WO2009109602A1 - Improving enzymatic treatment of a proteinaceous substrate by enzymatic removal of free thiols - Google Patents

Improving enzymatic treatment of a proteinaceous substrate by enzymatic removal of free thiols Download PDF

Info

Publication number
WO2009109602A1
WO2009109602A1 PCT/EP2009/052558 EP2009052558W WO2009109602A1 WO 2009109602 A1 WO2009109602 A1 WO 2009109602A1 EP 2009052558 W EP2009052558 W EP 2009052558W WO 2009109602 A1 WO2009109602 A1 WO 2009109602A1
Authority
WO
WIPO (PCT)
Prior art keywords
enzyme
proteinaceous
meat
substrate
foodstuff
Prior art date
Application number
PCT/EP2009/052558
Other languages
French (fr)
Inventor
Peter Edvard Degn
Jesper Kampp
Liv Spångner CHRISTIANSEN
Original Assignee
Danisco A/S
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Danisco A/S filed Critical Danisco A/S
Priority to JP2010549140A priority Critical patent/JP5706695B2/en
Priority to EP09716617A priority patent/EP2259686A1/en
Priority to CN200980113111.0A priority patent/CN102006783B/en
Publication of WO2009109602A1 publication Critical patent/WO2009109602A1/en
Priority to US12/875,206 priority patent/US20110123676A1/en

Links

Classifications

    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L13/00—Meat products; Meat meal; Preparation or treatment thereof
    • A23L13/70—Tenderised or flavoured meat pieces; Macerating or marinating solutions specially adapted therefor
    • A23L13/72—Tenderised or flavoured meat pieces; Macerating or marinating solutions specially adapted therefor using additives, e.g. by injection of solutions
    • A23L13/74—Tenderised or flavoured meat pieces; Macerating or marinating solutions specially adapted therefor using additives, e.g. by injection of solutions using microorganisms or enzymes
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23B—PRESERVING, e.g. BY CANNING, MEAT, FISH, EGGS, FRUIT, VEGETABLES, EDIBLE SEEDS; CHEMICAL RIPENING OF FRUIT OR VEGETABLES; THE PRESERVED, RIPENED, OR CANNED PRODUCTS
    • A23B4/00—General methods for preserving meat, sausages, fish or fish products
    • A23B4/14—Preserving with chemicals not covered by groups A23B4/02 or A23B4/12
    • A23B4/18—Preserving with chemicals not covered by groups A23B4/02 or A23B4/12 in the form of liquids or solids
    • A23B4/20—Organic compounds; Microorganisms; Enzymes
    • A23B4/22—Microorganisms; Enzymes; Antibiotics
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23J—PROTEIN COMPOSITIONS FOR FOODSTUFFS; WORKING-UP PROTEINS FOR FOODSTUFFS; PHOSPHATIDE COMPOSITIONS FOR FOODSTUFFS
    • A23J3/00—Working-up of proteins for foodstuffs
    • A23J3/04—Animal proteins
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y108/00—Oxidoreductases acting on sulfur groups as donors (1.8)
    • C12Y108/03—Oxidoreductases acting on sulfur groups as donors (1.8) with oxygen as acceptor (1.8.3)
    • C12Y108/03002—Thiol oxidase (1.8.3.2)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y108/00—Oxidoreductases acting on sulfur groups as donors (1.8)
    • C12Y108/03—Oxidoreductases acting on sulfur groups as donors (1.8) with oxygen as acceptor (1.8.3)
    • C12Y108/03003—Glutathione oxidase (1.8.3.3)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y110/00—Oxidoreductases acting on diphenols and related substances as donors (1.10)
    • C12Y110/03—Oxidoreductases acting on diphenols and related substances as donors (1.10) with an oxygen as acceptor (1.10.3)
    • C12Y110/03001—Catechol oxidase (1.10.3.1), i.e. tyrosinase
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y110/00—Oxidoreductases acting on diphenols and related substances as donors (1.10)
    • C12Y110/03—Oxidoreductases acting on diphenols and related substances as donors (1.10) with an oxygen as acceptor (1.10.3)
    • C12Y110/03002—Laccase (1.10.3.2)

Definitions

  • the invention relates to the enzymatic treatment of proteinaceous substrates with a first enzyme, such as a sulfhydryl oxidase.
  • the first enzyme removes enzyme inhibitors, such as free thiols, present in the proteinaceous substrate.
  • the removal of the inhibitory compounds in the substrate allows for an effective enzymatic action of a second enzyme such as protein cross-linking of the protein present in the substrate by a tyrosinase.
  • WO02/14484 and WO02/14595 reports on a tyrosinase enzyme isolated from Pseudomonadaceae, and its use for protein cross-linking, particularly of protein fibres which as wool fibres.
  • WO2006/084953 reports on a tyrosinase enzyme obtainable from Trichoderma spp. and its use in cross-linking food proteins.
  • Sulfhydryl oxidases catalyze the oxidation of sulfhydryl groups to disulfides, according to the general reaction : 2RSH + 02 -> RS-SR + H 2 O 2
  • Sulfhydryl oxidases are known in the art for example: Sulfhydryl oxidases derived from yeast are available commercially, for example from X-Zyme (Ervlp and Ervlp - Xl) GmbH (Duesseldorf/Germany) z ⁇ m ⁇ e_xgj ⁇ /d_e/Br ⁇ uctsJ ⁇ trrjl); R. S. de Ia Motte and F. W.
  • EP 0 321 81 IB discloses that sulfhydryl oxidases may be used to strengthen dough, apparently in combination with a glucose oxidase.
  • EP 0 705 538B reports that bovine and microbial sulfhydryl oxidases have been used as an enzyme additive for dough in the combination with a hemicellulose.
  • WO 2006/046146 indicates sulfhydryl oxidase may be used in the preparation of a durum wheat flour baked product.
  • WO 2007/093674 reports on a method of preparing a low-ingredient meat product by adding tyrosinase, and to a low-ingredient meat product modified by tyrosinase.
