 (m, 2 H), 5.47 (dd, J= 8.8, 4.0 Hz, 1 H), 2.98 (dd, J = 15.2, 4.0 Hz, 1 H), 2.38 (dd, J= 15.6, 9.2 Hz, 1 H). MS (ESI) m/z = 283 [M - H]".
E37 (3S) (l-hydroxy-ό-phenoxy-l^-dihydro-benzofclfl^ioxaborolS-vD-acetic acid
[0613] 1.16 g of (l-Hydroxy-6-phenoxy-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl)- acetic acid ethyl ester (E35) was separated by preparative HPLC using a CHIRALP AK® IC column (250 x 50 mm) using a mobile phase composition of 10% ethanol in hexane containing 0.1% of trifluoroacetic acid at a flow rate of 120 ml/min at ambient temperature. The sample size was 5ml at a concentration of 23g/l, giving a production rate of 2.76 g/hour. The second peak collected, (3S-(l-hydroxy-6- phenoxy-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl)-acetic acid ethyl ester) had a purity of 99.6%ee. [0614] To a solution of 3S-l-hydroxy-6-phenoxy-l,3-dihydro- benzo[c][l,2]oxaborol-3-yl)-acetic acid ethyl ester (0.491 g, 1.57 mmol, peak 2) in methanol (9 mL) was added a solution of LiOH (0.188 g, 7.86 mmol) in water (7 mL) at 0 0C. The resulting mixture was stirred at 0 0C for 5 hours then acidified to pH = 2
with dilute hydrochloric acid and extracted with EtOAc (2 x 20 mL). The organic extracts were washed with brine, dried over sodium sulfate and concentrated in vacuo. The residue was purified by silica gel flash column chromatography (acetone/hexanes = 1 :2) to give pure product as a white powder after lyophilization (0.320 g, 71.7%); mp 142-143 0C. IHNMR (400 MHz, DMSO-d) δ 9.26 (s, 1 H), 7.52 (d, J=8.0 Hz, 1 H) 7.46-7.42 (m, 2 H), 7.28 (d, J=2.4 Hz, 1 H), 7.23-7.17 (m, 2 H), 7.08-7.04 (m, 2 H), 5.48 (dd, J=8.8, 4.0 Hz, 1 H), 2.98 (dd, J=15.2, 4.0 Hz, 1 H), 2.37 (dd, J=15.6, 9.2 Hz, 1 H). MS (ESI) m/z = 283 [M - H]-.
E38 (3R) (l-hvdroxy-6-phenoxy-l,3-dihvdro-benzofcJfl,2Joxaborol-3-yl)- acetic acid
[0615] 1.16 g of (l-Hydroxy-6-phenoxy-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl)- acetic acid ethyl ester (E35) was separated by preparative HPLC using a CHIRALP AK® IC column (250 x 50 mm) using a mobile phase composition of 10% ethanol in hexane containing 0.1% of trifluoroacetic acid at a flow rate of 120 ml/min at ambient temperature. The sample size was 5ml at a concentration of 23g/l, giving a production rate of 2.76 g/hour. The 1st peak collected (3R-(l-hydroxy-6-phenoxy- l,3-dihydro-benzo[c][l,2]oxaborol-3-yl)-acetic acid ethyl ester) had a purity of 99.9%ee. [0616] To a solution of 3R-(I -hydroxy-6-phenoxy- 1, 3-dihydro- benzo[c][l,2]oxaborol-3-yl)-acetic acid ethyl ester (0.4 g, 1.28 mmol, peak 1) in methanol (8 mL) was added a solution of LiOH (0.153 g, 6.40 mmol) in water (6 mL) at 0 0C. The resulting mixture was stirred at 0 0C for 5 hours then acidified to pH = 2 with dilute hydrochloric acid and extracted with EtOAc (2 x 20 mL). The organic extracts were washed with brine, dried over sodium sulfate and concentrated in vacuo. The residue was purified by silica gel flash column chromatography (acetone/hexanes = 1 :2) to give pure product as a white powder after lyophilization (0.370 g, 100%); mp 146-147 0C. IHNMR (400 MHz, DMSO-d) δ 9.27 (s, 1 H), 7.52 (d, J=8.0 Hz, 1 H) 7.46-7.42 (m, 2 H), 7.28 (d, J=2.4 Hz, 1 H), 7.23-7.17 (m, 2 H), 7.08-7.05 (m, 2 H), 5.47 (dd, J=8.8, 4.0 Hz, 1 H), 2.98 (dd, J=15.2, 4.0 Hz, 1 H), 2.38 (dd, J=15.6, 9.2 Hz, 1 H). MS (ESI) m/z = 283 [M - H]-.
E39 3-(l-Hvdroxy-6-phenoxy-l,3-dihvdro-benzofclfl,21oxaborol-3-yl)- propionic acid
[0617] To a mixture of magnesium turnings (0.439 g, 18.04 mmol), iodine (catalytic amount) in anhydrous THF (10 mL) was slowly added (3-bromo-propoxy)- trimethyl-silane (3.52 g, 13.88 mmol) in THF (15 mL) at room temperature under nitrogen. After the reaction initiated, the speed of the addition of the (3-bromo- propoxy)-trimethyl-silane solution was controlled to maintain the temperature of the reaction mixture at 30-35 0C. After the addition completed the resulting mixture was stirred at 40 0C for 1 h to afford a solution of 3-(tert-butyl-dimethyl-silanyloxy)- propylmagnesium bromide.
Step 2 3- [3- (tert-Butyl-dimethyl-silanyloxy)-propyl] -6-phenoxy-3H-benzo[c] [1 , 2]- oxaborol-1-ol
[0618] To a solution of 4-phenoxy-2-(4,4,5,5-tetramethyl-[l ,3,2]dioxaborolan-2- yl)-benzaldehyde (3.0 g, 9.25 mmol) in anhydrous THF (15 mL) was slowly added the solution of 3-(tert-butyl-dimethyl-silanyloxy)-propylmagnesium bromide (whole from step 1, 13.88 mmol) at -78 0C under nitrogen. The resulting mixture was stirred while slowly warmed to room temperature for 2 h. The mixture was treated with saturated NH4Cl (50 mL) and extracted with EtOAc. The extract was washed with brine, dried and concentrated to dryness to give the crude product (4.42 g) which could be used without purification. IHNMR (400 MHz, DMSO-d6) δ 9.12 (s, 1 H), 7.42-7.36 (m, 3 H), 7.26 (d, J=2.05 Hz, 1 H), 7.19-7.13 (m, 2 H), 7.03 - 7.00 (m, 2 H), 5.17-14 (m, 1 H), 3.60 (t, J=6.5 Hz, 2 H), 2.00-1.92 (m, 1 H), 1.58-1.46 (m, 3 H), 0.85 (s, 9 H), 0.05 (s, 6H).
Step 3 3-(3-Hydroxy-propyl)-6-phenoxy-3H-benzo [c] [ 1 ,2] oxaborol- l-ol
[0619] To a solution of 3-[3-(tert-butyl-dimethyl-silanyloxy)-propyl]-6-phenoxy- 3H-benzo[c][l,2]-oxaborol-l-ol (4.42 g, crude) in THF (20 rnL) was added water (20 rnL) and acetic acid (60 mL). The reaction mixture was then stirred at 55-60 0C for 1.5 h. The resulting mixture was concentrated to dryness. The residue was purified by chromatography on silica gel (acetone/hexanes/AcOH = 2:5:trace) to give 1.56g (59%, 2 steps) of pure product as white solid. IHNMR (400 MHz, DMSO-d6) δ 9.11 (s, 1 H), 7.43-7.38 (m, 3 H), 7.26 (d, J=2.34 Hz, 1 H), 7.11 - 7.20 (m, 2 H), 7.02 (d, J=7.90 Hz, 2 H), 5.14 (d, J=6.73 Hz, 1 H), 4.41 (t, J=5.27 Hz, 1 H), 3.41 (q, J=5.66 Hz, 2 H), 1.89 - 2.02 (m, 1 H), 1.38 - 1.55 (m, 3 H). MS (ESI) m/z = 283 [M - H]-.
Step 4 3-(l-Hydroxy-6-phenoxy-l,3-dihydro-benzo[c] [ 1 ,2] oxaborol-3-yl)-propionic acid
[0620] To a solution of 3-(3-hydroxy-propyl)-6-phenoxy-3H- benzo[c][l,2]oxaborol-l-ol (0.5 g, 1.76 mmol) in acetone (15 mL) was added Jones' reagent (1/2 of the volume of the Jones' reagent of 0.469 g Of CrO3 in 0.5 ml of H2SO4 and 1.5 mL of water) at -50 0C. The reaction mixture was then stirred at -50 0C to RT for 0.5 h. The resulting mixture was quenched by adding brine at -60 0C, extracted with EtOAc. The extract was washed with brine, dried and concentrated to dryness. The residue was purified by chromatography on silica gel (acetone/hexanes/AcOH = 1 :2:trace) to give 0.30 g of product which was further purified by chromatography on silica gel (MeOH/DCM = 3:40) to give 0.203 g of pure product as a white solid; mp 54-56 0C. 1H NMR (400 MHz, DMSO-d6) 5 9.17 (br. s., 1 H), 7.32 - 7.55 (m, 3 H), 7.24 (d, J=I.76 Hz, 1 H), 7.08 - 7.20 (m, 2 H), 7.01 (d, J=7.91 Hz, 2 H), 5.12 (d, J=6.45 Hz, 1 H), 2.11 - 2.40 (m, 3 H), 1.63 (q, J=8.60 Hz, 1 H). MS (ESI) m/z = 297 [M - H]-.
E40 3-(l-hydroxy-6-(3-hydroxyt)henoxy)-l,3-dihvdrobenzotcltl,21oxaborol-3- vDpropanoic acid
[0621] A solution of 3-(6-(3-(benzyloxy)phenoxy)- 1 -hydroxy- 1 ,3- dihydrobenzo[c][l,2]oxaborol-3-yl)propanoic acid (80 mg, 0.2 mmol) in ethanol was treated with palladium (10 % wet on charcoal, 30 mg), then hydrogenation with hydrogen balloon overnight. The mixture was filtered through a Celite pad and rinsed with ethyl acetate. The filtrate was concentrated then purified by column to give product as a white solid (32 mg, 51% yield). This ester was then treated with sodium hydroxide and hydrogen chloride respectively, as demonstrated in the preparations of E55 and E61. 1H NMR (400 MHz, DMSO-d6) 512.0 (b, 1 H), 9.56 (s, 1 H), 9.14 (s, 1 H), 7.36 (d, J = 8.4 Hz, 1 H), 7.22 (d, J = 2.0 Hz, 1 H), 7.10 (m, 2 H), 6.48 (dd, J = 8.0, 2.0 Hz, IH), 6.36 (dd, J = 8, 2.0 Hz, IH), 6.32 (s, 1 H), 5.08 (d, J = 8.4 Hz, 1 H), 2.20 (m, 2 H), 1.60 (m,l H). MS (ESI) m/z = 313 [M - H]-. E41 N-t2-(l-Hvdroxy-6-phenoxy-l,3-dihvdro-benzotcltl,21oxaborol-3-yl)- acetyll-methanesulfonamide
[0622] To a suspension of (l-hydroxy-6-phenoxy-l,3-dihydro- benzo[c][l,2]oxaborol-3-yl)-acetic acid (0.15 g, 0.528 mmol) in DCM (5 mL) was added l,l '-carbonyldiimidazole (0.256 g, 1.58 mmol) at room temperature under nitrogen. The reaction mixture was then stirred at room temperature for 1 h before methanesulfonamide (0.151 g, 1.58 mmol) was added at room temperature. After stirred at room temperature for 0.5 h, l,8-diazabicyclo[5.4.0]undec-7-ene (0.241 g, 1.58 mmol) was added. Then the resulting mixture was stirred at room temperature for 1 h. The reaction was quenched by adding ice-water and acidified to pH 2 using diluted hydrochloric acid. The mixture was extract with EtOAc. The extract was washed with brine, dried over sodium sulfate, and concentrated. The residue was purified by chromatography on silica gel (DCM/MeOH/AcOH = 10:1 :trace) to give 0.065 g of pure product as white solid; mp 78-79 0C 1H NMR (400 MHz, DMSO-
d6) δ 9.29 (s, 1 H), 7.47 (d, J=8.20 Hz, 1 H), 7.38 - 7.43 (m, 2 H), 7.25 (d, J=2.05 Hz, 1 H), 7.13 - 7.22 (m, 2 H), 7.01 - 7.05 (m, 2 H), 5.48 (dd, J=9.23, 3.66 Hz, 1 H), 3.27 (s, 3 H), 2.98 (dd, J=15.38, 3.66 Hz, 1 H), 2.41 (dd, 1 H) MS (ESI) m/z = 360 [M - H]-.
E42 2-(l-hvdroxy-6-(3-hvdroxyphenoxy)-l,3-dihvdrobenzofclfl,21oxaborol-3- vϋacetic acid
Step 1. Ethyl 2-(6-(3-(benzyloxy)phenoxy)- 1 -hydroxy- 1 ,3-dihydrobenzo[c] [1 ,2] oxaborol-3-yl) acetate
I Zn, TMSCI, THF O
^^ OCzHg
[0623] This step was done similarly as Step 1 in the preparation of E90, except using 4-(3-(benzyloxy)phenoxy)-2-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)benzaldehyde (0.86 g, 2 mmol) as starting material. The product is a light yellow oil (0.67 g, 81% yield).
Step 2. 2-(l-hydroxy-6-(3-hydroxyphenoxy)-l ,3-dihydrobenzo[c] [1 ,2] oxaborol-3- yl)acetic acid
[0624] Ethyl 2-(6-(3-(benzyloxy)phenoxy)-l-hydroxy-l,3- dihydrobenzo[c][l,2]oxaborol-3-yl)acetate was treated with sodium hydroxide and hydrogenation respectively, as demonstrated in the preparation of E55 and step 3 of E46. The final product is a white solid. 1H NMR (400 MHz, DMSO-d6) δ 12.4 (b, 1 H), 9.53 (s, 1 H), 9.24 (s, 1 H), 7.40 (d, J = 8.4 Hz, 1 H), 7.20 (d, J = 2.4 Hz, 1 H), 7.10 (m, 2 H), 6.47 (dd, J = 8, 2 Hz, 1 H), 6.36 (dd, J = 8, 2 Hz, 1 H), 6.30 (t, J = 2.4
Hz, 1 H), 5.37 (dd, J = 9.2, 4 Hz, 1 H), 2.87 (dd, J = 15.6, 4 Hz, 1 H), 2.28 (dd, J = 15.6, 8.8 Hz, 1 H). MS (ESI) m/z = 299 [M-H]+.
E43 (l-Hvdroxy-6-(3-pwerazin-l-ylmethyl-phenoxy)-l,3-dihydro- benzofclfl,2]oxaborol-3-yl)-acetic acid
Step 1: 4-[3-(3-Ethoxycarbonylmethyl-l-hydroxy-l ,3-dihydro-benzo[c] '[1 ,2] 'oxaborol- 6-yloxy) -benzyl] -piper azine-1-carboxylic acid tert-butyl ester
[0625] To a solution [6-(3-formyl-phenoxy)-l-hydroxy-l,3-dihydro-benzo[c] [1, 2] oxaborol-3-yl)-acetic acid ethyl ester (0.8 g, 2.35 mmol) in 1 ,2-dichloroethane (50 rnL) was added two drops of acetic acid, triethylortho formate (0.69 g, 4.70 mmol) and piperazine-1-carboxylic acid tert-butyl ester (0.87 g, 4.70 mmol). The reaction mixture was stirred at room temperature for 45 minutes. NaBH(OAc)3 (99 g, 9.4 mmol) was added in portions and the reaction mixture was stirred at room temperature for 3 hours. Aqueous NaOH (IM, 30 mL) was added followed by water (200 mL) and the solution extracted with ethyl acetate (3 x 200 mL). The organic extracts were combined, dried over Na2SO4, filtered and concentrated. The residue was purified by silica gel flash column chromatography (0-7% MeOHZCH2Cl2) to give 4-[3-(3-ethoxycarbonylmethyl-l -hydroxy- l,3-dihydro-benzo[c][l,2]oxaborol-6- yloxy)-benzyl]-piperazine-l-carboxylic acid tert-butyl ester as a yellow foam (0.64 g, 53.7%). 1H NMR 400 MHz (d6-DMSO) δ 9.23 (s, IH), 7.48 (d, J = 8.4 Hz, IH), 7.36 (m, IH), 7.24 (d, J = 2.0 Hz, IH), 7.18 (dd, J = 8.0, 2.4 Hz, IH), 7.08 (d, J = 7.2 Hz, IH), 6.96 (s, IH), 6.90 (dd, J = 8.4, 2.0 Hz, IH), 4.46 (m, IH), 4.10 (m, 2H), 3.46 (s, 2H), 3.28 (m, 4H), 3.06 (m, IH), 2.45 (m, IH), 2.31 - 2.28 (m, 4H), 1.38 (s, 9H), 1.18 (t, J = 6.8 Hz, 3H).
Step 2: 4- [3-(3-Carboxylmethyl-l -hydroxy- 1 ,3-dihydro-benzo[c] '[1 ,2]oxaborol-6- yloxy)-benzyl]-piperazine-l-carboxylic acid tert-butyl ester
[0626] To a solution of 4-[3-(3-ethoxycarbonylmethyl-l-hydroxy-l,3-dihydro- benzo[c][l,2]oxaborol-6-yloxy)-benzyl]-piperazine-l-carboxylic acid tert-butyl ester (0.64 g, 1.25 mmol) in THF (15 mL)at 0 0C was added a solution of LiOH (0.15 g, 6.27 mmol) in water (10 mL). The solution was allowed to warm to room temperature and stirred for 5 hours then acidified to pH 5 with 6M HCl. The solution was extracted with ethyl acetate and the organic extracts washed with water, brine, dried over sodium sulfate and concentrated in vacuo. The residue was purified by silica gel flash column chromatography (1-11% MeOH/DCM) to give 4-[3-(3- carboxylmethyl-l-hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-6-yloxy)-benzyl]- piperazine-1-carboxylic acid tert-butyl ester as a white solid (0.35 g, 58%). IHNMR (400 MHz, DMSO-d6) δ 9.19 (s, IH), 7.48 (d, J = 8.4 Hz, IH), 7.34 (t, J = 8.0 Hz, IH), 7.24 (d, J = 2.0 Hz, IH), 7.17 (d, J = 8.0 Hz, IH), 7.08 (d, J = 8.0 Hz, IH), 6.97 (s, IH), 6.88 (s, IH), 5.44 (m, IH), 4.10 (m, 2H), 3.47 (s, 2H), 3.30 (m, 2H), 2.92 (m, IH), 2.37 - 2.28 (m, 5H), 1.38 (s, 9H).
Step 3: (l-Hydroxy-6-(3-piperazin-l-ylmethyl-phenoxy)-l, 3-dihydro- benzofcjfl, 2] oxaborol-3-yl)-acetic acid
[0627] To a solution of 4-[3-(3-carboxylmethyl-l-hydroxy-l,3-dihydro- benzo[c][l,2]oxaborol-6-yloxy)-benzyl]-piperazine-l-carboxylic acid tert-butyl ester (0.32 g, 0.66 mmol) in EtOAc (10 mL) was added 4M HCl in dioxane (1.99 mL, 7.96 mmol) at 0 0C. The resulting mixture was stirred at room temperature for 5 hours then concentrated in vacuo. The residue was purified by preparative HPLC to give (1- hydroxy-6-(3-piperazin- 1 -ylmethyl-phenoxy)- 1 ,3-dihydro-benzo[c][ 1 ,2]oxaborol-3-
yl)-acetic acid as a white solid (0.145 g, 57.5%). mp 196.2 - 197.6 0C. 1HNMR (400 MHz, DMSO-d6) δ 7.47 (d, J = 8.4, IH), 7.35 (t, J = 8.0, IH), 7.25 (s, IH), 7.16 (d, J = 8.0, IH), 7.10 (d, J = 7.6, IH), 6.99 (s, IH), 6.91 (d, J = 7.6, IH), 5.43 (m, IH), 3.52 (s, 2H), 3.40 - 3.20 (m, 6H), 2.99 (s, 2H), 2.93 (m, IH), 2.35 (m, IH). MS (ESI) m/z: 383 (M+l)+. HPLC purity: 96.16 % (Maxplot), 96.78 % (220 nm).
E44 (l-Hvdroxy-6-/3-f(2-methoxy-ethylamino)-methylJ-phenoxy}-l,3-dihvdw- benzoic] 11,2) 'oxaborol-3-yl)-acetic acid
Step 1 : (l-Hydroxy-6-{3-[(2-methoxy-ethylamino)-methyl] -phenoxy}-l , 3-dihydro- benzo[c] [ 1 ,2] oxaborol-3-yl)-acetic acid ethyl ester
[0628] To a solution of [6-(3-formyl-phenoxy)-l-hydroxy-l,3-dihydro-benzo[c] [1, 2] oxaborol-3-yl)-acetic acid ethyl ester (0.6 g, 1.76 mmol) in 1 ,2-dichloroethane (40 mL) was added two drops of acetic acid, triethylorthoformate (0.52 g, 3.52 mmol) and 2-methoxyethylamine (0.26 g, 3.52 mmol). The reaction mixture was stirred at room temperature for 45 minutes. NaBH(OAc)3 (1.49 g, 7.04 mmol) was added in portions and the reaction mixture was stirred at room temperature for 3 hours. Aqueous NaOH (IM, 30 mL) was added followed by water (200 mL) and the solution extracted with ethyl acetate (3 x 200 mL). The organic extracts were combined, dried over Na2SO4, filtered and concentrated. The residue was purified by silica gel flash column chromatography (1-11% MeOH/CH2Cl2) to give (l-hydroxy-6-{3-[(2- methoxy-ethylamino)-methyl]-phenoxy} - 1 ,3-dihydro-benzo[c] [ 1 ,2]oxaborol-3-yl)- acetic acid ethyl ester as a white solid (0.48 g, 68%). 1H NMR 400 MHz (d6-DMSO) δ 9.25 (s, IH), 7.45 (d, J = 8.4 Hz, IH), 7.35 (t, J = 8.0 Hz, IH), 7.25 (d, J = 2.4 Hz, IH), 7.20 - 7.15 (m, 2H), 7.10 (s, IH), 6.92 (dd, J = 8.0, 1.6 Hz, IH), 5.42 (m, IH), 4.08 (m, 2H), 3.85 (s, 2H), 3.50 (m, 2H), 3.22 (s, 3H), 3.10 (m, IH), 2.80 (m, 2H), 2.45 (m, IH), 1.18 (m, 3H).
Step 2: (l-Hydroxy-6-{3-[(2-methoxy-ethylamino)-methyl] -phenoxy}-l , 3-dihydro- benzofcjfl, 2] oxaborol-3-yl)-acetic acid
[0629] To a solution of (1 -hydroxy-6- {3-[(2-methoxy-ethylamino)-methyl]- phenoxy}-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl)-acetic acid ethyl ester (0.26 g, 0.65 mmol) in THF (9 niL) at 0 0C was added a solution of LiOH (0.078 g, 3.26 mmol) in water (5 rnL). The solution was allowed to warm to room temperature and stirred for 5 hours then acidified to pH 2 with 6M HCl and concentrated in vacuo. The residue was purified by preparative HPLC to give (1 -hydroxy-6- {3-[(2-methoxy- ethylamino)-methyl]-phenoxy} - 1 ,3-dihydro-benzo[c][ 1 ,2]oxaborol-3-yl)-acetic acid as a white solid (0.045 g, 18.6%). mp 117.9 - 118.2 0C. IHNMR (400 MHz, DMSO- d6) δ 7.45 (d, J = 8.0 Hz, IH), 7.34 (t, J = 7.6, IH), 7.22 (d, J = 2.4 Hz, IH), 7.16 (dd, J = 8.4, 2.4 Hz, IH), 7.10 (d, J = 7.6 Hz, IH), 7.00 (s, IH), 6.85 (d, J = 8.0 Hz, IH), 5.42 (m, IH), 3.69 (s, 2H), 3.38 (m, 2H), 3.21 (s, 3H), 2.92 (m, IH), 2.62 (t, J = 5.6 Hz, 2H), 2.35 (m, IH). MS (ESI) m/z: 372 (M+l)+. HPLC purity: 92.93 % (Maxplot), 94.31 % (220 nm).
E45 (l-Hvdroxy-6-(3-morpholin-4-ylmethyl-phenoxy)-l,3-dihydro- benzofclfl,2]oxaborol-3-yl)-acetic acid
[0630] To a solution of 3-hydroxybenzaldehyde (15.0 g, 0.12 mol) and p- toluenesulfonic acid in 1 ,2-ethanediol (27.2 mL, 0.488 mol)) was added triethylorthoformate (23.66 g, 0.159 mol). The resulting mixture was stirred at room temperature overnight. The reaction mixture was quenched by the addition of aqueous NaHCO3 (0. IM, 500 mL) and stirred vigorously for 2 minutes at room temperature
then extracted with ethyl acetate (3 x 400 mL). The organic extracts were combined, dried over Na2SO4, filtered and concentrated. The residue was purified by silica gel flash column chromatography (10-25% ethyl acetate/hexane) to give 3-[l,3]dioxolan- 2-yl-phenol as a clear oil (12.5 g, 61.8%). 1H NMR 400 MHz (CDCl3) δ 7.23 (d, J = 8.4 Hz, IH), 7.02 (d, J = 8.0 Hz, IH), 6.94 (d, J = 2.0 Hz, IH), 6.77 (dd, J = 7.6, 2.0 Hz, IH), 5.78 (s, IH), 5.41 (s, IH), 4.16 - 4.07 (m, 2H), 4.06 - 3.98 (m, 2H).
Step 2: 2-Bromo-4-(3- [ 1 ,3] dioxolan-2-yl-phenoxy)-benzaldehyde
[0631] A mixture of 3-[l,3]dioxolan-2-yl-phenol (10.0 g, 60.0 mmol), 2-bromo-4- fluorobenzaldehyde (13.45 g, 66.0 mmol) and K2CO3 (12.43 g, 90.0 mmol) in dimethyl formamide (50 mL) was heated at 55 0C overnight. The mixture was cooled to room temperature, diluted with water (1 L) and extracted with 50 % ethyl acetate/hexanes (4 x 600 mL). The organic extracts were combined, dried over Na2SO4, filtered and concentrated. The residue was purified by silica gel flash column chromatography (15 % ethyl acetate/hexane) to give 2-bromo-4-(3- [l,3]dioxolan-2-yl-phenoxy)-benzaldehyde as a clear oil (19 g, 90 %). 1H NMR 400 MHz (CDC13) δ 10.25 (s, IH), 7.89 (d, J = 9.2 Hz, IH), 7.46 - 7.36 (m, 2H), 7.22 (t, J = 2.4 Hz, IH), 7.18 (d, J = 2.4 Hz, IH), 7.08 (dd, J = 2.4, 1.2 Hz, IH), 6.98 (dd, J = 8.4, 2.4 Hz, IH), 5.82 (s, IH), 4.14 - 4.11 (m, 2H), 4.09 - 4.01 (m, 2H).
Step 3: 4-(3-[l,3JDioxolan-2-yl-phenoxy)-2-(4,4,5,5-tetramethyl- [1, 3, 2]dioxaborolan-2-yl)-benzaldehyde
[0632] To a mixture of 2-bromo-4-(3-[l,3]dioxolan-2-yl-phenoxy)-benzaldehyde (11.0 g, 31.5 mmol), bispinacolatodiboron (12.0 g, 47.3 mmol) and KOAc (6.2 g, 63 mmol) in dimethylformamide (40 mL) at 90 0C, PdCl2(dppf) (1.15 g, 1.58 mmol) was added and the reaction mixture was stirred at 90 0C for 3.5 hours. After cooling to
room temperature, the solution was diluted with water (800 mL) and extracted with ethyl acetate (4 x 600 mL). The organic extracts were combined, dried over Na2SO4, filtered and concentrated. The residue was purified by silica gel flash column chromatography (15-20% ethyl acetate/hexane) to give 4-(3-[l,3]dioxolan-2-yl- phenoxy)-2-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2-yl)-benzaldehyde as a colorless oil (8.0g, 64.5 %). 1H NMR 400 MHz (CDC13) δ 10.40 (s, IH), 7.92 (d, J = 8.4 Hz, IH), 7.44 (d, J = 2.4 Hz, IH), 7.40 (m, IH), 7.30 (d, J = 7.2 Hz, IH), 7.19 (d, J = 2.0 Hz, IH), 7.05 (m, 2H), 5.80 (s, IH), 4.13 - 4.07 (m, 2H), 4.07 - 4.01 (m, 2H), 1.38 (s, 12H).
Step 4: [6-(3-[l,3]Dioxolan-2-yl-phenoxy)-l-hydroxy-l,3-dihydro-benzo[c] [1, 2] oxaborol-3-yl) -acetic acid ethyl ester
[0633] To a suspension of zinc dust (8.17 g, 125 mmol) in THF (60 mL) was added trimethylsilyl chloride (1.8 g, 16.66 mmol) at 40 0C. The mixture was heated to 55 0C and stirred for 15 min. After cooling down to 37 0C, ethyl bromoacetate (19.47 g, 116.6 mmol) was slowly added to the reaction mixture at 37 - 40 0C. After addition, the resulting mixture was allowed to cool to room temperature over 30 minutes then cooled down to 0 0C. 4-(3-[l,3]Dioxolan-2-yl-phenoxy)-2-(4,4,5,5-tetramethyl- [l,3,2]dioxaborolan-2-yl)-benzaldehyde (3.3 g, 8.33 mmol) in THF (30 mL) was added to the zinc solution at 0 0C. The mixture was allowed to warm to room temperature over 1.5 hours before treating with saturated NH4Cl (50 mL) and extracting with EtOAc (10 x 100 mL). The organic extracts were washed with brine, dried and concentrated in vacuo. The residue was purified by silica gel flash column chromatography (5-100% EtOAc/hexane) to give [6-(3-[l,3]dioxolan-2-yl-phenoxy)- l-hydroxy-l,3-dihydro-benzo[c] [1, 2] oxaborol-3-yl)-acetic acid ethyl ester (3.0g, 94 %) as a colorless oil. 1H NMR 400 MHz (CDC13) δ 9.26 (s, IH), 7.48 (d, J = 8.4 Hz, IH), 7.42 (d, J = 8.0 Hz, IH), 7.25 - 7.18 (m, 3H), 7.04 (m, 2H), 5.71 (s, IH), 5.47
(m, IH), 4.12 - 4.07 (m, 2H), 4.06 - 4.00 (m, 2H), 3.99 - 3.90 (m, 2H), 3.07 (m, IH), 2.46 (m, IH), 1.20 (m, 3H).
Step 5: [6-(3-Formyl-phenoxy)- 1 -hydroxy- 1 ,3-dihydro-benzo [c] [I, 2] oxaborol-3- yl)-acetic acid ethyl ester
[0634] To a solution of [6-(3-[l,3]dioxolan-2-yl-phenoxy)-l-hydroxy-l,3-dihydro- benzo[c] [1, 2] oxaborol-3-yl)-acetic acid ethyl ester (3.0 g, 7.8 mmol) in tetrahydrofuran (5 mL) and water (5 mL) was added 20 mL of acetic acid. The reaction mixture was heated at 60 0C for 1.5 hours then cooled and concentrated in vacuo. 50 mL of water was added and the solution lyophilized to give [6-(3-formyl- phenoxy)-l-hydroxy-l,3-dihydro-benzo[c] [1, 2] oxaborol-3-yl)-acetic acid ethyl ester (3.0g, quantitative). 1H NMR 400 MHz (CDC13) δ 9.96 (s, IH), 9.25 (s, IH), 7.69 (d, J = 7.6 Hz, IH), 7.62 (t, J = 8.0 Hz, IH), 7.50 (d, J = 8.8 Hz, IH), 7.41 - 7.36 (m, 2H), 7.30 (s, IH), 7.24 (d, J = 2.4 Hz, IH), 5.44 (m, IH), 4.05 (m, 2H), 3.06 (m, IH), 2.48 (s, 3H), 2.46 (m, IH).
Step 6: [l-Hydroxy-6-(3-morpholin-4-ylmethyl-phenoxy)-l,3-dihydro-benzo[c] [I, 2] oxaborol-3-yl) -acetic acid ethyl ester
[0635] To a solution of [6-(3-formyl-phenoxy)-l-hydroxy-l,3-dihydro-benzo[c] [1, 2] oxaborol-3-yl)-acetic acid ethyl ester (0.5 g, 1.47 mmol) in 1 ,2-dichloroethane (30 mL) was added two drops of acetic acid, triethylorthoformate (0.44 g, 2.94 mmol) and morpholine (0.26 g, 2.94 mmol). The reaction mixture was stirred at room temperature for 45 minutes. NaBH(OAc)3 (1.25 g, 5.88 mmol) was added in portions and the reaction mixture stirred at room temperature for 3 hours. Aqueous NaOH (IM, 30 mL) was added followed by water (200 mL) and the solution extracted with ethyl acetate (3 x 200 mL). The organic extracts were combined, dried over Na2SO4,
filtered and concentrated. The residue was purified by Biotage using (1-6% MeOHZCH2Cl2) to give [l-hydroxy-6-(3-morpholin-4-ylmethyl-phenoxy)-l,3- dihydro-benzo[c] [1, 2] oxaborol-3-yl)-acetic acid ethyl ester as a white solid (0.29 g, 48%). IHNMR (400 MHz, DMSO-d6) δ 9.25 (s, IH), 7.47 (d, J = 8.4 Hz, IH), 7.34 (t, J = 8.0 Hz, IH), 7.24 (d, J = 2.4 Hz, IH), 7.17 (dd, J = 8.0, 2.4 Hz, IH), 7.08 (d, J = 7.6 Hz, IH), 6.96 (s, IH), 6.90 (dd, J = 8.0, 1.6 Hz, IH), 5.45 (dd, J = 8.4, 3.6 Hz, IH), 4.07 (m, 2H), 3.55 - 3.53 (m, 4H), 3.45 (s, 2H), 3.06 (m, IH), 2.45 (m, IH), 2.33 (m, 4H). 1.18 (m, 3H).
Step 7: [l-Hydroxy-6-(3-morpholin-4-ylmethyl-phenoxy)-l,3-dihydro-benzo[c] [1, 2] oxaborol-3-yl)-acetic acid hydrochloride
[0636] To a solution of [l-hydroxy-6-(3-morpholin-4-ylmethyl-phenoxy)-l,3- dihydro-benzo[c] [1, 2] oxaborol-3-yl)-acetic acid ethyl ester (0.26 g, 0.63 mmol) in THF (9 rnL) was added a solution of LiOH (0.076 g, 3.16 mmol) in water (0.5 mL) at 0 0C. The resulting mixture was stirred at room temperature for 5 hours then acidified to pH = 2 with 6M hydrochloric acid and concentrated. The residue was purified by silica gel flash column chromatography (5% MeOH/DCM). The obtained product was dissolved in 10 ml of water and 0.5 mL of concentrated HCl and stirred for 10 minutes. The solution was lyophilized to give [l-hydroxy-6-(3-morpholin-4- ylmethyl-phenoxy)-l,3-dihydro-benzo[c] [1, 2] oxaborol-3-yl)-acetic acid hydrochloride salt as an off white solid. (0.1 g, 38%). mp 137 - 139.2 0C. 1HNMR (400 MHz, DMSO-d6) δ 10.88 (brs, IH), 7.50 (d, J = 8.4 Hz, 2H), 7.37 (d, J = 7.6 Hz, IH), 7.31 (d, J = 2.4 Hz, 2H), 7.22 (m, IH), 7.12 (m, IH), 5.44 (m, IH), 4.33 (s, 2H), 3.93 (d, J = 11.6, 2H), 3.74 (t, = 12.0 Hz, 2H), 3.22 (d, J = 12.0 Hz, 2H), 3.10 - 3.02 (m, 2H), 2.94 (m, IH), 2.35 (m, IH). MS (ESI) m/z: 384 [M+l]+. HPLC purity: 91.09 % (Maxplot), 93.48 % (220 nm).
E46 3-(6-(3-(3-aminopropoxy)phenoxy)-l-hydroxy-l,3- dihydrobenzofclfUloxaborol-S-vDpropanoic acid
Step 1. Ethyl 3-(6-(3-(benzyloxy)phenoxy)-l-hydroxy-l,3- dihydrobenzo [c] [ 1 ,2] oxaborol-3-yl)propanoate
[0637] A few drops of concentrated sulfuric acid was added to a solution of 3-(6- (3 -(benzyloxy)phenoxy)- 1 -hydroxy- 1 ,3 -dihydrobenzo [c] [ 1 ,2]oxaborol-3 -yl)propanoic acid (0.8 g, 1.98 mmol)in ethanol and the resulting mixture was heated at reflux for two hours. Column purification gave desired product (0.6 g) and recovered starting material.
Step 2. Ethyl 3-( l-hydroxy-6-(3-hydroxyphenoxy)- 1 ,3 -dihydrobenzo [c] / 1 ,2) 'oxaborol- 3-yl)propanoate
[0638] Hydrogenation of ethyl 3-(6-(3-(benzyloxy)phenoxy)-l-hydroxy-l,3- dihydrobenzo[c][l,2]oxaborol-3-yl)propanoate (610 mg, 1.41 mmol) with hydrogen balloon overnight in ethanol with palladium (10 % wet on charcoal, 200 mg gave product as a colorless oil (394 mg, 82% yield). MS (ESI) m/z = 401 [M-H]+.
Step 3. 3-(6-(3-(3-aminopropoxy)phenoxy)-l-hydroxy-l,3- dihydrobenzofc] [1 , 2] oxaborol-3-yl)propanoic acid
[0639] To a cooled (0 0C) suspension of ethyl 3-(l-hydroxy-6-(3- hydroxyphenoxy)-l,3-dihydrobenzo[c][l,2]oxaborol-3-yl)propanoate (103 mg, 0.3 mmol)in DMF was added sodium hydride (40 mg, 0.9 mmol). After stirring at 0 0C for 15 minutes, a solution of tert-butyl 3-bromopropylcarbamate (216 mg, 0.9 mmol) in DMF was added. The reaction was stirred at room temperature for two hours. It
was then quenched with water, extracted with EtOAc, washed with brine, dried over Na2SO4, and concentrated under reduced pressure. Flash column purification gave colorless oil. This oil was then treated with sodium hydroxide and hydrogen chloride respectively, as demonstrated in the preparation of E55 and E61. The resulting crude is purified by HPLC to give product as a white solid. 1H NMR (300 MHz, CD3CN) δ 7.0-7.4 (m, 4 H), 6.5-6.7 (m, 3 H), 5.2 (d, J = 6.3 Hz, 1 H), 4.06 (6, J = 5.7 Hz, 2 H), 3.16 (s, 2 H), 2.34 (m, 4 H), 2.05 (m, 2 H). MS (ESI) m/z = 370 [M-H]+.