  • the tyrosinase is used to modify texture or water binding properties of low-ingredient meat products which have a low content of at least salt, phosphate or meat.
  • the present invention is based upon the discovery that inhibitory agents, such as free thiols, which are naturally present in proteinaceous substrates, such as proteinaceous foodstuffs, are responsible for the inhibition of several enzymes such as tyrosinases, and that the use of a first enzyme, which may be capable of reducing or eliminating such agents, such as sulfhydryl oxidases, allow enzymes such as tyrosinases inhibited by inhibitory agents to be utilised effectively for example to cross link protein present in the proteinaceous substrate, which may improve the gel strength, water holding capacity and/or improve the texture of the proteinaceous substrate.
  • inhibitory agents such as free thiols
  • a first enzyme which may be capable of reducing or eliminating such agents, such as sulfhydryl oxidases
  • the invention relates to the treatment of proteinaceous substrates with a first enzyme, such as a sulfhydryl oxidase prior to, or simultaneous with treatment with a second enzyme, the activity of which is inhibited by free thiols.
  • the first enzyme removes enzyme inhibitors, such as free thiols, present in the proteinaceous substrate.
  • the removal of the inhibitory compounds in the substrate may allow for a more effective action of the second enzyme, such as protein cross-linking of the protein present in the substrate by tyrosinase enzymes.
  • the invention provides in another aspect for a method for the preparation of a cross-linked proteinaceous substrate, said method comprising the steps:
  • step a) is performed prior to, or simultaneous to step b), and wherein step b) results in the cross-linking of proteins present in said proteinaceous substrate.
  • the invention provides in another aspect for an enzyme system comprising a first enzyme and a second enzyme, in which the first enzyme is an enzyme capable of removing free thiols from a proteinaceous substrate, and the second enzyme is a tyrosinase.
  • the invention provides further for the use of a first enzyme for reducing the concentration of free thiols in a proteinaceous substrate, such as a sulfhydryl oxidase.
  • a first enzyme for reducing the concentration of free thiols in a proteinaceous substrate, such as a sulfhydryl oxidase.
  • the invention provides in another aspect for a method for improving the enzymatic activity on a proteinaceous substrate comprising free thiols by a second enzyme, the activity of which is inhibited by the presence of free thiols, said method comprising treatment of the proteinaceous substrate with a first enzyme capable of removing free thiols; wherein the treatment with the first enzyme is performed prior to, or simultaneous with a treatment with the second enzyme and wherein the first enzyme and the second enzyme is not the same enzyme.
  • the invention provides for a method for the preparation of a cross-linked proteinaceous product, said method comprising the steps:
  • step a) is performed prior to, or simultaneous to step b), and wherein step b) results in the cross-linking of proteins present in said proteinaceous substrate.
  • the proteinaceous substrate may be a proteinaceous foodstuff.
  • the proteinaceous product may be a proteinaceous protein cross-linked foodstuff.
  • the invention also provides for the cross linked proteinaceous product prepared by the above method, and, in the case where the proteinaceous substrate is a proteinaceous foodstuff, the invention also provides for food products which comprise the proteinaceous protein cross linked foodstuff product.
  • the invention also provides for a proteinaceous foodstuff or food product comprising myosin protein, which exhibits an enhanced water holding capacity and/or an increased gel strength, and in which at least a proportion of the myosin protein present in the proteinaceous food product is cross-linked. Water holding capacity and gel strength of the product may be compared to similar products made without use of the method of the invention, or as otherwise defined herein.
  • Figure 1 Meat extracts treated with TrTyr2 and TGase.
  • the lanes contain the following extract/treatment: 1) turkey/TGase, 2) turkey/TrTyr2, 3) turkey/reference, 4) cod/TGase, 5) cod/TrTyr2, 6) cod/reference, 7) beef/TGase, 8) beef/TrTyr2, 9) beef/reference, 10) pork/TGase, 11) pork/TrTyr2, 12) pork/reference 13) chicken/TGase, 14)chicken/TrTyr2, 15) chicken/reference, 16) lamb/TGase, 17) lamb/TrTyr2, 18) lamb/reference.
  • FIG. 2 Pork extracts dialysed against buffers with (lanes 1-3) and without (lanes 4-6) STPP. Extracts are treated with TGase (lanes 1 and 4), with TrTyr2 (lanes 2 and 5) or are references (lanes 3 and 6).
  • Figure 3 SDS-PAGE gels of extracts treated with sulfhydryl oxidase before further enzyme treatment.
  • "High SOX” stands for a treatment with 0.33U/ml.
  • Low SOX stands for 0.033 nkat/ml.
  • Lanes contain (first enzyme treatment/second enzyme treatment): 1) high sulfhydryl oxidase/TGase, 2) high sulfhydryl oxidase/TrTyr2, 3) high sulfhydryl oxidase/no treatment, 4) low sulfhydryl oxidase/TGase, 5) low sulfhydryl oxidase/TrTyr2, 6) low sulfhydryl oxidase/ no treatment, 7) no treatment/TGase, 8) no treatment/TrTyr2, 9) no treatment/ no treatment, b) extracts from beef.
  • Lanes contain (first enzyme treatment/second enzyme treatment) : 1) high sulfhydryl oxidase/TGase, 2) high sulfhydryl oxidase/TrTyr2, 3) high sulfhydryl oxidase/no treatment, 4) low sulfhydryl oxidase/TGase, 5) low sulfhydryl oxidase/TrTyr2, 6) low sulfhydryl oxidase/ no treatment, 7) no treatment/TGase, 8) no treatment/TrTyr2, 9) no treatment/ no treatment.
  • Figure 4 illustrates that both gel-strength and WHC of gels made from the different meat extracts are positively correlated with protein content. Note that this figure only depicts reference samples (no enzyme treatment). The gel made from cod extract was inhomogeneous, which gives large variations in gel strength measurement. However, it was consistently lower than for the other gels.