E47 3-(6-(3-(benzyloxy)phenoxy)-l-hydroxy-l,3- dihydrobenzofcl fl,2]oxaborol-3-yl)propanoic acid
[0640] 6-(3-(benzyloxy)phenoxy)-3-(3-hydroxypropyl)benzo[c][l,2]oxaborol- l(3H)-ol (1.61 g, 4.13 mmol) was dissolved in 40 ml acetone, cooled to -50 0C, then a solution of chromium(VI) oxide (1.1 g, 11 mmol) in sulfuric acid and water (1 :3, total 6 ml) was slowly added. The reaction was allowed to warm up to room temperature in 30 minutes. Then it was cooled to -60 0C and quenched with brine, extracted with EtOAc, washed with brine, dried over Na2SO4, concentrated under reduced pressure. The crude was purified by column. 1U NMR (400 MHz, DMSO-d6) δ 12.1 (b, 1 H), 9.18 (s, 1 H), 7.25-7.5- (m, 8 H), 7.14 (dd, J = 8.4, 2.4 Hz, 1 H), 6.78 (dd, J = 8, 2.4 Hz, 1 H), 6.30 (t, J = 2.4 Hz, 1 H), 6.54 (dd, J = 8.4, 2.4 Hz, 1 H), 5.12(m, 1 H), 5.10 (s, 2 H), 2.2-2.3 (m, 3 H), 1.64 (m, 1 H). MS (ESI) m/z = 403 [M-H]+.
E48 2-(6-(3-(3-Aminopropoxy)phenoxy)-l-hydroxy-l,3- dihvdrobenzofclfl,21oxaborol-3-yl)acetic acid
Step 1. Ethyl 2-( l-hydroxy-6-(3-hydroxyphenoxy)- 1 ,3-dihydrobenzo [c] [ 1 ,2] oxaborol- 3-yl)acetate
[0641] The hydrogenation was done in the same manner as in E40. The product is a colorless oil. MS (ESI) m/z = 387 [M-H]+.
Step 2. 2-(6-(3-(3-Aminopropoxy)phenoxy)-l-hydroxy-l,3- dihydrobenzofcj [1 , 2] oxaborol-3-yl) acetic acid
[0642] The coupling step and the subsequent two steps were done according to the procedure described in E46. The product is a white powder. MS (ESI) m/z = 356 [M- H]+. 1H NMR (400 MHz, DMSO-d6) δ 12.4 (b, 1 H), 9.24 (s, 1 H), 7.71 (s, 2 H), 7.45 (d, J = 8.0 Hz, 1 H), 7.26 (t, J = 8.0 Hz, 1 H), 7.21 (s, 1 H), 7.14 (d, J = 8.4 Hz, 1 H), 6.69 (m, 1 H), 6.55 (m, 2 H), 5.41 (dd, J = 8.8, 4 Hz, 1 H), 4.0 (t, J = 6 Hz, 2 H), 2.93 (m, 3 H), 2.30 (dd, , J = 16, 9.2 Hz, 1 H), 1.95 (m, 2 H). MS (ESI) m/z = 374 [M - H]-.
E49 (S) {6-[3-(3-Amino-propoxy)-phenoxyl-l-hvdroxy-l,3-dihydro- benzotcl t 1,21 oxaborol-3-vU-acetic acid
[0643] E49 was obtained using a similar procedure as outlined for E50 using (S)- {6- [3 -(3 -tert-butoxycarbonylamino-propoxy)-phenoxy] - 1 -hydroxy- 1 ,3 -dihydro- benzo[c][l,2]oxaborol-3-yl} -acetic acid ethyl ester.
E50 (R)-{6-f3-(3-Amino-propoxy)-phenoxyI-l-hvdroxy-l,3-dihydro- benzotcl t 1,21 oxaborol-3-vU-acetic acid
Step 1: (R)-{6- [3-(3-tert-Butoxycarbonylamino-propoxy)-phenoxy] - 1 -hydroxy- 1,3- dihydro-benzofc] [ 1 ,2] oxaborol-3-yl}-acetic acid
[0644] 4 g of {6-[3-(3-tert-butoxycarbonylamino-propoxy)-phenoxy]-l-hydroxy- l,3-dihydro-benzo[c][l,2]oxaborol-3-yl}-acetic acid ethyl ester were separated by preparative supercritical fluid chromatography using a CHIRALP AK® IC column (250 x 50 mm) using a mobile phase composition of 15% methanol in carbon dioxide at a flow rate of 360 ml/min at ambient temperature. The sample size was 20 ml at a concentration of 16.8 g/1, giving a production rate of 1.8 g/hour. The purity of the products was 98.8%ee (1st peak) and 99.2%ee (2nd peak).
[0645] To a solution of (R){6-[3-(3-tert-butoxycarbonylamino-propoxy)-phenoxy]- 1 -hydroxy- 1 ,3-dihydro-benzo[c] [ 1 ,2]oxaborol-3-yl} -acetic acid ethyl ester (0.860 g, 1.77 mmol) in THF (10 mL) and water (6 mL) was added LiOH (0.26 g, 10.64 mmol) at 0 0C. The resulting mixture was stirred at room temperature for 2 hours then cooled to 00C and acidified to pH 3 with 6N HCl. The mixture was extracted with EtOAc, dried and concentrated in vacuo to give (R)-{6-[3-(3-tert-butoxycarbonylamino- propoxy)-phenoxy]-l-hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl} -acetic acid (0.88 g, quant.). 1H NMR (400 MHz, MeOD4) δ 7.40 (d, J = 10.2 Hz, IH), 7.22 - 7.08 (m, 3H), 6.64 (M, IH), 6.50 (m, 2H), 5.59 (m, IH), 3.95 (m, 2H), 3.20 (m, 2H), 2.90 (m, IH), 2.50 (m, IH), 1.90 (m, IH), 1.20 (m, IH).
Step 2: (R)-{6-[3-(3-Amino-propoxy)-phenoxy] -l-hydroxy-l ,3-dϊhydro- benzo[c] [ 1 ,2] oxaborol-3-yl}-acetic acid
[0646] To a solution of (R)- {6-[3-(3-tert-butoxycarbonylamino-propoxy)- phenoxy]-l-hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl}-acetic acid (0.88 g, 1.77 mmol) in dioxane (5 niL) was added 4M HCl in dioxane (7.5 niL). The mixture was stirred at room temperature for 1.5 hours and concentrated in vacuo. The residue was purified by preparative HPLC to give {6-[3-(3-amino-propoxy)-phenoxy]-l- hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl}-acetic acid (0.580 g, 70%). 1H NMR (400 MHz, DMSO-d6) δ 9.20 (s, IH), 8.75 (br s, 3H), 7.45 (d, J = 8.8 Hz, IH), 7.30 - 7.20 (m, 2H), 7.17 (m, IH), 6.72 (m, IH), 6.55 (m, 2H), 5.30 (m, IH), 4.00 (m, 2H), 2.93 (m, 3H), 2.34 (m, IH), 1.96 (m, IH). ( MS (ES) m/z: 358 (M +1)+. HPLC purity: 99.51 % (220 nm), 98.91% (Maxplot).
E51 3-(2-Hvdroxy-ethyl)-6-phenoxy-3H-benzofcJfl,2Joxaborol-l-ol
[0647] To a solution of (l-hydroxy-6-phenoxy-l,3-dihydro-benzo[c][l,2]oxaborol- 3-yl)-acetic acid ethyl ester (0.3 g, 0.960 mmol) in anhydrous THF (10 mL) was slowly added LiAlH4 (0.055 g, 1.44 mmol) at 0 0C under nitrogen. The resulting mixture was stirred at 0 0C to room temperature for 40 min. The reaction was quenched by adding water at 0 0C and the mixture was acidified to pH 2 using diluted hydrochloric acid. The mixture was extracted with EtOAc. The extract was washed with brine and dried to give the crude product which was purified by chromatography on silica gel (acetone/hexanes = 1 :1). The product was dissolved into water/methanol, acidified to pH 2 using diluted hydrochloric acid and lyophilized to give 0.189 g of pure product as a white powder. Mp 83-85 0C. 1HNMR (400 MHz, DMSO-d6) δ 9.24 (s, 1 H), 7.46 (d, J = 8.20 Hz, 1 H), 7.39 (t, J = 7.76 Hz, 2 H), 7.22 (d, J= 2.05 Hz, 1 H), 7.08 - 7.19 (m, 2 H), 7.00 (d, J= 8.20 Hz, 2 H), 5.44 (dd, J= 8.78, 3.81 Hz, 1 H), 4.08 (q, J= 7.22 Hz, 2 H), 3.64-3.53 (m, 2 H), 2.06-2.02 (m, 1 H), 1.53-1.47 (m, 1 H). MS (ESI) m/z = 269 [M - H]".
E52 S-β-Hvdroxy-propyD-ό-phenoxy-SH-benzofcIflJIoxaborol-l-ol
Step I. 3-(tert-Butyl-dimethyl-silanyloxy)-propylmagnesium bromide
[0648] To a mixture of magnesium turnings (0.444 g, 18.3 mmol), iodine (catalytic amount) in anhydrous THF (10 mL) was slowly added (3-bromo-propoxy)-trimethyl- silane (3.56 g, 14.1 mmol) in THF (15 mL) at room temperature under nitrogen. After the reaction initiated, the speed of the addition of the (3-bromo-propoxy)- trimethyl-silane solution was controlled to maintain the temperature of the reaction mixture at 30-35 0C. After the addition completed the resulting mixture was stirred at 40 0C for 1.25 h to afford a solution of 3-(ter£-butyl-dimethyl-silanyloxy)- propylmagnesium bromide.
Step 2. 2 3-[3-(tert-Butyl-dimethyl-silanyloxy)-propyl]-6-phenoxy-3H-benzo[c] [1,2]- oxaborol-1-ol
[0649] To a solution of 4-phenoxy-2-(4,4,5,5-tetramethyl-[l ,3,2]dioxaborolan-2- yl)-benzaldehyde (1.14 g, 3.52 mmol) in anhydrous THF (15 mL) was slowly added the solution of 3-(tert-butyl-dimethyl-silanyloxy)-propylmagnesium bromide (11.5 mL) at -78 0C under nitrogen. The resulting mixture was stirred while slowly warmed to room temperature for 2 h. The mixture was treated with saturated NH4Cl (50 mL) and extracted with EtOAc. The extract was washed with brine, dried and concentrated to dryness. The residue was purified by chromatography on silica gel (first purification using EtOAc/hexanes = 1 :5, second purification using THF/hexanes = 3:20) to give 0.401 g of product as a colorless oil. 1HNMR (DMSO-J6, 400MHz ) δ 9.12 (s, 1 H), 7.42-7.36 (m, 3 H), 7.26 (d, J= 2.05 Hz, 1 H), 7.19-7.13 (m, 2 H), 7.03 - 7.00 (m, 2 H), 5.17-14 (m, 1 H), 3.60 (t, J= 6.5 Hz, 2 H), 2.00-1.92 (m, 1 H), 1.58-1.46 (m, 3 H), 0.85 (s, 9 H), 0.05 (s, 6 H).
Step 3. 3-(3-Hydroxy-propyl)-6-phenoxy-3H-benzo [c] [ 1 ,2] oxaborol- l-ol
[0650] To a solution of 3-[3-(tert-butyl-dimethyl-silanyloxy)-propyl]-6-phenoxy- 3H-benzo[c][l,2]-oxaborol-l-ol (0.373 g, 0.936 mmol) in THF (2 mL) was added water (2 mL) and acetic acid (6 mL). The reaction mixture was then stirred at 55-60 0C for 1.5 h. The resulting mixture was concentrated to dryness. The residue was purified by chromatography on silica gel (acetone/hexanes/AcOH = 2:5:trace) to give 0.177g (66.6% yield) of pure product as white solid. Mp 89-91 0C. 1HNMR (DMSO- d6, 400MHz ) δ 9.11 (s, 1 H), 7.43-7.38 (m, 3 H), 7.26 (d, J= 2.34 Hz, 1 H), 7.11 - 7.20 (m, 2 H), 7.02 (d, J= 7.90 Hz, 2 H), 5.14 (d, J= 6.73 Hz, 1 H), 4.41 (t, J= 5.27 Hz, 1 H), 3.41 (q, J= 5.66 Hz, 2 H), 1.89 - 2.02 (m, 1 H), 1.38 - 1.55 (m, 3 H). MS (ESI) m/z = 283 [M - H]".
E53 6-(3-(benzyloxy)phenoxy)-3-(3-hvdroxypropyl)benzofc]fl,2]oxaborol- l(3H)-ol
[0651] To a mixture of 2-bromo-4-fluoro-benzaldehyde (26.6 g, 131 mmol), 3- (benzyloxy)phenol (25 g, 124.86 mmol) and potassium carbonate (27.1 g, 196 mmol) was added 180 ml DMF. The resulting mixture was heated at 80 0C overnight. The reaction mixture was diluted with EtOAc and washed with water, brine, dried over Na2SO4, and concentrated under reduced pressure to give 4-(3-(benzyloxy)phenoxy)- 2-bromobenzaldehyde as an off white solid, which was used for the next step without further purification.
Step 2. 4-(3-(benzyloxy)phenoxy)-2-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yljbenzaldehyde
[0652] 4-(3-(benzyloxy)phenoxy)-2-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)benzaldehyde was made the same way as in Step 2 of the preparation of E35 except using 4-(3-(benzyloxy)phenoxy)-2-bromobenzaldehyde as starting material.
Step 3. 6-(3-(benzyloxy)phenoxy)-3-(3-(tert- butyldinιethylsilyloxy)propyl)benzo[c] [1 , 2]oxaborol-l (3H)-ol
[0653] To an oven-dried round bottom flask with stirring bar, Mg turnings (140 mg, 5.76 mmol) and a few 12 crystals was slowly added one-fifth of 3- bromopropoxy)(tert-butyl)dimethylsilane (808 μL, 3.48 mmol) in 5 ml dry THF. This was heated with heat gun until brown color disappeared all at once. Then the rest of 3- bromopropoxy)(tert-butyl)dimethylsilane solution was slowly added to control temperature around 40 0C. After the addition completed, the resulting mixture was then heated at 40 0C for one hour. To a cooled (-78 0C) solution of 4-(3- (benzyloxy)phenoxy)-2-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)benzaldehyde in 5 ml dry THF was slowly added the fresh-made Grignard agent. The reaction was allowed to warm up to room temperature and then stirred at room temperature for two hours. The reaction was quenched with saturated ammonium chloride, extracted with EtOAc, washed with brine, dried over Na2SO4, and concentrated under reduced pressure. Flash column purification gave product as light yellow oil later solidified to off-white solid (1.04 g, 88% yield).
Step 4. 6-(3-(benzyloxy)phenoxy)-3-(3-hydroxypropyl)benzo [c] [ 1 ,2] oxaborol- 1 (3H)- ol
[0654] A solution of 6-(3-(benzyloxy)phenoxy)-3-(3-(tert- butyldimethylsilyloxy)propyl)benzo[c][l,2]oxaborol-l(3H)-ol (320 mg, 0.63 mmol) in a mixture of THF:water and acetic acid (1 : 1 :2) was heated at 55 0C for 1.5 hours. The solvent was removed and the crude was purified by column to give 170 mg colorless oil. (69% yield) 1H NMR (300 MHz, DMSO-d6) δ 9.10 (s, 1 H), 7.20-7.40 (m, 8 H), 7.13 (dd, J = 8.4, 1.8 Hz, 1 H), 6.77 (m 1 H), 6.63 (m, 1 H), 6.52 (dd, J = 8.4, 2.4 Hz, 1 H), 5.13 (s, 2 H), 5.08 (s, 1 H), 4.39 (s, 1 H), 3.40 (s, 2 H), 1.44 (m, 4 H).
E54 3-(Nitromethyl)-6-phenoxybenzofcJfl,2Joxaborol-l(3H)-ol
[0655] E54 was synthesized by the same method as E56 using 4-phenoxy-2- (4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)benzaldehyde as starting material instead of 4-(4-formyl-3-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)phenoxy)benzoate. Mp 110-114 0C. 1H NMR (DMSO-J6, 300MHz) δ 9.46 (s, 1 H), 7.54 (d, J = 8.4 Hz, 1 H), 7.39 (m, 2 H), 7.18 (m, 3 H), 7.01 (m, 2 H), 5.73 (d, J = 8.1, 1 H), 5.30 (d, J= 12.9 Hz, 1 H) and 4.55 (m, IH). MS (ESI) m/z 284.1 [M-H]" E55 4-(l-Hvdroxy-3-(nitromethyl)-l,3-dihydrobenzofcUl,21oxaborol-6- yloxy)benzoic acid
[0656] To a solution of ethyl 4-(l -hydroxy-3-(nitromethyl)- 1,3- dihydrobenzo[c][l,2]oxaborol-6-yloxy)benzoate (100 mg, 0.28 mmol) in 5 ml of methanol was added 1.5 mL of IM NaOH aqueous solution. Stir at rt. The reaction was monitored by TLC. After completion, 1 mL of 6 N HCl was added to pH < 2 at O0C. Concentrated, white solid (65 mg) was filtered as target molecule. Mp 141-145
0C. 1H NMR (DMSO-J6, 300MHz) δ 12.83 (s, 1 H), 9.52 (s, 1 H), 7.95 (d, J= 8.4 Hz, , 2 H), 7.62 (d, J= 9 Hz, 1 H), 7.32 (m, 2 H), 7.03 (d, J= 8.4 Hz, 2 H), 5.78 (d, J = 8.1, 1 H), 5.36 (d, J= 12.9 Hz, 1 H) and 4.60 (m, 1 H). MS (ESI) m/z 328.1 [M- H]-
E56 Ethyl 4-(l-hvdroxy-3-(nitromethyl)-l,3-dihvdrobenzofclfl,21oxaborol-6- yloxy)benzoate
[0657] To a solution of NaOH in 10 ml of water was added ethyl 4-(4-formyl-3- (4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)phenoxy)benzoate by stirring at rt. Stirring continued for 10 min. To the reaction mixture, 2-nitromethane was added dropwise. The solution was stirred for another 30 min. The reaction mixture was cooled to 5 0C and 3N HCl (4 mL) was added dropwise until pH of 2 was attained. Light brown solid precipitated out. Filtered to get 1 g of solid. Then chromatography (H/E 7:3 to 1 : 1) to get target molecule as off-white solid. 1H NMR (DMSO-J6, 300MHz) δ 9.52 (s, 1 H), 7.97 (d, J= 8.1 Hz, , 2 H), 7.62 (d, J= 8.7 Hz, 1 H), 7.36 (d, J= 2.4 Hz, 1 H), 7.30 (dd, J= 8.4, 2.4 Hz, 1 H), 7.06 (d, J= 8.4 Hz, 2 H), 5.78 (dd, J= 9, 2.7 Hz, 1 H), 5.35 (dd, J= 14.1, 2.7 Hz, 1 H), 4.60 (m, 1 H), 4.28 (q, 2H) and 1.29 (t, 3H).
E57 3-(Methylsulfonylmethyl)-6-phenoxybenzofcJfl,2Joxaborol-l(3H)-ol
Step I. 2-Bromo-4-phenoxybenzaldehyde
[0658] To a mixture of 2-bromo-4-fluorobenzaldehyde (15 g, 73.88 mmol) and phenol (6.95 g, 73.88 mmol) were added dimethylformamide (80 ml) and potassium carbonate (15.32 g, 110.8 mmol). The reaction mixture was heated at 1000C under a N2 balloon overnight. After cool down to room temperature, a mixture of ethyl acetate and water was added. After stirring for 20 minutes, the organic layer was
separated and the aqueous layer was extracted with more ethyl acetate. The combined organic layer was washed with brine, dried with Na2SO4, filtered and evaporated to afford 19.6 g title compound as a slight yellow solid (96 % yield). 1H NMR (DMSO- d6, 300MHz) δ ppm 10.1 (s, 1 H) 7.86 (d, J= 8.7 Hz, 1 H) 7.49 (t, J= 7.5 Hz, 2 H) 7.32-7.27 (m, 2 H) 7.18 (d, J= 8.7 Hz, 2 H) 7.06 (d, J= 9.3 Hz, 1 H)
Step 2. 4-Phenoxy-2-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)benzaldehyde
[0659] To a mixture of 2-bromo-4-phenoxybenzaldehyde (9.58 g, 34.57 mmol, 1 eq.), Bis(pinacolato)diboron (10.53 g, 41.49 mmol, 1.2 eq) and potassium acetate (10.18 g, 103.7 mmol, 3 eq) was added 1, 4-dioxane (140 ml) and 1,1- bis(diphenylphosphino)ferrocene dichloropalladium (706 mg, 0.86 mmol, 2.5mol %). The reaction mixture was de-gassed with N2 for 20 minutes then heated at 8O0C overnight. After cool down to room temperature, the reaction mixture was filtered through Celite and the Celite cake was washed with more ethyl acetate. The combined filtrate was evaporated and the residue was purified by column chromatography to give product as a light yellow solid. (First batch 4.49 g. NMR good. Second batch 7.72 g. NMR showed impurities but was used in following reactions without any problem.). 1H NMR (DMSO-J6, 300MHz) δ ppm 10.21 (s, IH) 7.93 (d, J= 8.1 Hz, 1 H) 7.46 (t, J= 8.1 Hz, 2 H) 7.25 (t, J= 7.7 Hz, 1 H) 7.18- 7.11 (m, 4 H) 1.29 (s, 12 H).
Step 3. 3-(Methylsulfonylmethyl)-6-phenoxybenzo [c] [ 1 ,2] oxaborol- 1 (3H)-ol
[0660] 1.6 M n-BuLi in hexanes (2.06 ml, 3.3 mmol) was slowly added to a suspension of dimethylsulfone (438 mg, 4.65 mmol) in 10 ml anhydrous THF. White precipitate crashed out. The reaction was heated at reflux for 1 hour. Then the mixture was cooled down to -780C, a solution of 4-phenoxy-2-(4,4,5,5-tetramethyl-l,3,2- dioxaborolan-2-yl)benzaldehyde (1.05 g, 3.24 mmol) in 10 ml anhydrous THF was added. The reaction was allowed to slowly warm up to room temperature and stir at
room temperature for 30 minutes. 5 ml water was then added and the mixture was acidified to pH 3 with IN HCl. Then most of the solvent was evaporated by reduced pressure and the residue was extracted with ethyl acetate twice. The combined organic layer was washed with brine, dried over Na2SO4, filtered and evaporated. Column purification gave 477 mg product as a white solid (46% yield). 1HNMR (DMSO-dβ, 300MHz) δ ppm 9.43 (s, IH) 7.61 (d, J= 8.4 Hz, 1 H) 7.40 (t, J= 7.1 Hz, 2 H) 7.26- 7.12 (m, 3 H) 7.01 (d, J= 8.4 Hz, 2 H) 5.46 (d, J= 10.2 Hz, 1 H) 3.79 (d, J= 13.8 Hz, 1 H) 3.45-3.37 (m, 1 H) 3.08 (s, 3 H) MS (ESI) m/z 317 [M-H]".
E58 3-(Ethylsulfonylmethyl)-6-phenoxybenzofcJfl,2Joxabowl-l(3H)-ol
[0661] E58 was synthesized by the same method as E57 except using methylethylsulfone as starting material instead of dimethylsulfone. 1H NMR (DMSO-J6, 300MHz) δ ppm 9.42 (s, 1 H) 7.62 (d, J= 8.4 Hz, 1 H) 7.40 (t, J= 7.8 Hz, 2 H) 7.26-7.14 (m, 3 H) 7.01 (d, J= 7.5 Hz, 2 H) 5.46 (d, J= 8.1 Hz, 1 H) 3.75 (d, J= 13.2 Hz, 1 H) 3.44-3.36 (m, 1 H) 3.27-3.20 (m, 2 H) 1.23 (t, 3 H). MS (ESI) m/z 331 [M-H]" .
E59 (l-Hvdroxy-6-vhenoxy-l,3-dihvdrobenzo[cl[l,21oxaborol-3- vDmethanesulfonic acid
[0662] To a solution of 130 mg of methyl (1-hy droxy-6-phenoxy-l, 3- dihydrobenzo[c][l,2]oxaborol-3-yl)methanesulfonate (130 mg, 0.39 mmol) in 10 ml acetone was added sodium iodide (64 mg, 0.43 mmol). The mixture was stirred at room temperature overnight and white precipitate crashed out. The precipitate was filtered and washed with more acetone to give produce as a white powder (90 mg, 68% yield). 1H NMR (300 MHz, DMSO-d6) δ 9.11 (s, 1 H), 7.76 (d, J = 8.4 Hz, 1 H), 7.38 (t, J = 7.8 Hz, 2 H), 7.14 (m, 3 H), 7. 0 (d, J = 7.2 Hz, 2 H), 5.36 (t, J = 5.7 Hz, 1 H), 2.83 (d, J = 5.7 Hz, 2 H).
E60 Methyl (l-hvdroxy-6-phenoxy-l,3-dihvdrobenzofclfl,2]oxaborol-3- vDmethanesulfonate
[0663] To a cooled (-78 0C) solution of methyl methanesulfonate (304 μL, 3.9 mmol) in 10 ml anhydrous THF was added 1.6 M n-BuLi in hexanes (2.15 ml, 3.45 mmol) dropwise The mixture was stirred at -78 0C for 20 minutes, then a solution of 4-[4-formyl-3-(4,4,5,5-tetramethyl-[ 1 ,3 ,2]dioxaborolan-2-yl)-phenoxy]-piperidine- 1 - carboxylic acid tert-butyl ester (973 mg, 3 mmol) in 10 mL THF was added slowly via syringe. The reaction mixture was allowed to warm up to 0 0C and stirred at 0 0C for 30 minutes then at room temperature for 1 hour. The reaction was quenched with saturated ammonium chloride, extracted with EtOAc and washed with brine, dried over Na2SO4, and concentrated under reduced pressure to give crude product, which was purified by flash column. Recrystallization from hexanes gave product as a white powder. (0.24 g, 72% yield) mp 106-108 0C. 1H NMR (300 MHz, DMSO-d6) δ 9.40 (s, 1 H), 7.64 (d, J = 8.4 Hz, 1 H), 7.40 (t, J = 8.4 Hz, 2 H), 7.20 (m, 3 H), 7. 0 (d, J = 8.1 Hz, 2 H), 5.46 (dd, J = 9.6, 1.8 Hz, 1 H), 4.10 (dd, J = 15, 2.1 Hz, 1 H), 3.60 (dd, J = 15, 9.6 Hz, 1 H), 3.90 (s, 3 H). MS (ESI) m/z = 333 [M - H]-.
E61 (l-Hydroxy-ό-phenoxy-U-dihydrobenzotcimioxaborolS- vDmethanesulfonamide
[0664] tert-Butyl (1 -hydroxy-6-phenoxy- 1 ,3-dihydrobenzo[c][ 1 ,2]oxaborol-3- yl)methylsulfonylcarbamate (300 mg, 0.71 mmol) was treated with 25% TFA in DCM for 1 hr. The resulting mixture was evaporated and then co-evaporated with DCM a few times to give title compound as a tan powder. 1H NMR (DMSO-ύk, 300MHz) δ ppm 9.36 (s, 1 H) 7.53 (d, J= 8.7 Hz, 1 H) 7.42-7.37 (m, 2 H) 7.25-7.15 (m, 3 H) 7.02 (dd, J= 9.0, 1.2 Hz, 2 H) 6.86 (s, 2 H) 5.49 (dd, J= 14.4, 3 Hz, 1 H) 3.67 (dd, J= 14.4, 3 Hz, I H) 3.15 (dd, J= 14.7, 8.7 Hz, 1 H) MS (ESI) m/z 318 [M- H]- .
E62 N-((l-hvdroxy-6-phenoxy-l,3-dihydrobenzotcl fl,21 oxaborol-3-
[0665] To a solution of (1 -hydroxy-6-phenoxy- 1 , 3-dihydrobenzo[c] [1, 2] oxaborol-3-yl) methane sulfonamide (320 mg, 1 mmol) in pyridine were added acetic anhydride (284 μL, 3 mmol) and DMAP (37 mg, 0.3 mmol). The reaction was allowed to proceed at room temperature with stirring over the weekend. The solvent was removed under reduced pressure. The residue was re-dissolved in EtOAc, washed with water, brine, dried over Na2SO4, and concentrated to give crude product, which was purified by flash column. The product was an off- white solid. 1H NMR (300 MHz, DMSO-d6) δ 11.8 (s, 1 H), 9.40 (s, 1 H), 7.56 (d, J = 8.4 Hz, 1 H), 7.38 (t, J = 7.8 Hz, 1 H), 7.2 (s, IH), 7.16 (m, 2 H), 7. 0 (d, J = 8.7 Hz, 2 H), 5.46 (d, J =
7.8 Hz, 1 H), 4.10 (d, J = 13.8 Hz, 1 H), 3.54 (dd, J = 14.7, 9.3 Hz, 1 H), 3.14 (d, J =
3.9 Hz 1 H), 2.0 (s, 3 H). MS (ESI) m/z = 360 [M - H]-. E63 N-((l-hvdroxy-6-phenoxy-l,3-dihydrobenzofcJfl,2J oxaborol-3- vDmethylsulfonvDpropionamide
[0666] To a cooled (0°C)solution of propionic acid (336 μL, 4.5 mmol) in DCM was added l,l '-carbonyldiimidazole (730 mg, 4.5 mmol) and the mixture was stirred at room temperature for two hours. (1 -Hydroxy-6-phenoxy- 1 ,3- dihydrobenzo[c][l,2]oxaborol-3-yl)methanesulfonamide (480 mg, 1.5 mmol) and 1,8- diazabicyclo[5.4.0]undec-7-ene (673 μL, 4.5 mmol) were then added. The reaction was stirred at room temperature overnight. The reaction was quenched with water, extracted with EtOAc and washed with saturated ammonium chloride, brine, dried over Na2SO4, and concentrated under reduced pressure. Flash column purification gave product as pale yellow solid. 1H NMR (300 MHz, DMSO-d6) δ 12.0 (b, 1 H), 9.12 (s, 1 H), 6.90-7.70 (m, 8 H), 5.38 (m, 1 H), 4.05 (m, 1 H), 3.18 (m, 1 H), 2.0(q, J = 7.8 Hz, 2 H), 0.9 (t, J = 7.5 Hz, 3 H). MS (ESI) m/z = 374 [M - H]-.
E64 N-((l-hvdroxy-6-phenoxy-l,3-dihydrobenzotcl fl,21 oxaborol-3- vDmethylsulfonvDcvclopropanecarboxamide
[0667] This was made in the same manner as E63 using cyclopropane carboxylic acid as starting material. 1U NMR (300 MHz, DMSO-d6) δ 12.06 (s, 1 H), 9.38 (s, 1 H), 7.50 (d, J = 8.1 Hz, 1 H), 7.38 (t, J = 7.8 Hz, 2 H), 7.28 (s, 1 H), 7.19 (m, 2 H), 7. 0 (d, J = 8.1 Hz, 2 H), 5.46 (d, J = 7.8 Hz, 1 H), 4.10 (m, 2 H), 1.76 (m, 1 H), 0.84 (m, 4 H). MS (ESI) m/z = 386 [M - H]-.
E65 (l-Hvdroxy-6-phenoxy-l,3-dihydrobenzofclfl,2]oxaborol-3- vDmethanesulfonamide
[0668] To a stirred suspension of methylsulfonamide (6 g, 62 mmol) in DCM at O0C was added DMAP (760 mg, 6.2 mmol), triethylamine (10.4 ml, 74.4 mmol) and (BoC)2O (14.2 g, 65.1 mmol). The reaction mixture was warmed up to room temperature and stirred overnight. The solution was concentrated and the residue was diluted with ethyl acetate, washed consecutively with IN HCl and water, dried with Na2SO4, filtered and evaporated to afford a colorless oil. The oil was refluxed in hexane for 1 hour then cooled to room temperature and filtered to afford the target compound as a white solid (12.1 g, 42.1% yield). 1H NMR (DMSO-J6, 300MHz) δ ppm 11.22 (s, 1 H), 3.18 (s, 3 H), 1.42 (s, 9 H).
Step 2. tert-Butyl ( l-hydroxy-6-phenoxy- 1 ,3-dihydrobenzo [c] [ 1 ,2] oxaborol-3- yl)methylsulfonylcarbamate
[0669] 1.6 M n-Butyl lithium in hexanes (20.2 ml, 32.4 mmol) was added drop wise to a solution of N, JV-diisopropylethylamine (5.91 ml, 33.9 mmol) in 25 ml dry THF in ice bath and stirred for 30 minutes. Then tert-butyl methylsulfonylcarbamate in 25 ml dry THF was added slowly and stirred at O0C for 1 hour. The mixture was then cooled to -780C and 4-phenoxy-2-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2- yl)benzaldehyde (3.01 g, 15.4 mmol) in 25 ml dry THF was added slowly. The reaction was slowly warmed up to room temperature and stirred at room temperature for 1 hour. Then it was quenched with water, acidified with IN HCl to pH 3, extracted with ethyl acetate. The combined organic layer was then dried over Na2SO4, filtered and concentrated. Column purification gave 1 g product as off-white solid. 1H NMR (DMSO-J6, 300MHz) δ ppm 11.34 (s, 1 H), 9.39 (s, IH), 7.54 (d, J = 8.10 Hz, 1 H), 7.42-7.37 (m, 2 H), 7.28 (d, J= 2.40, 1 H), 7.22-7.12 (m, 2 H), 7.03- 7.01 (m, 2 H), 5.43 (dd, J= 9.3, 1.8 Hz, 1 H), 4.01 (dd, J= 13.5, 2.1 Hz, 1 H), 3.54 (dd, , J= 14.7, 9.3Hz, 1 H), 1.42 (s, 9 H). MS (ESI) m/z 418 [M-H]".
E66 (l-Hvdro-6-phenoxy-l,3-dihvdrobenzofcJfl,2Joxaborol-3-ylmethyl)- phosphonic acid
[0670] To a solution of (l-hydro-6-phenoxy-l,3-dihydrobenzo[c][l,2]oxaborol-3- ylmethyl)-phosphonic acid dimethyl ester (0.088 g, 0.25 mmol) was added TMSI at O0C and stirred for 30 minutes. MeOH was added and the reaction stirred at room temperature for 30 minutes then concentrated in vacuo. A second portion of MeOH was added and the solution concentrated. The residue was purified by preparative HPLC to give (l-hydro-6-phenoxy-l,3-dihydrobenzo[c][l,2]oxaborol-3-ylmethyl)- phosphonic acid (0.035 g, 44%). mp: 143 -145 0C. 1H NMR (400 MHz, DMSO-J6) δ: 9.20 (s, IH), 7.62 (d, J = 8.3 Hz, IH), 7.40 (m, 2H), 7.23 (s, IH), 7.22 - 7.17 (m, 2H),
7.00 (m, 2H), 5.27 (m, IH), 2.10 - 2.00 (m, IH), 2.00 - 1.80 (m, IH). MS (ESI) m/z: 319 [M - I]"; HPLC purity: 98.48 % (220 nm), 97.51 % (Maxplot).
E67 (l-Hvdro-6-phenoxy-l,3-dihvdrobenzofclfl,21oxaborol-3-ylmethyl)- phosphonic acid dimethyl ester
[0671] A solution of (l-hydro-6-phenoxy-l,3-dihydrobenzo[c][l,2]oxaborol-3- ylmethyl)-phosphonic acid dimethyl ester (0.095 g, 0.27 mmol) in MeOH (3 mL) and 6 N HCl (3 mL) was refluxed for 48 hours then concentrated in vacuo. The residue was purified by silica gel flash column chromatography to give (l-hydro-6-phenoxy- l,3-dihydrobenzo[c][l,2]oxaborol-3-ylmethyl)-phosphonic acid monomethyl ester (0.018 g, 20%). mp 143 -145 0C. 1H NMR (400 MHz, DMSO-J6) δ: 9.25 (s, IH), 7.60 (d, J = 8.3 Hz, IH), 7.40 (m, 2H), 7.23 (s, IH), 7.22 - 7.17 (m, 2H), 7.00 (m, 2H), 5.35 (m, IH), 3.65 (d, J = 8.4 Hz, 3H), 2.40 (m, IH), 2.00 (m, IH). MS (ESI) m/z: 333 [M - H]MIPLC purity: 98.13 % (220 nm), 94.15% (254 nm), 97.71% (Maxplot).
E68 (l-Hvdro-6-phenoxy-l,3-dihvdrobenzofclfl,21oxaborol-3-ylmethyl)- phosphonic acid dimethyl ester
[0672] To a cooled (-78 0C) solution of methyl phosphonic acid dimethylester (0.16 g, 1.30 mmol) in THF was added n-BuLi (0.46 mL, 2.5 M in Hexane) dropwise. After the addition was over, the mixture was stirred at -78 0C for 15 min, a solution of 4-phenoxy-2-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2-yl)benzaldehyde (324 mg, 1 mmol) in THF (4 mL) was added via syringe. The resulting mixture was gradually warmed up to 0 0C, and kept at 0 0C for 20 min, then quenched with saturated aqueous NH4Cl, extracted with EtOAc, dried and concentrated. The residue was purified by chromatography to give (l-hydro-6-phenoxy-l,3-dihydrobenzo[c][l,2]oxaborol-3- ylmethyl)-phosphonic acid dimethyl ester (190 mg, 52% yield) as a white solid. Mp 143 -145 0C. 1H NMR (DMSO-J6, 400MHz) δ 9.25 (s, IH), 7.60 (d, J= 8.3 Hz, 1
H), 7.40 (m, 2 H), 7.23 (s, 1 H), 7.22 - 7.17 (m, 2 H), 7.00 (m, 2 H), 5.25 (m, 1 H), 3.65 (m, 6 H), 2.70 - 2.50 (m, 1 H), 2.10 - 2.00 (m, 1 H). MS (ESI) m/z = 249 [M H]+.