  • b Similar to a but depicting WHC. Error bars represent the standard deviation.
  • a method for the preparation of a cross-linked proteinaceous substrate comprising the steps:
  • step a) is performed prior to, or simultaneous to step b), and wherein step b) results in the cross-linking of proteins present in said proteinaceous substrate and wherein the first enzyme and the second enzyme is not the same enzyme.
  • a method for improving the enzymatic activity on a proteinaceous substrate comprising free thiols by a second enzyme, the activity of which is inhibited by the presence of free thiols, said method comprising treatment of the proteinaceous substrate with a first enzyme capable of removing free thiols; wherein the treatment with the first enzyme is performed prior to, or simultaneous with a treatment with the second enzyme and wherein the first enzyme and the second enzyme is not the same enzyme.
  • the present inventors have found that the inhibition of tyrosinase enzymes in proteinaceous substrates may be due to the presence of free thiols present in the proteinaceous substrate.
  • the present invention is based upon the removal of at least part of the free thiol content of the proteinaceous substrate, thereby alleviating, at least partially, the inhibition of the second enzyme such as tyrosinase.
  • the invention is particularly relevant to the meat processing industry, where tyrosinases are considered as suitable processing aids for increasing water retention, improving gel strength and improving texture and mouth-feel of processed meat products.
  • the invention provides for a method for the preparation of a cross-linked proteinaceous substrate, said method comprising the steps:
  • step a) is performed prior to, or simultaneous to step b), and wherein step b) results in the cross-linking of proteins present in said proteinaceous substrate and wherein the first enzyme and the second enzyme is not the same enzyme.
  • the invention further provides for a method for the preparation of a cross-linked protein product, such as protein cross-linked foodstuff, said method comprising the steps:
  • step b) treatment of the proteinaceous substrate with a second enzyme; wherein step a) is performed prior to, or simultaneous to step b), and wherein step b) results in the cross-linking of proteins present in said proteinaceous substrate to produce the cross-linked protein product.
  • the invention further provides for a method for improving the enzymatic activity on a proteinaceous substrate comprising free thiols by a second enzyme, the activity of which is inhibited by the presence of free thiols, said method comprising treatment of the proteinaceous substrate with a first enzyme capable of removing free thiols; wherein the treatment with the first enzyme is performed prior to, or simultaneous with a treatment with the second enzyme and wherein the first enzyme and the second enzyme is not the same enzyme.
  • the treatment with the first enzyme such as in step a) results in a reduction in the free thiol concentration of the proteinaceous substrate of at least 5%.
  • the treatment with the first enzyme such as in step a) results in a reduction in the free thiol concentration of the proteinaceous substrate by at least l ⁇ M.
  • the treatment with the first enzyme results in a reduction in free thiol concentration of the proteinaceous substrate which is sufficient to enhance the ability of the second enzyme to cross link the protein, which may be myosin, present in the substrate, such as a proteinaceous foodstuff.
  • Cross-linking of protein present in the cross-linked proteinaceous product may be determined by SDS-PAGE analysis of i) the proteins present in the proteinaceous substrate as compared to ii) the cross-linked proteinaceous product of the invention obtained by the method of the invention.
  • An increase in the average size of proteins in the SDS-PAGE in ii) as compared to i) is indicative of a protein cross- linked product.
  • Reduced SDS-PAGE is appropriate as the protein cross-links formed by the activity of tyrosinase are not affected by reducing agents such as dithiothreitol or mercaptoethanol.
  • the proteinaceous foodstuff comprises myosin, and the degree of cross-linking of the myosin protein present in the treated ⁇ i.e. cross- linked) proteinaceous food products, subsequent to steps a) and b) is at least 5%.
  • the above method can be used for enhancing the gel strength or water holding capacity, or both, of the proteinaceous substrate (e.g. foodstuff) - so that after steps a) and b) are performed one or more of these parameters are enhanced in the protein cross linked proteinaceous product as compared to the proteinaceous substrate.
  • the proteinaceous substrate e.g. foodstuff
  • the first enzyme is typically selected as an enzyme which is capable of alleviating the inhibition of the second enzyme within a proteinaceous substrate, such as a meat extract, for example a pork meat extract.
  • a proteinaceous substrate such as a meat extract, for example a pork meat extract.
  • the examples provide protocols of how such meat extracts may be performed.
  • the tyrosinase spot assay as disclosed in the examples, may be used to measure tyrosinase inhibition, and alleviation thereof, using either free cysteine as a control inhibitor, or a meat extract, such as a pork meat extract as prepared according to the examples.
  • the enzyme which is capable of removing free thiols from a proteinaceous substrate, is referred to as the 'first enzyme' herein.
  • the term 'removing free thiols' refers to the decrease (i.e. reduction) in concentration of free thiols present in the proteinaceous substrate, which may, suitably, be performed using a first enzyme, which may be an oxidase.
  • Yemoving free thiols' does not relate, necessarily, to the preparation of proteinaceous substrates/products which lack any free thiols, just that the concentration of free thiols is reduced.
  • the term Yemoving free thiols' or 'reducing the concentration of free thiols' refers to the 'oxidation of free thiols'.
  • the invention provides for the use of the first enzyme, for reducing the concentration of free thiols in a proteinaceous substrate, such as a proteinaceous foodstuff.
  • the removal of free thiols from the proteinaceous substrate may be performed using an enzyme, which is capable of removing free thiols from a proteinaceous substrate.
  • an enzyme which is capable of removing free thiols from a proteinaceous substrate.
  • Such enzymes may be identified using a free thiol depletion assay.
  • the free thiol depletion assay is used with a minced pork substrate extraction prepared as according to the Examples.
  • One unit of enzyme activity is defined as the amount of enzyme that consumes 1 ⁇ mol of free thiol groups, such as free cysteine or glutathione, per minute with 1 mM as substrate at pH 7.4 and 3O 0 C in phosphate buffer.