E69 6-Phenoxy-3-fl,23Hriazol-2-ylmethyl-3H-benzoIclfl,21oxaborol-l-ol
[0673] To a solution of 1 -(2-bromo-4-phenoxy-phenyl)-2-[ 1 ,2,3]triazol-2-yl- ethanol (0.44 g, 1.22 mmol) in toluene (30 mL) was added triisopropyl borate (0.459 g, 2.44 mmol) under nitrogen. The reaction mixture was then stirred at reflux and toluene was slowly distilled out. The resulting mixture was dissolved into THF (10 mL). BuLi (2.5 M in hexane, 0.59 mL, 1.46 mmol) was added to the reaction mixture at -78 0C and stirred at this temperature for 2 h while the temperature was slowly warmed up to room temperature. Then the reaction was quenched by adding water at
0 0C and acidified to pH 2 using diluted hydrochloric acid. The mixture was extract with EtOAc. The extract was washed with brine, dried over sodium sulfate, and concentrated. The residue was purified by chromatography on silica gel
(EtO Ac/hexanes/ AcOH = 1 :2:trace) to give 0.101 g material which was purified again by prep-HPLC to give 0.052 g of pure product as white solid; mp 43-45 0C. 1H NMR (400 MHz, DMSO-J6) δ 9.30 (s, 1 H), 7.77 (s, 2 H), 7.34 - 7.42 (m, 3 H), 7.21 (d, J=2.34 Hz, 1 H), 7.11 - 7.19 (m, 2 H), 6.97 - 7.02 (m, 2 H), 5.63 (dd, J=7.77, 3.96 Hz,
1 H), 4.93 (dd, J=13.92, 3.96 Hz, 1 H), 4.55 (dd, ./=14.07, 7.91 Hz, 1 H). MS (ESI) m/z = 308 [M + H]+.
E70 6-Phenoxy-3-fl,2,31triazol-l-ylmethyl-3H-benzofclfl,2]oxaborol-l-ol
Step 1 2-(2-Bromo-4-phenoxy-phenyl)-oxirane
[0674] To a suspension of NaH (95%, 0.656 g, 26.0 mmol) in dry DMSO (40 mL) was slowly added trimethylsulfoxoium iodide (5.718 g, 26.0 mmol) at 10-20 0C. The
mixture was stirred at room temperature till no gas released. A solution of 2-bromo-4- phenoxy-benzaldehyde (6.0 g, 21.7 mmol) in dry DMSO (15 mL) was added to the reaction mixture at 10-20 0C. Then the resulting mixture was stirred at room temperature for 2 h. The reaction mixture was poured into ice-water (100 mL), extracted with EtOAc. The extract was washed with brine, dried over sodium sulfate, and concentrated. The residue was purified by chromatography on silica gel (EtOAc/hexanes = 1 :20) to give 3.62 g of pure product as colorless oil. 1HNMR (400 MHz, CDCl3) δ 7.37 (dd, J=8.64, 7.47 Hz, 2 H), 7.12 - 7.20 (m, 3 H), 7.00 - 7.04 (m, 2 H), 6.94 (dd, J=8.79, 2.64 Hz, 1 H), 4.12 (dd, J=4.10, 2.34 Hz, 1 H), 3.17 (dd, J=5.57, 4.10 Hz, 1 H), 2.66 (dd, 1 H).
Step 2 l-(2-Bromo-4-phenoxy-phenyl)-2-[l,2,3]triazol-l-yl-ethanol and l-(2-bromo- 4-phenoxy-phenyl)-2- [ 1 , 2, 3]triazol-2-yl-ethanol
[0675] To a solution of 2-(2-bromo-4-phenoxy-phenyl)-oxirane (1.5 g, 5.15 mmol), lH-l,2,3-triazole (1.103 g, 15.97 mmol) in anhydrous DMF (10 mL) was added potassium carbonate (2.207 g, 15.97 mmol) at room temperature under nitrogen. The resulting mixture was stirred at 80 0C for 3 h. The reaction mixture was poured into ice-water (20 mL), acidified to pH 2 using diluted hydrochloric acid, and extracted with EtOAc. The extract was washed with brine, dried over sodium sulfate, and concentrated. The residue was purified by chromatography on silica gel
(EtOAc/hexanes = 1 :1) to give 1.07 g of l-(2-bromo-4-phenoxy-phenyl)-2- [l,2,3]triazol-l-yl-ethanol as colorless oil, IHNMR (400 MHz, DMSO-d6) δ 8.04 (s,
1 H), 7.71 (s, 1 H), 7.52 (d, J=8.59 Hz, 1 H), 7.44 (t, j=7.81 Hz, 2 H), 7.18 - 7.25 (m,
2 H), 7.01 - 7.10 (m, 3 H), 6.01 (d, J=4.68 Hz, 1 H), 5.16 - 5.23 (m, 1 H), 4.59 (dd, J=13.85, 3.32 Hz, 1 H), 4.42 (dd, 1 H), and 0.460 g of l-(2-bromo-4-phenoxy- phenyl)-2-[l,2,3]triazol-2-yl-ethanol as colorless oil, IHNMR (400 MHz, DMSO-d6) δ 7.77 (s, 2 H), 7.63 (d, J=8.98 Hz, 1 H), 7.44 (t, j=7.81 Hz, 2 H), 7.17 - 7.25 (m, 2 H), 7.07 (d, J=7.81 Hz, 3 H), 5.84 (d, J=5.07 Hz, 1 H), 5.40 (m, 1 H), 4.50 - 4.57 (m, 1 H), 4.42 - 4.49 (m, 1 H)
Step 3 6-Phenoxy-3-[l,2, 3]triazol-l-ylmethyl-3H-benzo[c] [l,2]oxaborol-l-ol
[0676] To a solution of 1 -(2-bromo-4-phenoxy-phenyl)-2-[ 1 ,2,3]triazol- 1 -yl- ethanol (0.6 g, 1.66 mmol) in toluene (15 niL) was added triisopropyl borate (0.626 g, 3.33 mmol) under nitrogen. The reaction mixture was then stirred at 90 0C for 0.5 h and then toluene was slowly distillated out. The resulting mixture was dissolved into THF (10 mL). BuLi (2.5 M in hexane, 0.87 mL, 2.16 mmol) was added to the reaction mixture at -78 0C and stirred at this temperature for 20 min before the temperature was slowly warmed up to room temperature for 2 h. Then the reaction was quenched by adding water at 0 0C and acidified to pH 2 using diluted hydrochloric acid. The mixture was extract with EtOAc. The extract was washed with brine, dried over sodium sulfate, and concentrated. The residue was purified by chromatography on silica gel (EtO Ac/hexanes/ AcOH = 2:1 :trace) to give 0.102 g material which was recrystallized from EtO Ac/hexanes to give 0.052 g of pure product as white solid; mp 158-159 0C . IHNMR (400 MHz, DMSO-d6) δ 9.35 (s, 1 H), 7.98 (s, 1 H), 7.69 (s, 1 H), 7.53 (d, J=9.08 Hz, 1 H), 7.41 (t, J=8.05 Hz, 2 H), 7.13 - 7.25 (m, 3 H), 7.01 (d, J=7.90 Hz, 2 H), 5.56 (dd, J=7.47, 3.37 Hz, 1 H), 4.99 (dd, J=14.20, 3.37 Hz, 1 H), 4.57 (dd, 1 H). MS (ESI) m/z = 308 [M + H]+.
E71 Ethyl l-hydroxy-ό-phenoxy-U-dihydrobenzotcimioxaboroleS- carboxylate
Step 1. l-Hydroxy-6-phenoxy-l,3-dihydrobenzo[c] [ 1 ,2] oxaborole-3-carbonitrile
[0677] To a solution of sodium cyanide (98 mg, 2 mmol, 1 eq) in 5 ml of water was added 4-phenoxy-2-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)benzaldehyde (650 mg, 2 mmol, 1 eq) in 5 ml THF. After stirring for 30 minutes at room temperature, the solution was acidified with IN HCl to pH 3. The mixture was then extracted with
ethyl acetate. The combined organic layer was dried over Na2SO4, filtered and evaporated to get 560 mg off-white solid. MS (ESI(-)) m/z 250 [M-H]" .
Step 2. Ethyl l-hydroxy-6-phenoxy- 1 ,3-dihydrobenzo [c] [ 1 ,2] oxaborole-3- carboxylate
[0678] l-Hydroxy-6-phenoxy-l,3-dihydrobenzo[c][l,2]oxaborole-3-carbonitrile was dissolved in a mixture of 5 ml ethanol and 5 ml 6N HCl, and heated at 8O0C for 3.5 hours, 1 ml concentrated HCl was then added and the reaction was allowed to stir at room temperature overnight. Column chromatography gave 170 mg target compound as colorless oil (yield for the two steps: 31%). 1H NMR (DMSO-^,
300MHz) δ ppm 9.61 (s, IH) 7.50 (d, J=8.1 Hz, 1 H) 7.43-7.37 (m, 2 H) 7.27-7.15 (m, 3 H) 7.03 (d, J=7.8 Hz, 2 H) 5.72 (s, 1 H) 4.16 (q, J=5.4 Hz, 2 H) 1.21 (t, 3H) MS (ESI(-)) m/z 297 [M-H]+.
E72 (l-Hvdroxy-6-pyridin-3-voxyl)-l,3-dihvdro-benzotcltl,21oxaborol-3-yl)- acetic acid
[0679] To a solution of 1 -hydroxy-6-(pyridine-3-yoxyl)- 1 ,3-dihydro- benzo[c][l,2]oxaborol-3-yl]-acetic acid ethyl ester (0.104 g, 0.33 mmol) in MeOH (4 mL) and H2O (4 mL) was added LiOH (0.040 g) at 0 0C. The resulting mixture was stirred at room temperature for 24 hours then cooled to 0 0C. The reaction mixture was acidified to pH 3 using 6M HCl then concentrated in vacuo. The residue was purified by silica gel flash column chromatography to give (l-hydroxy-6-pyridin-3- yoxyl)-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl)-acetic acid (0.040 g, 43%). 1H NMR (400 MHz, DMSO-J6) δ 9.24 (br s, IH), 8.43 (m, 2H), 7.50 (m, 3H), 7.25 (m, 2H), 5.44 (m, IH), 3.00 - 2.90 (m, IH), 2.40 - 2.30 (m, IH). MS (ESI) m/z = 286 [M + H]+, HPLC purity: 97.97 % (220 nm), 97.72 % (Maxplot).
E73 fl-Hvdroxy-6-(vyridine-3-voxyl)-l,3-dihvdro-benzofcUl,21oxaborol-3-yll- acetic acid ethyl ester
[0680] To a suspension of zinc dust (1.46 g, 22.5 mmol) in THF (10 niL) was added trimethylsilyl chloride (0.28 mL, 2.25 mmol) at 40 0C. The mixture was heated to 55 0C and stirred for 15 minutes. After cooling down to 37 0C, ethyl bromoacetate (2.16 mL, 19.5 mmol) was slowly added to the reaction mixture at 37 - 40 0C. After addition, the resulting mixture was allowed to cool to room temperature over 30 minutes. This solution was added to a solution of 4-(pyridine-3-yloxy)-2-( 4,4,5,5)tetramethyl-[l,3,2]dioxaborolan-2-yl)benzaldehyde (0.49 g, 1.5 mmol) in THF (6 mL) at 0 0C. The mixture was stirred for 10 minutes before treating with saturated NH4Cl (10 mL) and extracted with EtOAc (2x25 mL). The organic extracts were washed with brine, dried and concentrated in vacuo. The residue was diluted with H2O and lyophilized to give [l-hydroxy-6-(pyridine-3-yoxyl)-l,3-dihydro- benzo[c][l,2]oxaborol-3-yl]-acetic acid ethyl ester (0.480 g, 100%).1U NMR (400
MHz, DMSO-J6) δ 9.22 (s, IH), 8.40 (m, IH), 7.50 (d, J = 6.5 Hz, IH), 7.43 (m, 2H), 7.21 (m, 2H), 5.44 (m, IH), 4.10 (m, 2H), 3.20 - 3.00 (m, IH), 2.50 - 2.40 (m, IH), 1.20 (m, 3H). MS (ES) m/z: 314 (M + I)+; HPLC purity: 99.01 % (220 nm), 92.03% (254 nm), 98.62% (Maxplot). E74 f6-(2-Chloro-pyridin-4-yloxy)-l-hvdroxy-l,3-dihydro- benzotcl fl, 21 oxaborol-3-yll -acetic acid
Step 1: [6-(2-Chloro-pyridin-4-yloxy)- 1 -hydroxy-1 ,3-dihydro-benzo [c] [ 1 ,2] oxaborol- 3-yl] -acetic acid ethyl ester
[0681] To a solution of (l,6-dihydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl)- acetic acid ethyl ester (0.40 g, 1.86 mmol)in DMF (4 mL) was added NaH (0.22 g,
5.59 mmol). The mixture was stirred at room temperature for 10 minutes. 2-Chloro- 4-nitro-pyridine (0.74 g, 4.65 mmol) was added and the mixture stirred at room temperature for 16 hours. The reaction mixture was acidified with HCl and concentrated in vacuo. The residue was purified by silica gel flash column chromatography to give [6-(2-chloro-pyridin-4-yloxy)- 1 -hydroxy- 1 ,3 -dihydro- benzo[c][l,2]oxaborol-3-yl]-acetic acid ethyl ester (0.500 g, 77%). 1H NMR (400 MHz, DMSO-d6) δ 9.40 (s, IH), 8.60 (d, IH), 7.50 (s, IH), 7.37 (d, IH), 7.00 (m, IH), 6.97 (m, IH), 5.50 (m, IH), 4.10 (m, 2H), 3.10 (m, IH), 2.40 (m, IH), 1.20 (m, 3H). Step 2: [6-(2-Chloro-pyridin-4-yloxy)-l-hydroxy-l ,3-dihydro-benzo [c] '[1 ,2]oxaborol- 3-yl] -acetic acid
[0682] To a solution of [6-(2-chloro-pyridin-4-yloxy)-l-hydroxy-l,3-dihydro- benzo[c][l,2]oxaborol-3-yl]-acetic acid ethyl ester (0.660 g, 1.90 mmol) in THF (20 mL) and water (10 mL) was added LiOH (0.450 g) at 0 0C. The resulting mixture was stirred at room temperature for 2 hours then cooled to 00C and acidified to pH 3 with 6N HCl. The mixture was concentrated in vacuo and the residue purified by preparative HPLC to give [6-(2-chloro-pyridin-4-yloxy)-l-hydroxy-l,3-dihydro- benzo[c][l,2]oxaborol-3-yl]-acetic acid (0.520 g, 90%). 1H NMR (400 MHz, DMSO- d6) δ 12.40 (br s, IH), 9.34 (s, IH), 8.31 (d, J = 3.2 Hz, IH), 7.59 (d, J = 8.4 Hz, IH), 7.44 (s, IH), 7.36 (d, J = 2.4 Hz, IH), 7.03 (s, IH), 6.96 (d, J = 2.4 Hz, IH), 5.49 (m, IH), 3.01 (m, IH), 2.41 (m, IH). MS (ESI) m/z = 320 [M + H]+. HPLC: 98.71% (220 nm); 98.44% (Maxplot).
E75 t6-(6-Fluoro-pyridin-2-yloxy)-l-hvdroxy-l,3-dihvdro- benzotcl t 1,21 oxaborol-3-yl)-acetic acid
Step 1: [6-(6-Fluoro-pyridin-2-yloxy)- 1 -hydroxy- 1 ,3-dihydro-benzo [c] [ 1 ,2] 'oxaborol- 3-yl)-acetic acid
[0683] To a solution of (l,6-dihydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl)- acetic acid ethyl ester (0.1 g, 0.42 mmol) in anhydrous DMF (2 rnL) was added sodium hydride (0.043 g, 1.05 mmol) at 0 0C followed by 2,6-difluoro-pyridine (0.122 g, 1.05 mmol). The resulting mixture was stirred at room temperature for 18 hours then quenched with crushed ice. The pH was adjusted to 4 with 6M HCl and the mixture extracted with EtOAc. The organic extracts were washed with water, brine, dried over Na2SO4, filtered, and concentrated in vacuo. The residue was purified by preparative HPLC to give [6-(6-fluoro-pyridin-2-yloxy)-l -hydroxy- 1,3 -dihydro- benzo[c][l,2]oxaborol-3-yl)-acetic acid as an off white solid after lyophilization
(0.027 g). mp 138.6 - 140 0C. 1H NMR 400 MHz (DMSO-J6) δ 12.40 (s, IH), 9.27 (s, IH), 8.04 (q, J = 8.4 Hz, IH), 7.54 (d, J = 8.4 Hz, IH), 7.41 (s, IH), 7.30 (d, J = 10.4 Hz, IH), 6.96 (d, J = 8.4 Hz, IH), 6.88 (d, J = 8.0 Hz, IH), 5.48 (m, IH), 2.99 (dd, J = 15.6, 4.0 Hz, IH), 2.38 (m, IH). MS (ESI) m/z: 302 (M - I)". HPLC purity: 98.58 % (Maxplot), 99.2 % (220 nm).
E76 fl-Hvdroxy-6-(vyrimidin-4-yloxy)-l,3-dihydro-benzofcUl,21oxaborol-3- ylj '-acetic acid
Step 1 : [l-Hydroxy-6-(pyrimidin-4-yloxy)-l, 3-dihydro-benzo [c] [ 1 , 2] oxaborol-3-yl] - acetic acid ethyl ester
[0684] To a solution of (l,6-dihydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl)- acetic acid ethyl ester (0.4 g, 1.69 mmol) and 4-chloro-pyrimidine hydrochloride (0.5 Ig, 3.38 mmol) in DMF (10 mL) at 0 0C was added NaH (0.25 g, 5.08 mmol) in portions. The solution was allowed to warm to room temperature and stirred for 10 hours. Saturated NH4Cl (10 mL) was added at 0 0C. The mixture was acidified to pH~3 with IN HCl and extracted with EtOAc (2x10 mL). The organic extracts were washed with water (10 mL), dried and concentrated in vacuo. The residue was purified by silica gel flash column chromatography (DCM:MeOH 95:5) to give [1- hydroxy-6-(pyrimidin-4-yloxy)-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl]-acetic acid ethyl ester (0.2 g, 37%). 1H NMR (400 MHz, CDCl3): δ 8.79 (s, IH), 8.59 (d, J = 5.6 Hz, IH), 7.45-7.38 (m, 2H), 7.27-7.23 (m, IH), 6.94 (d, J = 6.0Hz, IH), 5.68-5.64 (m, IH), 4.22 (q, J = 7.2 Hz, 2H), 2.86 (dd, J = 6.4, 16.8 Hz, IH), 2.72-2.66 (m, IH), 1.29 (t, J = 7.6 Hz, 3H). MS (ESI) m/z = 315 [M+H]+.
Step 2: [l-Hydroxy-6-(pyrimidin-4-yloxy)-l, 3-dihydro-benzo [c] [ 1 , 2] oxaborol-3-yl] - acetic acid
[0685] To a solution of [l-hydroxy-6-(pyrimidin-4-yloxy)-l,3-dihydro- benzo[c][l,2]oxaborol-3-yl]-acetic acid ethyl ester (0.37 g, 1.18 mmol) in THF:H2O (1 :1, 6 mL) at 0 0C was added a solution of LiOH (0.085 g, 3.53 mmol) in water (1 mL) The solution was allowed to warm to room temperature over 3 hours then acidified to pH 2 with IN HCl at 0 0C. The mixture was extracted with EtOAc (2x10
niL) and the organic extracts washed with water, dried and concentrated in vacuo. The residue was purified by preparative HPLC to give [l-hydroxy-6-(pyrimidin-4- yloxy)-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl]-acetic acid (0.15 g, 45%). 1H NMR (400 MHz, DMSO): δ 9.39 (s, IH), 8.78 (d, J = 6 Hz, IH), 7.60 (d, J = 8.4Hz, IH), 7.51 (s, IH), 7.39 (d, J = 6.4 Hz, IH), 7.22 (d, J = 5.2 Hz, IH), 5.55 (d, J = 6 Hz, IH), 3.04 (d, J = 15.6Hz, IH), 2.47-2.41 (m, IH). MS (ESI) m/z = 287 [M+H]+.
E77 f6-(2-Benzylamino-pyrimidin-4-yloxy)-l-hvdroxy-l,3-dihydw- benzotcl fl, 21 oxaborol-3-yll -acetic acid
Step 1: [6-(2-Chloro-pyrimidin-4-yloxy)-l-hydroxy-l,3-dihydro- benzo[c] [ 1 ,2] oxaborol-3-yl] -acetic acid ethyl ester
[0686] A solution of (l,6-dihydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl)- acetic acid ethyl ester (0.10 g, 0.42 mmol) in DMF (2 rnL) was treated with cesium carbonate (0.414 g, 1.27 mmol) at 0 0C followed by 2,4-dichloropyrimidine (0.094 g, 0.63 mmol). The mixture was stirred at room temperature for 18 hours. The mixture was quenched with water and extracted with ethyl acetate. The extracts were dried (Na2SO4), filtered and concentrated in vacuo. The residue was purified by silica gel flash column chromatography (EtOAc/hexane; 1 :3 gradient) to give [6-(2-chloro- pyrimidin-4-yloxy)- 1 -hydroxy- 1 ,3-dihydro-benzo[c] [ 1 ,2]oxaborol-3-yl]-acetic acid ethyl ester as a light yellow oil (0.08 g, 52 %). 1H NMR (400 MHz, CD3OD) δ 8.50 (d, J = 5.86 Hz, IH), 7.51 (d, J = 8.21 Hz, IH), 7.41 (s, IH), 7.30 (d, J= 8.21 Hz, IH), 7.01 (d, J= 5.86 Hz, IH), 5.66-5.63 (m, IH), 4.10 (q, J= 7.03 Hz, 2H), 3.02 (dd, J= 15.63, 4.30 Hz, IH), 2.63 (dd, J= 15.63, 9.18 Hz, IH), 1.24 (t, J= 7.03 Hz, 3H).
Step 2: [6-(2-Benzylamino-pyrimidin-4-yloxy)- 1 -hydroxy- 1, 3-dihydro- benzo[c] [ 1 ,2] oxaborol-3-yl] -acetic acid ethyl ester
[0687] A solution of [6-(2-chloro-pyrimidin-4-yloxy)- 1 -hydroxy- 1 ,3-dihydro- benzo[c][l,2]oxaborol-3-yl]-acetic acid ethyl ester (0.30 g, 086 mmol) and benzylamine (0.38 mL, 3.47 mmol) was stirred at room temperature for 1.5 hours. The solution was concentrated and residue was purified by silica gel flash column chromatography (MeOHiCH2Cl2; 1 :99 gradient) to give [6-(2-benzylamino- pyrimidin-4-yloxy)- 1 -hydroxy- 1 ,3-dihydro-benzo[c] [ 1 ,2]oxaborol-3-yl]-acetic acid ethyl ester as a yellow foam (0.25 g, 69 %). 1H NMR (400 MHz, CD3OD) δ 8.06 (d, J = 5.85 Hz, IH), 7.40-7.00 (m, 8H), 6.15 (d, J = 5.46 Hz, IH), 5.65 (dd, J = 8.20, 2.34 Hz, IH), 4.40-4.20 (m, 2H), 4.18-4.03 (m, 2H), 2.90 (dd, J = 15.22, 3.12 Hz, IH), 2.60 (dd, J = 15.22, 8.98 Hz, IH), 1.20 (t, J = 7.03 Hz, 3H).
Step 3: [6-(2-Benzylamino-pyrimidin-4-yloxy)- 1 -hydroxy- 1, 3-dihydro- benzofcjfl, 2] oxaborol-3-yl] -acetic acid
[0688] A solution of [6-(2-benzylamino-pyrimidin-4-yloxy)- 1 -hydroxy- 1 ,3- dihydro-benzo[c][l,2]oxaborol-3-yl] -acetic acid ethyl ester (0.25 g, 0.60 mmol) in methanol (2 mL) was treated with lithium hydroxide (0.071 g, 2.96 mmol) in water (2 mL) at room temperature. The solution was stirred at room temperature for 1 hour then quenched with 2N HCl to pH 2. The precipitated solid was collected by vacuum filtration to give [6-(2-benzylamino-pyrimidin-4-yloxy)-l -hydroxy- 1,3 -dihy dro- benzo[c][l,2]oxaborol-3-yl]-acetic acid as a white solid (0.11 g, 47 %). 1H NMR (400 MHz, DMSO-d6) δ 9.20 (br s, IH), 8.40-8.10 (br m, IH), 7.60 (d, J = 7.81 Hz, IH), 7.51 (s, IH), 7.42-7.10 (m, 5H), 6.89 (br s, IH), 6.70-6.40 (br m, IH), 5.60-5.45 (m, IH), 4.48 (br s, IH), 4.19 (s, 2H), 3.02 (d, J = 15.24 Hz,lH), 2.36 (dd, J = 15.24, 9.19 Hz, IH). MS (ESI) m/z: 392[M+1].
E78 tl-Hvdroxy-6-(pyrimidin-2-yloxy)-l,3-dihvdro-benzotcni,21oxaborol-3- ylj '-acetic acid
[0689] To a mixture of 2,4-dihydroxy-benzaldehyde (6.9 g, 50 mmol) in dichloromethane (50 mL) was added 3,4-dihydro-2H-pyran (6.8 mL, 75 mmol) and pyridium p-toluenesulfonic acid (0.050 g) at room temperature. The resulting mixture was stirred at room temperature for 18 hours then concentrated in vacuo. The residue was purified by silica gel flash column chromatography to give 2-hydroxy-4-
(tetrahydro-pyran-2-yloxy)-benzaldehyde (7.04 g, 62%). 1HNMR (400MHz, CDCl3): 11.40 (s, IH), 9.88 (s, IH), 7.43 (d, J = 8.1 Hz, IH), 6.65 (m, 2H), 5.51 (m, IH), 3.80 (m, IH), 3.65 (m, IH), 2.00 - 1.50 (m, 6H).
Step 2: Tήfluoro-methanesulfonic acid 2-formyl-5-(tetrahydro-pyran-2-yloxy)-phenyl ester Tf2o, Et3N, DCM, -780C, 30 min
[0690] To a solution of 2-hydroxy-4-(tetrahydro-pyran-2-yloxy)-benzaldehyde (2.08 g, 9.37 mmol) and Et3N (3.91 mL, 28.11 mmol) in dichloromethane (20 mL) was slowly added Tf2O (1.42 mL, 11.24 mmol) at -78 0C. The mixture was stirred at - 78 0C for 30 minutes. The mixture was diluted with cold brine and extracted with dichloromethane. The organic extracts were washed with brine, dried and concentrated in vacuo. The residue was dissolved in Hexane-EtOAc(4: 1) and passed through a plug of silica gel and concentrated in vacuo to give trifluoro- methanesulfonic acid 2-formyl-5-(tetrahydro-pyran-2-yloxy)-phenyl ester (3.25 g, quant.). IHNMR (400MHz, CDC13): 10.10 (s, IH), 7.93 (d, J = 8.1 Hz, IH), 7.20 (d, J = 8.1 Hz, IH), 7.07 (s, IH), 5.60 (m, IH), 3.80 (m, IH), 3.65 (m, IH), 2.00 - 1.50 (m, 6H).
Step 3: 4-(Tetrahydro-pyran-2-yloxy)-2-(4, 4,5, 5-tetramethyl-[ 1,3,2] dioxaborolan-2- yl)-benzaldehyde
[0691] A solution of trifluoro-methanesulfonic acid 2-formyl-5-(tetrahydro-pyran- 2-yloxy)-phenyl ester (3.25 g, 10.16 mmol), bis(pinacolato)diborane (3.35 g, 13.21 mmol) PdCl2(dppf) (1.48 g, 2.03 mmol) and KOAc (2.99 g, 30.48 mmol) in dioxane (40 mL) was degassing for 10 minutes with bubbling N2. The reaction mixture was heated at 90 0C for 2 hours then diluted with EtOAc (100 mL). The mixture was filtered through a pad of celite and concentrated in vacuo. The residue was purified by silica gel flash column chromatography to give 4-(tetrahydro-pyran-2-yloxy)-2- (4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2-yl)-benzaldehyde as a yellow oil (5.2 g). IHNMR (400MHz, CDC13): 10.40 (s, IH), 7.93 (d, J = 8.1 Hz, IH), 7.44 (s, IH), 7.20 (m, IH), 5.60 (m, IH), 3.80 (m, IH), 3.60 (m, IH), 2.00 - 1.50 (m, 6H), 1.40 (s, 12H).
Step 4: (1 ,6-Dihydroxy-l ,3-dihydro-benzo[c] [1 ,2]oxaborol-3-yl)-acetic acid ethyl ester
THF
[0692] To a suspension of zinc dust (5.35 g, 82.3 mmol) in THF (10 mL) was added trimethylsilyl chloride (1.1 g, 10.15 mmol) at 40 0C. The mixture was heated to 55 0C and stirred for 45 minutes. After cooling down to 37 0C, ethyl bromoacetate (7.58 mL, 74.87 mmol) was slowly added to the reaction mixture at 37 - 40 0C. After addition, the resulting mixture was allowed to cool to room temperature over 30 minutes. This solution was added to a solution of 4-(tetrahydro-pyran-2-yloxy)-2- (4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2-yl)-benzaldehyde (8.18 g, 29 mmol) in THF (6 mL) at 0 0C. The mixture was stirred for 10 minutes before treating with 3 N HCl and extracting with EtOAc (2x25 mL). The organic extracts were washed with brine, dried and concentrated in vacuo. The residue was diluted with water and lyophilized to give (l,6-dihydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl)-acetic
acid ethyl ester (4.1 g , 60%). 1H NMR (400 MHz, DMSO-d6) 59.40 (s, IH), 7.80 (d, J = 8.4 Hz, IH), 7.00 (s, IH), 6.80 (d, J = 8.4 Hz, IH), 5.30 (m, IH), 4.10 (m, IH), 2.90 (m.,lH), 2.30 (m, IH), 1.20 (m, 3H).
Step 5: [l-Hydroxy-6-(pyrimidin-2-yloxy)-l, 3-dihydro-benzo [c] [ 1 , 2] oxaborol-3-yl] - acetic acid ethyl ester
[0693] To a solution of (l,6-dihydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl)- acetic acid ethyl ester (0.33 g, 1.40 mmol) in DMF (4 rnL) was added NaH (0.17 g, 4.20 mmol). The mixture was stirred at room temperature for 10 minutes. 2- Chloropyrimidine (0.40 g, 3.50 mmol) was added and the mixture stirred at room temperature for 48 hours. The reaction mixture was acidified with HCl and concentrated in vacuo. The residue was purified by silica gel flash column chromatography to give a mixture of [l-hydroxy-6-(pyrimidin-2-yloxy)-l,3-dihydro- benzo[c][l,2]oxaborol-3-yl]-acetic acid ethyl ester and [l-hydroxy-6-(pyrimidin-2- yloxy)-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl]-acetic acid. (0.280 g, 64%).
Step 6: [l-Hydroxy-6-(pyrimidin-2-yloxy)-l, 3-dihydro-benzo [c] [ 1 , 2] oxaborol-3-yl] - acetic acid
[0694] To a solution of [l-hydroxy-6methoxy-l,3-dihydro-benzo[c][l,2]oxaborol- 3-yl]-acetic acid ethyl ester (0.28 g, 0.89 mmol) in THF (8 mL) and water (4 mL) was added LiOH (0.220 g) at 0 0C. The resulting mixture was stirred at room temperature for 2 hours then cooled to 00C and acidified to pH 3 with 6N HCl. The mixture was concentrated in vacuo and the residue purified by preparative HPLC to give [1- hydroxy-6-(pyrimidin-2-yloxy)-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl]-acetic acid (0.120 g, 47%). 1H NMR (400 MHz, DMSO-d6) δ 9.20 (s, IH), 8.60 (s, 2H), 7.20 (m, 2H), 7.15 (m, 2H), 5.70 (m, IH), 3.20 (m, IH), 2.44 (s, IH).
E79 3-(l-Hvdroxy-6-pyridin-3-voxyl)-l,3-dihydro-benzofcUl,21oxaborol-3-yl)- propionic acid
Step 1: 4-(2,4-Dihydroxy-phenyl)-4-oxo-butyric acid
[0695] To a suspension of benzene- 1, 3 -diol (11 g, 100 mmol) and succinic anhydride (11 g, 110 mmol) in nitrobenzene (100 mL) was added AICI3 (67 g, 500 mmol). The reaction mixture was heated at 900C for 3 hours then at 500C for 16 hours. After cooling to room temperature, the mixture was poured onto ice and acidified with HCl. The aqueous solution was washed with dichloromethane and concentrated to -100 mL volume. The solution was left to stand overnight and the precipitated solid was collected to give 4-(2,4-dihydroxy-phenyl)-4-oxo-butyric acid (8.6 g, 41%). IHNMR (400MHz, DMSO-d6): 12.40 (s, 1 H), 12.10 (br s, IH), 10.62 (s, IH), 7.80 (d, J = 8.4 Hz, IH), 6.40 (d, J = 8.4 Hz, IH), 6.29 (s, IH), 3.20 (t, J = 7.8 Hz, 2H), 2.50 (t, J = 7.8 Hz, 2H).
Step 2: 4-(2,4-Dihydroxy-phenyl)-4-oxo-butyric acid methyl ester
[0696] A mixture of 4-(2,4-dihydroxy-phenyl)-4-oxo-butyric acid (5.8 g, 27.62 mmol) and concentrated H2SO4 (0.5 mL) in MeOH was heated at 75°C for 1 hour then concentrated in vacuo. The residue was dissolved in EtOAc, passed through a plug of silica gel and concentrated to give 4-(2,4-dihydroxy-phenyl)-4-oxo-butyric acid methyl ester (6.0 g, 100%). IHNMR (400MHz, CDC13): 12.40 (s, 1 H), 7.81 (d, J = 8.4 Hz, IH), 6.40 (m, 2H), 5.90 (br s, IH), 3.27 (t, J = 7.8 Hz, 2H), 2.78 (t, J = 7.8 Hz, 2H).
Step 3: 4-[2-Hydroxy-4-(tetrahydro-pyran-2-yloxy)-phenyl]-4-oxo-butyric acid methyl ester
[0697] To a mixture of 4-(2,4-dihydroxy-phenyl)-4-oxo-butyric acid methyl ester (8.7 g, 38.84 mmol) in dichloromethane (50 mL) was added 3,4-dihydro-2H-pyran (7.7 mL, 85.44 mmol) and pyridium p-toluenesulfonic acid (0.050 g) at room temperature. The resulting mixture was stirred at room temperature for 16 hours then concentrated in vacuo. The residue was purified by silica gel flash column chromatography to give 4-[2-hydroxy-4-(tetrahydro-pyran-2-yloxy)-phenyl]-4-oxo- butyric acid methyl ester (10.96 g, 92%). . IHNMR (400MHz, CDC13): 12.40 (s, IH), 7.60 (d, J = 8.4 Hz, IH), 6.35 (m, 2H), 6.07 (s, IH), 3.77 (s, 3H), 3.27 (t, J = 8.4 Hz, 2H), 2.79 (t, J = 8.4 Hz, 2H).
Step 4: 4-Oxo-4-[4-(tetrahydro-pyran-2-yloxy)-2-tήfluoromethanesulfonyloxy- phenyl] -butyric acid methyl ester Jf2Q1 Et3N1 DCM] -78oC] 2 h
[0698] To a solution of 4-[2-hydroxy-4-(tetrahydro-pyran-2-yloxy)-phenyl]-4-oxo- butyric acid methyl ester (10.96 g, 35.58 mmol) and Et3N (14.85 mL, 107 mmol) in dichloromethane (100 mL) was slowly added Tf2O (9.60 mL, 56.94 mmol) at -78 0C. The mixture was stirred at -78 0C for 2 hours. The mixture was diluted with water and extracted with dichloromethane. The organic extracts were washed with brine, dried and concentrated in vacuo. The residue was dissolved in Hexane-EtOAc(4: 1), filtered through a plug of silica gel and the filtrate was concentrated to give 4-oxo-4-[4- (tetrahydro-pyran-2-yloxy)-2-trifluoromethanesulfonyloxy-phenyl]-butyric acid methyl ester (15.62 g, quant.). 1H NMR (400MHz, CDC13): 7.80 (d, J = 8.4 Hz, IH), 7.10 (d, J = 8.4 Hz), 7.00 (s, IH), 5.50 (m, IH), 3.80 (m, IH), 3.70 (s, 3H), 3.60 (m, IH), 3.22 (t, J = 8.8 Hz, 2H), 2.79 (t, J = 8.8 Hz, 2H), 2.00 - 1.50 (m, 6H).
Step 5: 4-Oxo-4-[4-(tetrahydro-pyran-2-yloxy)-2-(4,4,5,5-tetramethyl- [ 1 ,3 ,2] dioxaborolan-2-yl)-phenyl] -butyric acid methyl ester
[0699] A solution of 4-oxo-4-[4-(tetrahydro-pyran-2-yloxy)-2- trifluoromethanesulfonyloxy-phenylj-butyric acid methyl ester (14.75 g, 33.52 mmol), bis(pinacolato)diborane (17.03 g, 67.05 mmol), PdCl2(dppf) (2.45 g, 3.35 mmol) and KOAc (9.85 g, 101 mmol) in dioxane (150 mL) was degassed for 10 minutes with bubbling N2. The reaction mixture was heated at 100 0C for 2 hours then diluted with EtOAc (100 mL). The mixture was filtered through a pad of celite and filtrate was concentrated in vacuo. The residue was purified by silica gel flash column chromatography to give 4-oxo-4-[4-(tetrahydro-pyran-2-yloxy)-2-(4,4,5,5- tetramethyl-[l,3,2]dioxaborolan-2-yl)-phenyl]-butyric acid methyl ester as a yellow oil (11.84 g, 84%). IHNMR (400MHz, CDC13): 7.80 (d, J = 8.4 Hz, IH), 7.10 (s, IH), 7.05 (d, J = 8.4 Hz, IH), 5.59 (m, IH), 3.80 (m, IH), 3.70 (s, 3H), 3.60 (m, IH), 3.27 (t, J = 8.8 Hz, 2H), 2.78 (t, J = 8.8 Hz, 2H), 2.00 - 1.50 (m, 6H), 1.40 (s, 12H).
Step 6: 3-( 1 ,6-Dihydroxy- 1 ,3-dihydro-benzo [c] [ 1 ,2] oxaborol-3-yl)-propionic acid methyl ester
[0700] To a solution of 4-oxo-4-[4-(tetrahydro-pyran-2-yloxy)-2-(4,4,5,5- tetramethyl-[l,3,2]dioxaborolan-2-yl)-phenyl]-butyric acid methyl ester (11.83 g, 28.30 mmol) in MeOH (50 mL) was added NaBH4 (2.36 g, 62.26 mmol) at 0 0C. The reaction mixture was stirred at 00C for 30 minutes, quenched with 6 N HCl and concentrated in vacuo. The residue was purified by silica gel flash column chromatography and lyophilized to give 3-(l,6-dihydroxy-l,3-dihydro- benzo[c][l,2]oxaborol-3-yl)-propionic acid methyl ester (4.2 g, 62%). 1H NMR (400 MHz, DMSO-d6) δ 9.35 (s, IH), 9.00 (s, IH), 7.20 (d, J = 8.4 Hz, IH), 7.03 (s, IH),
6.84 (d, J = 8.4 Hz, IH), 5.00 (m, IH), 3.60 (s, 3H), 2.40 - 2.10 (m, 3H), 1.65 (m, IH).
Step 7: 3-[l-Hydroxy-6-(pyrimidin-2-yloxy)-l,3-dihydro-benzo[c] [l^JoxaborolS- yl] -propionic acid methyl ester
[0701] To a solution of 3-(l,6-dihydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl)- propionic acid methyl ester (0.36 g, 1.50 mmol) in DMF (5 rnL) was added NaH (0.20 g, 4.50 mmol). The mixture was stirred at room temperature for 10 minutes. 2- Chloropyrimidine (0.43 g, 3.75 mmol) was added and the mixture stirred at room temperature for 48 hours. The reaction mixture was acidified with HCl and concentrated in vacuo. The residue was purified by silica gel flash column chromatography to give 3-[l-hydroxy-6-(pyrimidin-2-yloxy)-l,3-dihydro- benzo[c][l,2]oxaborol-3-yl]-propionic acid methyl ester (0.260 g, 55%). 1H NMR (400 MHz, MeOD-d4) δ 8.60 (m, 2H), 7.50 - 7.20 (m, 4H), 5.30 (m, IH), 3.66 (s, 3H), 2.46 (m, 3H), 1.86 (m, IH).