  • the catalytic activity may also be defined in katal (SI unit for catalytic activity) which is the amount of enzyme needed to convert 1 mol of substrate pr. second at a pre-defined substrate concentration, temperature and pH.
  • SI unit for catalytic activity is the amount of enzyme needed to convert 1 mol of substrate pr. second at a pre-defined substrate concentration, temperature and pH.
  • nkat/g is equivalent to a specific enzyme activity of 0.06 units/g or 1 unit/g is equivalent to 16.6nkat/g.
  • the first enzyme is preferably an oxidase (oxido-reductase) enzyme.
  • the first enzyme is an oxidase enzyme, such as an enzyme which exhibits one or more of the following activities: sulfhydryl oxidase, laccase (E. C. 1.10.3.2), glutathione oxidase, and disulphide isomerase.
  • the first enzyme exhibits an enzyme activity selected from the group consisting of: EC 1.8.3.2 and 1.8.3.3. In one embodiment, the first enzyme is a sulfhydryl oxidase, or exhibits sulfhydryl oxidase activity, i.e. E. C. 1.8.3.2.
  • the first enzyme is an enzyme capable of generating hydrogen peroxide, such as a carbohydrate oxidase, such as glucose oxidase or hexose oxidase.
  • a carbohydrate oxidase such as glucose oxidase or hexose oxidase.
  • the inventors consider that the hydrogen peroxide generated oxidises the free thiols present, thereby alleviating the inhibition of the tyrosinase.
  • SOX sulfydryl oxidase
  • sulfhydryl oxidases Numerous sulfhydryl oxidases are known in the art, and may be used for the purposes of the present invention.
  • the sulfhydryl oxidase may be isolated from, or derived from a microbial source, such as a fungus, such as yeast or Aspergillus.
  • EP 0 321 881 EP 0 338 452 and EP 0 705 538 report on the use of microbial sulfydryl oxidases in bakery application.
  • a preferred sulfhydryl oxidase may be derived from Aspergillus niger, such as the sulfydryl oxidase described in de Ia Motte and Wagner Biochemistry 26 (1987) 7363 - 737.
  • sulfydryl oxidases include bovine sulfydryl oxidase.
  • a suitable sulfyhryl oxidase is provided by EP 0 565 172, hereby incorporated by reference, as shown in SEQ ID NO 1
  • Laccase (EC 1.10.3.2) has been reported to oxidize SH groups directly (Ref: Applied and Environmental Microbiology, February 2000, p. 524-528, Vol. 66, No. 2). Therefore, in one embodiment, the first enxyme is a laccase, or exhibits laccase activity.
  • laccase activity is defined by the enzyme classification EC 1.10.3.2
  • laccase as set out by the Nomenclature Committee of the International Union of Biochemistry and Molecular Biology (IUBMB); or enzyme classification EC 1.10.3.1 (catechol oxidase), enzyme classification EC 1.10.3.4 (o- aminophenol oxidase), or enzyme classification EC 1.3.3.5 (bilirubin oxidase).
  • laccase enzymes are known in the art, for example those disclosed in : WO2007/054034A - which reports on a laccase from Streptomyces coelicolor, particularly the laccase represented by 1 to 343 of SEQ ID NO: 2 of WO2007/054034A, hereby incorporated by reference.
  • the oxidase is a laccase, such as a Polyporus sp.
  • laccase such as the Polyporus pinisitus laccase (also called Trametes villosa laccase) described in WO 96/00290 (from Novo Nordisk Biotech., inc.) or a Myceliophthera sp.
  • laccase especially the Myceliophthera thermophila laccase described in WO 95/33836 (from Novo Nordisk Biotech inc.).
  • the laccase may be a Scytalidium sp. laccase, such as the S. thermophilium laccase described in WO 95/33837 (from Novo Nordisk Biotech inc.) or a Pyricularia sp. laccase, such as the Pyricularia oryzae laccase which can be purchased from SIGMA under the trade name SIGMA no. L5510, or a Coprinus sp. laccase, such as a C. cinereus laccase, especially a C. cinereus IFO 30116 laccase, or a Rhizoctonia sp.
  • laccase such as a Rh. solani laccase, especially the neutral Rh. solani laccase described WO 95/07988 (from Novo Nordisk A/S) having a pH optimum in the range from 6.0 to 8.5.
  • the laccase may also be derived from a fungi such as Collybia, Fomes, Lentinus, Pleurotus, Aspergillus, Neurospora, Podospora, Phlebia, e. g. P. radiata (WO 92/01046), Coriolus sp., e. g. C. hirsitus (JP 2-238885), or Botrytis. Further laccases are disclosed in WO01/83770.
  • glutathione activity may be determined by measuring the disappearance of glutathione in buffer solution in the presence of oxygen.
  • one ⁇ GOX' unit is the amount of enzyme needed to oxidize 1 ⁇ mole glutathione per minute at 30 0 C and pH 7.
  • the first enzyme has a specific activity of at least 0.01nkat/mg, such as at least O.lnkat/mg, such as at least lnkat/mg, such as at least 10nkat/mg, such as at least 50nkat/mg, such as at least 100nkat/mg, such as at least 200nkat/mg, such as at least 300nkat/mg.
  • the first enzyme has a specific activity of no greater than 500nkat/mg, such as no greater than 300nkat/mg, such as no greater than 100nkat/mg, such as no greater than 10nkat/mg, such as no greater than 5nkat/mg, such as no greater than lnkat/mg.
  • the first enzyme is added to the proteinaceous substrate, in an amount of between 0.00001mg/g and 100mg/g of proteinaceous substrate, such as between 0.01mg/g and 10mg/g, such as between 0.10mg/g and 5mg/g. In one embodiment, at least O.OOOOlmg of the first enzyme is added per g of proteinaceous substrate, such as at least 0.0001mg/g, such as at least 0.001mg/g, such as at least 0.01mg/g.
  • up to lOmg of the first enzyme is added per g of proteinaceous substrate, such as up to 5mg/g, such as up to 1 mg/g, such as up to 0.5mg/g, such as up to 0.2mg/g.