Step 8: 3-[l-Hydroxy-6-(pyrimidin-2-yloxy)-l,3-dihydro-benzo[c] [l^JoxaborolS- yl] -propionic acid
[0702] To a solution of 3-[ 1 -hydroxy-6-(pyrimidin-2-yloxy)- 1 ,3-dihydro- benzo[c][l,2]oxaborol-3-yl]-propionic acid methyl ester (0.26 g, 0.83 mmol) in THF (8 mL) and water (2 mL) was added LiOH (0.200 g) at 0 0C. The resulting mixture was stirred at room temperature for 2 hours then cooled to 00C and acidified to pH 3 with 6N HCl. The mixture was concentrated in vacuo and the residue purified by preparative HPLC to give 3-[l-hydroxy-6-(pyrimidin-2-yloxy)-l,3-dihydro- benzo[c][l,2]oxaborol-3-yl]-propionic acid (0.100 g, 47%). 1H NMR (400 MHz, DMSO-d6) δ 9,23 (br s, IH), 8.65 (m, 2H), 7.44 (m, 2H), 7.30 (m, 2H), 5.17 (m, IH),
2.40 - 2.20 (m, 3H), 1.70 (m, IH). MS (ES) m/z: 299 (M - 1)-. HPLC purity: 97.18 % (220 nm), 98.12% (Maxplot).
E80 fl-Hvdroxy-6-(vyrazin-2-yloxy)-l,3-dihvdro-benzofcni,21oxaborol-3-yll- acetic acid
Step 1 : [ 1 -Hydroxy-6-(pyrazin-2-yloxy)- 1 , 3-dihydro-benzo fcj / 1 , 2]oxaborol-3-yl]- acetic acid ethyl ester
[0703] To a solution of (l,6-dihydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl)- acetic acid ethyl ester (0.33 g, 1.40 mmol) in DMF (4 rnL) was added NaH (0.17 g, 4.20 mmol). The mixture was stirred at room temperature for 10 minutes. Chloropyrazine (0.40 g, 3.50 mmol) was added and the mixture stirred at room temperature for 48 hours. The reaction mixture was acidified with HCl and concentrated in vacuo. The residue was purified by silica gel flash column chromatography to give a mixture of [l-hydroxy-6-(pyrazin-2-yloxy)-l,3-dihydro- benzo[c][l,2]oxaborol-3-yl]-acetic acid ethyl ester and [l-hydroxy-6-(pyrazin-2- yloxy)-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl]-acetic acid ethyl ester (0.240 g, 55%).
Step 2: [l-Hydroxy-6-(pyrazin-2-yloxy)-l, 3-dihydro-benzo [c] [ 1 , 2] oxaborol-3-yl] - acetic acid
[0704] To a solution of [l-hydroxy-6-methoxy-l,3-dihydro-benzo[c][l,2]oxaborol- 3-yl]-acetic acid ethyl ester (0.240 g, 0.76 mmol) in THF (8 mL) and water (4 mL) was added LiOH (0.220 g) at 0 0C. The resulting mixture was stirred at room temperature for 2 hours then cooled to 00C and acidified to pH 3 with 6N HCl. The mixture was concentrated in vacuo and the residue purified by preparative HPLC to
give [l-hydroxy-6-(pyrazin-2-yloxy)-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl]-acetic acid (0.100 g, 46%). 1H NMR (400 MHz, DMSO-d6) δ 12.39 (s, IH), 9.20(s, IH), 8.56 (s, IH), 8.38 (s, IH), 8.22 (s, IH), 7.27 (s, IH), 7.16 (s, IH), 5.56 (s, IH), 3.05 (m, IH), 2.65 (m, 2H), 2.19 (M, IH).
E81 tl-Hvdroxy-6-(tl,3,41thiadiazol-2-yloxy)-l,3-dihvdro-benzotcltl,21oxaborol- 3-yll-acetic acid
Step 1: 2-Bromo-5-nitro-[l,3,4]thiadiazole
N-N N-N
// \\ NaNO2, Cu // \\
2 S Dl HCI, H2O [0705] To a mixture of Cu (1.0 g, 15 mmol) and NaNO2 (1.0 g, 15 mmol) in water (10 rnL) was added 2 drops of concentrated HCl at room temperature and stirred for 15 minutes. A warm solution of 5-bromo-[l,3,4]thiadiazol-2-ylamine (0.9 g, 5 mmol) in aqueous HCl (4M, 10 mL) was added over a period of 15 minutes. The resulting mixture was stirred for 2 hours and the precipitated yellow solid was filtered and washed with water (20 mL). The solid was dissolved in ether (25 mL), filtered and the filtrate concentrated in vacuo to give 2-bromo-5-nitro-[l,3,4]thiadiazole (0.25 g, 25%). MS (ESI) m/z = 211 [M+H]+ .
Step 2: [6-(5-Bromo- [ 1 ,3 ,4] thiadiazol-2-yloxy)- l-hydroxy-4-methyl- 1 ,3-dihydro- benzo[c] [1,2] oxaborol-3-yl] -acetic acid ethyl ester and [l-Hydroxy-6-(5- nitro- [ 1 ,3 ,4] thiadiazol-2-yloxy)- 1 ,3-dihydro-benzo [c] [ 1 ,2] oxaborol-3-yl] - acetic acid ethyl ester
[0706] To a solution of (l,6-dihydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl)- acetic acid ethyl ester (1.0 g, 4.23 mmol) and 2-bromo-5-nitro-[l,3,4]thiadiazole (1.78 g, 8.47 mmol) in CH3CN (30 mL) at - 20 0C was added K2CO3 (1.16 g, 8.47 mmol). The reaction mixture was stirred for 8 hours at -20 0C then concentrated in vacuo. The residue was dissolved in EtOAc (20 mL), washed with water (2x10 mL), dried and concentrated. The residue was purified by silica gel flash column chromatography to give 1.2 grams of a 3 : 1 mixture of products which was used
without further purification. 1U NMR (400 MHz, CDCl3): δ 7.72 (d, J = 2.4 Hz, IH), 7.65-7.52 (m, 2H), 5.52-5.47 (m, IH), 4.06 (q, J = 7.2 Hz, 2H), 3.11-3.05 (m, IH), 2.54-2.48 (m, IH), 1.16 (t, J = 8Hz, 3H). MS (ESI) m/z = 366 and 400 [M+H]+.
Step 3: [ l-Hydroxy-6-( [ 1 ,3 ,4] thiadiazol-2-yloxy)- 1 ,3-dihydro-benzo [c] [ 1 ,2] oxaborol- 3-ylJ -acetic acid ethyl ester and [6-(5-amino-[ 1,3, 4] thiadiazol-2-yloxy)- 1- hydroxy- 1 ,3-dihydro-benzo [c] [1,2] Oxaborol-3-yl] '-acetic acid ethyl ester
R = Br, NO2
[0707] Pd/C (0.75 g) was added to a solution of [6-(5-bromo-[l,3,4]thiadiazol-2- yloxy)-l-hydroxy-4-methyl-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl]-acetic acid ethyl ester and [l-hydroxy-6-(5-nitro-[l,3,4]thiadiazol-2-yloxy)-l,3-dihydro- benzo[c][l,2]oxaborol-3-yl]-acetic acid ethyl ester (3:1 mixture, 1.0 g) in MeOH (20 rnL) and hydrogenated at 50 psi for 1 hour. The mixture was filtered through a pad of celite and concentrated in vacuo. The residue was purified by preparative HPLC to give 1 -hydroxy-6-([ 1 ,3,4]thiadiazol-2-yloxy)- 1 ,3-dihydro-benzo[c] [ 1 ,2]oxaborol-3- yl]-acetic acid ethyl ester (0.070 g, 16%) and [6-(5-amino-[l,3,4]thiadiazol-2-yloxy)- 1 -hydroxy- l,3-dihydro-benzo[c][l,2]oxaborol-3-yl]-acetic acid ethyl ester (0.077 g, 20 %).
[0708] 1 -hydroxy-6-([ 1 ,3 ,4]thiadiazol-2-yloxy)- 1 ,3 -dihydro- benzo[c][l,2]oxaborol-3-yl]-acetic acid ethyl ester. 1H NMR (400 MHz, DMSO): δ 9.40 (s, IH), 9.18 (s, IH), 7.64-7.58 (m, 2H), 7.52 (dd, J = 2.4, 8 Hz, IH), 5.51 (dd, J = 4, 9.2 Hz, IH), 4.09 (q, J = 6.8 Hz, 2H), 3.10 (dd, J = 4, 15.6, IH), 2.54-2.47 (m, IH), 1.18 (t, J = 6.8Hz, 3H). MS (ESI) m/z = 321 [M+H]+.
[0709] [6-(5-amino-[l,3,4]thiadiazol-2-yloxy)-l-hydroxy-l,3-dihydro- benzo[c][l,2]oxaborol-3-yl]-acetic acid ethyl ester. 1H NMR (400 MHz, DMSO): δ 9.36 (s, IH), 7.53-7.51 (m, 2H), 7.37 (dd, J = 2.4 Hz, 8.4 Hz, IH), 7.08 (s, 2H), 5.47 (dd, J = 4, 8.8 Hz, IH), 4.10 (q, J = 6.8 Hz, IH), 3.17-3.08 (m, IH), 2.51-2.49 (m, IH), 1.17 (t, J = 6.8 Hz, 3H). MS (ESI) m/z = 336 [M+H]+.
Step 4: [ l-Hydroxy-6-( [ 1 ,3 ,4] thiadiazol-2-yloxy)- 1 ,3-dihydro-benzo [c] [ 1 ,2] oxaborol- 3-yl] -acetic acid
[0710] To a stirred solution of [l-hydroxy-6-([l,3,4]thiadiazol-2-yloxy)-l,3- dihydro-benzo[c][l,2]oxaborol-3-yl] -acetic acid ethyl ester (0.05 g, 0.15 mmol) in THFiH2O (1 :1, 5 mL) at 0 0C was added a solution of LiOH (0.01 g, 0.46 mmol) in water (1 mL). The solution was allowed to warm to room temperature over 3 hours then acidified to pH 2 with IN HCl. The mixture was extracted with EtOAc (2x10 mL) and the organic extracts dried and concentrated in vacuo. The residue was purified by preparative HPLC to give [l-hydroxy-6-([l,3,4]thiadiazol-2-yloxy)-l,3- dihydro-benzo[c][l,2]oxaborol-3-yl]-acetic acid (0.04 g, 87%). 1H NMR (400 MHz, DMSO): δ 9.15 (s, IH), 7.66 (d, J = 2.4 Hz, IH), 7.60 (d, J = 8.4 Hz, IH), 7.50 (dd, J= 2, 8.4 Hz, IH), 5.50 (dd, J = 4.4, 9.2 Hz, IH), 3.0 (dd, J = 3.2, 15.6Hz, IH), 2.44-2.37 (m, IH). MS (ESI) m/z = 291 [M-H]-. E82 [6-(5-Amino-[l,3,41thiadiazol-2-yloxy)-l-hvdroxy-l,3-dihydro- benzofclfl,2]oxaborol-3-yll-acetic acid
Step 1: [6-(5-Amino-[l, 3, 4] 'thiadiazol-2-yloxy)- 1 -hydroxy- 1, 3-dϊhydro- benzofcjfl, 2] oxaborol-3-yl] -acetic acid
[0711] To a stirred solution of [6-(5 -amino- [1,3, 4]thiadiazol-2-yloxy)- 1-hy droxy- l,3-dihydro-benzo[c][l,2]oxaborol-3-yl]-acetic acid ethyl ester (0.05 g, 0.15 mmol) in THF:H2O (1 :1, 5 mL) at 0 0C was added a solution of LiOH (0.01 g, 0.46 mmol) in water (1 mL). The solution was allowed to warm to room temperature over 3 hours then acidified to pH 2 with 2N HCl at 0 0C. The mixture was extracted with EtOAc (2x10 mL) and the organic extracts dried and concentrated in vacuo. The residue was purified by preparative HPLC to give [6-(5-amino-[l,3,4]thiadiazol-2-yloxy)-l-
hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-3-yl]-acetic acid (0.035 g, 76%). 1H NMR (400 MHz, DMSO): δ 7.58-7.53 (m, 2H), 7.40 (dd, J = 2.4, 8 Hz, IH), 5.45 (dd, J = 4, 8.8 Hz, IH), 2.96 (dd, J = 4, 16 Hz, IH), 2.39-2.33 (m, IH). MS (ESI) m/z = 308 [M+H]+.
E83 ό-CvclopentyloxyS-methanesulfonylmethyl-SH-benzotcimioxaborol-l-ol
[0712] To a solution of dimethylsulfone (0.39g, 4.17 mmol) in THF (10 mL) was added n-BuLi (2.6 mL, 4.17mmol). White precipitate crashed out. The reaction mixture was heated to reflux for 1.5 h. The mixture was cooled to 0 0C, a solution of 4-cyclopentyloxy-2-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2-yl)-benzaldehyde (1.2 g, 3.79 mmol) in 5 mL of THF was added to the reaction mixture and stirred at room temperature for 30 min, the reaction mixture was quenched with water and acidified to pH ~ 3 with 6M HCl, extracted with EtOAc and washed with water, brine, dried over Na2SO4, and concentrated under reduced pressure to give crude product, which was purified by biotage (50-100% EtOAc in hexane) to afford 6-cyclopentyloxy-3- methanesulfonylmethyl-3H-benzo[c][l,2]oxaborol-l-ol (0.15 g, 12% yield) as a white solid. Mp 132 - 134 0C. 1H NMR (400 MHz, DMSO-d6) δ 9.38 (s, 1 H), 7.48 (d, J = 8.4 Hz, 1 H), 7.22 (d, J= 2.4 Hz, 1 H), 7.03 (dd, J= 8.4, 2.4 Hz, 1 H), 5.40 (dd, J = 10.4, 2.0 Hz, 1 H), 4.90 (m, 1 H), 3.76 (d, J= 14.8 Hz, IH), 3.40 (d, J= 10.8 Hz, IH), 3.10 (s, 3H), 2.00 - 1.82 (m, 2H), 2.80 - 2.68 (m, 4H), 1.62 - 1.55 (m, 2H). MS (ESI) m/z = 309 [M - H]".
E84 4-(3-Ethoxycarbonylmethyl-l-hvdroxy-l,3-dihydro-benzo[cl [1, 2] oxaborol-ό-yloxyi-pweridine-l-carboxylic acid tert-butyl ester
[0713] To a suspension of zinc dust (3.18 g, 48 mmol) in THF (30 mL) was added trimethylsilyl chloride (0.69 g, 6.4 mmol) at 40 0C. The mixture was heated to 55 0C and stirred for 15 min. After cooling down to 37 0C, ethyl bromoacetate (7.48 g, 48 mmol) was slowly added to the reaction mixture at 37 - 40 0C. After addition, the
resulting mixture was allowed to cool to room temperature over 30 minutes then cooled down to 0 0C. 4-[4-formyl-3-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2-yl)- phenoxy]-piperidine-l-carboxylic acid tert-butyl ester (1.4 g, 3.2 mmol) in THF (10 mL) was added to the zinc solution at 0 0C. The mixture was allowed to warm to room temperature over 1.5 hours before treating with saturated NH4Cl (20 mL) and extracting with EtOAc (3 x 100 mL). The organic extracts were washed with brine, dried and concentrated in vacuo. The residue was purified by silica gel flash column chromatography (10 - 50% ethyl acetate/hexane) to get 4-(3-ethoxycarbonylmethyl-l- hydroxy-l,3-dihydro-benzo[c] [1, 2] oxaborol-6-yloxy)-piperidine-l-carboxylic acid tert-butyl ester (1.07 g, 81 %). mp 79.2 - 80.5 0C. 1H NMR 400 MHz (DMSO - d6) δ 9.18 (s, IH), 7.34 (d, J = 8.0 Hz, IH), 7.23(s, IH), 7.07 (d, J = 8.8 Hz, IH), 5.40 (m, IH), 4.53 - 4.51 (m, IH), 4.12 - 4.06 (m, 2H), 3.64 (m, 2H), 3.18 (m, 2H), 3.02 - 2.97 (m, IH), 2.40 - 2.34 (m, IH), 1.88 (m, 2H), 1.53 (m, 2H), 1.40 (s, 9H), 1.18 (t, J = 7.6 Hz, 3H). HPLC purity: 96.30 % (Maxplot), 96.09 % (220 nm). E85 4-β-Carboxymethyl-l-hydr oxy-1, 3-dihydro-benzotcl H, 21 oxaborol-6- yloxy)-pweridine-l-carboxylic acid tert-butyl ester
[0714] To a solution of 4-(3-ethoxycarbonylmethyl- 1 -hydroxy- 1 ,3-dihydro- benzo[c] [1, 2] oxaborol-6-yloxy)-piperidine-l-carboxylic acid tert-butyl ester (0.07 g, 0.167 mmol) in MeOH (0.5 mL) was added a solution of LiOH (0.02 g, 0.84 mmol) in water (0.5 mL) at 0 0C. The resulting mixture was stirred at 0 0C for 5 h. The reaction mixture was acidified to pH 2 using 6M hydrochloric acid and stirred at room temperature for 2 h. The precipitate was filtered and dried to give 4-(3- carboxymethyl-l-hydroxy-l,3-dihydro-benzo[c] [1, 2] oxaborol-6-yloxy)-piperidine- 1-carboxylic acid tert-butyl ester (0.025g, 38%) as a white solid, mp 188.5 - 190.2 0C. 1H NMR 400 MHz (DMSO - d6) ^9.15 (s, IH), 7.35 (d, J = 8.4 Hz, IH), 7.23 (s, IH), 7.07 (d, J = 6.4 Hz, IH), 5.39 (m, IH), 4.50 (m, IH), 3.65 (m, 2H), 3.18 (m, 2H), 2.88 (m, IH), 2.32 - 2.25 (m, IH), 1.98 (m, 2H), 1.53 (m, 2H), 1.40 (s, 9H). MS (ESI) m/z: 390 [M - I]". HPLC purity: 97.98 % (Maxplot), 97.82 % (220 nm).
E86 H-Hvdroxy-6-(pweridin-4-yloxy)-l,3-dihvdro-benzofclH,21oxaborol-3- yl)-acetic acid
[0715] A solution of 4-(3-carboxymethyl-l -hydroxy- l,3-dihydro-benzo[c] [1,2] oxaborol-6-yloxy)-piperidine-l-carboxylic acid tert-butyl ester (0.13 g, 0.33 mmol) and 4M HCl (0.99 mL, 3.98 mmol) in dioxane was stirred at room temperature for 2 hours then concentrated in vacuo. The residue was purified by preparative HPLC to give [l-hydroxy-6-(piperidin-4-yloxy)-l,3-dihydro-benzo[c][l, 2] oxaborol-3-yl)- acetic acid (0.0.045 g, 46.8%) as a white solid, mp 97.8 - 98.2 0C. IHNMR (400 MHz, DMSO-d6) δ 9.17 (s, IH), 7.37 (d, J = 8.4 Hz, IH), 7.25 (d, J = 2.0 Hz, IH), 7.11 (d, J = 2.4 Hz, IH), 5.38 (m, IH), 4.60 (m, IH), 3.21 (m, 2H), 3.05 (m, 2H), 2.88 (m, IH), 2.32 (m, IH), 2.08 (m, 2H), 1.90 (m, 2H). MS (ESI) m/z: 292 [M+l]+. HPLC purity: 97.36 % (Maxplot), 98.40 % (220 nm).
E87 H-Hvdroxy-6-(pweridin-4-yloxy)-l,3-dihvdro-benzofclH, 21 oxaborol-3- vD-acetic acid ethyl ester
[0716] To a solution of 4-(3-ethoxycarbonylmethyl- 1 -hydroxy- 1 ,3-dihydro- benzo[c] [1, 2] oxaborol-6-yloxy)-piperidine-l-carboxylic acid tert-butyl ester (0.37 g, 0.88 mmol) in dichloromethane (10 mL) at 0 0C was bubbled HCl (g) for 10 min. The reaction mixture was stirred at room temperature for 1 h and concentrated to give [ 1 -hydroxy-6-(piperidin-4-yloxy)- 1 ,3-dihydro-benzo[c][ 1 , 2] oxaborol-3-yl)-acetic acid ethyl ester 0.28 g, 89%) as a hydrochloride salt, mp 164.9 - 165.3 0C. 1HNMR (400 MHz, DMSO-d6) δ 9.20 (s, IH), 8.82 (brs, IH), 7.35 (d, J = 8.0 Hz, IH), 7.25 (d, J = 2.4 Hz, IH), 7.10 (dd, J = 8.8, 2.8 Hz, IH), 5.38 (m, IH), 4.60 (m, IH), 4.10 (q, J = 8.8 Hz, 2H), 3.25 (m, 2H), 3.05 (m, 2H), 3.00 (m, IH), 2.39 (m, IH), 2.08 (m, 2H), 1.90 (m, 2H), 1.17 (t, J = 6.8 Hz, 3H). MS (ESI) m/z: 320 [M+1]+.HPLC purity: 93.99 % (Maxplot), 91.38 % (220 nm).
E88 ^(l-HvdroxyS-methanesulfonylmethyl-U-dihvdro-benzofcimioxaborol- 6-yloxy)- pweridine-1-carboxylic acid tert-butyl ester
[0717] To a solution of dimethylsulfone (0.5g, 5.2 mmol) in THF (10 mL) was added n-BuLi (2.5 M in hexane) (1.54 mL, 3.8 mmol). White precipitate crashed out. The reaction mixture was heated to reflux for Ih. The mixture was cooled to -78 0C, a solution of 4-[4-formyl-3-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2-yl)-phenoxy]- piperidine-1-carboxylic acid tert-butyl ester (1.5 g, 3.5 mmol) in 10 mL of THF was added to the reaction mixture and stirred at room temperature for 30 min, the reaction mixture was quenched with saturated ammonium chloride, extracted with EtOAc and washed with water, brine, dried over Na2SO4, and concentrated under reduced pressure to give crude product, which was purified by biotage (5-100% EtOAc in hexane) to afford the title compound (0.97 g, 71% yield) as a light yellow solid. Mp 150.9 - 153 0C. 1H NMR (400 MHz, DMSO-d6) <S 9.38 (s, 1 H), 7.50 (d, J= 8.4 Hz, 1 H), 7.27 (d, J= 2.4 Hz, 1 H), 7.12 (dd, J= 8.8, 2.8 Hz, 1 H), 5.40 (dd, J= 10.4, 2.0 Hz, 1 H), 4.56 (m, 1 H), 3.76 (d, J= 14.6 Hz, 1 H), 3.68 - 3.63 (m, 2 H), 3.40 (m, 1 H), 3.27 - 3.18 (m, 2 H), 3.16 (s, 3 H), 1.98 - 1.88 (m, 2 H), 1.56 - 1.48 (m, 2 H), 1.40 (s, 9 H). MS (ESI) m/z = 424 [M - H]".
E89 3-Methanesulfonylmethyl-6-(piperidin-4-yloxy)-3H-benzofcJfl,2Joxabowl- l-ol
[0718] To a solution of 4-(l-hydroxy-3-methanesulfonylmethyl-l,3-dihydro- benzo[c][l,2]-oxaborol-6-yloxy)-piperidine-l-carboxylic acid tert-butyl ester (0.57g, 1.34 mmol) in methanol (5 mL) was added IM HCl in ether (4.4 mL, 4.37 mmol). The reaction mixture was stirred at room temperature for 3 h, and concentrated to 3- methanesulfonylmethyl-6-(piperidin-4-yloxy)-3H-benzo[c][l,2]oxaborol-l-ol hydrochloric salt (0.45 g, 93% yield) as an off white solid. Mp 234 -236 0C. 1H NMR (400 MHz, DMSO-d6) δ 9.40 (s, IH), 8.69 (br s, IH), 7.52 (d, J= 8.8 Hz, IH),
7.30 (d, J= 2.4 Hz, IH), 7.16 (dd, J= 8.8, 2.8 Hz, IH), 4.44 (d, J= 8.4 Hz, IH), 4.65 (m, IH), 3.78 (d, J= 14.8 Hz, IH), 3.36 (d, J= 14.4 Hz, IH), 3.26 - 3.21 (m, 2H), 3.09 (s, 3H), 3.07 - 3.03 (m, 2H), 2.11 - 2.08 (m, 2H), 1.84 - 1.81 (m, 2H) . MS (ESI) m/z = 326 [M - H]".
E90 (ό-Benzyl-l-hydroxy-U-dihydro-benzotcimioxaborolS-vD-acetic acid ethyl ester
(6-Benzyl- 1 -Hydroxy- 1 ,3-dihydro-benzo [c] [1,2] ] oxaborol-3-yl) -acetic acid ethyl ester
[0719] A mixture of 4-benzyl-2-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2-yl)- benzaldehyde (0.32 g, 1.0 mmol), ethyl bromoacetate (0.84 g, 5.0 mmol), zinc dust (1.30 g, 20 mmol) and NH4Cl (0.54 g, 10 mmol) was thoroughly grounded in a mortar and pestle. The resulting mixture was kept at room temperature (20 0C) for 3.5 h. The mixture was treated with sat. NH4Cl (50 mL) and extracted with ether (3 x 50 mL). The extract was washed with brine, dried and concentrated to dryness. The residue was purified by chromatography on silica gel to give 140 mg (45% yield) of
acid ethyl ester as a colorless oil. 1HNMR (400 MHz, CD3OD) δ 7.50 (s, 1 H), 7.40 - 71.0 (m, 7 H), 5.56 (m, 1 H), 4.16 (m, 2 H), 3.98 (q, 2 H), 2.90 (m, 1 H), 2.50 (m, 1 H), 1.20 (t, J = 6.5 Hz, 3 H).
E91 (6-Benzyl-l-hvdroxy-l,5-dihvdro-benzoIc]Il,2]oxaborol-5-yl)-acetic acid
(6-Benzyl-l -hydroxy- 1, 3-dihydro-benzo[c] [1, 2] oxaborol-3-yl)-acetic acid
[0720] To a solution of (6-benzyl- 1 -hydroxy- 1 ,3-dihydro-benzo[c] [ 1 ,2]oxaborol-3- yl)-acetic acid ethyl ester (140 mg, 0.45 mmol) in methanol (5 mL) was added aqueous LiOH-H2O (54 mg in 5 mL of water, 2.26 mmol) at 0 0C. The resulting mixture was stirred at RT for 5 h. The reaction mixture was acidified to pH 2 using diluted hydrochloric acid. The mixture was extracted with EtOAc (2 x 20 mL). The extract was washed with brine and dried to give the crude product which was purified by chromatography on silica gel to give 0.11 (86% yield) of pure product as white powder; mp 187 - 189 0C. 1HNMR (DMSO-J6, 400MHz ) δ 9.19 (s, 1 H), 7.53 (s, 1 H), 7.40 - 7.10 (m, 7 H), 4.40 (m, 1 H), 3.97 (s, 2 H), 2.90 (m, 1 H), 2.30 (m, 1 H). MS (ESI) m/z = 281 [M - H]". E92 ό-Benzyl-S-methanesulfonylmethylSH-benzotcloxaborol-l-ol
[0721] To a solution of dimethylsulfone (197 mg, 2.1 mmol) in THF (6 mL) was added n-BuLi (0.66 mL, 2.5 M in hexane) in an oven-dried three-neck flask under N2 atmosphere. The resulting suspension was heated at 90 0C for Ih and then cooled to -78 0C. A solution of 4-benzyl-2-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2- yl)benzaldehyde in THF (10 mL) was added. The cooling bath was removed. The reaction mixture was gradually warmed up to RT and stirred at RT for 30 min, quenched with H2O and acidified to pH 3 with 6 N HCl, extracted with ethyl acetate, dried and concentrated. The residue was purified by chromatography to give 6-
benzyl-3-methanesulfonylmethyl-3H-benzo[c]oxaborol-l-ol (380 mg, 80% yield). Mp 152 -154 0C. 1HNMR (DMSO-J6, 400MHz) δ 9.40 (s, 1 H), 7.58 (s, 1 H), 7.50 (m, 1 H), 7.40 (m, 1 H), 7.30 - 7.10 (m, 5 H), 5.22 (m, 1 H), 4.00 (s, 2 H), 3.75 (m, 1 H), 3.40 (m, 1 H), 3.08 (s, 3 H). MS (ESI) m/z = 315 [M - H]".
E93 2-Cvano-N-(l-hvdroxy-l,3-dihydro-benzofcUl,21oxaborol-6-yl)- benzenesulfonamide
[0722] E93 was prepared using a procedure similar to that of E95. LCMS (m/z) 315 [M+H]; 1H NMR (400 MHz, DMSO- d6) δ ppm 4.89 (s, 2 H) 7.19 (dd, J=8.2, 2.1 Hz, 1 H) 7.30 (d, J=8.2 Hz, 1 H) 7.45 (d, J=I.8 Hz, 1 H) 7.81 (dd, J=7.6, 1.2 Hz, 1 H) 7.88 (td, J=7.7, 1.4 Hz, 1 H) 7.99 (dd, J=8.0, 1.0 Hz, 1 H) 8.06 (dd, J=7.5, 1.1 Hz, 1 H) 9.22 (s, 1 H) 10.74 (s, 1 H).
E93 Alternate Synthesis
[0723] A 40 mL scintillation vial was charged with 5-amino-2- hydroxymethylphenylboronic acid hydrochloride (100 mg, 0.54 mmol, 1 eq) in dry DCM (10 mL). Pyridine (100 μl, 1.2 mmol, 2.2 eq) was then added followed by 2- cyanobenzenesulfonylchloride (135 mg, 0.67 mmol, 1.2 eq). The mixture was allowed to stir at room temperature overnight. Aqueous hydrochloric acid (1 M, 3 mL) was added and the resulting mixture was extracted twice with DCM (5 mL). The combined organic phases were dried over sodium sulfate, and the material was concentrated under reduced pressure. The residue was purified by silica gel chromatography to furnish E93 as a white solid. LCMS (m/z) 315 [M+H]; 1H NMR (400 MHz, DMSO- d6) δ ppm 4.89 (s, 2 H) 7.19 (dd, J=8.2, 2.1 Hz, 1 H) 7.30 (d, J=8.2 Hz, 1 H) 7.45 (d, J=I.8 Hz, 1 H) 7.81 (dd, J=7.6, 1.2 Hz, 1 H) 7.88 (td, J=7.7, 1.4 Hz, 1 H) 7.99 (dd, J=8.0, 1.0 Hz, 1 H) 8.06 (dd, J=7.5, 1.1 Hz, 1 H) 9.22 (s, 1 H) 10.74 (s, 1 H).
E94 3-Cvano-N-(l-hvdroxy-l,3-dihydro-benzofcUl,21oxaborol-6-yl)- benzenesulfonamide
[0724] General procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (1.72 g, 11.56 mmol), 3-cyano-benzenesulfonyl chloride (2.33 g, 11.56 mmol), pyridine (2.8 rnL, 34.68 mmol), and MeCN (20 mL). Purification: flash chromatography (95:5 CΗ2Cl2/Me0Η): yield 1.5 g (41%). 1H NMR (400 MHz, DMSO-J6) δ (ppm): 10.45 (bs, IH), 9.25 (s, IH), 8.05-8.21 (m, 2H), 7.91-8.04 (m, IH), 7.77 (t, J= 7.8 Hz, IH), 7.47 (d, J= 1.6 Hz, IH), 7.30 (d, J= 8.2 Hz, IH), 7.17 (dd, J= 8.2, 2.0 Hz, IH), 4.90 (s, 2H); MS (ESI) m/z = 313 (M-I, negative); HPLC: 95.49% (220 nm), 95.15% (254 nm).
E95 4-Cvano-N-(l-hvdroxy-l,3-dihvdro-benzofcJfl,2Joxaborol-6-yl)- benzenesulfonamide
[0725] General procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (775 mg, 5.21 mmol), 4-cyano-benzenesulfonyl chloride (1.05 g, 5.21 mmol), pyridine (1.29 mL, 15.6 mmol), and MeCN (20 mL). Purification: flash chromatography (95:5 CΗ2Cl2/Me0Η): yield 1.2 g (74%). 1H NMR (400 MHz, DMSO-J6) δ (ppm): 10.49 (bs, IH), 9.22 (s, IH), 8.02 (d, J= 8.6 Hz, 2H), 7.85 (d, J= 8.6 Hz, 2H), 7.45 (s, IH), 7.27 (d, J= 8.2 Hz, IH), 7.14 (dd, J= 7.8, 2.0 Hz, IH), 5.74 (s, 7H), 4.87 (s, 2H); MS (ESI) m/z = 313 (M-I, negative); HPLC: 96.56% (220 nm), 90.98% (254 nm).
E96 2-Aminomethyl-N-(l-hvdroxy-l,3-dihydro-benzofcUl,21oxaborol-6-yl)- benzenesulfonamide hydrochloride
[0726] General procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (1.51 mg, 10.1 mmol), 2-cyano-benzenesulfonyl chloride (2.05 g, 10.1 mmol), pyridine (2.5 mL, 30.3 mmol), and MeCN (20 mL). The resulting 2-cyano-iV-(l-hydroxy-l,3-dihydro- benzo[c][l,2]oxaborol-6-yl)-benzene sulfonamide (E93) was used directly without further purification. 1H NMR (400 MHz, DMSO-J6) δ (ppm): 10.77 (s, IH), 9.25 (s, IH), 8.07 (d, J= 7.9 Hz, IH), 7.98 (d, J= 7.9 Hz, IH), 7.88 (dd, J= 7.9 Hz, 7.3 Hz, IH), 7.80 (dd, J= 8.2 Hz, 7.9 Hz, IH), 7.45 (s, IH), 7.30 (d, J= 8.2 Hz, IH), 7.19 (d, J= 7.3 Hz, IH), 4.89 (s, 2H); MS (ESI) m/z = 313 (M-H)".
[0727] General procedure 6: 2-cyano-iV-(l-hydroxy-l,3-dihydro- benzo[c][l,2]oxaborol-6-yl)-benzene sulfonamide (500 mg, 1.59 mmol), Raney Ni (1 g), and 7 M NH3 in MeOH (20 mL): H2 (50 psi) at rt for 5 h. Purification: precipitation: yield 398 mg (80%) of E96. 1H NMR (400 MHz, DMSO-J6) δ (ppm): 10.69 (s, IH), 8.56 (bs, 3H), 7.77 (d, J= 7.8 Hz, IH), 7.67 (d, J= 3.5 Hz, 2H), 7.49 (s, 2H), 7.26 (d, J= 8.2 Hz, IH), 7.21-7.11 (m, IH), 4.86 (s, 2H), 4.38 (d, J= 5.1 Hz, 2H); MS (ESI) m/z = 319 (M+ 1, positive); HPLC: 96.12% (220 nm), 95.11% (MaxPlot). E97 3-Aminomethyl-N-(l-hvdroxy-l,3-dihvdro-benzotcltl,21oxaborol-6-yl)- benzenesulfonamide h O/N
E94 E97
[0728] A mixture of 3-cyano-Λ/-(l-hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-6- yl)-benzene sulfonamide (700 mg, 2.23 mmol), Raney Ni (1 g), and 7 M NH3 in MeOH (20 mL) was hydrogenated at 50 psi at rt for 5 h. After filtration, the filtrate was concentrated in vacuo. The residue was dissolved in MeOH (3 mL) and a solution of 4 M HCl in dioxane (10 mL) was added. After stirring for 30 min,
dioxane (10 niL) was added to initiate crystallization. After stirring O/N, the precipitate was filtered off. The filtrate was mixed with H2O (15 mL) and then lyophilized to give E97: yield 550 mg (70%). 1H NMR (400 MHz, DMSO-J6) δ (ppm): 10.45 (s, IH), 9.26 (s, IH), 8.47 (bs, 3H), 7.97 (s, IH), 7.76 (dd, J= 12.09, 7.8 Hz, 2H), 7.60 (t, J= 7.8 Hz, IH), 7.53 (d, J= 1.6 Hz, IH), 7.40 (s, IH), 7.27 (d, J = 7.8 Hz, 2H), 7.19-7.23 (m, IH), 7.15 (s, IH), 4.88 (s, 2H), 4.08 (d, J= 5.1 Hz, 2H); MS (ESI) m/z = 319 (M+l, positive); HPLC: 95.61% (220 nm), 90.95% (254 nm).
E98 4-Aminomethyl-N-(l-hvdroxy-l,3-dihvdro-benzofcJfl,2Joxaborol-6-yl)- benzenesulfonamide h O/N
E95 E98
[0729] A mixture of 4-cyano-Λ/-(l-hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-6- yl)-benzene sulfonamide (600 mg, 1.91 mmol), Raney Ni (1 g), and 7 M NH3 in MeOH (20 mL) was hydrogenated at 50 psi at rt for 5 h. After filtration, the filtrate was concentrated in vacuo. The residue was dissolved in MeOH (3 mL) and a solution of 4 M HCl in dioxane (10 mL) was added. After stirring for 30 min, dioxane (10 mL) was added to initiate crystallization. After stirring O/N, the precipitate was filtered off. The filtrate was mixed with H2O (15 mL) and then lyophilized to give E98: yield 520 mg (76%). 1H NMR (400 MHz, DMSO-J6) δ (ppm): 10.40 (s, IH), 9.22 (s, IH), 8.42 (bs, 3H), 7.80 (d, 2H), 7.63 (d, 2H), 7.53 (s, IH), 7.26-7.19 (m, 2H), 4.86 (s, 2H), 4.03 (s, 2H); MS (ESI) m/z = 319 (M+l, positive); HPLC: 93.58% (220 nm), 90.3% (254 nm)
E99 N-(l-hvdroxy-l,3-dihvdrobenzofcUl,21oxaborol-6-yl)-3- (hydroxymethvDbenzenesulfonamide
[0730] General Procedure 2: Starting Materials 6-amino-3H- benzo[c][l,2]oxaborol-l-ol and 3-(hydroxymethyl)benzene-l-sulfonyl chloride. 1H NMR (300 MHz, DMSO-J6) δ (ppm): 10.41 (s, IH), 9.07 (s, IH), 7.77 (s, IH), 7.61- 7.59 (d, IH), 7.53-7.50 (d, IH), 7.44-7.42 (m, 2H), 7.32 (m, IH), 7.21(m, IH), 5.35
(bs, IH), 4.96 (s, 2H), 4.59 (s, 2H); MS (ESI): m/z = 320.0 (M+l, positive); HPLC purity: 100% (254 nm), 94.1% (220 nm).