  • the amount of first enzyme added is between 0.01 and 1 nkat/g of proteinaceous substrate (or foodstuff), such as between 0.02 and 0.5nkat/g.
  • the removal of the inhibitory compounds in the proteinaceous substrate may allow for a more effective action of the second enzyme, such as a more effective protein cross-linking of the protein present in the substrate e.g. by tyrosinase.
  • the second enzyme is an enzyme which catalytic action is inhibited by the presence of free thiols.
  • the catalytic action of the second enzyme such as tyrosinase in a proteinaceous substrate will result in cross-linking of proteins.
  • the term "improvement" is defined by an increase in the catalytic activity of the second enzyme in the product treated according to the invention as compared to the catalytic activity of the second enzyme in the product without treatment with the first enzyme.
  • the term “improvement” is defined by a change in a measurable parameter (such as gel strength), which will be perceived as an improvement by the manufacturer or consumer. In one embodiment, the term “improvement” is defined by an improvement in water holding capacity in the product treated according to the invention as compared to the water holding capacity in the product without treatment with the first enzyme.
  • the term "improvement” is defined by an improvement in cross-linking in the product treated according to the invention as compared to the cross-linking in the product without treatment with the first enzyme.
  • the term "improvement" is defined by an improvement in the texture of the product treated according to the invention as compared to the texture of the product without treatment with the first enzyme.
  • the enzymatic activity results in the cross-linking of proteins present in a proteinaceous substrate such as meat.
  • a proteinaceous substrate such as meat.
  • An example of a second enzyme which is suitable for use for cross-linking of proteins in a proteinaceous substrate such as meat is tyrosinase.
  • the first enzyme and the second enzyme is not the same enzyme.
  • the second enzyme is selected from the group consisting of a tyrosinase, laccase, lipoxygenase, galactose oxidase, protein lysin 6-oxidase (lysyl oxidase), galactolipase and lysophospholipase,
  • the second enzyme is selected from the group consisting of a tyrosinase, laccase, lipoxygenase and protein lysin 6-oxidase (lysyl oxidase), In a further embodiment, the second enzyme is selected from the group consisting of lipoxygenase and protein lysin 6-oxidase (lysyl oxidase). In a further embodiment, the second enzyme is laccase. Most preferably the enzyme is a tyrosinase belonging to the group described by the EC number: 1.14.18.1.
  • the second enzyme is tyrosinase, which is defined by the enzyme classification EC E. C. 1.14.18.1 as set out by the Nomenclature Committee of the International Union of Biochemistry and Molecular Biology (IUBMB) (also referred to a monophenyl monoxoygenase).
  • IUBMB International Union of Biochemistry and Molecular Biology
  • Tyrosinase belongs to the group of phenol oxidases, which use oxygen as electron acceptor. Traditionally tyrosinases can be distinguished from other phenol oxidases, i.e. laccases, on the basis of substrate specificity and sensitivity to inhibitors. However, the differentiation is nowadays based on structural features. Structurally the major difference between tyrosinases and laccases is that tyrosinase has a binuclear copper site with two type III coppers in its active site, while laccase has altogether four copper atoms (type I and M coppers, and a pair of type III coppers) in the active site. Tyrosinase oxidizes various phenolic compounds to the corresponding quinones.
  • quinones are highly reactive and may react further non- enzymatically.
  • a typical substrate of tyrosinase is tyrosine (or tyrosine residue in proteins), which is first hydroxylated into DOPA (dihydroxyphenylalanine or DOPA residue in proteins)), which is then further oxidized by the enzyme to dopaquinone (or dopaquinone residue in proteins).
  • Dopaquinone may react non-enzymatically with a number of chemical structures, such as other dopaquinones, thiol and amino groups. Tyrosinase thus has two enzyme activities in one and the same protein, i.e. monophenol monooxyganase activity (EC 1.14.18.1) and catechol oxidase activity (EC 1.10.3.1) as shown below.
  • monophenol monooxyganase activity EC 1.14.18.1
  • catechol oxidase activity EC 1.10.3.1
  • tyrosinase The substrate specificity of tyrosinase is relatively broad, and the enzyme is capable of oxidizing a number of polyphenols and aromatic amines. Contrary to laccase (EC 1.10.3.2), however, tyrosinase does not oxidize syringaldazin. At least tyrosine, lysine and cysteine residues in proteins form covalent bonds with active dopaquinones catalysed by tyrosinase.
  • Tyrosinase activity can be measured by techniques generally known in the art.
  • L- DOPA or L-tyrosine can be used as a substrate, whereafter dopachrome formation may be monitored spectrofotometrically, or alternatively substrate consumption may be monitored by following the oxygen consumption.
  • Tyrosinases are widely distributed in nature, and they are found in animals, plants, fungi and bacteria. Especially vegetables and fruits susceptible of browning are rich in tyrosinase.
  • the only commercialiy available tyrosinase at present is derived from the mushroom Agaricus bisporus.
  • the tyrosinase used in the present invention may originate from any animal, plant, fungus or microbe capable of producing tyrosinase.
  • the tyrosinase is derived from a filamentous fungus. It may for example be an extracellular tyrosinase obtainable from Trichoderma reesei (WO 2006/084953) hereby incorporated by reference.
  • Tyrosinases catalyse the reaction L-tyrosine + L-dopa + 0(2) --> L-dopa + dopaquinone + 1-1(2)0.
  • the tyrosinase is isolated or derived from a fungal species, such as Trichoderma or Hypocrea.
  • the tyrosinase is as disclosed in SEQ ID NO 2, taking into account co- and post-translational modifications, such as signal peptide cleavage:
  • One unit of tyrosinase activity - 1 nkat is defined as the amount of enzyme that converts 1 nmol of L-DOPA into DOPA-quinone pr. second at pH 7 and 25 0 C.
  • the second enzyme is a laccase as defined above.