ElOO N-a-hvdroxy-1.3-dihvdrobenzofclfl.21oxaborol-6-yl)-4- (hydroxymethyDbenzenesulfonamide
[0731] General Procedure 2: Starting Materials 6-amino-3H- benzo[c][l,2]oxaborol-l-ol and 4-(hydroxymethyl)benzene-l-sulfonyl chloride. 1H NMR (300 MHz, DMSO-J6) δ (ppm): 10.41 (s, IH), 9.07 (s, IH), 7.68-7.66 (d, 2H), 7.37-7.35 (m, 2H), 7.13-7.05 (m, 2H), 6.84- 6.81 (m, IH), 5.32 (bs, IH), 4.82 (s, 2H), 4.49 (s, 2H); MS (ESI): m/z = 320.0 (M+l, positive); HPLC purity: 95.7% (254 nm), 94.7% (220 nm).
ElOl 4-Acetyl-N-(l-hvdroxy-l,3-dihvdro-benzofclfl,21oxaborol-6-yl)- benzenesulfonamide
[0732] ElOl was prepared using a procedure similar to that of E95. LCMS (m/z) 332 [M+H]; 1H NMR (400 MHz, DMSO- d6) δ ppm 2.58 (s, 3 H) 4.88 (s, 2 H) 7.18 (dd, J=8.2, 2.1 Hz, 1 H) 7.27 (d, J=8.4 Hz, 1 H) 7.49 (d, J=2.1 Hz, 1 H) 7.85 (d, J=8.6 Hz, 2 H) 8.07 (d, J=8.6 Hz, 2 H) 9.22 (s, 1 H) 10.42 (s, 1 H).
E102 2-(l-Hvdmxy-l,3-dihvdro-benzofcl[l,21oxaborol-6-ylsulfamoyl)-benzoic acid methyl ester
[0733] General Procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (1.00 g, 6.71 mmol), acetonitrile (20 mL), 2-chlorosulfonyl-benzoic acid methyl ester (1.89 g, 8.06 mmol), N-methyl morpholine (2.71 g, 26.85). Column purification followed by ΗPLC purification in MeOH and 0.1% formic acid/water afforded 124 mg (0.35
mmol, 5%) of the title compound as white solid. 1H NMR (400 MHz, DMSO-J6) δ ppm 10.09 (s, 1 H), 9.22 (s, 1 H), 7.88 - 7.79 (m, 1 H), 7.73 - 7.58 (m, 3 H), 7.49 (s, 1 H), 7.28 (d, J=8.2 Hz, 1 H), 7.20 (dd, J=S.2, 1.6 Hz, 1 H), 4.89 (s, 2 H), 3.84 (s, 3 H); MS (ESI) m/z = 346 (M-I, negative); HPLC purity: 97.99% (MaxPlot 200 - 400 nm), 98.11% (220 nm); Anal. Calcd for Ci5Hi4BNO6S: C 51.90%; H 4.06%; N 4.03%. Found: C 51.77%; H 4.16%; N 4.48%.
E103 2-(l-hvdroxy-l,3-dihvdro-benzofcJfl,2Joxaborol-6-ylsulfamoyl)-benzoic acid
[0734] To a stirred solution of 2-(l-hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-6- ylsulfamoyl)-benzoic acid methyl ester (800 mg, 2.30 mmol) in MeOH (40 mL) was added LiOH (670 mg, 27.91 mmol in 15 mL water). After overnight, the reaction mixture was cooled in an ice bath and acidified using 2N HCl. The aqueous layer was extracted with DCM (3x50 mL), and the combined organic layer was dried over MgSO4 and filtered. Flash column chromatography in MeOH /DCM (1 to 5%) and then preparative HPLC (50x100 Gem lOμ) in 30 to 90% acetonitrile in water afforded 110 mg (0.33 mmol, 14%) of the title compound as a white solid. 1H NMR (400 MHz, DMSO-J6) δ ppm 9.19 (s, 1 H), 7.71 (d, J=7.4 Hz, 1 H), 7.69 - 7.59 (m, 2 H), 7.57 - 7.50 (m, 1 H), 7.46 (s, 1 H), 7.25 (d, J=8.2 Hz, 1 H), 7.23 - 7.17 (m, 1 H), 4.86 (s, 2 H); MS (ESI) m/z = 332 (M-I , negative); HPLC purity: 96.00% (MaxPlot 200 - 400 nm), 95.67% (220 nm); Anal. Calcd for Ci4Hi2BNO6S 0.33H2O: C 49.58%; H 3.76%; N 4.13%. Found: C 49.60%; H 3.78%; N 4.31%.
E104 ^(l-Hydroxy-U-dihydro-benzotcimioxaborol-ό-ylsulfamovD-benzoic acid methyl ester
[0735] General Procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (536 mg, 3.6 mmol), 4-chlorosulfonylbenzoic acid methyl ester (1.0 g, 4.3 mmol), NMM (1.5 mL, 14.2 mmol), and MeCN (10 mL) at rt O/N. The mixture was concentrated in vacuo. H2O (7.5 mL) was added and the mixture was then acidified with 1 M HCl (5 drops).
EtOAc (15 niL) was added and the mixture was stirred until a clear biphasic solution was observed. The aqueous layer was loaded onto an Isolute HM-N column and left to stand for 10 min. The organic layer was then eluted through the column. The column was further washed with EtOAc (20 mL). The organic fractions were concentrated in vacuo and the residue was dissolved in MeOH and loaded onto a pre- column (silica, 12 g). Purification by flash chromatography (20-100% EtOAc/hexane) gave a yellow solid; yield: 280 mg (22%). Recrystallization from MeCN/H2O (2 x) was followed by prep HPLC (0.1% TFA (aq)/MeCN. The major fraction was isolated, concentrated in vacuo at 40 0C and then lyophilized to give the title compound as a white solid (61 mg). 1H NMR (400 MHz, DMSO-J6) δ (ppm): 10.42 (bs, IH), 9.24 (s, IH), 8.10-8.07 (m, 2H), 7.86-7.84 (m, 2H), 7.47-7.46 (m, IH), 7.29-7.27 (m, IH), 7.17-7.15 (m, IH), 4.88 (s, 2H), 3.86 (s, 3H); MS (ESI) m/z = 346 (M-I, negative); HPLC purity: 98.96% (MaxPlot 200-400 nm), 98.78% (220 nm).
E105 4-(N-(l-hvdroxy-l,3-dihvdrobenzofcJfl,2Joxaborol-6-yl)sulfamoyl)benzoic acid
[0736] General Procedure 2: Starting Materials 6-amino-3H- benzo[c][l,2]oxaborol-l-ol and 4-(chlorosulfonyl)benzoic acid. 1H NMR (300 MHz, DMSO-J6) δ (ppm): 13.46 (bs, IH), 10.41 (s, IH), 9.23 (s, IH), 8.07-8.04 (d, 2H), 7.85-7.82 (d, 2H), 7.48 (s, IH), 7.29-7.26 (d, IH), 7.19- 7.16 (dd, IH), 4.88 (s, 2H); MS (ESI): m/z = 334.0 (M+ 1, positive); HPLC purity: 100% (254 nm), 100% (220 nm).
E106 N-(l-Hvdroxy-l,3-dihvdro-benzofcUl,21oxaborol-6-yl)-2-methoxy- benzenesulfonamide
[0737] 2-Methoxybenzenesulfonyl chloride (0.67 g, 3.24 mmol) was added to a mixture of 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (0.5 g, 2.7 mmol) and N-
methylmorpholine (1.64 g, 16.2 mmol) in anhydrous acetonitrile (10 rnL) at 0 0C under nitrogen. The reaction mixture was stirred at room temperature for 18 h, diluted with ethyl acetate (100 mL), washed with water (40 mL), brine, dried over Na2SO4 and concentrated to give crude product as a yellow solid. Purification by silica column chromatography (eluant 3% MeOH in DCM) to afford E 106 as an ivory solid (0.52 g, 60 %). m.p. 177-179 0C. 1H NMR (400 MHz, DMSO) δ (ppm) 9.94 (s, IH), 9.19 (s, IH); 7.71 (d, J= 7.6Hz, IH); 7.52 (t, J= 7.6Hz, IH), 7.47 (s, IH); 7.23- 7.14 (m, 3H), 7.00 (t, J= 7.8 Hz, IH), 4.84 (s, 2H), 3.89 (s, 3H). MS(ESI): m/z = 318 (M-I, negative). HPLC purity: 98.23% (Max. Plot 200-400 nm), 98.64%( 220 nm). E107 2-Hvdroxy-N-a-hvdroxy-1.3-dihvdro-benzofclfl.21oxaborol-6-yl)- benzenesulfonamide
[0738] To a solution of E106 (107 mg, 0.335 mmol) in anhydrous DCM (5 mL) was added slowly BBr3 (IM in DCM, 0.74 mL, 0.737 mmol) at -5 0C under nitrogen. The reaction mixture was stirred at O0C for 10 min. and at room temperature for 2 h. The reaction was poured into ice-brine (7 mL) and extracted with DCM (30 mL). The organic layer was washed with brine (2x10 mL) to pH 7, dried over Na2SO4 and concentrated in vacuo. Crystallization of from DCM/hexanes provided 79 mg (78%) of the title compound as a white solid, m.p. 166-168 0C. 1H NMR (400 MHz, DMSO) δ (ppm) 10.86 (s, IH); 9.90 (s, IH), 9.19 (s, IH), 7.65 (d, J= 8 Hz, IH), 7.49 (s, IH), 7.36 (t, J= 8 Hz, IH), 7.21 (s, 2H); 6.92 (d, J= 8 Hz, IH), 6.84 (t, J= 8 Hz, IH), 4.84 (s, 2H); MS(ESI): m/z = 304 (M-I, negative). HPLC purity: 97.77% (Max. Plot 200-400 nm); 98.25%( 220 nm).
E108 N-(l-Hvdroxy-l,3-dihvdro-benzofcJfl,2Joxabowl-6-yl)-3-methoxy- benzenesulfonamide
[0739] General Procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (0.60 g, 4.0 mmol), 3-methoxybenzenesulfonyl chloride (1.0 g, 4.8 mmol), NMM (1.7 mL, 16.0 mmol) and MeCN (20 mL) at rt O/N. The mixture was concentrated in vacuo and
H2O (5 mL) and EtOAc (15 mL) were added. The mixture was stirred until a clear biphasic solution was observed. The aqueous layer was then loaded onto an Isolute HM-N column and left to stand for 10 min. The organic layer was then eluted through the column. The column was then further washed with EtOAc (20 mL). The organic fractions were concentrated in vacuo and the residue was dissolved in MeOH and loaded onto a pre-column (silica, 4 g). Purification by flash chromatography (silica, 12 g; 20-100% EtOAc/hexane) gave a colorless oil; yield: 398 mg (31%). Recrystallization from MeCNZH2O gave the title compound as a white solid (267 mg). 1H NMR (400 MHz, DMSO-J6) δ (ppm): 10.24 (bs, IH), 9.24 (s, IH), 7.51-7.50 (m, IH), 7.46-7.42 (m, 2H), 7.29-7.25 (m, 2H), 7.19-7.14 (m, 2H), 4.88 (s, 2H), 3.76 (s, 3H); MS (ESI) m/z = 318 (M-I, negative); HPLC purity: 89.76% (MaxPlot 200-400 nm), 89.70% (220 nm).
E108 Alternate synthesis
[0740] A 40 mL scintillation vial was charged with 5-amino-2- hydroxymethylphenylboronic acid hydrochloride (100 mg, 0.54 mmol, 1 eq) in dry DCM (10 mL). Pyridine (100 μl, 1.2 mmol, 2.2 eq) was then added followed by 3- methoxybenzenesulfonylchloride (95 μl, 0.67 mmol, 1.2 eq). The mixture was allowed to stir at room temperature overnight. Aqueous hydrochloric acid (1 M, 3 mL) was added and the resulting mixture was extracted twice with DCM (5 mL). The combined organic phases were dried over sodium sulfate, and the material was concentrated under reduced pressure. The residue was purified by silica gel chromatography to furnish E108 as a clear oil. LCMS (m/z) 320 [M+H]; 1H NMR (400 MHz, DMSO- d6) δ ppm 3.76 (s, 3 H) 4.88 (s, 2 H) 7.12 - 7.21 (m, 2 H) 7.23 - 7.31 (m, 3 H) 7.44 (t, J=8.0 Hz, 1 H) 7.50 (d, J=2.0 Hz, 1 H) 9.22 (s, 1 H) 10.23 (s, 1 H).
E109 3-Hvdroxy-N-(l-hvdroxy-l,3-dihvdro-benzotcltl,21oxaborol-6-yl)- benzenesulfonamide
[0741] N-(I -Hydroxy- 1 ,3-dihydro-benzo[c] [ 1 ,2]oxaborol-6-yl)-3-methoxy- benzenesulfonamide (70 mg, 0.22 mmol) was dissolved in 1 M BBr3 in CH2Cl2 (2.2 rnL, 2.2 mmol) and the resulting solution was stirred at rt for 4 h. H2O was then added and the mixture concentrated in vacuo at 50 0C. The residue was purified by prep HPLC [MeCN/0.1% HCO2H (aq)] and lyophilization of the major peak from 1 M HCl gave the title compound as a white solid: yield; 19 mg (28%). 1H NMR (400 MHz, DMSO-J6) δ (ppm): 10.56 (bs, IH), 10.05 (s, IH), 9.21 (s, IH), 7.48-7.47 (m, IH), 7.33-7.25 (m, 2H), 7.18-7.14 (m, 2H), 7.11-7.10 (m, IH), 6.95-6.93 (m, IH), 4.88 (s, 2H); MS (ESI) m/z = 304 (M-I, negative); HPLC purity: 99.82% (MaxPlot 200-400 nm), 99.61% (220 nm).
EIlO N-a-Hvdroxy-l,3-dihvdro-benzofcIfl,2Ioxaborol-6-yl)-4- methoxybenzenesulfonamide
[0742] General Procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (0.764 g, 5.13 mmol), MeCN (20 mL), NMM (2.26 mL, 20.5 mmol), and 4-methoxy- benzenesulfonyl chloride (1.16 g, 5.64 mmol). Purification: flash chromatography (95 :5 EtOAc/MeOΗ) then recrystallization from H2O. El 10 is isolated as a white solid: yield 0.753 g (46%). mp 157-158 0C; 1H NMR (400 MHz, DMSO-J6) δ (ppm): 10.11 (s, IH), 9.23 (s, IH), 7.66 (d, J= 9.0 Hz, 2H), 7.48 (d, J= 2.0 Hz, IH), 7.25 (d, J= 8.2 Hz, IH), 7.16 (dd, J= 8.2, 2.0 Hz, IH), 7.04 (d, J= 9.0 Hz, 2H), 4.87 (s, 2H), 3.78 (s, 3H); HPLC purity: 95.72% (MaxPlot 200-400 nm), 96.96% (220 nm), 96.99% (254 nm); Anal. Calcd for Ci4Hi4BNO5S: C 52.69%; H 4.42%; N 4.39%. Found: C 52.42%; H 4.30%; N 4.65%.
ElIl N-(l-hvdroxy-l,3-dihvdrobenzofclfl,21oxaborol-6-yl)-4- methoxybenzenesulfonamide
[0743] To a solution of N-(I -hydroxy- 1,3 -dihydrobenzo[c][ 1 ,2]oxaborol-6-yl)-4- methoxybenzenesulfonamide (EIlO) (0.3 g, 0.94 mmol) in DCM (10 mL), was added boron tribromide (IM solution in DCM) (2.82 ml , 2.82 mmol) and stirred at 0 0C overnight. Purification: ice was added and worked up with EtOAc; preparative HPLC was applied for the purification to give ElIl as a white powder. Yield 0.973 g (34%). 1H NMR (400 MHz, DMSO-J6) δ (ppm): 10.38 (bs, IH), 9.99 (s, IH), ), 9.28 (s, IH), 7.56-7.53 (m, 2H), 7.47-7.46 (d, J= 1.7 Hz, IH), 7.24 (d, J= 8.2 Hz, IH), 7.16-7.14 (dd, J= 8.1, 2.0 Hz, IH), 6.83-6.80 (m, 2H), 4.87 (s, 2H); MS (ESI): m/z = 304.1 (M-H, negative).
E112 N-(l-hvdroxy-l,3-dihvdrobenzofc]fl,2]oxaborol-6-yl)-4- (trifluoromethoxy)benzenesulfonamide
[0744] General Procedure 2: Starting Materials 6-amino-3H- benzo[c][l,2]oxaborol-l-ol and 4-(trifluoromethoxy)benzene-l-sulfonyl chloride. 1H NMR (300 MHz, DMSO-J6) δ (ppm): 10.37 (s, IH), 9.22 (s, IH), 7.86-7.83 (d, 2H), 7.56-7.49 (m, 3H), 7.30-7.28 (d, IH), 7.19- 7.16 (m, IH), 4.89 (s, 2H); MS (ESI): m/z = 374.0 (M+ 1, positive); HPLC purity: 100% (254 nm), 100% (220 nm).
E113 3-Difluoromethoxy-N-(l-hvdroxy-l,3-dihvdro-benzofclfl,21oxaborol-6- yl)-benzenesulfonamide
[0745] General Procedure 2: 6-Amino-3H-benzo[c][l,2]oxaborol-l-ol (150 mg, 1.0 mmol), 3-(difluoromethoxy)benzenesulfonyl chloride (300 mg, 1.2 mmol), NMM
(0.43 mL, 4.0 mmol) and MeCN (5 niL) at rt 0/N. The mixture was concentrated in vacuo and H2O (5 mL) and EtOAc (15 mL) were added and the mixture was stirred until a clear biphasic solution was observed. The aqueous layer was loaded onto an Isolute HM-N column and left to stand for 10 min. The organic layer was then eluted through the column. The column was then further washed with EtOAc (20 mL). The organic fractions were concentrated in vacuo and the residue was dissolved in MeOH and loaded onto a pre-column (silica, 4 g). Purification by flash chromatography (silica, 12 g; 20-100% EtOAc/hexane) gave a yellow oil. Recrystallization from MeCN/H2O gave the title compound as a white solid: yield; 25 mg (7%). 1H NMR (400 MHz, DMSO-J6) δ (ppm): 10.36 (bs, IH), 9.22 (s, IH), 7.60-7.53 (m, 2H), 7.46- 7.44 (m, 2H), 7.41-7.39 (m, 2H), 7.26-7.24 (m, IH), 7.16-7.14 (m, IH), 4.86 (s, 2H); 19F NMR (376 MHz, DMSO-J6) δ (ppm): -83.16 (s); MS (ESI) m/z = 354 (M-I, negative); HPLC purity: 96.32% (MaxPlot 200-400 nm), 96.08% (220 nm).
El 14 N-(l-Hvdroxy-l,3-dihvdw-benzofcJfl,2Joxabowl-6-yl)-2-nitw- benzenesulfonamide
[0746] General Procedure 1 : 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (1.0 g, 6.7 mmol), 2-nitrobenzenesulfonyl chloride (1.8 g, 8.0 mmol), NMM (2.94 mL, 26.8 mmol) and MeCN (20 mL) at rt O/N. The mixture was concentrated in vacuo and H2O (5 mL) and EtOAc (15 mL) were added and the mixture was stirred until a clear biphasic solution was observed. The aqueous layer was loaded onto an Isolute HM-N column and left to stand for 10 min. The organic layer was then eluted through the column. The column was then further washed with EtOAc (20 mL). The organic fractions were concentrated in vacuo and the residue was dissolved in MeOH and loaded onto a pre-column (silica, 12 g). Purification by flash chromatography (20- 100% EtOAc/hexane, then 0-20% MeOH/EtOAc) gave a yellow oil; yield: 1.23 g (31%). Recrystallization of a portion of this material from MeCNZH2O gave the title compound as a white solid (25 mg). 1U NMR (400 MHz, DMSO-J6) δ (ppm): 10.68 (bs, IH), 9.27 (s, IH), 7.98-7.92 (m, 2H), 7.85-7.77 (m, 2H), 7.51-7.50 (m, IH), 7.33- 7.31 (m, IH), 7.22-7.21 (m, IH), 4.90 (s, 2H); (ESI) m/z = 333 (M-I, negative); HPLC purity: 95.65% (MaxPlot 200-400 nm), 95.43% (220 nm).
E115 N-(l-Hvdroxy-l,3-dihvdro-benzotcltl,21oxaborol-6-yl)-3-nitro- benzenesulfonamide
[0747] General Procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (1.0 g, 6.7 mmol), 3-nitrobenzenesulfonyl chloride (1.8 g, 8.0 mmol), NMM (2.9 mL, 26.8 mmol), and MeCN (20 rnL) at rt O/N. The mixture was concentrated in vacuo. H2O (10 mL) was added and the resulting mixture acidified with 1 M HCl (10 drops). EtOAc (20 mL) was added and the mixture was stirred until a clear biphasic solution was observed. The aqueous layer was loaded onto an Isolute HM-N column and left to stand for 10 min. The organic layer was then eluted through the column. The column was then further washed with EtOAc (40 mL). The organic fractions were concentrated in vacuo and the residue was dissolved in MeOH and loaded onto a pre- column (silica, 12 g). Purification by flash chromatography (20-100% EtOAc/hexane) gave a yellow solid. Recrystallization from MeCNZH2O gave a white solid. A portion of the precipitate was further purified by prep HPLC (0.1% TFA (aq)/MeCN). The major fraction was isolated, concentrated in vacuo at 40 0C, and then lyophilized to give the title compound as a white solid (84 mg). 1H NMR (400 MHz, DMSO-J6) δ (ppm): 10.55 (bs, IH), 9.25 (s, IH), 8.51-8.50 (m, IH), 8.46-8.43 (m, IH), 8.09-8.07 (m, IH), 7.86-7.82 (m, IH), 7.49-7.48 (m, IH), 7.30-7.29 (m, IH), 7.20-7.17 (m, IH), 4.89 (s, 2H); MS (ESI) m/z = 333 (M-I, negative); HPLC purity: 99.53% (MaxPlot 200-400 nm), 99.35% (220 nm).
El 16 N-(l-Hvdroxy-l,3-dihvdw-benzofcJfl,2Joxabowl-6-yl)-4-nitw- benzenesulfonamide
[0748] General Procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (1 g, 6.71 mmol), 4-nitro-benzenesulfonyl chloride (1.63 g, 7.38 mmol) and NMM (2.71 g, 26.84 mmol) in acetonitrile (150 mL). The product was purified by column using 20% EtOAc in hexanes to afford the title compound (0.7 g, 31%) as a white solid, mp 166 - 167 0C; 1H NMR (400 MHz, DMSO-J6) δ ppm 10.57 (s, 1 H), 9.23 (s, 1 H),
8.37 (d, J= 9.0 Hz, 2 H), 7.96 (d, J= 9.0 Hz, 2 H), 7.49 (d, J= 2.0 Hz, 1 H), 7.30 (d, J= 8.2 Hz, 1 H), 7.18 (dd, J= 8.2, 2.3 Hz, 1 H), 4.89 (s, 2 H); ESI-MS m/z 333 (M-H, negative); HPLC purity: 94.53% (MaxPlot 200 - 400 nm), 94.41% (220 nm).
E 116 A lternate synthesis
[0749] A 40 rnL scintillation vial was charged with 5-amino-2- hydroxymethylphenylboronic acid hydrochloride (80 mg, 0.43 mmol, 1 eq) in dry DCM (8 rnL). Pyridine (80 μl, 0.95 mmol, 2.2 eq) was then added followed by 4- nitrobenzenesulfonylchloride (115 mg, 0.52 mmol, 1.2 eq). The mixture was allowed to stir at room temperature overnight. Aqueous hydrochloric acid (1 M, 3 mL) was added and the resulting mixture was extracted twice with DCM (5 mL). The combined organic phases were dried over sodium sulfate, and the material was concentrated under reduced pressure. The residue was purified by silica gel chromatography and the appropriate fractions were combined and evaporated to afford a off white solid. Trituration with dichloromethane (2 mL) furnished El 16 as a white solid. LCMS (m/z) 335 [M+H]; 1H NMR (400 MHz, DMSO- d6) δ ppm 4.89 (s, 2 H) 7.18 (dd, J=8.2, 2.1 Hz, 1 H) 7.29 (d, J=8.2 Hz, 1 H) 7.49 (d, J=2.1 Hz, 1 H) 7.96 (d, J=4.7 Hz, 2 H) 8.36 (d, J=4.9 Hz, 2 H) 9.22 (s, 1 H) 10.56 (s, 1 H).
E117 2-Amino-N-(l-hvdroxy-l,3-dihvdro-benzofcJfl,2Joxabowl-6-yl)- benzenesulfonamide
[0750] A suspension of TV-(I -hydroxy- 1,3 -dihydro-benzo[c][ 1 ,2]oxaborol-6-yl)-2- nitro-benzenesulfonamide (0.85 g, 2.5 mmol), 10% Pd/C (200 mg), and abs. EtOH (150 mL) was shaken in a Parr apparatus at rt under an atmosphere of H2 (50 psi) for 2.5 h. The mixture was filtered through Celite (washing with EtOH) and then a 0.2 μM filter. The filtrate was concentrated in vacuo at 40 0C and the residue was recrystallized (MeCNZH2O) to give the title compound in two crops; yield 280 mg (37%). mp (crop 2) 143-144 0C; 1H NMR (400 MHz, DMSO-J6) δ (ppm): 10.17 (s, IH), 9.20 (s, IH), 7.48-7.45 (m, 2H), 7.25-7.14 (m, 3H), 6.73-6.71 (m, IH), 6.53-6.49
(m, IH), 5.98 (s, 2H), 4.86 (s, 2H); MS (ESI) m/z = 303 (M-I, negative); HPLC purity: 95.57% (MaxPlot 200-400 nm), 95.01% (220 nm).
E118 3-Amino-N-(l-hvdroxy-l,3-dihvdro-benzotcltl,21oxaborol-6-yl)- benzenesulfonamide hydrochloride
[0751] A suspension of N-(I -hydroxy- 1,3 -dihydro-benzo[c][ l,2]oxaborol-6-yl)-3- nitro-benzenesulfonamide (430 mg, 1.40 mmol), 10% Pd/C (100 mg), and abs. EtOH (150 rnL) was shaken in a Parr apparatus at rt under an atmosphere of H2 (50 psi) for 2 h. The mixture was filtered through Celite® (washing with EtOH) and then a 0.2 μM filter. Purification by prep HPLC followed by lyophilization from 1 M HCl gave the title compound as a white solid; yield 105 mg (22%). 1H NMR (400 MHz, DMSO-J6) δ (ppm): 10.16 (s, IH), 7.48-7.47 (m, IH), 7.27-7.16 (m, 2H), 7.05 (s, IH), 7.00-6.98 (m, IH), 6.83-6.82 (m, IH), 4.88 (s, 2H); MS (ESI) m/z = 303 (M-I, negative); HPLC purity: 88.93% (MaxPlot 200-400 nm), 88.86% (220 nm). E119 4-Amino-N-(l-hvdroxy-l,3-dihydro-benzofcJfl,2Joxaborol-6-yl)- benzenesulfonamide
[0752] A mixture of N-(l-hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-6-yl)-4- nitro-benzenesulfonamide (0.6 g, 1.79 mmol), Pd/C (10% wet, 0.6 g) in methanol (50 mL) was placed under a hydrogen atmosphere at 50 psi for 0.5 h. The catalyst was filtered off through a pad of Celite® and the solvent was evaporated. The product was purified by column using 10% MeOH in dichloromethane, suspended in hot water and sonicated for 10 min to afford the target compound El 19 (0.28 g, 51%) as a white solid after drying, mp 151 - 152 0C; 1H NMR (400 MHz, DMSO-J6) δ ppm 9.82 (s, 1 H), 9.20 (s, 1 H), 7.46 (s, 1 H), 7.37 (d, J= 9.0 Hz, 2 H), 7.23 (d, J= 8.2 Hz, IH), 7.15 (d, J= 8.2 Hz, 1 H), 6.50 (d, J= 9.0 Hz, 2 H), 5.94 (s, 2 H), 4.87 (s, 2 H); ESI- MS m/z 305 (M + H, positive); HPLC purity: 94.19% (MaxPlot 200 - 400 nm), 93.45% (220 nm).
E 119 A lternate synthesis
[0753] A 40 niL scintillation vial was charged with N-{ 1 -hydroxy- 1,3 -dihy dro- benzo[c][l,2]oxaborol-6-yl)-4-nitro-benzenesulfonamide (115 mg, 0.34 mmol, 1 eq) and EtOH (10 rnL). The vial was purged with nitrogen (3X), then palladium on carbon (5% w/w, 20 mg) was added and the mixture was purged with hydrogen (3X) then held under an atmosphere of hydrogen. The mixture was stirred overnight, then the catalyst was removed by filtration and washed with EtOH (20 mL). The resulting solution was evaporated and the residue purified by silica gel chromatography (0 - 10% MeOH/DCM) to furnish Compound 019JMS062 as a white solid. LCMS (m/z) 305 [M+H]; 1H NMR (400 MHz, DMSO- d6) δ ppm 4.87 (s, 2 H) 5.92 (s, 2 H) 6.45 - 6.55 (m, 2 H) 7.15 (dd, J=8.2, 2.1 Hz, 1 H) 7.20 - 7.25 (m, 1 H) 7.36 (d, J=8.8 Hz, 2 H) 7.46 (d, J=2.0 Hz, 1 H) 9.18 (s, 1 H) 9.80 (s, 1 H).
E120 4-Dimethylamino-N-(l-hvdroxy-l,3-dihvdro-benzofcJfl,2Joxaborol-6-yl)- benzenesulfonamide
4-Dimethylamino-benzenesulfonic acid
[0754] A mixture of N,N-dimethylaniline (2.5 g, 20 mmol) and bistrimethylsilyl sulfate (5.0 g, 20 mmol) was heated at 170 0C for 5 h. The mixture was allowed to cool to rt and the resulting solid was isolated by filtration and washed with Et2O. The solid was then dissolved in H2O, and the solution was concentrated in vacuo to give the title compound as a white solid: yield; 4.3 g (quant.). 1H NMR (400 MHz, DMSO-d6) δ (ppm): 7.59-7.57 (m, 2H), 7.10-7.02 (m, 2H), 3.07 (s, 6H); MS (ESI) m/z = 202 (M+H, positive).
4-Dimethylamino-benzenesulfonyl chloride
[0755] 4-Dimethylamino-benzenesulfonic acid (4.3 g, 20 mmol) was added portionwise to a suspension of PCI5 (5.0 g, 24 mmol) in CH2Cl2 (60 mL) at 0 °C. The mixture was then allowed to warm to rt and was then stirred at rt for 3 h. The mixture was concentrated in vacuo and the residue was dissolved in Et2O and H2O. The layers were separated and the organic layer was dried (MgSO4) and concentrated in vacuo to give the title compound as a yellow solid: yield; 1.95 g (42%). 1H NMR (400 MHz, CDCl3) δ (ppm): 7.84-7.82 (m, 2H), 6.77-6.75 (m, 2H), 3.10 (s, 6H). 4-Dimethylamino-N-(l -hydroxy- 1 ,3-dihydro-benzo [c] [1,2] oxaborol-6-yl)- benzenesulfonamide
[0756] General Procedure 2: 6-Amino-3H-benzo[c][l,2]oxaborol-l-ol (200 mg, 1.34 mmol), 4-dimethylamino-benzenesulfonyl chloride (350 mg, 1.61 mmol), Si- pyridine (2.8 g, 4.0 mmol), and MeCN (20 mL) at rt O/N. Si-amine (0.8 g, 1.34 mmol) was added and the mixture was stirred at rt for 6 h. The mixture was then filtered and the resin was washed with MeCN. Water was added to the filtrate and the mixture was concentrated in vacuo at 40 0C until precipitate was observed. The solid was isolated by filtration to give the title compound as white needles: yield; 120 mg (27%). mp 153 0C; 1H NMR (400 MHz, DMSO-d6) δ (ppm): 9.88 (s, IH), 9.18 (s, IH), 7.50-7.46 (m, 3H), 7.22-7.14 (m, 2H), 6.67-6.65 (m, 2H), 4.85 (s, 2H), 2.92 (s, 6H); MS (ESI) m/z = 333 (M+H, positive); HPLC purity: 96.52% (MaxPlot 200-400 nm), 97.55% (220 nm).
E121 4-Formylamino-N-(l-hvdroxy-l,3-dihvdro-benzotcltl,21oxaborol-6-yl)- benzenesulfonamide
[0757] A suspension of 4-amino-N-(l-hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol- 6-yl)-benzenesulfonamide (0.40 g, 1.30 mmol) in formic acid (5.0 g, 130.0 mmol.)
was heated at 100 0C (bath temp) for 16 h. The mixture was then cooled to rt and formic acid was removed under reduced pressure. The resulting residue was diluted with ethyl acetate (50 mL), and the solution was washed with saturated aq. NaHCO3 solution, water, brine, dried over Na2SO4, decanted and concentrated under reduced pressure. The residue was dissolved in minimal amount of DCM and hexanes was added until the solution became cloudy. The precipitate was collected by filtration and was washed with hexanes. The solid was dried under vacuum providing 260 mg (60%) of the title compound. MS (ESI): m/z = 331 (M-I, negative).
E122 N-(l-Hvdroxy-l,3-dihvdro-benzofcJfl,2Joxaborole-6-yl)-4-methylamino- benzene sulfonamide
[0758] To a suspension of lithium aluminum hydride (30 mg, 0.70 mmol) in THF (15 mL) at -10 0C was added solution of 4-formylamino-N-(l -hydroxy- 1,3 -dihydro- benzo[c][l,2]oxaborol-6-yl)-benzenesulfonamide (0.20 g, 0.6 mmol) in THF (5 mL). The reaction mixture was allowed to warm to rt. After 3 h, the reaction mixture was cooled in an ice bath and saturated aq. NH4Cl solution (5 mL) was added. The reaction mixture was diluted with ethyl acetate (100 mL), and the resulting organic layer was washed with water, brine and dried over Na2SO4, decanted and concentrated under reduced pressure. Purification was accomplished by preparative HPLC generating 70 mg (36%) of the title compound as pale yellow solid. 1H NMR (400 MHz, DMSO-d6) δ (ppm): 9.82 (s, IH), 9.19 (s, IH), 7.47-7.42 (m, 3H), 7.23 (d, J = 8.2 Hz, IH), 7.16 (dd, J= 8.2, 2.0 Hz, IH), 6.51-6.48 (m, 3H), 4.86 (s, 2H), 2.66 (d, J = 4.7 Hz, 3H); MS (ESI): m/z = 319 (M+ 1, positive); HPLC purity: 96.91% (MaxPlot 200-400 nm), 97.47% (220 nm). E123 N-f4-(l-Hvdroxy-l,3-dihvdro-benzofcJfl,2Joxaborol-6-ylsulfamoyl)- phenylj-acetamide
[0759] General Procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (250 mg, 1.7 mmol), 4-acetamidobenzenesulfonyl chloride (466 mg, 2.0 mmol), NMM (0.74 mL,
6.8 mmol), and MeCN (5 mL) at rt 0/N. The mixture was concentrated in vacuo. H2O (5 mL) was added to the residue and the mixture acidified with 1 M HCl (5 drops). EtOAc (15 mL) was added and the mixture stirred until a clear biphasic solution was observed. The aqueous layer was loaded onto an Isolute HM-N column and left to stand for 10 min. The organic layer was then eluted through the column. The column was then further washed with EtOAc (20 mL). The organic fractions were concentrated in vacuo. Recrystallization from MeCNZH2O gave give the title compound as a white solid: yield; 125 mg (21%). mp 226-227 0C; 1H NMR (400 MHz, DMSO-J6) δ (ppm): 10.28 (bs, IH), 10.15 (bs, IH), 9.25 (s, IH), 7.71-7.62 (m, 4H), 7.43 (s, IH), 7.24-7.22 (m, IH), 7.19-7.16 (m, IH), 4.88 (s, 2H), 2.03 (s, 3H); MS (ESI) m/z = 345 (M-I, negative); HPLC purity: 95.04% (MaxPlot 200-400 nm), 95.35% (220 nm).
E124 4-Hvdroxyamino-N-(l-hvdroxy-l,3-dihvdro-benzotcltl,21oxaborol-6-yl)- benzenesulfonamide
[0760] A mixture of N-(l-hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-6-yl)-4- nitro-benzene-sulfonamide (500 mg, 1.50 mmol), Zn powder (392 mg, 6.0 mmol) in sat NH4Cl (20 mL) and CHCl3 (20 mL) was stirred for 1 h. Solid particles were removed by filtration. After removal of organic solvent aqueous solution was then lyophilized. The crude material was then purified by preparative HPLC to afford the title compound as a white solid. Yield: 50 mg (10%). 1H NMR (400 MHz, DMSO- d6) δ ppm 9.19 (s, 1 H), 8.93 (s, 1 H), 8.62 (s, 1 H), 7.58 - 7.41 (m, 3 H), 7.27 - 7.21 (m, 1 H), 7.18 - 7.10 (m, 1 H), 6.78 (d, J=9.0 Hz, 2 H), 4.87 (s, 2 H); MS (ESI) m/z = 319 (M-I, negative); HPLC purity: 96.27% (MaxPlot 200 - 400 nm), 96.67% (220 nm).
E125 N-a-Hvdroxy-1.3-dihvdro-benzofclfl.21oxaborol-6-yl)-4- methanesulfonylamino-benzenesulfonamide
[0761 ] To a solution of 4-Amino-N-( 1 -hydroxy- 1 ,3 -dihydro- benzo[c][l,2]oxaborol-6-yl)-benzenesulfonamide (0.30 g, 0.986 mmol) in DCM (7 rnL) was added pyridine (7 rnL, 8.70 mmol) and the resulting mixture was cooled to 0 0C. Methanesulfonyl chloride (0.08 mL, 1.08 mmol) was slowly added. After warming to room temperature and stirring overnight the reaction was heated to 60 0C for 5 h. The volatiles were removed in vacuo and the residue was treated with ethyl acetate and water. The organic layer was separated, washed with brine, dried over
Na2SO4, filtered and concentrated in vacuo providing a yellow solid. Purification was accomplished by preparative HPLC (MeOH/ water (0.1% formic acid) gradient) resulting in the isolation of 120 mg (32% yield) of the title compound as a white lyophilizate. 1H NMR (400 MHz, DMSO-J6) δ (ppm): 9.22 (s, IH), 7.67 (d, J= 8.6 Hz, 2H), 7.48 (d, J= 1.9 Hz, IH), 7.27 - 7.22 (m, 3H), 7.17 (dd, J= 7.9, 1.9 Hz, IH), 4.88 (s, 2H), 3.08 (s, 3H); MS (ESI) m/z = 383 (M+l, positive); HPLC purity: 98.45% (MaxPlot 200-400 nm), 98.51% (220 nm).