  • the second enzyme is a lipoxygenase defined by the enzyme classification EC 1.13.11.
  • Lipoxygenases are a class of iron-containing dioxygenases, which catalyzes the hydroperoxidation of lipids, containing a cis,cis- 1,4-pentadiene structure.
  • the primary products are hydroperoxy fatty acids, which usually are rapidly reduced to hydroxy derivatives.
  • the second enzyme is galactose oxidase.
  • a galactose oxidase enzyme catalyzes the stereospecific oxidation of primary alcohols to the corresponding aldehydes.
  • the biologically most relevant substrate of the enzyme is not known as the enzyme exhibits broad substrate specificity.
  • galactose is a substrate.
  • the second enzyme is a lysin 6-oxidase (lysyl oxidase) defined by the enzyme classification EC 1.4.3.13.
  • a lysyl oxidase is an extracellular copper-dependent enzyme that catalyzes the oxidative deamination of peptidyl lysine residues in precursors of various collagens and elastins. The deaminated lysines are then able to form aldehyde cross-links.
  • the second enzyme is a galactolipase defined by the enzyme classification E. C. 3.1.1.26.
  • a galactolipase is capable of hydrolysing at least 1,2- diacyl-3-beta-D-galactosyl-sn-glycerol.
  • galactolipases are also able to hydrolyse 2,3-di-0-acyl-l-0-(6-0- ⁇ -D-galactosyl- ⁇ -D-galactosyl)-D-glycerol, and phosphatidylcholine and other phospholipids.
  • they are incapable, or substantially incapable, of hydrolysing a triglyceride and/or a 1-monoglyceride.
  • the second enzyme is a lysophospholipase defined by the enzyme classification EC 3.1.1.5.
  • a lysophospholipase is an enzyme that catalyzes the hydrolysis of a single fatty acid ester bond in lysoglycerophosphatidates with the formation of glyceryl phosphatidates and a fatty acid.
  • the dosage of the second enzyme used such as tyrosinase may be, for example at least 20, at least 40, at least 80, at least 160, at least 320 or at least 640 nkat/g of protein.
  • an amount between 100 and 500, such as between 200- 200, or 250-350 or (about) 300 nkat/g of meat protein is usually suitable for cross-linking of meat proteins.
  • the second enzyme such as tyrosinase has a specific activity of at least 0.1nkat/mg, such as at least lnkat/mg, such as at least 10nkat/mg, such as at least 100nkat/mg, such as at least 200nkat/mg, such as at least 250nkat/mg, such as at least 300nkat/mg.
  • the second enzyme such as tyrosinase has a specific activity of no greater than 1000nkat/mg, such as no greater than 800nkat/mg, such as no greater than 500nkat/mg.
  • the enzyme used in the examples (derived from SEQ ID NO 2) has a specific activity of about 300nkat/mg.
  • the second enzyme is added to the proteinaceous substrate, in an amount of between 0.00001mg/g and 100mg/g of proteinaceous substrate, such as between 0.01mg/g and 10mg/g, such as between 0.10mg/g and 5mg/g. In one embodiment, at least O.OOOOlmg of the second enzyme is added per g of proteinaceous substrate, such as at least 0.0001mg/g, such as at least
  • up to lOmg of the second enzyme is added per g of proteinaceous substrate, such as up to 5mg/g, such as up to 1 mg/g, such as up to 0.5mg/g, such as up to 0.2mg/g.
  • the amount of second enzyme added is between 0.001 and 10 nkat/ml, such as between 0.01nkat/ml and lnkat/ml, of proteinaceous substrate (or foodstuff), such as between 0.02 and 0.5nkat/ml.
  • the first and second enzymes may be isolated from their natural source or prepared by synthetic or recombinant techniques.
  • the sequences may be variants, homologues or fragments - these terms are used as defined in EP 1 704 240B.
  • the enzyme may have a homology of at least 70%, such as at least 80%, such as at least 90%, such as at least 95%, such as at least 98% homologous or 100% homologous to the (mature) sequences as disclosed or referenced herein.
  • the expression of the first and or second enzyme is a eukaryotic host, such as native of a foreign host cell, results in the co and post-translational modifications, such as signal peptide cleavage.
  • EP 1 704 240B provides a description of the standard recombinant technology which can be employed for the expression and preparation of enzymes.
  • Thiols contain the -SH group, which also known as the thiol group.
  • a free thiol is a thiol containing compound, such as an amino acid, or a short peptide with a molecular weight of less than lOOOg/mol, such as less than 500g/mol, such as less than 350g/mol, such as less than 200g/mol.
  • Free thiols which may typically be present or formed in a proteinaceous substrate include, cysteine, glutathione, preferably cysteine.
  • the free thiol is a -SH group containing (free) amino acid, such as free cysteine - i.e. cysteine which is present as an amino acid monomer, and not part of a polypeptide chain.
  • the ⁇ free thiol' is a peptide, comprising one or more thiol groups, wherein the peptide consists of between 2 - 8 amino acids residues in lengths, such as a peptide consisting of 2, 3, 4, 5, 6, 7 or 8 amino acids, such as di-or tri- peptides, such as glutathione.
  • the peptide comprises one or more cysteine residues.
  • the presence or concentration of free thiols present in a proteinaceous substrate may be determined by the free thiol assay provided in the examples - please note that the protocol for the preparation of a meat extract can also be used with other proteinaceous substrates.
  • the free thiol concentration in the proteinaceous (food) substrate which may be treated with the first enzyme, has a free thiol concentration, prior to treatment with the first enzyme, of at least 2 ⁇ M, such as at least 3 ⁇ M, such as at least 4 ⁇ M, such as at least 5 ⁇ M, such as at least 6 ⁇ M, such as at least 7 ⁇ M, such as at least 8 ⁇ M, such as at least 9 ⁇ M, such as at least 10 ⁇ M, such as at least 11 ⁇ M, such as at least 12 ⁇ M, such as at least 13 ⁇ M, such as at least 14 ⁇ M, such as at least 15 ⁇ M, such as at least 16 ⁇ M, such as at least 17 ⁇ M.
  • at least 2 ⁇ M such as at least 3 ⁇ M, such as at least 4 ⁇ M, such as at least 5 ⁇ M, such as at least 6 ⁇ M, such as at least 7 ⁇ M, such as at least 8 ⁇ M, such as at least 9 ⁇ M
  • the free thiol concentration in the proteinaceous (food) substrate which may be treated with the first enzyme, has a free thiol concentration, prior to treatment with the first enzyme of between 5 - 25 ⁇ M, such as between 10 - 25 ⁇ M, such as between 15 - 20 ⁇ M.
  • the free thiol concentration of the proteinaceous (food) substrate is reduced by at least 5%, such as at least 10%, such as at least 20%, such as at least 30%, such as at least 40%, such as at least 50%, such as at least 60%, such as at least 70%, such as at least 80%, by the treatment with the first enzyme (such as after step a)).
  • the free thiol concentration of the proteinaceous (food) substrate after the treatment with the first enzyme (such as after step a)) is less than 15 ⁇ M, such as less than lO ⁇ M, such as less than 9 ⁇ M, such as less than 8 ⁇ M, such as less than 7 ⁇ M, such as less than 6 ⁇ M, such as less than 5 ⁇ M, such as less than 4 ⁇ M, such as less than 3 ⁇ M.
  • the reduction in the free thiol concentration of the proteinaceous food substrate is (such as after step a) at least l ⁇ M, such as at least 2 ⁇ M, at least 3 ⁇ M, at least 4 ⁇ M, at least 5 ⁇ M, at least 6 ⁇ M, at least 7 ⁇ M, at least 8 ⁇ M, at least 9 ⁇ M , at least lO ⁇ M , at least ll ⁇ M , at least 12 ⁇ M , at least lB ⁇ M ⁇ at least 14 ⁇ M, at least 15 ⁇ M, such as at least 16 ⁇ M.
  • l ⁇ M such as at least 2 ⁇ M, at least 3 ⁇ M, at least 4 ⁇ M, at least 5 ⁇ M, at least 6 ⁇ M, at least 7 ⁇ M, at least 8 ⁇ M, at least 9 ⁇ M , at least lO ⁇ M , at least ll ⁇ M , at least 12 ⁇ M , at least lB ⁇ M ⁇ at least 14 ⁇ M, at least 15 ⁇ M, such as at least 16 ⁇ M.
  • the reduction in free thiol concentration of the proteinaceous food substrate is sufficient to enhance the ability of a second enzyme to cross link the protein present in the food substrate, such as myosin.
  • a proteinaceous food substrate may be in the form of a foodstuff or food product, preferably a foodstuff.
  • the proteinaceous (food) substrate comprises meat or meat protein.
  • the proteinaceous substrate is flour, dough, a cereal derived product, milk, a milk derived product, a dairy product, soy protein, soy milk, or a vegetable derived product.
  • the proteinaceous substrate is, in one embodiment a foodstuff.
  • the proteinaceous substrate comprises or consists of animal meat.
  • the proteinaceous substrate such as the meat substrate, comprises myosin.
  • proteinaceous refers to a substrate or composition which has a protein content of at least 1%, such as at least 2%, such as at least 3%, such as at least 4%, such as at least 5%, such as at least 10% by weight, such as at least 10% by weight, such as at least 20% by weight, such as at least 30% by weight, such as at least 40% by weight, such as at least 50% by weight.
  • the proteinaceous substrate or composition comprises the protein myosin, such as at least 1%, at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50% of the protein present in the proteinaceous substrate or composition is myosin.
  • myosin refers to the motor protein found in eukaryotic muscle, i.e. the major protein found in meat. Myosin is identified as a 188kDa protein by SDS-PAGE analysis. The proportion of myosin protein can therefore be determined by SDS-PAGE analysis.
  • meal refers to the flesh of animals which is used as food, preferably comprising muscle flesh optionally with associated fat and connective tissues.
  • Meat as used herein includes any kind of meat of livestock, game, poultry, fish and other edible sea animals.
  • the meat may be e.g. pork, beef, mutton, kangaroo, chicken, turkey, ostrich, fish, molluscs, shark and shellfish etc.
  • “Meat product” refers to any material comprising meat or meat protein as an essential ingredient, such as sausages, hams, restructured meat products, surimi, etc.
  • the proteinaceous substrate may, in one embodiment be a meat substrate.
  • the proteinaceous food substrate contains or is derived from animal meat, such as mammalian, bird, or fish.
  • the proteinaceous food source is obtained from a mammal (commonly referred to as red meat), such as pork, lamb, beef, goat, horse, kangaroo etc.
  • the proteinaceous food substrate is obtained from a bird, such as poultry, such as chicken, turkey, ostrich.
  • the proteinaceous food substrate contains or is derived from fish, such as white fish, cod, haddock, coley etc, cartilaginous fish such as shark, swordfish, sea water fish, tuna, mackerel, sardines, anchovies, herring, salmon, freshwater fish, trout, etc.
  • the proteinaceous food substrate contains or is, or comprises, or is derived from meat selected from the group consisting of pork, lamb, chicken, beef, turkey, cod, kangaroo, ostrich, shark.
  • the proteinaceous food substrate is, or comprises, or is derived from pork, lamb, and chicken, most preferably pork.
  • pork refers to meat obtained from the carcass of a pig.
  • beef refers to meat obtained from the carcass of a cow (male of female bovine).
  • lamb refers to meat obtained from a sheep.
  • the meat substrate (or product) may contain at least 20%, at least 30%, at least 40% or at least 45 wt-% (wet) meat.
  • the meat substrate (or product) may contain up to 100% wt-% meat (wet), such as up to 50%, up to 60%, up to 70%, up to 80% and up to 90% meat.
  • 1 restructured meat substrate may in practice comprise up to 100 wt-% meat.
  • the proteinaceous substrate typically comprises water, such as between lwt% and 95wt% water.