E126 N-a-Hvdroxy-1.3-dihvdro-benzofclfl.21oxaborol-6-yl)-3- methanesulfonyl-benzenesulfonamide
[0762] General Procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (250 mg,
1.67 mmol), acetonitrile (7 mL), 3-methanesulfonyl-benzenesulfonyl chloride (513 mg, 2.01 mmol), N-methyl morpholine (678 mg, 6.70 mmol). Preparative ΗPLC purification using 0.1% formic acid/water and acetonitrile provided 49 mg (9%) of the title compound as a white solid. 1H NMR (400 MHz, DMSO-J6) δ ppm 9.19 (br. s., 1 H), 8.20 (s, 1 H), 8.13 (d, J=7.8 Hz, 1 H), 8.0 (d, J=7.8 Hz, 1 H), 7.85 - 7.75 (m, 1 H), 7.46 (s, 1 H), 7.25 (d, J=8.2 Hz, 1 H), 7.13 (dd, J=8.2, 1.9 Hz, 1 H), 4.86 (s, 2 H), 3.30 (br. s., 3 H); MS (ESI) m/z = 365 (M-I, negative); HPLC purity: 97.15 %
(MaxPlot 200 - 400 nm), 97.72% (220 nm); Anal. Calcd for CI4HI4BNO6S2O-SSH2O: C 45.09%; H 3.96%; N 3.75%.
E127
[0763] General Procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (0.150 g, 1.01 mmol), MeCN (10 mL), pyridine (0.243 mL, 3.0 mmol), and 3-sulfamoyl- benzenesulfonyl chloride (0.245 g, 0.958 mmol). Purification: precipitation from acidic H2O. E139 was isolated as an orange solid: yield 210 mg (60%). mp 199 - 201 0C; 1H NMR (400 MHz, DMSO-J6) δ (ppm): 10.49 (s, IH), 9.22 (s, IH), 8.22 - 8.21 (m, IH), 8.02 (d, J= 7.8 Hz, IH), 7.90 - 7.88 (m, IH), 7.75 (t, J= 8.0 Hz, IH), 7.59 (s, 2H), 7.49 (d, J= 1.6 Hz, IH), 7.28 (d, J= 8.2 Hz, IH), 7.18 (dd, J= 8.2, 2.0 Hz, IH), 4.89 (s, 2H); MS (ESI) m/z = 367 (M-I, negative); HPLC purity: 96.29% (MaxPlot 200-400 nm), 96.26% (220 nm); Anal. Calcd for C13H13BN2O6S2O. IH2O: C 42.20%; H 3.60%; N 7.57%. Found: C 41.94%; H 3.52%; N 7.77%. E128 Pyridine-4-sulfonic acid (l-hydroxy-l,3-dihydro- benzotcltl,21oxaborol-6-yl)-amide
[0764] General Procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-ol, MeCN, K2Cθ3, and pyridine-4-sulfonyl chloride. The reaction is restarted with NMM to consume all the 6-amino-3H-benzo[c][l,2]oxaborol-l-ol. Purification: precipitation occurs from H2O, flash chromatography (95:5 CH2Cl2/Me0H), then precipitation from H2O. The title compound is isolated as a light yellow solid.
E129 6-Methoxy-pyridine-3-sulfonic acid (l-hydroxy-l,3-dihydro- benzotcltl,21oxaborol-6-vl)-amide
[0765] General Procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-olΗCl (0.2 g, 1.08 mmol), MeCN (4 mL), pyridine (0.35 rnL, 4.31 mmol), and 6-methoxy-pyridine- 3-sulfonyl chloride (0.36 g, 1.73 mmol). Purification by flash chromatography (0-5% MeOH/ CH2Cl2) gave the title compound as a white solid: yield 281 mg (81%). 1H NMR (400 MHz, DMSO-J6) δ ppm 10.30 (br. s., 1 H), 9.23 (s, 1 H), 8.48 (d, J=2.3 Hz, 1 H), 7.94 (dd, J=8.8, 2.5 Hz, 1 H), 7.49 (s, 1 H), 7.34 - 7.23 (m, 1 H), 7.23 - 7.11 (m, 1 H), 6.96 (d, J=8.6 Hz, 1 H), 4.89 (s, 2 H), 3.88 (s, 3 H); MS (ESI) m/z = 319 (M-I, negative); HPLC purity: 98.30% (MaxPlot 200-400 nm), 98.17% (220 nm).
E130 6-Hydroxy-pyridine-3-sulfonic acid (l-hydroxy-l,3-dihydro- benzotcltl,21oxaborol-6-vl)-amide
[0766] A stirred solution of 6-Methoxy-pyridine-3 -sulfonic acid ( 1 -hydroxy- 1,3- dihydro-benzo[c][l,2]oxaborol-6-yl)-amide (0.2 g, 0.63 mmol) in 3N aqueous hydrochloric acid was heated at reflux for 3h. After cooling to rt, the pH was raised to 6 by adding solid sodium bicarbonate and the aqueous layer extracted with ethyl acetate. The organic layer was washed with saturated aqueous sodium bicarbonate and brine, dried over sodium sulfate and concentrated in vacuo. Purification by preparative HPLC gave the title compound as a white solid: yield 51 mg (27%). 1H NMR (400 MHz, DMSO-J6) δ ppm 12.09 (br. s., 1 H), 10.15 (br. s., 1 H), 9.25 (s, 1 H), 7.71 (br. s., 1 H), 7.62 - 7.43 (m, 2 H), 7.32 (d, J=8.2 Hz, 1 H), 7.19 (dd, J=8.0, 1.8 Hz, 1 H), 6.42 (d, J=9.8 Hz, 1 H), 4.91 (s, 2 H); MS (ESI) m/z = 305 (M-I, negative); HPLC purity: 99.48% (MaxPlot 200-400 nm), 99.47% (220 nm).
E131 5-Nitro-pyridine-2-sulfonic acid (l-hydroxy-lj-dihydro- benzotcltl,21oxaborol-6-vl)-amide
5-Nitro-pyridine-2-sulfonyl chloride
[0767] To an ice-cold solution of 5-nitro-pyridine-2-thiol (1.27 g, 8.13 mmol) in
IN aqueous HCl (25 niL) and acetic acid (5 mL) was vigorously bubbled chlorine (gas) for 15 min, followed by nitrogen for 5 min. the solid was collected by filtration, washed with cold IN aqueous HCl and water and dried in vacuo: yield 842 mg (47%). 1H NMR (400 MHz, CHLOROFORM-J) δ ppm 9.60 (d, J=2.0 Hz, 1 H), 8.84 (dd, J=8.6, 2.3 Hz, 1 H), 8.35 (d, J=8.6 Hz, 1 H).
5 -Nitro-pyridine-2 -sulfonic acid (1-hydroxy-l, 3-dihydro-benzo [c] [ 1 ,2] oxaborol-6- yl)-amide
[0768] General Procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (0.2 g, 1.34 mmol), MeCN (4 mL), pyridine (0.22 mL, 2.69 mmol), and 5-nitro-pyridine-2- sulfonyl chloride (0.3 g, 1.34 mmol). Purification by filtration from water and wash with water and ethyl acetate generated 380 mg (84%) of the title compound as an orange solid, mp 211 - 213 0C; 1H NMR (400 MHz, DMSO-J6) δ ppm 10.85 (s, 1 H), 9.45 (d, J=2.2 Hz, 1 H), 9.22 (s, 1 H), 8.78 (dd, J=8.6, 2.5 Hz, 1 H), 8.16 (d, J=8.6 Hz, 1 H), 7.52 (s, 1 H), 7.34 - 7.15 (m, 2 H), 4.88 (s, 2 H); MS (ESI) m/z = 334 (M-I, negative); HPLC purity: 93.99% (MaxPlot 200-400 nm), 93.92% (220 nm).
E132 5-Amino-pyridine-2-sulfonic acid (l-hydroxy-lj-dihydro- benzofcIfl,2Ioxaborol-6-yl)-amide; hydrochloride
[0769] A mixture of 5 -Nitro-pyridine-2-sulfonic acid ( 1 -hydroxy- 1 ,3 -dihydro- benzo[c][l,2]oxaborol-6-yl)-amide (1.51 g, 4.51 mmol)) and 10% Pd on carbon (1.51 g, 1 : 1 w/w substrate to catalyst) in THF (30 mL) and methanol (135 mL) was shaken under an atmosphere OfH2 (40 psi) in a Parr shaker. Once the reaction was complete (30 min), the mixture was filtered through Celite. The filtrate was concentrated in vacuo and the residue dissolved in acetonitrile - water, washed with ethyl ether and lyophilized to provide the title compound as a yellow solid: yield 827 mg (60%). 1H NMR (400 MHz, DMSO-J6) δ ppm 10.10 (s, 1 H), 9.17 (br. s., 1 H), 7.90 (d, J=2.5 Hz, 1 H), 7.56 (d, J=8.6 Hz, 1 H), 7.47 (s, 1 H), 7.27 - 7.13 (m, 2 H), 6.89 (dd, J=8.6, 2.5 Hz, 1 H), 6.17 (br. s., 2 H), 4.86 (s, 2 H); MS (ESI): m/z = 304 (M-I, negative); HPLC purity: 95.56% (MaxPlot 200-400 nm), 95.55% (220 nm).
E133 6-Amino-pyridine-3-sulfonic acid (l-hydroxy-lj-dihydro- benzotcl t 1,21 oxaborol-6-yl)-amide hydrochloride
6-Amino-pyridine-3-sulfonyl chloride
[0770] Pyridin-2-ylamine (2 g, 21.25 mmol) was added slowly to ice-cold chlorosulfonic acid (14 mL, 212.5 mmol) in a sealable flask. Thionyl chloride (6.2 mL, 85 mmol) was added dropwise and the flask was sealed. The mixture was heated at 80 0C for 2.5 h and at 150 0C for 16h. After cooling to rt, the mixture was cautiously poured on crushed ice and the resulting precipitate filtered off. The filtrate was extracted with ethyl acetate (3 times) and the combined organic layers washed brine, dried over sodium sulfate and dried in vacuo to give the title compound as a white solid: yield 870 mg (21%). 1U NMR (400 MHz, CHLOROFORM-^) δ ppm
8.70 (d, J=I.9 Hz, 1 H), 7.96 (dd, J=9.0, 2.4 Hz, 1 H), 6.57 (d, J=8.9 Hz, 1 H), 5.29 (br. s., 2 H); MS (ESI): m/z = 191 (M-I, negative).
6-Amino-pyridine- 3 -sulfonic acid (1 -hydroxy- 1, 3-dihydro-benzo [c] [ 1 , 2] oxaborol-6- yl)-amide; hydrochloride
[0771] General Procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (0.32 g, 2.15 mmol), MeCN (7 mL), pyridine (0.35 mL, 4.31 mmol), and 6-amino-pyridine-3- sulfonyl chloride (0.42 g, 2.15 mmol). Purification by preparative HPLC generated 260 mg (40%) of the title compound as a pale yellow solid after lyophilization. 1H NMR (400 MHz, DMSO-J6) δ ppm 10.04 (s, 1 H), 9.22 (br. s., 1 H), 8.19 (d, J=2.2 Hz, 1 H), 7.62 (dd, J=9.0, 2.4 Hz, 1 H), 7.49 (d, J=I.6 Hz, 1 H), 7.28 (d, J=8.2 Hz, 1 H), 7.17 (dd, J=8.2, 1.9 Hz, 1 H), 7.10 (br. s., 2 H), 6.50 (d, J=8.9 Hz, 1 H), 4.89 (s, 2 H); MS (ESI) m/z = 306 (M+ 1, positive); HPLC purity: 99.85% (MaxPlot 200-400 nm), 99.55% (220 nm); Anal. Calcd for Ci2Hi2BN3O4S 0.5 HCl : C 44.57%; H 3.90%; N 13.00%. Found: C 44.97%; H 4.19%; N 12.72%.
E134 5-(l-Hvdroxy-l,3-dihvdro-benzotcltl,21oxaborol-6- ylsulfamoyl)-furan-2-carboxylic acid methyl ester
[0772] General Procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-olΗCl (0.2 g, 1.08 mmol), MeCN (4 mL), pyridine (0.35 mL, 4.32 mmol), and 5-chlorosulfonyl- furan-2-carboxylic acid methyl ester (0.29 g, 1.3 mmol). Purification by flash chromatography (0-5% MeOΗ/CΗ2Cl2) gave the title compound as a white solid: yield 284 mg (78%). 1H NMR (400 MHz, DMSO-J6) δ ppm 10.93 (br. s., 1 H), 9.25 (s, 1 H), 7.51 (d, J=1.6 Hz, 1 H), 7.43 - 7.28 (m, 2 H), 7.27 - 7.15 (m, 2 H), 4.92 (s, 2 H), 3.84 (s, 3 H).
E135 5-Hvdroxymethyl-furan-2-sulfonic acid (l-hydroxy-l,3-dihydro- benzotcltl,21oxaborol-6-vl)-amide
[0773] A IM solution of lithium borohydride (1.04 mL, 2.08 mmol) was added dropwise to an ice-cold solution of 5 -(I -hydroxy- 1,3 -dihydro-benzo[c][l,2]oxaborol- 6-ylsulfamoyl)-furan-2-carboxylic acid methyl ester (0.23 g, 0.69 mmol) in anhydrous THF (5 mL) and methanol (0.1 mL) and the mixture was stirred at rt for 3 h. The mixture was then cooled to 0 0C and acidified to pH 6 with 3N aqueous HCl. The mixture was extracted with ethyl acetate and the organic layer washed with brine, dried over sodium sulfate and concentrated in vacuo to give the title compound as a white solid: yield 153 mg (71%). 1H NMR (400 MHz, DMSO-J6) δ ppm 10.61 (s, 1 H), 9.25 (br. s., 1 H), 7.53 (s, 1 H), 7.30 (d, J=8.3 Hz, 1 H), 7.20 (dd, J=8.3, 1.9 Hz, 1 H), 7.04 (d, J=3.5 Hz, 1 H), 6.42 (d, J=3.5 Hz, 1 H), 5.46 (br. s., 1 H), 4.91 (s, 2 H), 4.40 (s, 2 H); MS (ESI) m/z = 308 (M-I, negative); HPLC purity: 95.43% (MaxPlot 200-400 nm), 95.15% (220 nm); Anal. Calcd for Ci2Hi2BNO6 ' 2 H2O : C 41.76%; H 4.67%; N 4.06%. Found: C 41.50%; H 4.47%; N 4.33%.
E136 lH-Pyrazole-4-sulfonic acid (l-hydroxy-l,3-dihydro- benzotcltl,21oxaborol-6-yl)-amide
[0774] General Procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (0.200 g, 1.07 mmol), MeCN (10 mL), NMM (0.23 mL, 2.14 mmol), lΗ-pyrazole-4-sulfonyl chloride (0.189 g, 1.07 mmol). Purification: preparative HPLC. E136 was isolated as white solid; yield 50 mg (16%). 1U NMR [400 MHz, METHANOL-J4 + Cone HCl (1 drop)] δ ppm 7.89 (br.s, 2 H), 7.45 (d, J=2.0 Hz, 1 H), 7.37 - 7.20 (m, 2 H), 4.98 (s, 2 H); MS (ESI) m/z = 280 (M+ 1, positive); HPLC purity: 97.48% (MaxPlot 200-400 nm), 98.72% (220 nm).
E137 lH-Imidazole-4-sulfonic acid (l-hydroxy-l,3-dihydro- benzotcltl,21oxaborol-6-vl)-amide
[0775] General Procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (0.500 g, 2.69 mmol), MeCN (20 mL), NMM (0.88 mL, 8.07 mmol), and lH-imidazole-4- sulfonyl chloride (0.493 g, 2.95 mmol). Purification: Recrystallization from hot water. E137 was isolated as orange solid; yield 50 mg (16%). m.p. 195-196 0C. 1H NMR (400 MHz, DMSO-J6) δ ppm 12.67 (br. s, 1 H), 10.15 (s, 1 H), 9.20 (s, 1 H), 7.79 (s, 1 H), 7.71 (s, 1 H), 7.51 (s, 1 H), 7.23 (s, 2 H), 4.87 (s, 2 H); MS (ESI) m/z = 278 (M-I, negative); HPLC purity: 96.57% (MaxPlot 200-400 nm), 95.35% (220 nm).
E138 N-t5-(l-Hvdroxy-l,3-dihvdro-benzotcπi,21oxaborol-6-ylsulfamoyl)- thiazol-2-ylJ-acetamide
[0776] General Procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (0.216 g, 1.07 mmol), pyridine (10 mL), and 2-acetylamino-thiazole-5-sulfonyl chloride (0.284 g, 1.17 mmol), 60 0C for 1.5 h. Purification: Recrystallization from hot water. E138 was isolated as orange solid; yield 120 mg (29%). mp. 235- 236 0C. 1H NMR (400 MHz, DMSO-J6) δ ppm 12.61 (s, 1 H), 10.41 (s, 1 H), 9.25 (s, 1 H), 7.80 (s, 1 H), 7.53 (d, J=2.0 Hz, 1 H), 7.37 - 7.27 (m, 1 H), 7.28 - 7.18 (m, 1 H), 4.91 (s, 2 H), 2.16 (s, 3 H); MS (ESI) m/z = 352 (M-I, negative); HPLC purity: 91.99% (MaxPlot 200- 400 nm), 92.41% (220 nm).
E139 2-Amino-thiazole-5-sulfonic acid (l-hydroxy-l,3-dihydro- benzotcltl,21oxaborol-6-vl)-amide
[0777] To a solution of N-[5-(l-hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-6- ylsulfamoyl)-thiazol-2-yl]-acetamide (90 mg, 0.25 mmol) in THF (5 mL) was added HCl (5 mL, 10%) and the reaction mixture was heated to 60 0C for 4 h. After
removing the solvent in vacuo, purification was accomplished by preparative HPLC to afford 28 mg (36%) of the title compound as a white solid. 1H NMR (400 MHz, DMSO-J6) δ ppm 10.15 (s, 1 H), 7.79 (s, 2 H), 7.55 (d, J=I.6 Hz, 1 H), 7.36 - 7.29 (m, 2 H), 7.25 - 7.20 (m, 1 H), 4.92 (s, 2 H); MS (ESI) m/z = 310 (M-I, negative); HPLC purity: 95.14% (MaxPlot 200-400 nm), 95.44% (220 nm).
E140 lH-fl,2,41Triazole-3-sulfonic acid (1-hydroxy-l ,3-dihydro- benzotcltl,21oxaborol-6-yl)-amide
[0778] General Procedure 2: 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (0.200 g, 1.07 mmol), MeCN (5 mL), NMM (0.35 mL, 3.21 mmol), IH-[1, 2,4]triazole-3- sulfonyl chloride (0.197 g, 1.17 mmol). Purification: Recrystallization from hot water. E140 was isolated as orange solid; yield 170 mg (56%). m.p. >300 0C (dec). 1H NMR (400 MHz, DMSO-J6) δ ppm 10.69 (br. s., 1 H), 9.23 (s, 1 H), 8.75 (s, 1 H), 7.53 (s, 1 H), 7.30 - 7.25 (m, 2H), 4.90 (s, 2 H); MS (ESI) m/z = 279 (M-I, negative); HPLC purity: 98.32% (MaxPlot 200-400 nm), 98.94% (220 nm).
5.81 mmol), MeCN (30 mL), NMM (2.55 mL, 23.2 mmol), and cyclopropanesulfonyl chloride (0.898 g, 6.39 mmol). Purification: flash chromatography (95:5 CΗ2Cl2/Me0Η, sample absorbed to 14 g SiO2 with CH2Cl2/Me0H) then trituration with EtOAc. E141 was isolated as a light yellow solid: yield 0.373 g (25%). mp 177- 181 0C; 1H NMR (400 MHz, DMSO-J6) δ (ppm): 9.64 (bs, IH), 9.22 (s, IH), 7.62 (s, IH), 7.34 (d, J= 7.8 Hz, IH), 7.31 (dd, J= 8.2, 1.6 Hz, IH), 4.93 (s, 2H), 2.54-2.49 (m, IH), 0.92-0.87 (m, 4H); MS (ESI): m/z = 252 (M-I, negative); HPLC purity:
99.25% (MaxPlot 200-400 nm), 99.05% (220 nm); Anal. Calcd for CioHi2BN04S«0.5H20: C 46.63%; H 4.89%; N 5.44%. Found: C 46.51%; H 4.71%;
N 5.52%.
E142 4-(l-Hydroxy-l,3-dihydro-benzofclH,21oxaborol-6-ylsulfamoyl)- piperidine-1-carboxylic acid benzyl ester
[0780] To a solution of 6-amino-3H-benzo[c][l,2]oxaborol-l-ol (HCl salt, 0.145 g, 0.786 mmol) in pyridine (7 mL, 8.70 mmol) cooled to 0 0C was added 4- chlorosulfonyl-piperidine-1-carboxylic acid benzyl ester (0.25 g, 0.786 mmol). After warming to room temperature and stirring overnight the reaction was heated to 70 0C for 6 h. The volatiles were removed in vacuo and the residue was treated with ethyl acetate and water. The organic layer was separated, washed with brine, dried over Na2SO4, filtered and concentrated in vacuo providing a brown oil. Purification was accomplished by preparative HPLC (MeOH/ water (0.1% formic acid) gradient) resulting in the isolation of 140 mg (41% yield) of the title compound as a white lyophilizate. 1H NMR (400 MHz, DMSO-J6) δ (ppm): 9.92 (s, IH), 9.26 (s, IH), 7.62 (s, IH), 7.39 - 7.31 (m, 7H), 5.07 (s, 2H), 4.94 (s, 2H), 4.04 (d, J= 12.1 Hz, 2H), 3.29 - 3.17 (m, IH), 2.99 - 2.70 (m, 2H), 1.98 (d, J= 11.7 Hz, 2H), 1.55 - 1.47 (m, 2H); MS (ESI) m/z = 429 (M-I, negative); HPLC purity: 99.54% (MaxPlot 200-400 nm), 99.62% (220 nm).
E143 Pweridine-4-sulfonic acid (l-hydroxy-l,3-dihydro-benzofcl H,21oxaborol- 6-yl)-amide; hydrochloride salt
[0781] To a solution of 4-(l-Hydroxy-l,3-dihydro-benzo[c][l,2]oxaborol-6- ylsulfamoyl)-piperidine-l-carboxylic acid benzyl ester (0.10 g, 0.23 mmol) in methanol (4 mL) was added Pd/C (10% by wt, wet, 0.09 g) and a balloon filled with hydrogen. After overnight, filter through Celite® and rinse with methanol followed by chloroform/methanol (1 :1) mixture and concentrate in vacuo. Purification was
accomplished by preparative HPLC (MeOH/ water (0.1% formic acid) gradient) followed by treatment of the lyophilizate in methanol (1.5 mL) with IM HCl in ether (0.169 mL, 0.169 mmol) and concentration in vacuo and lyophilization from water generating 40 mg (52% yield) of the title compound. 1U NMR (400 MHz, DMSO-J6) δ (ppm): 10.03 (br.s, IH), 9.28 (s, IH), 7.64 (s, IH), 7.39 - 7.33 (m, 2H), 4.95 (s, 2H), 3.42 - 3.34 (m, 2H), 2.89 (t, J= 12.5 Hz, 2H), 2.51 - 2.50 (m, IH), 2.11 (d, J= 12.9 Hz, 2H), 1.90 - 1.82 (m, 2H); MS (ESI) m/z = 297 (M+ 1, positive); HPLC purity: 98.34% (MaxPlot 200-400 nm), 99.15% (220 nm).
E144 N-(l-Hvdroxy-3-nitromethyl-l,3-dihvdro-benzofcJfl,2Joxaborol-6-yl)-4- nitro-benzenesulfonamide
[0782] General Procedure 2: 6-Amino-3-nitromethyl-3H-benzo[c][l,2]oxaborol-l- ol hydrochloride (0.75 g, 3.1 mmol), 4-nitrobenzenesulfonyl chloride (0.82 g, 3.7 mmol), pyridine (1.0 mL, 12 mmol), and MeCN (10 mL) at rt O/N. Mixture was concentrated in vacuo at 40 0C. The residue was dissolved in EtOAc and loaded onto a pre-column (SiO2, 12 g). Purification by Biotage (10-100% EtOAc/CH2Cl2) gave the title compound as a yellow oil which solidified on standing under high vacuum: yield; 510 mg (42%). 1H NMR (400 MHz, DMSO-J6) δ (ppm): 10.73 (s, IH), 9.56 (s, IH), 8.38-8.36 (m, 2H), 8.01-8.00 (m, 2H), 7.50-7.49 (m, IH), 7.45-7.43 (m, IH), 7.24-7.21 (m, IH), 5.68 (dd, J= 8.9, 2.5 Hz, IH), 5.25 (dd, J= 13.6, 2.5 Hz, IH), 5.25 (dd, J= 13.6, 8.9 Hz, IH); MS (ESI) m/z = 392 (M-I, negative).
E145 4-Amino-N-(3-aminomethyl-l-hvdroxy-l,3-dihydw- benzofclfl,2]oxaborol-6-yl)-benzenesulfonamide dihydrochloride
[0783] A mixture of N-(l-hydroxy-3-nitromethyl-l,3-dihydro- benzo[c][l,2]oxaborol-6-yl)-4-nitrobenzenesulfonamide (200 mg, 0.51 mmol), Raney nickel (100 mg), cone. NH4OH (1.0 mL), H2O (10 mL), and MeOH (5 mL) was shaken in a Parr apparatus under an atmosphere of H2 (50 psi) at rt O/N. The mixture
was filtered through celite and the filtrate was concentrated in vacuo. The residue was purified by prep HPLC (MeOH/0.1% aq TFA) and then lyophilized from 1 M HCl to give the title compound as a yellow solid: yield; 11 mg (5%). 1H NMR (400 MHz, DMSO-^δ (ppm): 10.00 (s, IH), 9.56 (bs, IH), 8.00 (bs, 3H), 7.56-7.55 (m, IH), 7.43-7.41 (m, 2H), 7.36-7.34 (m, IH), 7.20-7.19 (m, IH), 6.54-6.51 (m, 2H), 5.22-5.20 (m, IH), 3.40 - 3.30 (hidden, IH), 2.74-2.67 (m, IH); MS (ESI) m/z = 334 (M+H, positive); HPLC purity: 88.52% (MaxPlot 200-400 nm), 86.81% (220 nm).
E146 N-β-Aminomethyl-l-hvdroxy-l,3-dihvdro-benzoIc]Il,2]oxaborol-6-vD-3- difluoromethoxy-benzenesulfonamide, TFA salt
[0784] A mixture of 6-amino-3-aminomethyl-3H-benzo[c][l,2]oxaborol-l-ol dihydrochloride (250 mg, 0.52 mmol), silica bound diethylamine (2.0 g, 1.25 mmol g" 1 J 2.6 mmol), and MeOH (10 mL) was stirred at rt for 30 min. The mixture was then concentrated in vacuo at 40 0C and then further dried on a high vac at rt O/N. BoC2O (113 mg, 0.52 mmol) and THF (10 mL) were added and the resulting mixture was stirred vigorously at rt for 5 h. 3-(Difluoromethoxy)benzene sulfonyl chloride (378 mg, 1.56 mmol) was added and the mixture was stirred at rt O/N. The mixture was concentrated in vacuo at 30 0C. The silica was placed in a Dasi dry loading unit. Purification using a Teledyne cyano column (50 g), running a gradient of hexane to CH2Cl2, then CH2Cl2 to MeOH resulted in the isolation of a mixture of [6-(3- difluoromethoxy-benzenesulfonylamino)-l-hydroxy-l,3-dihydro- benzo[c][l,2]oxaborol-3-ylmethyl]-carbamic acid tert-butyl ester and 3- difluoromethoxy-benzenesulfonic acid. This mixture was dissolved in 4 M HCl/dioxane (10 mL) and the resulting solution was stirred at rt O/N. The mixture was concentrated in vacuo at 40 0C and the residue was purified by prep HPLC: gradient 5 to 10% MeCN/0.1% aq TFA over 2 min, then 10 to 90% MeCN/0.1% aq TFA over 15 min. The fractions were concentrated in vacuo at 40 0C to remove the organics and then freeze dried to give the title compound as a yellow solid: yield 13 mg (5%). 1H NMR (400 MHz, DMSO-J6): δ 10.54 (s, IH), 9.61 (s, IH), 8.00 (bs,
3H), 7.64-7.62 (m, 2H), 7.59-7.58 (m, IH), 7.51 (s, IH), 7.47-7.41 (m, 2H), 7.29 (s, IH), 7.22-7.20 (m, IH), 5.23-5.22 (m, IH), 2.73-2.67 (m, IH); 19F NMR (376 MHz, DMSO-J6): δ -74.13 (s), -83.32 (d); MS (ESI) m/z = 385 (M+ 1, positive); HPLC purity: 89.81% (MaxPlot 200-400 nm), 91.75% (220 nm).
E147 5-Oxazol-5-yl-thiophene-2-sulfonic acid β-aminomethyl-l-hydroxy-1,3- dihvdro-benzotcltl,21oxaborol-6-yl)-amide, hydrochloride
[0785] A mixture of 6-amino-3-aminomethyl-3H-benzo[c][l,2]oxaborol-l-ol dihydrochloride (250 mg, 0.52 mmol), silica bound diethylamine (2.0 g, 1.25 mmol g" \ 2.6 mmol), and MeOH (10 mL) was stirred at rt for 15 min. The mixture was then concentrated in vacuo at 30 0C and then further dried under high vac at rt O/N. BoC2O (113 mg, 0.52 mmol) and THF (10 mL) were added and the resulting mixture was stirred vigorously at rt for 8.5 h. 5-(l,3-Oxazol-5-yl)-2-thiophene sulfonyl chloride (0.39 g, 1.56 mmol) was added and the mixture was stirred at rt O/N. The mixture was concentrated in vacuo at 30 0C. The silica was placed in a Dasi dry loading unit. Purification using a Teledyne cyano column (50 g), running a gradient of hexane to CH2Cl2, then CH2Cl2 to MeOH resulted in the isolation of a mixture of [ 1 -hydroxy-6-(5-oxazol-5-yl-thiophene-2-sulfonylamino)- 1 ,3-dihydro- benzo[c][l,2]oxaborol-3-ylmethyl]-carbamic acid tert-butyl ester and 5-oxazol-5-yl- thiophene-2-sulfonic acid. This mixture was dissolved in 4 M HCl/dioxane (10 mL) and the resulting solution was stirred at rt O/N. The mixture was concentrated in vacuo at 40 0C and the residue was purified by prep HPLC: gradient 5 to 10% MeCN/0.1% aq TFA over 2 min, then 10 to 90% MeCN/0.1% aq TFA over 15 min. The fractions were concentrated in vacuo at 40 0C to remove the organics, 1 M HCl was added and then the solution was freeze dried to give the title compound as a yellow solid: yield 6 mg (3%). 1H NMR (400 MHz, DMSO-J6): δ 10.79 (s, IH), 8.52 (s, IH), 8.20 (bs, 3H), 7.74 (s, IH), 7.75-7.74 (m, IH), 7.66-7.59 (m, IH), 7.49-7.45 (m, 2H), 7.30-7.28 (m, IH), 5.30-5.29 (m, IH), 3.48-3.39 (m, IH), 2.78-2.71 (m, IH); MS (ESI) m/z = 392 (M+l, positive); HPLC purity: 88.98% (MaxPlot 200-400 nm), 91.03% (220 nm).
E148 N-fd-Hydroxy-ό-fphenylsulfonamidoi-U-dihydrobenzofcimioxaborolS- yl)methyl)-4-methylpentanamide
Step 1. N-(( 1 -Hydroxy- 1 ,3-dihydrobenzo [c] / 1 ,2) 'oxaborol-3-yl)methyl)-4- methylpentanamide
[0786] To a suspension of 3-(aminomethyl)benzo[c][l,2]oxaborol-l(3H)-ol (8.59 g, 43.15 mmol) in 145 ml of DCM was added triethylamine (18ml, 129.5 mmol), cooled to O0C, then slowly added 4-methylvaleryl chloride (5.81 g, 43. 15 mmoi). The reaction mixture was slowly wanned up to room temperature and stirred tor additional
1.5 hours. It was filtered and the filtrate was collected and dried. 1 he crude residue was re-suspended in CAN, filtered and dried to give 8.23 g off-white powder. 1 g of this powder was. purified by flash chromatography to give 0.86 g product as white powder. MS (ESI) m/z 260 [M-H]" Step 2. N-((l-Hydroxy-6-nitro-l ,3-dihydrobenzo [c] [1 ,2] 'oxaborol-3-yl)methyl)-4- methylpentanamide
[0787] N-((l-hydroxy-l,3-dihydrobenzo[c][l,2]oxaborol-3-yl)methyl)-4- methylpentanamide (1.08 g, 4.14 mmol) was added to 5 ml concentrated HNO3 at - 5O0C and stirred for 2 hours. The mixture was then poured over crushed ice and extracted with ethyl acetate. Combined organic layer was washed with brine, concentrated and purified by column to get yellowish oil (0.96 g). MS (ESI) m/z 593 [2*M-18-H]+
Step 3. N- ((6- Amino- 1 -hydroxy- 1 ,3-dihydrobenzo [c] [1,2] oxaborol-3-yl)methyl)-4- methylpentanamide
[0788] N-((l-hydroxy-6-nitro-l,3-dihydrobenzo[c][l,2]oxaborol-3-yl)methyl)-4- methylpentanamide (0.96g, 3.14 mmol)was dissolved in 80 ml MeOH and IN HC1(62 ml, 62.8 mmol) then Zn powder (2.05 g, 31.4 mmol) were added. After 1 hour, 100 ml saturated sodium bicarbonate and 150 ml ethyl acetate were added. The mixture was stirred vigorously and an intense precipitate was produced. This was filtered through Celite and the Celite was rinsed with more ethyl acetate. The organic layer of the combined filtrate was separated, rinsed with more saturated sodium bicarbonate, brine, dried over Na2SO4, filtered and evaporated. The crude residue was purified by flash chromatography to get 0.44 g off-white solid. MS (ESI) m/z 533 [2*M-18-H]+
Step 4. N-((l-Hydroxy-6-(phenylsulfonamido)-l,3-dihydrobenzo[c] [l,2]oxaborol-3- yl)methyl)-4-methylpentanamide
[0789] N-((6-amino-l-hydroxy-l,3-dihydrobenzo[c][l,2]oxaborol-3-yl)methyl)-4- methylpentanamide (0.44 g, 1. 59 mmol, 1 eq) was dissolved in 10 ml ACN. Triethylamine (0.22 ml, 1.59 mmol, 1 eq) followed by benzenesulfonyl chloride (0.2 ml, 1.59 mmol, 1 eq) were added and the mixture was stirred for 2 hours at room temperature. The solvent was then evaporated by reduced pressure and the residue was dissolved in ethyl acetate, washed with saturated sodium bicarbonate, brine, dried over Na2SO4, filtered and evaporated. The crude residue was purified by flash chromatography to get 120 mg title compound as white powder. 1H NMR (DMSO- d6, 300MHz) δ ppm 10.3 (s, 1 H) 9.25 (s, IH) 7.92 (t, J= 5.4 Hz, 1 H) 7.74 (d, J = 5.3 Hz, 2 H) 7.61-7.46 (m, 3 H) 7.22 (d, J= 8.1 Hz, 1 H) 7.12 (d, J= 8.3 Hz, 1 H) 5.03-5.00 (m, 1 H) 3.42-3.36 (m, 1 H) 3.18-3.16 (m, 1 H) 2.00 (t, J= 7.2 Hz, 2 H) 1.34-1.22 (m, 3 H) 0.79 (d, J= 11.1 Hz, 6H) MS (ESI) m/z 415 [M-H]+.
E149 y-PhenoxySJ-dihydro-benzofcimioxaborinin-l-ol
Step 1. 2-Bromo-4-phenoxy-benzaldehyde
[0790] To a solution of 2-bromo-4-fluoro-benzaldehyde (10.0 g, 49.0 mmol) in DMF (60 niL) was added potassium carbonate (10.25 g, 73.8 mmol), followed by addition of phenol (4.6 g, 49.0 mmol). The resulting mixture was heated at 100 0C for 7 h. The reaction mixture was diluted with EtOAc and washed with water, brine, dried over Na2SO4, and concentrated under reduced pressure to give 2-bromo-4- phenoxy-benzaldehyde as an off white solid, which was used for the next step without further purification. 1U NMR (400 MHz, CDCl3) δ 10.25 (s, 1 H), 7.90 (d, J= 8.8 Hz, 1 H), 7.46 - 7.41 (m, 2 H), 7.25 (m, 1 H), 7.16 (d, J= 2.0 Hz, 1 H), 7.17 - 7.07 (m, 2 H), 6.98 (m, 1 H).
[0791] To a solution of (methoxymethyl)triphenylphosphonium chloride (1.05 g,
3.07 mmol) in DMSO (10 mL) was added potassium tert-butoxide (0.3 g, 2.7 mmol) and stirred at room temperature for 1 h. 2-Bromo-4-phenoxy-benzaldehyde in 10 mL of DMSO was added dropwise to the reaction mixture and stirred at room temperature overnight. The reaction mixture was quenched with saturated ammonium chloride, extracted with EtOAc, washed with water, brine, dried over Na2SO4, and concentrated under reduced pressure to give crude product, which was purified by column chromatography (silica gel, 5% yield EtOAc in hexane) to give 0.35 g of white solid, which was dissolved in 10 mL of THF and 2 mL of 6M HCl. The reaction mixture was heated to reflux for 6 h, extracted with EtOAc, washed with water, brine, dried over Na2SO4, and concentrated under reduced pressure to give (2-bromo-4-phenoxy- phenyl)-acetaldehyde (0.35 g, 66% yield) as a colorless oil. 1H NMR (400 MHz, CDCl3) δ 9.76 (t, J= 2.4 Hz, 1 H), 7.37 (t, J= 5.0, 7.2 Hz, 2 H), 7.25 (m, 2 H), 7.18 (s, 1 H), 7.02 (dd, J= 8.8, 1.2 Hz, 2 H), 6.95 (dd, J= 8.4, 2.4 Hz, 1 H), 3.8 (d, J= 1.6 Hz, 2 H).
Step 3. 2-(2-Bromo-4-phenoxy-phenyl)-ethanol
[0792] To a solution of (2-bromo-4-phenoxy-phenyl)-acetaldehyde (0.35 g, 1.20 mmol) in methanol (10 niL) was added sodium borohydride (0.055 g, 1.44 mmol) at 0 0C. The resulting mixture was stirred at rt for 1 h. The solvent was removed under reduced pressure, diluted with EtOAc and washed with water. The combined organic layer was dried over Na2SO4, and concentrated under reduced pressure to give 2-(2- bromo-4-phenoxy-phenyl)-ethanol which was used for the next step without further purification. 1H NMR (400 MHz, CDCl3) δ 1.31 (t, J= 6.38 Hz, 2 H), 7.20 (m, 2 H), 7.13 (d, J= 4.0 Hz, 1 H), 7.02 (dd, J= 8.4, 1.2 Hz, 2 H), 6.90 (dd, J= 8.0, 2.0 Hz, 1 H), 3.88 (q, J= 12.4, 6.8 Hz, 2 H), 3.00 (t, J= 6.6 Hz, 2 H).
Step 4. 2-Bromo-l-(2-methoxymethoxy-ethyl)-4-phenoxy-benzene
[0793] A solution of 2-(2-bromo-4-phenoxy-phenyl)-ethanol (0.32 g, 1.1 mmol) in DCM (15 mL) was cooled to 0 0C. Diisopropylethylamine (0.17 g, 1.32 mmol) and chloromethylmethyl ether (0.11 g, 1.32 mmol) were added. The reaction mixture was stirred at rt overnight. The reaction mixture was extracted with DCM and washed with water, brine, dried over Na2SO4, and concentrated under reduced pressure to give crude product, which was purified by biotage (5% EtOAc in hexane) to afford 2- bromo-l-(2-methoxymethoxy-ethyl)-4-phenoxy-benzene (0.2 g, 54.5% yield) as a white solid. 1U NMR (400 MHz, CDCl3) δ 7.35 (t, J= 8.0 Hz, 2H), 7.22 (d, J= 8.4 Hz, IH), 7.19 (d, J= 2.4 Hz, 1 H), 7.13 (t, J= 7.4 Hz, 1 H), 7.00 (dd, J= 8.8, 1.6 Hz, 2 H), 6.89 (dd, J= 8.8, 2.8 Hz, 1 H), 4.75 (s, 2 H), 3.76 (t, J= 7.0 Hz, 2 H), 3.30 (s, 3 H), 3.02 (t, J= 7.0 Hz, 2 H).
Step 5. 2- [2- (2-Methoxymethoxy-ethyl)-5-phenoxy-phenyl]-4, 4, 5, 5-tetramethyl- [1, 3, 2] dioxaborolane
[0794] To a solution of 2-bromo-l-(2-methoxymethoxy-ethyl)-4-phenoxy-benzene (0.19 g, 0.56 mmol) in 1,4-dioxane (10 niL) was added bis(pinacolato)diboron (0.29 g, 1.13 mmol), potassium acetate (0.22 g, 2.24 mmol), and [1,1 '- bis(diphenylphosphino)ferrocene]-palladium(II)chloride (0.02 g, 0.028 mmol). Nitrogen gas was passed through the mixture for 10 min and the suspension was heated at 80 0C overnight. The reaction mixture was extracted with EtOAc and washed with water, brine, dried over Na2SO4, and concentrated under reduced pressure to give crude product, which was purified by biotage (5-100% EtOAc in hexane) to afford 2-[2-(2-Methoxymethoxy-ethyl)-5-phenoxy-phenyl]-4,4,5,5- tetramethyl-[ 1,3, 2] dioxaborolane (0.18 g, 83% yield) as a white semi solid. 1H NMR (400 MHz, CDCl3) δ 7.48 (d, J= 2.8 Hz, IH), 7.29 (t, J= 8.0 Hz, 3 H), 7.20 (d, J = 8.0 Hz, 1 H), 7.04 (m, 1 H), 6.99 (dd, J= 8.0, 2.8 Hz, 1 H), 6.94 (d, J= 8.8 Hz, 1 H), 4.62 (s, 2 H), 3.70 (t, J= 7.2, Hz, 2 H), 3.30 (s, 3 H), 3.18 (t, J= 7.2 Hz, 2 H), 1.32 (s, 12 H).
Step 6. 7-Phenoxy-3 ,4-dihydro-benzo [c] [l,2]oxaborinin-l-ol
4,4,5,5-tetramethyl-[l,3,2]dioxaborolane (0.18 g, 0.468 mmol) in methanol (5 mL) was added 6N HCl (5 mL). The resulting mixture was refluxed overnight. The reaction mixture was extracted with DCM and washed with water, brine, dried over Na2SO4, and concentrated under reduced pressure to give crude product, which was purified by biotage (50% EtOAc in hexane) to afford 7-phenoxy-3,4-dihydro- benzo[c][l,2]oxaborinin-l-ol (0.045 g, 40% yield) as a white semi solid. 1H NMR (400 MHz, CDCl3) δ 7.39 (d, J= 2.8 Hz, 1 H), 7.35 (t, J= 7.4 Hz, 2 H), 7.18 (d, J = 8.0 Hz, 1 H), 7.09 (m, 2 H), 7.00 (d, J= 8.0 Hz, 2 H). MS (ESI) m/z = 239 [M - H]".
E150 3-(l-Amino-2-hvdroxyethyl)benzo[cl[l,21oxaborol-l(3H)-ol
[0796] To a solution of NaOH (4.8 g, 119.88 mmol) in 96 ml of water was added 2-formyl benzene boronic acid (15 g, 99.9 mmol) by stirring at rt for 10 min. To the reaction mixture, 2-nitromethane (10.92 g, 119.88 mmol) was added dropwise. The solution was stirred for another 30 min. The reaction mixture was cooled to 50C and 3N HCl (10 mL) was added dropwise until pH of 2 was attained. Then extracted with EtOAc, washed with water, dried, concentrated. Chromatography (hexane/EtOAc 1 : 1) to get the target molecule H g. 1U NMR (DMSO-J6, 300MHz) δ ppm 9.48 (s, IH), 7.69 (dd, J= 7.5 Hz, 0.8 Hz , 1 H), 7.54 (m, 2 H), 7.39 (d, J= 6.9 Hz, 1 H), 5.58 (d, J= 5.4 Hz, 1 H), 5.49 (br, IH), 5.02 (m, 1 H), 4.18 (d, J= 6 Hz, 1 H), and 4.04 (dd, J= 12, 3.6 Hz, 1 H). MS (ESI) m/z 222.1 [M-H]".
E151 4-Phenyl-3,4-dihydro-benzofclfl,2]oxaborinin-l-ol
Step 1. (2-Bromo-phenyl)-phenyl-acetaldehyde
[0797] To a solution of (methoxymethyl)triphenylphosphonium chloride (6.6 g, 19.15 mmol) in THF (40 mL) at 0 0C was added n-BuLi (12 mL, 19.15 mmol) dropwise, and stirred at room temperature for 20 min. (2-Bromo-phenyl)-phenyl- methanone in 7 mL of THF was added dropwise to the reaction mixture and stirred at room temperature for 1 h. The reaction mixture was quenched with water, extracted with ether, washed with brine, dried over Na2SO4, and concentrated under reduced pressure to give crude product, which was purified by biotage (1 :20 Ether : hexane) to give 1.5 g of colorless oil, which was dissolved in 4 mL of concentrated HCl. The reaction mixture was heated at 70 0C for 1 h, extracted with EtOAc, washed with
water, brine, dried over Na2SO4, and concentrated under reduced pressure to give (2- bromo-phenyl)-phenyl-acetaldehyde (1.0 g, 94% yield) as a colorless oil. 1H NMR (400 MHz, CDCl3) δ 9.98 (s, IH), 7.64 (dd, J= 8.4, 1.6 Hz, 1 H), 7.40 - 7.28 (m, 5 H), 7.24 - 7.11 (m, 3 H), 5.46 (s, 1 H).
Step 2. 2-(2-Bromo-phenyl)-2-phenyl-ethanol
[0798] To a solution of (2-bromo-phenyl)-phenyl-acetaldehyde (1.0 g, 3.6 mmol) in methanol (20 rnL) was added sodium borohydride (0.165 g, 4.4 mmol) at 0 0C. The resulting mixture was stirred at rt for 1 h. The solvent was removed under reduced pressure, diluted with EtOAc and washed with water. The combined organic layer was dried over Na2SO4, and concentrated under reduced pressure to give 2-(2-bromo- phenyl)-2-phenyl-ethanol (1.0 g, quantitative) which was used for the next step without further purification. 1H NMR (400 MHz, CDCl3) δ 7.58 (dd, J= 8.0, 1.2 Hz, 1 H), 7.34 - 7.20 (m, 7 H), 7.12 (m, 1 H), 4.70 (t, J= 7.0 Hz, 1 H), 4.17 (d, J= 6.8 Hz, 2 H).
Step 3. 1 -Bromo-2-(2-methoxymethoxy-l -phenyl- ethyl) -benzene
[0799] To a solution of 2-(2-bromo-phenyl)-2-phenyl-ethanol (1.0 g, 3.6 mmol) in DCM (20 mL) was cooled to 0 0C. Diisopropylethylamine (0.56 g, 4.33 mmol) and chloromethylmethyl ether (0.35 g, 4.33 mmol) was added. The reaction mixture was stirred at rt overnight. The reaction mixture was extracted with DCM and washed with water, brine, dried over Na2SO4, and concentrated under reduced pressure to give crude product, which was purified by biotage (20% EtOAc in hexane) to afford 1- bromo-2-(2-methoxymethoxy-l-phenyl-ethyl)-benzene (0.54 g, 47% yield) as a colorless oil. 1H NMR (400 MHz, CDCl3) δ 7.55 (d, J= 8.0 Hz, 1 H), 7.31 - 7.19 (m, 7 H), 7.10 - 7.06 (m, 1 H), 4.82 (t, J= 7.4 Hz, 1 H), 4.62 (s, 2 H), 4.11 - 4.01 (m, 2 H), 3.25 (s, 3 H).
Step 4. 2-[ 2 -(2 -M ethoxymethoxy-1 -phenyl- ethyl) -phenyl] -4,4,5, 5-tetramethyl- [1, 3, 2] dioxaborolane
[0800] 1 -Bromo-2-(2-methoxymethoxy- 1 -phenyl-ethyl)-benzene (0.54 g, 1.68 mmol) in 1,4-dioxane (15 niL) was degassed for 30 min under nitrogen gas. Bis(pinacolato)diboron (0.85 g, 3.36 mmol), potassium acetate (0.66 g, 6.72 mmol), and [l,r-bis(diphenylphosphino)ferrocene]palladium(II)chloride (0.062 g, 0.084 mmol) were added. The reaction mixture was heated at 80 0C overnight. The reaction mixture was extracted with EtOAc and washed with water, brine, dried over Na2SO4, and concentrated under reduced pressure to give crude product, which was purified by biotage (5-20% EtOAc in hexane) to afford 2-[2-(2-Methoxymethoxy-l- phenyl-ethyl)-phenyl]-4,4,5,5-tetramethyl-[l,3,2]dioxaborolane (0.32 g, 52% yield) as a white solid. 1H NMR (400 MHz, CDCl3) δ 1.11 (d, J= 8.0Hz, 1 H), 7.65 (d, J = 7.6 Hz, 1 H), 7.41 - 7.13 (m, 7 H), 5.28 (t, J = 7.2 Hz, 1 H), 4.70 (s, 2 H), 3.86 (d, J = 6.8 Hz, 2 H), 3.34 (s, 3 H), 1.31 (s, 12 H).
Step 5. 4-Phenyl-3,4-dihydro-benzo[c] [l,2]oxaborinin-l-ol
[0801] To a solution of 2-[2-(2-methoxymethoxy-l-phenyl-ethyl)-phenyl]-4,4,5,5- tetramethyl-[ 1,3, 2] dioxaborolane (0.32 g, 0.87 mmol) in methanol (10 mL) was added 6N HCl (5 mL). The resulting mixture was refluxed overnight. The reaction mixture was extracted with DCM and washed with water, brine, dried over Na2SO4, and concentrated under reduced pressure to give crude product, which was purified by preparative HPLC (to afford 4-phenyl-3,4-dihydro-benzo[c][l,2]oxaborinin-l-ol (0.025 g, 13% yield) as an off white solid, mp 83 - 85 0C. 1H NMR (400 MHz, CDCl3) δ 7.78 (d, J = 7.6 Hz, 2 H), 7.62 (dd, J = 7.6, 1.2 Hz, 2 H), 7.42 - 7.39 (m, 2
H), 7.35 - 7.31 (m, 3 H), 4.22 (s, 1 H), 4.20 - 4.10 (m, 3H). MS (ESI) m/z = 223 [M - H]-.
E152 2-Nitromethyl-7,8-dihvdro-2H-l,6,9-trioxa-9a-bora-benzotcdlazulene
[0802] To a solution of NaOH (0.027 g, 0.683 mmol) in water (1.35 niL) was added nitromethane (0.104 g, 1.71 mmol) at 5-10 0C. After stirring at for 5 min at 5- 10 0C, ACTBr (0.0124 g, 0.034 mmol) was added to the reaction mixture and followed by the addition of 3-[2-(tetrahydro-pyran-2-yloxy)-ethoxy]-2-(4,4,5,5- tetramethyl-[l,3,2]dioxaborolan-2-yl)-benzaldehyde (0.257 g, 0.683 mmol) at 5-10 0C. The reaction mixture was stirred at 15 0C for 5 h. The reaction mixture was acidified to pH 1 using diluted hydrochloric acid and stirred at room temperature overnight. The reaction mixture was diluted with EtOAc, washed with brine, dried and concentrated to dryness. The residue was purified by recrystalized from EtOAc/hexanes to give 0.062 g of product as white solid. Mp 115-118 0C. 1HNMR (400 MHz, DMSO-de) δ 1 Al (dd, J= 8.0 Hz, 8.4 Hz, 1 H), 7.13 (d, J= 8.0 Hz, 1 H), 6.89 (d, J= 8.4 Hz, 1 H), 5.89 (br. m, 1 H), 5.33 (br. m, 1 H), 4.67-4.61 (m, 2 H), 4.34-4.30 (m, 2 H), 4.18 (br. m, 1 H). CaIc. for Ci0Hi0BNO5: C 51.11% yield, H 4.29% yield, N 5.96% yield; Found: C 51.00% yield, H 4.36% yield, N 5.99% yield.
E153 6-Benzyl-3H-benzofcloxaborol-l-ol
[0803] A mixture of benzylboronic acid (2.15 g, 10 mmol), 4-bromo-2-methoxy- benzaldehyde (2.44 g, 18 mmol), Pd(dppf)Cl2 (1.46 g , 2 mmol), CsF (3.02 g, 20 mmol) and K2CO3 (4.14 g, 30 mmol) in dioxane (30 mL) was degassed for 10 min and heated at 80 0C for 16 h, cooled to RT, diluted with EtOAc, filtered through a pad of Celite and concentrated. The residue was purified by chromatography to give A-
benzyl-2-methoxy-benzaldehyde (2.24 g, 100% yield). 1HNMR (400MHz, CDCl3) δ 10.40 (s, 1 H), 7.77 (d, J= 8.2 Hz, 1 H), 7.30 - 7.10 (m, 5 H), 6.85 (d, J= 8.2 Hz, 1 H), 6.77 (s, 1 H), 4.03 (s, 2 H), 3.85 (s, 3 H).
Step 2. 4-Benzyl-2-hydroxy-benzaldehyde
[0804] A mixture of 4-benzyl-2-methoxy-benzaldehyde (1.14 g, 5 mmol), CeCl3 (1.85 g, 7.5 mmol) and NaI (1.13 g, 7.5 mmol) in CH3CN (20 mL) was refluxed for 18 h, diluted with EtOAc, washed with aqueous Na2S2O4, dried and concentrated to give 4-benzyl-2-hydroxy-benzaldehyde (1.10 g, 100% yield). 1HNMR (400MHz, CDCl3) δ 11.00 (s, 1 H), 9.80 (s, 1 H), 7.47 (d, J= 8.1 Hz, 1 H), 7.30 - 7.10 (m, 5 H), 6.82 (m, 2 H), 3.98 (s, 2 H).
Step 3. Trifluoro-methanesulfonic acid 5-benzyl-2-formyl-phenyl ester
[0805] To a cooled (-78 0C) solution of 4-benzyl-2-hydroxy-benzaldehyde (0.44 g, 2.08 mmol) in dichloromethane (10 mL) was added Et3N (0.68 mL, 6.24 mmol) and then Tf2O (0.40 mL, 3.12 mmol). The mixture was stirred at -78 0C for 30 min, quenched with H2O (2 mL), diluted with dichloromethane (50 mL), washed with 1 N HCl (20 mL), dried and concentrated to give trifluoro-methanesulfonic acid 5-benzyl- 2-formyl-phenyl ester (0.68 g, 100% yield). 1HNMR (400MHz, CDCl3) δ 10.20 (s, 1 H), 7.90 (d, J= 7.7 Hz, 1 H), 7.40 - 7.00 (m, 7 H), 4.00 (s, 2 H).
Step 4. 4-Benzyl-2-(4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2-yl)benzaldehyde
[0806] A mixture of trifluoro-methanesulfonic acid 5-benzyl-2-formyl-phenyl ester (0.68 g, 2.08 mmol), bis(pinocolato)diborane (0.80 g, 3.12 mmol), Pd(dppf)Cl2 (0.31 g, 0.42 mmol) and KOAc (0.61 g, 6.24 mmol) in dioxane (15 mL) was heated at 80 0C for 16 h, cooled to RT, diluted with EtOAc, filtered through a pad of Celite and
concentrated. The residue was purified by chromatography to give 4-benzyl-2- (4,4,5,5-tetramethyl-[l,3,2]dioxaborolan-2-yl)benzaldehyde (0.61 g, 90% yield). 1HNMR (400MHz, CDCl3) δ 10.50 (s, 1 H), 7.90 (d, J= 8.2 Hz, 1 H), 7.70 (s, 1 H), 7.40 - 7.10 (m, 6 H), 4.02 (s, 2 H), 1.40 (s, 12 H).
Step 5. 6-Benzyl-3H-benzo[c]oxaborol-l-ol
[0807] To a cooled (0 0C) solution of 4-benzyl-2-(4,4,5,5-tetramethyl- [l,3,2]dioxaborolan-2-yl)benzaldehyde (0.61 g, 1.89 mmol) in MeOH (10 rnL) and THF (10 rnL) was added NaBH4 (0.16 g, 4.17 mmol) in portions. After the addition was over, the mixture was stirred at 0 0C for 30 min, quenched with 6 N HCl (0.5 mL) and diluted with H2O (20 mL). The mixture was stirred at RT for 1 h. The solid formed was collected, washed with H2O (10 mL) and dried under high vacuum to give 6-benzyl-3H-benzo[c]oxaborol-l-ol (290 mg, 68% yield). Mp 173 -175°C. 1HNMR (DMSO-J6, 400MHz) δ 9.10 (s, 1 H), 7.58 (s, 1 H), 7.40 - 7.10 (m, 7 H), 4.92 (s, 2 H), 3.97 (s, 2 H). MS (ESI) m/z = 223 [M-H]".
EXAMPLE 2
Testing Of Compounds For The Biochemical and Micriobial Inhibition Ofβ- Lactamases
[0808] All β-lactamases were tested as essentially described by Payne et al. , J. Antimicrob. Chemother., 1991; 28: 775-776) with a few modifications. The buffer was 50 mM potassium phosphate pH 7 with 0.2% Triton x-100, and the concentration of nitrocefin was 500 μM for class A β-lactamases and 200 μM for class C β-lactamases. Kinetic data is collected by measuring the rate of change in A4S6 over 30 minutes. The fraction of enzyme inhibited is determined by dividing the reaction rates in the presence of inhibitor by the reaction rate determined in the absence of inhibitor. Dose-response curves are then generated by plotting log [inhibitor] vs. fraction inhibited. IC50 values were determined from the dose-response curves by determining the inhibitor concentration required to reduce the maximum inhibitory activity of the compound by
50%. The Ki values were calculated from the IC50 using the K1n for nitrocefm for each
enzyme and the following equation 1 + Α Km .
[0809] AmpC P99 was purchased from Sigma-Aldrich #P4399, TEM- 1 was purchased from Invitrogen #PV3575, and CTX-M-9 was obtained from Professor Brian Shoichet of the University of California-San Francisco (Yu Chen, Brian
Shoichet, and Richard Bonnet, J. Am. Chem. Soc, 2005, 127 (15): pp 5423-5434).
[0810] CMY-2 was synthesized by GenScript and subcloned into pET24b at the Ndel/Sall sites. The DNA sequence of the insert is SEQ ID NO: 25 and is as follows, CATATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACA
TTT
GCTGCCGCAAAAACAGAACAACAGATTGCCGATATCGTTAATCGCACCATCACCCCG
TTG
ATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCC TAT
TATTTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACG
CTG
TTTGAGCTAGGATCGGTTAGTAAGACGTTTAACGGCGTGTTGGGCGGCGATGCTATC
GCC CGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGC
AAA
CAGTGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCG
CTG
CAGATCCCCGATGACGTTAGGGATAAAGCCGCATTACTGCATTTTTATCAAAACTGG CAG
CCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTT
GGC
GCGCTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTC
CTG CAACCATTAAAACTGGCGCATACCTGGATTACGGTTCCGCAGAACGAACAAAAAGAT
TAT
GCCTGGGGCTATCGCGAAGGGAAGCCCGTACACGTTTCTCCGGGACAACTTGACGCC
GAA
GCCTATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATG GAT
GCCAGCCACGTTCAGGAGAAAACGCTCCAGCAGGGCATTGCGCTTGCGCAGTCTCGC
TAC
TGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTG
AAA GCTGATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCC
GTT
GAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCCTCATGGGTGCATAAAACGGGCTCC
ACT
GGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATG CTG
GCAAACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAA AAG CTGCAATAAGTCGAC
[0811] KPC-2 was synthesized by GenScript and subcloned into pET24b at the Ndel/Sall sites. The DNA sequence of the insert is SEQ ID NO: 26 and is as follows,
CATATGTCACTGTATCGCCGTCTAGTTCTGCTGTCTTGTCTCTCATGGCCGCTGGCT GGC
TTTTCTGCCACCGCGCTGACCAACCTCGTCGCGGAACCATTCGCTAAACTCGAACAG
GAC
TTTGGCGGCTCCATCGGTGTGTACGCGATGGATACCGGCTCAGGCGCAACTGTAAGT
TAC CGCGCTGAGGAGCGCTTCCCACTGTGCAGCTCATTCAAGGGCTTTCTTGCTGCCGCT
GTG
CTGGCTCGCAGCCAGCAGCAGGCCGGCTTGCTGGACACACCCATCCGTTACGGCAAA
AAT
GCGCTGGTTCCGTGGTCACCCATCTCGGAAAAATATCTGACAACAGGCATGACGGTG GCG
GAGCTGTCCGCGGCCGCCGTGCAATACAGTGATAACGCCGCCGCCAATTTGTTGCTG
AAG
GAGTTGGGCGGCCCGGCCGGGCTGACGGCCTTCATGCGCTCTATCGGCGATACCACG
TTC CGTCTGGACCGCTGGGAGCTGGAGCTGAACTCCGCCATCCCAGGCGATGCGCGCGAT
ACC
TCATCGCCGCGCGCCGTGACGGAAAGCTTACAAAAACTGACACTGGGCTCTGCACTG
GCT
GCGCCGCAGCGGCAGCAGTTTGTTGATTGGCTAAAGGGAAACACGACCGGCAACCAC CGC
ATCCGCGCGGCGGTGCCGGCAGACTGGGCAGTCGGAGACAAAACCGGAACCTGCGGA
GTG
TATGGCACGGCAAATGACTATGCCGTCGTCTGGCCCACTGGGCGCGCACCTATTGTG
TTG GCCGTCTACACCCGGGCGCCTAACAAGGATGACAAGCACAGCGAGGCCGTCATCGCC
GCT
GCGGCTAGACTCGCGCTCGAGGGATTGGGCGTCAACGGGCAGTAAGTCGAC
[0812] TEM-64 was synthesized by GenScript and subcloned into pET24b at the Nde Il Xho I sites. The DNA sequence of the insert is SEQ ID NO: 27 and is as follows,
CATATGAGTATTCAACATTTCCGTGTCGCCCTTATTCCGTTTTTTGCGGCATTTTGC CTTCCTGTTTTTGCTCACC
CAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTT ACATCGAACTGGATCTCAA CAGCGGTAAGATCCTTGAGAGTTTTCGCCCGGAAGAACGTTTTCCAATGATGAGCAC TTTTAAAGTTCTGCTGTGT
GGCGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATTCAC
TATTCTCAGAATGACTTGG
TTAAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTACGCGAAT
TATGCAGTGCTGCCATTAC CATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGCGGCCCGAAGGA
GCTGACCGCTTTTTTGCAC
AACATGGGGGATCATGTAACTCGCCTTGATAGCTGGGAACCGGAGCTGAATGAAGCC
ATTCCAAACGACGAGCGTG
ACACCACGACCCCTGCAGCAATGGCAACAACGTTGCGCAAACTGTTAACTGGCGAAC TGCTTACTCTGGCTTCCCG
GCAACAATTAATTGACTGGATGGAGGCGGATAAAGTTGCAGGCCCACTTCTGCGCTC
GGCCCTTCCGGCTGGCTGG
TTTATTGCTGATAAATCTGGCGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCA
CTGGGGCCAGATGGTAAGC CGTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAA
ATCGCCAGATCGCTGAGAT
TGGTGCCTCACTGATTAAGCATTGGCTCGAG
[0813] SHV- 18 was synthesized by GenScript with the CMY-2 leader sequence and subcloned into pET24b at the Nde I/ Xho I sites. The DNA sequence of the insert is SEQ ID NO: 28 and is as follows,
CATATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACA TTTGCTGCCAGCCCGCAGCCGCTTGAGCAAATTAAACTAAGCGAAAGCCAGCTGTCG GGCAGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGG CGCGCCGATGAACGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCA GTGCTGGCGCGGGTGGATGCCGGTGACGAACAGCTGGAGCGAAAGATCCACTATCGC CAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACACCTTGCCGACGGCATG ACGGTCGGCGAACTCTGTGCCGCCGCCATTACCATGAGCGATAACAGCGCCGCCAAT CTGCTGCTGGCCACCGTCGGCGGCCCCGCAGGATTGACTGCCTTTTTGCGCCAGATC GGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCC GGCGACGCCCGCGACACCACTACCCCGGCCAGCATGGCCGCGACCCTGCGCAAGCTG CTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTG GACGATCGGGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATC GCCGATAAGACCGGAGCTGCCAAACGGGGTGCGCGCGGGATTGTCGCCCTGCTTGGC CCGAATAACAAAGCAGAGCGGATTGTGGTGATTTATCTGCGGGATACGCCGGCGAGC ATGGCCGAGCGAAATCAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGG CAACGCTAACTCGAG
[0814] KPC-2, TEM-64, CMY-2, SHV-18 were over-expressed as essentially described for CTX-M-9 (Structure, Function, and Inhibition along the Reaction Coordinate of CTX-M β-Lactamases, Yu Chen, Brian Shoichet, and Richard Bonnet,
J. Am. Chem. Soc, 2005, 127 (15), pp 5423-5434). Since β-lactamases are exported to the periplasm we obtained these enzymes by treating the cells with an osmotic shock. Cells were harvested by centrifugation at 4000 x g for 20 minutes, the supernatant was discarded and the pellet was resuspended in 30 mM Tris-HCl, 20% sucrose, pH 8 .0 (80 ml for each gram of cells wet weight) . Then EDTA was added to
I mM and the cells were incubated for 5-10 minutes at room temperature with shaking. The cells were then centrifuged at 8000 x g for 20 minutes at 4°C, the supernatant was removed, and the pellet resuspended in ice-cold 5 mM MgSO4 (80 ml for each gram of cells wet weight). The cells were incubated on ice for 10 minutes and then centrifuged at 8000 x g for 20 minutes at 4°C. The supernatant was removed and dialyzed overnight at 4C against 10 mM potassium phosphate pH 6.8, 50% glycerol. These partially purified enzyme preparations were used in for IC50 determination.
[0815] The bacterial activity of our BLIs were screened by measuring the MIC of a β-lactam antibiotic in the presence of 4 μg/mL BLI using the Clinical and Laboratory Standards Institute's microbroth dilution method in cation-adjusted Mueller-Hinton Broth (Methods for dilution Antimicrobial susceptibility tests for bacteria that grow aerobically M7-A7).
[0816] To test the synergistic activity, compounds were tested in a modified M7- A7 microbroth method, called a 2-D checkerboard assay. In a 96 well plate, lanes 1-
I 1 contain 2-fold serial dilutions of the test compound usually starting at a concentration 64 μg/mL, while lanes A-G contain 2-fold serial dilutions of β-lactam antibiotic usually starting at a concentration 16 μg/mL. Lane 12 contains no test compound and lane H contains no β-lactam, therefore the dynamic range of the synergistic activity of the test compound can be tested in the presence of the β-lactam.
[0817] In vitro testing results for exemplary compounds of the invention are provided in FIG. 2.
EXAMPLE 3
Assay for determining that a compound inhibits the editing domain oftRNΛ synthetase in a bacteria
[0818] This example sets forth a representative assay for determining whether a particular compound inhibits the editing domain of an ARS in a bacterium.
[0819] The [3H]-isoleucine mischarged tRNAleu was synthesized by incubating 1 μM of Saccharomyces cerevisiae editing defective CdcβOp (C326F) in 500 μL of 5OmM Tris-HCl (pH 8.0), 6OmM MgCl2, 4mM ATP, ImM DTT, 0.02% (w/v) BSA, 4mg/mL crude E.coli tRNA tRNA (Roche), 0.ImM isoleucine and 5 mCi L-[4,5- 3H]isoleucine (lOOCi/mmole, GE Healthcare) and 20% (v/v) DMSO for 1 hour at 300C. The reaction was stopped by adding 10 μL of 10% (v/v) acetic acid followed by two acidic phenol (Sigma) extractions. The mischarged tRNA in the top aqueous phase was removed and precipitated by adding two volumes of 96% (v/v) ethanol and incubating at -200C for 30 minutes. The precipitate was pelleted by centrifugation at 13,200 xg for 30 minutes and the mischarged tRNA pellet was washed twice with 70% (v/v) ethanol and then resuspended in 50 mM potassium phosphate buffer pH 5.2.
[0820] The reaction was terminated after 2 hours incubation at 300C by the addition of acetic acid to 0.17 % (v/v). The isoleucylated crude tRNALeu was purified by extracting twice with acidic phenol-chloroform extractions (pH 4.3), followed by ethanol precipitation. The tRNA pellet was washed twice with 70% ethanol, dried and then resuspended in 50 mM potasium phosphate (pH 5.0) and stored at -200C. An aliquot was precipitated with 10% (w/v) TCA to quantify ile-tRNALeu.
[0821] Post-transfer editing hydrolysis assays were carried out at 300C in 50 mM Hepes (pH 8), 10 mM MgCl2, 3OmM KCl, with 3H-isoleucine-tRNA crude (-0.3 μCi/mL). Each reaction was initiated by addition of the 150 nM enzyme. At each time point three 20 μL aliquots of the reaction mixture was added to 200 μL of 10% (w/v) TCA in a Millipore filter plate and precipitated for 20 minutes at 4°C. The precipitate was filtered and washed three times with 200 μL of 5% (w/v) TCA, then dried and 20 μL Supermix scintillation cocktail was added. The Millipore filter plates were counted in the MicroBeta Trilux. The IC50 was determined by the amount of
inhibitor that inhibited 50% activity, 100% post-transfer editing was calculated by taking the activity of the no enzyme control from the wild-type enzyme activity.
[0822] Compare the minimal inhibitory concentration (MIC) of a tolC Escherichia coli strain bearing a pUC derived plasmid with and without an leuS gene insert. [0823] If the MIC of the strain bearing the extra copies of leuS is greater than 2-fold more than the control strain then pour LB agar plates with four times the concentration of the MIC of the compound.
[0824] Plate 1 x 1010 E. coli on ten plates containing 4 x MIC of the compound. Incubate for 1-2 days at 37°C and pick ten colonies and restreak on 4 x MIC LB agar plates to confirm resistance.
[0825] Take one large colony from each of the ten E. coli resistant mutants and resuspend in 50 μL of PCR buffer.
[0826] Amplify the editing domain of CDC60 using a proof-reading PCR enzyme and the following primers, SEQ ID NO: 29, ggcaccgtggacgtacgacaacatcgc and SEQ ID NO: 30, gggaaacaccccagtcgcgcaggcgg.
[0827] Purify the 980 bp PCR product using either Qiagen or Promega PCR cleanup kits.
[0828] Sequence amplify the mutant DNA and compared it to wild-type. If the mutant DNA bears mutations in the editing domain the inhibitor affects leucyl-tRNA synthetase via the editing domain.
[0829] In vitro testing results for exemplary compounds of the invention are provided in FIG. 3.
EXAMPLE 2
Antibacterial MIC Testing [0830] All MIC testing of bacteria followed the Clinical and Laboratory Standards Institute (CLSI) guidelines for antimicrobial testing of aerobic bacteria (Methods for Dilution Antimicrobial Susceptibility Tests for Bacteria That Grow Aerobically; Approved Standard - Seventh Edition)(M07-A7) and anaerobic bacteria (Methods for Antimicrobial Susceptibility Testing of Anaerobic Bacteria; Approved Standard -
Seventh Edition) (Ml 1-A7). MIC data for exemplary compounds of the invention are provided in FIG. 2 and FIG. 3.
EXAMPLE 3
Anti-Inflammatory in vitro assays [0831] The ability of the compounds described herein to inhibit pro-inflammatory cytokines or phosphodiesterases can be tested.
Cytokine assay
[0832] Frozen human peripheral blood mononucleocytes (PBMC) were thawed and centrifuged. Cryopreservation media is aspirated off of the cell pellet, and the cells are resuspended in fresh culture media (CM) comprising RPMI 1640 and 10% FBS in 96 well plates. A compound described herein is dissolved in DMSO to form a 10 mM sample (DMSO, 100%). The 10 mM samples are diluted to 100 μM in CM (DMSO, 1%), then further diluted to 10, 1, 0.1, 0.01 μM in 200 μL of CM (n = 3). Inducer (1 μg/mL LPS for TNF-α and IL- lβ [and IL-6] or 20 ug/mL PHA for IFNγ, IL-2, IL-4, IL-5 and IL-10. IL-23 is induced with 100 ng/ml IFN-g + 1 mg/ml LPS, using THP-I cells. Vehicle (1% DMSO) is used as a control for this experiment. Vehicle without inducer are used as a negative control. Cells are incubated at 37 0C, 5% CO2. Supernatants are extracted at 24 hours (for TNF-α, IL-I β, IL-2, IL-6 and IFNγ) and 48 hours (for IL-4, IL-5, IL-IO and IL-23), and stored at -20 0C. Supernatants are thawed and assayed for cytokine expression using the fluorochrome- labeled cytokine-specifϊc beads and a BD FAC S Array™. IL-23 is assayed using a commercial ELISA kit (R&D Systems).
PDE Isoform profiling
[0833] Recombinant human phosphodiesterase (PDE) enzymes are expressed in a baculoviral system. The assay is a modification of the 2-step method of Thompson & Appleman (Biochem. 10:311-316, 1971), which is adapted for 96-well plate format. Stock solutions are prepared at 40 mM in 100% DMSO. Final [DMSO] was 5%. A compound described herein is tested by performing 1 in 4 serial dilutions at starting concentration of 100 mM. Each concentration is tested in duplicate. IC50s are generated from 11 -point curves and analyzed using Prism software (GraphPad Inc.). PDE isoforms tested include PDE1A3 (cAMP), PDE1A3 (cGMP), PDE2A3,
PDE3Cat, PDE4Cat, PDE4A4, PDE4B2, PDE4C2, PDE4D3, PDE5Cat, PDE6AB, PDE7A1, PDE8A1, PDE9A1, PDElOAl (cAMP), PDElOAl (cGMP), PDEI lAl (cAMP) and PDEl IAl (cGMP).
PDE4 assay [0834] PDE4 partially purified from human U-937 myeloid leukemia cells is used. A compound described herein and/or vehicle is incubated with 0.2 mg enzyme and 1 mM cAMP containing 0.01 mM [3H]cAMP in Tris buffer pH 7.5 for 20 minutes at 25 0C. The reaction is terminated by boiling for 2 minutes and the resulting AMP is converted to adenosine by addition of 10 mg/ml snake venom nucleotidase and further incubation at 37 0C for 10 minutes. Unhydrolyzed cAMP is bound to AG1-X2 resin, and remaining [3H]Adenosine in the aqueous phase is quantitated by scintillation counting. A compound described herein is tested at 10, 3, 1, 0.3, 0.1, 0.03, 0.01, 0.003, and 0.001 μM for IC50 determination.
EXAMPLE 4 Anti-Inflammatory in vivo assays
1. In vivo anti-inflammation activity in phorbol ester induced mouse ear edema model
[0835] Phorbol 12-myristate 13-acetate (PMA, 5 μg in 20 μL of acetone) is applied topically to the anterior and posterior surfaces of the right ear to eight groups of CD-I (CrI.) derived male mice of 5 each (weighing 22 ± 2 g). A compound described herein and vehicle (acetone :ethano 1/1 : 1 , 20 μL/ear) are each applied to both ears topically 30 minutes before and 15 minutes after PMA challenge. Dexamethasone (1 mg/ear x 2) is used as the positive control was administered topically to test animals using the same application schedule. Ear swelling is then measured by a Dyer model micrometer gauge at 6 hours after PMA application as an index of inflammation.
Percent inhibition is calculated according to the formula: [(Ic - It)/Ic] x 100%, where Ic and It refer to increase of ear thickness (mm) in control and treated mice, respectively. Percent inhibition of 30 percent or more in ear swelling is considered significant anti-inflammatory activity. 2. In vivo anti-inflammation activity in oxazolone induced mouse ear edema model [0836] Groups of 5 BALB/c male mice weighing 23 ± 2 g were used. The preshaved abdomens of test animals are sensitized by application of 100 μL of 1.5%
oxazolone solution dissolved in acetone. Seven days after the initial sensitization, compound described herein, as well as vehicle (acetone:ethanol/l :l, 20 μL/ear) are each administered topically to the anterior and posterior surfaces of the right ear 30 minutes before, and 15 minutes after, challenge by a second application of oxazolone (1% in acetone, 20 ml/ear) via topical route. As a positive control, indomethacin (0.3 mg/ear x 2) is administered topically using the same treatment regime as for the test compounds. Twenty-four hours after the second application of oxazolone, the ear thickness of each mouse is measured with a Dyer model micrometer gauge. A 30 percent or more inhibition in ear swelling relative to the vehicle control is considered significant and indicated possible anti-inflammatory activity.
[0837] It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.
Claims
1. A compound having a structure according to the formula:
wherein A is a member selected from cycloalkyl, heterocycloalkyl, aryl and heteroaryl; Y is a member selected from O and -S(O)2NH- wherein the sulfur In-S(O)2NH- is covalently attached to A; R is a member selected from H, cyano and substituted alkyl; Ra is a member selected from H, -OR10, -NR10R11, -SR10, -S(O)R10, -S(O)2R10, -S(O)2NR10R11, -C(O)R10, -C(O)OR10, -C(O)NR10R11, nitro, cyano, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl wherein each R10 and each R11 is a member independently selected from H, nitro, halogen, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl with the proviso that R10 and R11, together with the nitrogen to which they are attached, are optionally combined to form a 5- to 7- membered substituted or unsubstituted heterocycloalkyl ring; with the proviso that when Y is O, R is a member selected from cyano and substituted alkyl; with the proviso that when Y is -S(O)2NH-, R3 is H, and Ra is not H or unsubstituted alkyl or halosubstituted alkyl and salts thereof.
2. The compound of claim 1, having a structure according to the formula:
3. The compound of claim 2, having a structure which is a member selected from:
4. The compound of claim 3, wherein Ra is a member selected from H, F, Cl, -OR10a and -C(O)OR10b, wherein R , 10aa is alkyl, optionally substituted with a member selected from NH2 and phenyl wherein R10b is unsubstituted alkyl.
5. The compound of claim 3, wherein Ra is -O(CH2)nNH2, wherein n is an integer selected from 1 to 6.
6. The compound of claim 5, wherein n is 2 or 3 or 4.
7. The compound of claim 2, having a structure according to the formula:
8. The compound of claim 7, wherein m is 1 or 2 or 3.
9. The compound of claim 7, having a structure according to the formula:
10. The compound of claim 9, wherein R 20 is H.
11. The compound of claim 9, wherein R , 20 is Ci or C2 Or C3 unsubstituted alkyl.
12. The compound of claim 2, wherein R is -CH2COOH or -CH2COOCH3 or -CH2COOCH2CH3.
13. The compound of claim 9, having a structure according to the formula:
14. The compound of claim 1, having a structure according to the formula:
15. The compound of claim 14, wherein C* is a stereocenter which has a (R) configuration.
16. The compound of claim 14, having a structure according to the formula:
17. The compound of claim 16, wherein R 20 is H.
18. The compound of claim 16, having a structure according to the formula:
19. The compound of claim 18, which is:
20. The compound of claim 1, having a structure according to the formula:
21. The compound of claim 20, wherein A is a member selected from phenyl, pyridinyl, furanyl, thiophenyl, pyrazolyl, imidazolyl, thiazolyl, triazolyl, and piperidinyl.
22. The compound of claim 20, wherein Ra is a member selected from cyano, nitro, aminoalkyl, hydroxyalkyl, -C(O)(CH2)miCH3, -COOH, -C(O)O(CH2)mlCH3, -O(CH2)mlCH3, -O(CH2)mlCF3, -O(CH2)mlCHF2, -OH, -NH2, -NHCH3, -NHC(O)H, -NHC(O)(CH2)miCH3, -NHOH, -NHS(O)2NH2, -NH2S(O)2CH3, -S(O)2CH3, wherein ml is an integer which is a member selected from 0 to 3.
23. The compound of claim 21, having a structure according to the formula:
24. The compound of claim 23, having a structure according to the formula:
25. The compound of claim 24, wherein Ra is a member selected from OH and NH2.
26. A combination comprising: a) a compound of claim 1, or a pharmaceutically acceptable salt thereof; and b) a therapeutically active agent.
27. The combination of claim 26, wherein said therapeutically active agent is an antibiotic which comprises a β-lactam moiety.
28. A pharmaceutical formulation comprising: a) a compound of claim 1 or a combination of claim 26, or a pharmaceutically acceptable salt thereof; and b) a pharmaceutically acceptable excipient.
29. The pharmaceutical formulation of claim 28, wherein said formulation is a unit dosage form.
30. The pharmaceutical formulation of claim 29, wherein said formulation is a member selected from an oral unit dosage form and a topical unit dosage form.
31. A method of treating a bacterial infection comprising: administering to an animal suffering from said infection an effective amount of a compound of claim 1, or a pharmaceutically-acceptable salt thereof, and an effective amount of an antibiotic, or a pharmaceutically acceptable salt thereof, wherein said antibiotic comprises a β-lactam moiety, thereby treating the bacterial infection.
32. The method of claim 31, wherein a bacteria involved with said infection is resistant to said antibiotic.
33. The method of claim 31, wherein the antibiotic is a member selected from a penicillin, cephalosporin, monobactam, carbapenem and derivatives thereof.
34. The method of claim 33, wherein the antibiotic is a penicillin or derivatives thereof.
35. The method of claim 34, wherein said penicillin is a member selected from narrow spectrum penicillins, narrow spectrum penicillinase-resistant penicillins, narrow spectrum β-lactamase-resistant penicillins, moderate spectrum penicillins, broad spectrum penicillins and extended spectrum penicillins.
36. The method of claim 35, wherein said penicillin is a narrow spectrum penicillin which is a member selected from benzathine penicillin, benzylpenicillin (penicillin G), phenoxymethylpenicillin (penicillin V) and procaine penicillin.
37. The method of claim 35, wherein said penicillin is a narrow spectrum penicillinase-resistant penicillins which is a member selected from methicillin, dicloxacillin and flucloxacillin.
38. The method of claim 35, wherein said penicillin is a narrow spectrum β-lactamase-resistant penicillin which is temocillin.
39. The method of claim 35, wherein said penicillin is a moderate spectrum penicillin which is a member selected from amoxicillin and ampicillin.
40. The method of claim 35, wherein said penicillin is a broad spectrum penicillin which is a member selected from co-amoxiclav (amoxicillin and clavulanic acid).
41. The method of claim 35, wherein said penicillin is an extended spectrum penicillin, which is a member selected from azlocillin, carbenicillin, ticarcillin, mezlocillin and piperacillin.
42. The method of claim 31, wherein the antibiotic is a cephalosporin or a derivative thereof.
43. The method of claim 42, wherein the cephalosporin is a member selected from a first-generation cephalosporin, second-generation cephalosporin, second-generation cephamycin, third-generation cephalosporin and fourth-generation cephalosporin.
44. The method of claim 42, wherein the cephalosporin is a member selected from cefalexin, cephalothin and cefazolin.
45. The method of claim 42, wherein the cephalosporin is a member selected from cefaclor, cefuroxime and cefamandole.
46. The method of claim 42, wherein the cephalosporin is a member selected from cefotetan and cefoxitin.
47. The method of claim 42, wherein the cephalosporin is a member selected from ceftriaxone, cefotaxime, cefpodoxime and ceftazidime.
48. The method of claim 42, wherein the cephalosporin is a member selected from cefepime and cefpirome.
49. The method of claim 31, wherein the antibiotic is a monobactam.
50. The method of claim 49, wherein the monobactam is aztreonam.
51. The method of claim 31, wherein the antibiotic is a carbapenem.
52. The method of claim 51, wherein the carbapenem is a member selected from imipenem, cilastatin, meropenem, ertapenem and faropenem.
53. The method of claim 31, wherein said animal is a human.
54. A method of killing or inhibiting the growth of a bacteria, said method comprising: contacting said bacteria with an effective amount of a compound of claim 1 or a combination of claim 26, or a pharmaceutically acceptable salt thereof, thereby killing or inhibiting the growth of the bacteria.
55. The method of claim 54, further comprising contacting said bacteria with an effective amount of an antibiotic, or a pharmaceutically acceptable salt thereof, wherein said antibiotic comprises a β-lactam moiety.
56. The method of claim 55, wherein the bacteria is resistant to said antibiotic.
57. A method of inhibiting a β-lactamase, comprising contacting the β-lactamase with an effective amount of a compound of claim 1, or a pharmaceutically acceptable salt thereof, thereby inhibiting the β-lactamase.
58. The method of claim 57, wherein the β-lactamase is a member selected from a Group 1 β-lactamase, a Group 2 β-lactamase, a Group 3 β-lactamase, and a Group 4 β-lactamase.
59. The method of claim 58, wherein said Group 1 β-lactamase is a cephalosporinase.
60. The method of claim 58, wherein said Group 2 β-lactamase is a member selected from penicillinase, a Group 2b, Group 2be, Group 2br, carbenicillinase, cloxacilanase, cephalosporinase and carbapenamase.
61. The method of claim 58, wherein said Group 3 β-lactamase is a metallo-β-lactamase.
62. The method of claim 58, wherein said Group 4 β-lactamase is a penicillinase.
63. The method of claim 57, wherein the β-lactamase is a member selected from a class A β-lactamase, a class B β-lactamase, a class C β-lactamase, and a class D β-lactamase.
64. The method of claim 63, wherein the class A β-lactamase is a member selected from a TEM β-lactamase, SHV β-lactamase, CTX-M β-lactamase and a KPC β-lactamase.
65. The method of claim 63, wherein the class C β-lactamase is a member selected from a CMY β-lactamase and a AmpC β-lactamase.
66. The method of claim 63, wherein the class D β-lactamase is an OXA β-lactamase.
67. The method of claim 63, wherein the β-lactamase is a metallo β-lactamase.
68. The method of claim 63, wherein the metallo β-lactamase is a member selected from an IMP carbapenemase and a VIM β-lactamase.
69. The method of claim 57, wherein the contacting takes place in vitro.
70. A method of treating a bacterial infection comprising: administering to an animal suffering from said infection an effective amount of a compound of claim 1, or a pharmaceutically-acceptable salt thereof, thereby treating the bacterial infection.
71. A method of inhibiting the editing domain of a t-RNA synthetase, comprising: contacting the synthetase with an effective amount of a compound of claim 1, or a pharmaceutically-acceptable salt thereof, thereby inhibiting the synthetase.
72. The method of claim 71, wherein the synthetase is a leucyl t- RNA synthetase.
73. The use of a compound of claim 1 or a combination of claim 26, or a pharmaceutically acceptable salt thereof, in the manufacture of a medicament for the treatment and/or prophylaxis of bacterial infection.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP09747393A EP2285384A4 (en) | 2008-05-12 | 2009-05-12 | Boron-containing small molecules |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US5260408P | 2008-05-12 | 2008-05-12 | |
US61/052,604 | 2008-05-12 | ||
US13848408P | 2008-12-17 | 2008-12-17 | |
US61/138,484 | 2008-12-17 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2009140309A2 true WO2009140309A2 (en) | 2009-11-19 |
WO2009140309A3 WO2009140309A3 (en) | 2010-05-20 |
Family
ID=41319297
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2009/043672 WO2009140309A2 (en) | 2008-05-12 | 2009-05-12 | Boron-containing small molecules |
Country Status (3)
Country | Link |
---|---|
US (1) | US20100256092A1 (en) |
EP (1) | EP2285384A4 (en) |
WO (1) | WO2009140309A2 (en) |
Cited By (50)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20100292504A1 (en) * | 2007-06-20 | 2010-11-18 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
WO2011017125A1 (en) * | 2009-07-28 | 2011-02-10 | Anacor Pharmaceuticals, Inc. | Trisubstituted boron-containing molecules |
WO2013033461A1 (en) * | 2011-08-31 | 2013-03-07 | Rempex Pharmaceuticals, Inc. | Heterocyclic boronic acid ester derivatives and therapeutic uses thereof |
US8440642B2 (en) | 2005-02-16 | 2013-05-14 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US8461134B2 (en) | 2009-11-11 | 2013-06-11 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US8461135B2 (en) | 2008-03-06 | 2013-06-11 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules as anti-inflammatory agents |
US8461336B2 (en) | 2008-09-04 | 2013-06-11 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US8470803B2 (en) | 2008-09-04 | 2013-06-25 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
WO2013093615A1 (en) | 2011-12-22 | 2013-06-27 | Micurx Pharmaceuticals, Inc. | Tricyclic boron compounds for antimicrobial therapy |
US8501712B2 (en) | 2006-02-16 | 2013-08-06 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules as anti-inflammatory agents |
WO2013123444A1 (en) | 2012-02-17 | 2013-08-22 | Amgen Inc. | Sulfonyl compounds that interact with glucokinase regulatory protein |
US8623911B2 (en) | 2010-03-19 | 2014-01-07 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules as anti-protozoal agent |
US8680136B2 (en) | 2010-08-10 | 2014-03-25 | Rempex Pharmaceuticals, Inc. | Cyclic boronic acid ester derivatives and therapeutic uses thereof |
US8703742B2 (en) | 2010-09-07 | 2014-04-22 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US8722917B2 (en) | 2005-02-16 | 2014-05-13 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
RU2519143C1 (en) * | 2012-12-29 | 2014-06-10 | Федеральное государственное бюджетное учреждение научно-исследовательский институт детских инфекций Федерального медико-биологического агентства | Method for prevention of ixodic tick-borne borreliosis in children |
WO2015016558A1 (en) | 2013-07-30 | 2015-02-05 | 동아에스티 주식회사 | Tricyclic benzoxaborole compound, preparation method therefor, and use thereof |
US9101638B2 (en) | 2013-01-04 | 2015-08-11 | Rempex Pharmaceuticals, Inc. | Boronic acid derivatives and therapeutic uses thereof |
WO2015121442A1 (en) * | 2014-02-17 | 2015-08-20 | Syngenta Participations Ag | Microbiocidally active benzoxaboroles |
US9132140B2 (en) | 2013-01-04 | 2015-09-15 | Rempex Pharmaceuticals, Inc. | Boronic acid derivatives and therapeutic uses thereof |
US9138002B2 (en) | 2013-01-30 | 2015-09-22 | Agrofresh Inc. | Compounds and compositions |
US9145429B2 (en) | 2010-01-27 | 2015-09-29 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US9156858B2 (en) | 2012-05-23 | 2015-10-13 | Rempex Pharmaceuticals, Inc. | Boronic acid derivatives and therapeutic uses thereof |
US9220715B2 (en) | 2010-11-08 | 2015-12-29 | Omeros Corporation | Treatment of addiction and impulse-control disorders using PDE7 inhibitors |
WO2016001834A1 (en) | 2014-07-01 | 2016-01-07 | Daiichi Sankyo Company, Limited | Tricyclic benzoxaboroles as antibacterial agents |
US9241947B2 (en) | 2013-01-04 | 2016-01-26 | Rempex Pharmaceuticals, Inc. | Boronic acid derivatives and therapeutic uses thereof |
US9346834B2 (en) | 2009-10-20 | 2016-05-24 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules as antiprotozoal agents |
US9426996B2 (en) | 2013-01-30 | 2016-08-30 | Agrofresh Inc. | Use of benzoxaboroles as volatile antimicrobial agents on meats, plants, or plant parts |
US9493489B2 (en) | 2008-10-15 | 2016-11-15 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules as anti-protozoal agents |
US9585396B2 (en) | 2013-01-30 | 2017-03-07 | Agrofresh Inc. | Volatile applications against pathogens |
US9642869B2 (en) | 2013-01-04 | 2017-05-09 | Rempex Pharmaceuticals, Inc. | Boronic acid derivatives and therapeutic uses thereof |
US9687497B1 (en) | 2014-05-05 | 2017-06-27 | Rempex Pharmaceuticals, Inc. | Salts and polymorphs of cyclic boronic acid ester derivatives and therapeutic uses thereof |
US9963467B2 (en) | 2014-05-19 | 2018-05-08 | Rempex Pharmaceuticals, Inc. | Boronic acid derivatives and therapeutic uses thereof |
EP3212196A4 (en) * | 2014-10-29 | 2018-07-11 | Wisconsin Alumni Research Foundation | Boronic acid inhibitors of hiv protease |
US10070649B2 (en) | 2013-01-30 | 2018-09-11 | Agrofresh Inc. | Volatile applications against pathogens |
US10206937B2 (en) | 2014-07-01 | 2019-02-19 | Qpex Biopharma, Inc. | Boronic acid derivatives and therapeutic uses thereof |
US10294249B2 (en) | 2016-06-30 | 2019-05-21 | Qpex Biopharma, Inc. | Boronic acid derivatives and therapeutic uses thereof |
US10385074B2 (en) | 2014-05-05 | 2019-08-20 | Rempex Pharmaceuticals, Inc. | Synthesis of boronate salts and uses thereof |
US10561675B2 (en) | 2012-06-06 | 2020-02-18 | Rempex Pharmaceuticals, Inc. | Cyclic boronic acid ester derivatives and therapeutic uses thereof |
US10618918B2 (en) | 2015-03-17 | 2020-04-14 | Qpex Biopharma, Inc. | Substituted boronic acids as antimicrobials |
US10662205B2 (en) | 2014-11-18 | 2020-05-26 | Qpex Biopharma, Inc. | Cyclic boronic acid ester derivatives and therapeutic uses thereof |
US10961261B2 (en) | 2017-03-01 | 2021-03-30 | Anacor Pharmaceuticals, Inc. | Oxaborole analogs and uses thereof |
US10966429B2 (en) | 2016-03-07 | 2021-04-06 | Agrofresh Inc. | Synergistic methods of using benzoxaborole compounds and preservative gases as an antimicrobial for crops |
US11039617B2 (en) | 2013-01-30 | 2021-06-22 | Agrofresh Inc. | Large scale methods of uniformly coating packaging surfaces with a volatile antimicrobial to preserve food freshness |
US11207275B2 (en) | 2010-11-08 | 2021-12-28 | Omeros Corporation | Treatment of addiction and impulse-control disorders using PDE7 inhibitors |
US11236057B2 (en) * | 2015-11-06 | 2022-02-01 | Regents Of The University Of Minnesota | Aromatic surfactants |
WO2022043936A1 (en) | 2020-08-31 | 2022-03-03 | Pfizer Inc. | Methods of protecting rna |
US11286270B2 (en) | 2017-10-11 | 2022-03-29 | Qpex Biopharma, Inc. | Boronic acid derivatives and synthesis thereof |
CN114685537A (en) * | 2020-12-28 | 2022-07-01 | 南京理工大学 | Application of butylphthalide derivative G-3702 in preparation of medicines for preventing and treating cerebral ischemia reperfusion injury |
US12016868B2 (en) | 2018-04-20 | 2024-06-25 | Qpex Biopharma, Inc. | Boronic acid derivatives and therapeutic uses thereof |
Families Citing this family (11)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU2009335744A1 (en) * | 2008-12-17 | 2010-07-15 | Anacor Pharmaceuticals, Inc. | Polymorphs of (S)-3-aminomethyl-7-(3-hydroxy-propoxy) -3H-benzo[c][1,2] oxaborol-1-ol |
WO2011019618A1 (en) * | 2009-08-14 | 2011-02-17 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules as antiprotozoal agents |
WO2011022337A1 (en) * | 2009-08-19 | 2011-02-24 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules as antiprotozoal agents |
US20110124597A1 (en) * | 2009-09-25 | 2011-05-26 | Anacor Pharmaceuticals, Inc. | Boron containing small molecules |
CN102432566B (en) * | 2011-09-30 | 2013-09-04 | 湖南大学 | 2-(4-phenoxyphenyl)oxirane and preparation method and application thereof |
CN103191091B (en) * | 2012-01-04 | 2016-12-14 | 天津市国际生物医药联合研究院 | Sulfamide compound application in suppression NDM-1 activity |
FR2993900B1 (en) * | 2012-07-27 | 2016-03-25 | Biomerieux Sa | PROCESS FOR THE DETECTION OF OXA-48 CARBAPENEMASES PRODUCTION BACTERIA |
CN104138594B (en) * | 2013-05-06 | 2020-08-14 | 南开大学 | Application of D-homocysteine-L-phenylalanine dipeptide derivative in preparation of new Delhi metallo-beta-lactamase 1 inhibitor |
WO2015013318A1 (en) * | 2013-07-22 | 2015-01-29 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
JP2021515767A (en) | 2018-03-07 | 2021-06-24 | バイエル・アクチエンゲゼルシヤフト | Identification and use of ERK5 inhibitors |
CN111196820A (en) * | 2020-02-15 | 2020-05-26 | 桂林理工大学 | Preparation method of phenylboronic acid half ester |
Family Cites Families (34)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US460211A (en) * | 1891-09-29 | Wheel | ||
US2260336A (en) * | 1939-10-16 | 1941-10-28 | Dow Chemical Co | Method of preparation of organic borates |
GB1396904A (en) * | 1972-08-11 | 1975-06-11 | Ici Ltd | Method for the control of micro-organisms |
US4766113A (en) * | 1975-10-24 | 1988-08-23 | Chapman Chemical Company | Antimicrobial compositions and methods of using same |
US4716035A (en) * | 1985-05-24 | 1987-12-29 | The Procter & Gamble Company | Oral compositions and methods for treating gingivitis |
US5962498A (en) * | 1986-06-11 | 1999-10-05 | Procyon Pharmaceuticals, Inc. | Protein kinase C modulators. C. indolactam structural-types with anti-inflammatory activity |
US4894220A (en) * | 1987-01-30 | 1990-01-16 | Colgate-Palmolive Company | Antibacterial antiplaque oral composition |
SG47101A1 (en) * | 1992-07-31 | 1998-03-20 | Us Bioscience | Crystalline amifostine compositions and methods for the preparation and use of same |
US5348948A (en) * | 1993-05-07 | 1994-09-20 | American Cyanamid Company | 2,2-diaryl-1-(oxa and thia)-2a-azonia-2-borataacenaphthene fungicidal |
US5348947A (en) * | 1993-05-07 | 1994-09-20 | American Cyanamid Company | Diarylboron ester and thioester fungicidal agents |
US5594151A (en) * | 1994-01-28 | 1997-01-14 | Prolinx, Inc. | Phenylboronic acid complexing reagents derived from aminosalicylic acid |
GB9411587D0 (en) * | 1994-06-09 | 1994-08-03 | Zeneca Ltd | Compound, composition and use |
US6083903A (en) * | 1994-10-28 | 2000-07-04 | Leukosite, Inc. | Boronic ester and acid compounds, synthesis and uses |
GB9604926D0 (en) * | 1996-03-08 | 1996-05-08 | Sandoz Ltd | Organic compounds |
WO1997048697A1 (en) * | 1996-06-19 | 1997-12-24 | Rhone-Poulenc Rorer Limited | Substituted azabicylic compounds and their use as inhibitors of the production of tnf and cyclic amp phosphodiesterase |
US5831046A (en) * | 1996-08-05 | 1998-11-03 | Prolinx, Incorporated | Boronic acid-contaning nucleic acid monomers |
US6306628B1 (en) * | 1999-08-25 | 2001-10-23 | Ambergen, Incorporated | Methods for the detection, analysis and isolation of Nascent proteins |
US6369098B1 (en) * | 1999-10-05 | 2002-04-09 | Bethesda Pharmaceuticals, Inc. | Dithiolane derivatives |
AU7593001A (en) * | 2000-07-14 | 2002-01-30 | Zycos Inc | Alpha-msh related compounds and methods of use |
DE10110051C2 (en) * | 2001-03-02 | 2003-07-03 | Clariant Gmbh | Process for the preparation of boronic and boric acids |
GB0117645D0 (en) * | 2001-07-19 | 2001-09-12 | Isis Innovation | Therapeutic stratergies for prevention and treatment of alzheimers disease |
DE10143979A1 (en) * | 2001-09-07 | 2003-03-27 | Clariant Gmbh | Process for the preparation of bisallylboranes and non-aromatic boronic acids |
WO2003033002A1 (en) * | 2001-10-11 | 2003-04-24 | Ono Pharmaceutical Co | Intracellular calcium concentration increase inhibitors |
US7390806B2 (en) * | 2002-12-18 | 2008-06-24 | Anacor Pharmaceuticals, Inc. | Antibiotics containing borinic acid complexes and methods of use |
JP2006511613A (en) * | 2002-12-18 | 2006-04-06 | アナコア ファーマシューティカルズ インコーポレイテッド | Antibiotics containing boronic acid conjugates and methods of use |
WO2005000200A2 (en) * | 2003-05-09 | 2005-01-06 | Sugen, Inc. | Novel kinases |
CA2529792A1 (en) * | 2003-06-16 | 2005-02-17 | Anacor Pharmaceuticals, Inc. | Hydrolytically-resistant boron-containing therapeutics and methods of use |
PL1755661T3 (en) * | 2004-05-12 | 2014-10-31 | Brigham & Womens Hospital Inc | Gelsolin for use in treating infections |
EP2343304B1 (en) * | 2005-02-16 | 2015-06-10 | Anacor Pharmaceuticals, Inc. | Biocidal boronophthalide compounds |
PE20061303A1 (en) * | 2005-03-30 | 2006-12-07 | Astion Dev As | PHARMACEUTICAL COMPOSITION INCLUDING OXAPROZIN |
WO2007078340A2 (en) * | 2005-12-30 | 2007-07-12 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
EP1988779B1 (en) * | 2006-02-16 | 2015-06-24 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules as anti-inflammatory agents |
US20070286822A1 (en) * | 2006-06-12 | 2007-12-13 | Anacor Pharmaceuticals Inc. | Compounds for the Treatment of Periodontal Disease |
JO3396B1 (en) * | 2007-06-20 | 2019-10-20 | Anacor Pharmaceuticals Inc | Boron-containing small molecules |
-
2009
- 2009-05-12 WO PCT/US2009/043672 patent/WO2009140309A2/en active Application Filing
- 2009-05-12 EP EP09747393A patent/EP2285384A4/en not_active Withdrawn
- 2009-05-12 US US12/464,829 patent/US20100256092A1/en not_active Abandoned
Non-Patent Citations (1)
Title |
---|
See references of EP2285384A4 * |
Cited By (92)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8889656B2 (en) | 2005-02-16 | 2014-11-18 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US9353133B2 (en) | 2005-02-16 | 2016-05-31 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US8722917B2 (en) | 2005-02-16 | 2014-05-13 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US8440642B2 (en) | 2005-02-16 | 2013-05-14 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US9566289B2 (en) | 2005-02-16 | 2017-02-14 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US9549938B2 (en) | 2005-02-16 | 2017-01-24 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US9566290B2 (en) | 2005-02-16 | 2017-02-14 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US9572823B2 (en) | 2005-02-16 | 2017-02-21 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US9029353B2 (en) | 2006-02-16 | 2015-05-12 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules as anti-inflammatory agents |
US8501712B2 (en) | 2006-02-16 | 2013-08-06 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules as anti-inflammatory agents |
US9682092B2 (en) | 2006-02-16 | 2017-06-20 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules as anti-inflammatory agents |
US9796735B2 (en) | 2007-06-20 | 2017-10-24 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
EP2164331B1 (en) * | 2007-06-20 | 2017-11-29 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US20100292504A1 (en) * | 2007-06-20 | 2010-11-18 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US8895534B2 (en) * | 2007-06-20 | 2014-11-25 | Anacor Pharmaceuticals, Inc. | Boron containing small molecules |
US10533021B2 (en) | 2007-06-20 | 2020-01-14 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US9012431B2 (en) | 2008-03-06 | 2015-04-21 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules as anti-inflammatory agents |
US8461135B2 (en) | 2008-03-06 | 2013-06-11 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules as anti-inflammatory agents |
US9416146B2 (en) | 2008-03-06 | 2016-08-16 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules as anti-inflammatory agents |
US8470803B2 (en) | 2008-09-04 | 2013-06-25 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US8461336B2 (en) | 2008-09-04 | 2013-06-11 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US9493489B2 (en) | 2008-10-15 | 2016-11-15 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules as anti-protozoal agents |
WO2011017125A1 (en) * | 2009-07-28 | 2011-02-10 | Anacor Pharmaceuticals, Inc. | Trisubstituted boron-containing molecules |
US9346834B2 (en) | 2009-10-20 | 2016-05-24 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules as antiprotozoal agents |
US8461134B2 (en) | 2009-11-11 | 2013-06-11 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US9145429B2 (en) | 2010-01-27 | 2015-09-29 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US9499570B2 (en) | 2010-01-27 | 2016-11-22 | Anacor Pharmaceuticals, Inc. | Boron containing small molecules |
US8623911B2 (en) | 2010-03-19 | 2014-01-07 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules as anti-protozoal agent |
US8680136B2 (en) | 2010-08-10 | 2014-03-25 | Rempex Pharmaceuticals, Inc. | Cyclic boronic acid ester derivatives and therapeutic uses thereof |
US11684629B2 (en) | 2010-08-10 | 2023-06-27 | Melinta Subsidiary Corp. | Therapeutic uses of pharmaceutical compositions comprising cyclic boronic acid ester derivatives |
US10183034B2 (en) | 2010-08-10 | 2019-01-22 | Rempex Pharmaceuticals, Inc. | Therapeutic uses of pharmaceutical compositions comprising cyclic boronic acid ester derivatives |
US11090319B2 (en) | 2010-08-10 | 2021-08-17 | Melinta Subsidiary Corp. | Therapeutic uses of pharmaceutical compositions comprising cyclic boronic acid ester derivatives |
US10004758B2 (en) | 2010-08-10 | 2018-06-26 | Rempex Pharmaceuticals, Inc. | Cyclic boronic acid ester derivatives and methods of making the same |
US9296763B2 (en) | 2010-08-10 | 2016-03-29 | Rempex Pharmaceuticals, Inc. | Cyclic boronic acid ester derivatives and therapeutic uses thereof |
US9694025B2 (en) | 2010-08-10 | 2017-07-04 | Rempex Pharmaceuticals, Inc. | Cyclic boronic acid ester derivatives and therapeutic uses thereof |
US10639318B2 (en) | 2010-08-10 | 2020-05-05 | Rempex Pharmaceuticals, Inc. | Therapeutic uses of pharmaceutical compositions comprising cyclic boronic acid ester derivatives |
US10172874B2 (en) | 2010-08-10 | 2019-01-08 | Rempex Pharmaceuticals, Inc. | Pharmaceutical compositions comprising cyclic boronic acid ester derivatives |
US9751898B2 (en) | 2010-09-07 | 2017-09-05 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US11008345B2 (en) | 2010-09-07 | 2021-05-18 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
US8703742B2 (en) | 2010-09-07 | 2014-04-22 | Anacor Pharmaceuticals, Inc. | Boron-containing small molecules |
JP2016199558A (en) * | 2010-09-07 | 2016-12-01 | アナコール ファーマシューティカルズ,インコーポレーテッド | Benzoxaborole derivatives for treating bacterial infections |
US11464785B2 (en) | 2010-11-08 | 2022-10-11 | Omeros Corporation | Treatment of addiction and impulse-control disorders using PDE7 inhibitors |
US9220715B2 (en) | 2010-11-08 | 2015-12-29 | Omeros Corporation | Treatment of addiction and impulse-control disorders using PDE7 inhibitors |
US11207275B2 (en) | 2010-11-08 | 2021-12-28 | Omeros Corporation | Treatment of addiction and impulse-control disorders using PDE7 inhibitors |
US9012491B2 (en) | 2011-08-31 | 2015-04-21 | Rempex Pharmaceuticals, Inc. | Heterocyclic boronic acid ester derivatives and therapeutic uses thereof |
WO2013033461A1 (en) * | 2011-08-31 | 2013-03-07 | Rempex Pharmaceuticals, Inc. | Heterocyclic boronic acid ester derivatives and therapeutic uses thereof |
JP2015502974A (en) * | 2011-12-22 | 2015-01-29 | ミクウルク ファーマシューティカルズ,インコーポレイテッド | Tricyclic boron compounds for antimicrobial therapy |
US8530452B2 (en) | 2011-12-22 | 2013-09-10 | Micurx Pharmaceuticals, Inc. | Tricyclic boron compounds for antimicrobial therapy |
WO2013093615A1 (en) | 2011-12-22 | 2013-06-27 | Micurx Pharmaceuticals, Inc. | Tricyclic boron compounds for antimicrobial therapy |
WO2013123444A1 (en) | 2012-02-17 | 2013-08-22 | Amgen Inc. | Sulfonyl compounds that interact with glucokinase regulatory protein |
US9156858B2 (en) | 2012-05-23 | 2015-10-13 | Rempex Pharmaceuticals, Inc. | Boronic acid derivatives and therapeutic uses thereof |
US10561675B2 (en) | 2012-06-06 | 2020-02-18 | Rempex Pharmaceuticals, Inc. | Cyclic boronic acid ester derivatives and therapeutic uses thereof |
US11007206B2 (en) | 2012-06-06 | 2021-05-18 | Melinta Subsidiary Corp. | Cyclic boronic acid ester derivatives and therapeutic uses thereof |
RU2519143C1 (en) * | 2012-12-29 | 2014-06-10 | Федеральное государственное бюджетное учреждение научно-исследовательский институт детских инфекций Федерального медико-биологического агентства | Method for prevention of ixodic tick-borne borreliosis in children |
US9642869B2 (en) | 2013-01-04 | 2017-05-09 | Rempex Pharmaceuticals, Inc. | Boronic acid derivatives and therapeutic uses thereof |
US9241947B2 (en) | 2013-01-04 | 2016-01-26 | Rempex Pharmaceuticals, Inc. | Boronic acid derivatives and therapeutic uses thereof |
US9132140B2 (en) | 2013-01-04 | 2015-09-15 | Rempex Pharmaceuticals, Inc. | Boronic acid derivatives and therapeutic uses thereof |
US9101638B2 (en) | 2013-01-04 | 2015-08-11 | Rempex Pharmaceuticals, Inc. | Boronic acid derivatives and therapeutic uses thereof |
US9585396B2 (en) | 2013-01-30 | 2017-03-07 | Agrofresh Inc. | Volatile applications against pathogens |
US10765117B2 (en) | 2013-01-30 | 2020-09-08 | Agrofresh Inc. | Volatile applications against pathogens |
US11039617B2 (en) | 2013-01-30 | 2021-06-22 | Agrofresh Inc. | Large scale methods of uniformly coating packaging surfaces with a volatile antimicrobial to preserve food freshness |
US9426996B2 (en) | 2013-01-30 | 2016-08-30 | Agrofresh Inc. | Use of benzoxaboroles as volatile antimicrobial agents on meats, plants, or plant parts |
US11917997B2 (en) | 2013-01-30 | 2024-03-05 | Agrofresh Inc. | Volatile applications against pathogens |
US9138002B2 (en) | 2013-01-30 | 2015-09-22 | Agrofresh Inc. | Compounds and compositions |
US11202448B2 (en) | 2013-01-30 | 2021-12-21 | Agrofresh Inc. | Volatile applications against pathogens |
US10070649B2 (en) | 2013-01-30 | 2018-09-11 | Agrofresh Inc. | Volatile applications against pathogens |
US11771089B2 (en) | 2013-01-30 | 2023-10-03 | Agrofresh Inc. | Large-scale methods of uniformly coating packaging surfaces with a volatile antimicrobial to preserve food freshness |
WO2015016558A1 (en) | 2013-07-30 | 2015-02-05 | 동아에스티 주식회사 | Tricyclic benzoxaborole compound, preparation method therefor, and use thereof |
US9676796B2 (en) | 2013-07-30 | 2017-06-13 | Dong-A St Co., Ltd. | Tricyclic benzoxaborole compound, preparation method and use thereof |
WO2015121442A1 (en) * | 2014-02-17 | 2015-08-20 | Syngenta Participations Ag | Microbiocidally active benzoxaboroles |
US10040806B2 (en) | 2014-02-17 | 2018-08-07 | Syngenta Participations Ag | Microbiocidally active benzoxaboroles |
US9687497B1 (en) | 2014-05-05 | 2017-06-27 | Rempex Pharmaceuticals, Inc. | Salts and polymorphs of cyclic boronic acid ester derivatives and therapeutic uses thereof |
US10385074B2 (en) | 2014-05-05 | 2019-08-20 | Rempex Pharmaceuticals, Inc. | Synthesis of boronate salts and uses thereof |
US10669292B2 (en) | 2014-05-05 | 2020-06-02 | Rempex Pharmaceuticals, Inc. | Synthesis of boronate salts and uses thereof |
US9963467B2 (en) | 2014-05-19 | 2018-05-08 | Rempex Pharmaceuticals, Inc. | Boronic acid derivatives and therapeutic uses thereof |
WO2016001834A1 (en) | 2014-07-01 | 2016-01-07 | Daiichi Sankyo Company, Limited | Tricyclic benzoxaboroles as antibacterial agents |
US10206937B2 (en) | 2014-07-01 | 2019-02-19 | Qpex Biopharma, Inc. | Boronic acid derivatives and therapeutic uses thereof |
EP3212196A4 (en) * | 2014-10-29 | 2018-07-11 | Wisconsin Alumni Research Foundation | Boronic acid inhibitors of hiv protease |
US10662205B2 (en) | 2014-11-18 | 2020-05-26 | Qpex Biopharma, Inc. | Cyclic boronic acid ester derivatives and therapeutic uses thereof |
US10618918B2 (en) | 2015-03-17 | 2020-04-14 | Qpex Biopharma, Inc. | Substituted boronic acids as antimicrobials |
US11236057B2 (en) * | 2015-11-06 | 2022-02-01 | Regents Of The University Of Minnesota | Aromatic surfactants |
US10966429B2 (en) | 2016-03-07 | 2021-04-06 | Agrofresh Inc. | Synergistic methods of using benzoxaborole compounds and preservative gases as an antimicrobial for crops |
US11180512B2 (en) | 2016-06-30 | 2021-11-23 | Qpex Biopharma, Inc. | Boronic acid derivatives and therapeutic uses thereof |
US10570159B2 (en) | 2016-06-30 | 2020-02-25 | Qpex Biopharma, Inc. | Boronic acid derivatives and therapeutic uses thereof |
US10294249B2 (en) | 2016-06-30 | 2019-05-21 | Qpex Biopharma, Inc. | Boronic acid derivatives and therapeutic uses thereof |
US11999759B2 (en) | 2016-06-30 | 2024-06-04 | Qpex Biopharma, Inc. | Boronic acid derivatives and therapeutic uses thereof |
US10961261B2 (en) | 2017-03-01 | 2021-03-30 | Anacor Pharmaceuticals, Inc. | Oxaborole analogs and uses thereof |
US11691992B2 (en) | 2017-03-01 | 2023-07-04 | Anacor Pharmaceuticals, Inc. | Oxaborole analogs and uses thereof |
US11286270B2 (en) | 2017-10-11 | 2022-03-29 | Qpex Biopharma, Inc. | Boronic acid derivatives and synthesis thereof |
US12016868B2 (en) | 2018-04-20 | 2024-06-25 | Qpex Biopharma, Inc. | Boronic acid derivatives and therapeutic uses thereof |
WO2022043936A1 (en) | 2020-08-31 | 2022-03-03 | Pfizer Inc. | Methods of protecting rna |
CN114685537A (en) * | 2020-12-28 | 2022-07-01 | 南京理工大学 | Application of butylphthalide derivative G-3702 in preparation of medicines for preventing and treating cerebral ischemia reperfusion injury |
Also Published As
Publication number | Publication date |
---|---|
US20100256092A1 (en) | 2010-10-07 |
EP2285384A2 (en) | 2011-02-23 |
EP2285384A4 (en) | 2012-04-25 |
WO2009140309A3 (en) | 2010-05-20 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2009140309A2 (en) | Boron-containing small molecules | |
US8343944B2 (en) | Trisubstituted boron-containing molecules | |
US11008345B2 (en) | Boron-containing small molecules | |
ES2730013T3 (en) | Betalactamase inhibitors | |
AU2009221793B2 (en) | Boron-containing small molecules as anti-inflammatory agents | |
EP1846424B1 (en) | Proteasome inhibitors and methods of using the same | |
US20140315861A1 (en) | Beta-lactamase inhibitors | |
WO2011060196A1 (en) | Boron-containing small molecules | |
JP5745279B2 (en) | Boron-containing small molecules as anti-inflammatory agents | |
JP2017048198A (en) | Boron-containing small molecules as anti-inflammatory agents |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 09747393 Country of ref document: EP Kind code of ref document: A2 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2009747393 Country of ref document: EP |