  • Meat animal muscle typically comprises about 60-75% water, although meat from different sources and different species may contain differing amounts of water.
  • exogenous water is added to the proteinaceous substrate, for example water is added prior to or during steps a) and/ or b) of the method of the invention.
  • exogenous water is, for example water which is not naturally present in or derived from the meat obtained from the animal.
  • the amount of exogenous water is between 1% and 90% of the original weight of the proteinaceous substrate ⁇ i.e. prior to addition of exogenous water), such as between 10 and 80%.
  • the amount of exogenous or added water may be up to 90%, up to 80%, up to 70%, up to 60%, up to 50%, up to 40%, up to 30%, up to 20%, up to 10%.
  • the amount of added water may be at least 1%, such as at least 5%, such as at least 10%, such as at least 20%, such as at least 30%, such as at least 40%, such as at least 50%.
  • the exogenous water added to the substrate prior to or during the steps a) and/or b) may comprise other ingredients.
  • exogenous water may become incorporated into the proteinaceous substrate (such as meat substrate) by the method of the invention, to produce a product (such as a meat product) which has enhanced water content as compared to the proteinaceous substrate.
  • Excess water which has not been incorporated into the product may be separated and removed.
  • the method according to the invention may be used to enhance the water holding capacity of a meat product.
  • the water content of the proteinaceous substrate is increased by the enzymatic treatment according to the present invention.
  • the water content of the meat product obtained from the method according to the invention is higher that the water content of the meat substrate prior to enzymatic treatment.
  • the increase in water content may, in one embodiment be at least 1%, such as at least 5%, such as at least lOsuch as at least 15%, such as at least 20%.
  • the particle size of the comminuted meat depends on the type of meat product to be prepared.
  • the meat is cut into recognizable pieces with edges of usually several cm, whereas the meat in hams and sausages is usually ground, chopped and/or minced or otherwise homogenized.
  • ham contains coarsely ground meat with particles of several mm up to one or a few cm, whereas sausages contain finely ground meat.
  • the meat protein ⁇ i.e. present in the meat substrate may be in the form of mechanically separated or recovered meat, and/or meat which has been mechanically disrupted, e.g. by homogenised, mincing, grinding, dicing, liquidising etc (collectively referred to as "comminuting").
  • the proteinaceous food substrate is in the form of a meat slurry, reconstituted meat or emulsified meat.
  • the meat substrate contains from about 1 to about 30 percent by weight (“% w/w”) animal protein, based on the dry weight of such protein.
  • the meat substrate comprises, based on about 100% w/w of the food product, from about 1 % w/w to about 30% w/w muscle protein (myosin), from about 30% w/w to about 80% w/w water, up to about 50% w/w fat.
  • myosin muscle protein
  • the proteinaceous substrate such as meat substrate
  • Meat slurry is typically prepared by a process where the meat is first finely ground and mixed with water. The mixture is then used in a centrifuge or with an emulsifier to separate the fats and myoglobin from the muscle. The product is then allowed to settle into three layers: meat, excess water, and fat. The meat layer is then separated off and either used directly as a foodstuff in the preparation of food products, such as chicken nuggets, sausage, burgers, reconstituted meats etc, or stored for future use (e.g. by freezing).
  • MMM Mechanically separated meat
  • MRM mechanically recovered meat
  • a paste-like and batter-like meat product produced by forcing animal (e.g. beef, pork or chicken) bones, with attached edible meat, under high pressure through a sieve or similar device to separate the bone from the edible meat tissue. Since the advent of BSE disease, the use of mechanically separated meat is less favoured, and recovered meat is preferred.
  • Recovered meat refers to the residual meat trimmings which are extracted from bones and other carcass materials, without mixing the bone and meat tissues. This meat is comparable in appearance, texture, and composition to meat trimmings and similar meat products derived by hand. The meat is separated from bone by scraping, shaving, or pressing the meat from the bone without breaking or grinding the bone.
  • the "meat-substrate” comprises meat. In addition, it may, comprise "other ingredients” which encompass any conventional additives, such as NaCI, phosphates, and/or water. Further, the term other ingredients includes e.g.
  • salts other than NaCI and phosphates spices, preservatives, antioxidants, stabilizers, sugar, sweeteners, gums, binders, extenders, starch, dextrin-type of carbohydrates, animal or vegetable fats and oils, fat substitutes and/or other non- meat ingredients such as soy, casein, and whey, wheat proteins and other non- meat proteins etc.
  • the "meat-substrate” consists or comprises of meat and water.
  • the meat substrate may be communited meat.
  • meal product refers to the product prepared by the method according to the invention, wherein the proteinaceous substrate is a "meat substrate".
  • the proteinaceous protein-cross linked proteinaceous product may therefore be a meat product.
  • the product prepared by the method of the invention may be a meat product prepared by binding communited meat by the activity of a second enzyme (tyrosinase).
  • tyrosinase Such meat products may be referred to as restructured (reconstituted).
  • the communited meat is either before or during tyrosinase treatment, treated with a first enzyme according to the invention.
  • the meat product prepared may be a fat-reduced product containing 15-18 wt-% fat, or a low-fat meat product containing up to 10 wt-% fat, or a lean meat product containing up to 5 wt-% fat.
  • the fat content of the meat product is no more than 18 wt-%, preferably no more than 10 wt-%, and most preferably no more than 5 wt-% or even no more than 3 wt-%.
  • the meat product may comprise less than 2.0 wt-% of salt, preferably less than 1.5 wt-%.
  • Meat products comprising no more than 1.2 wt-% salt are generally considered as low-salt products.
  • the meat product of the invention therefore preferably contains no more than 1.2 wt-% salt, and, according to one embodiment of the invention, no more than 1.0 wt-%.
  • Salt in this respect refers to sodium chloride (NaCI).
  • the meat substrate and or product is essentially salt free - i.e. the concentration of phosphate is less than 0.1% wt% salt.
  • phosphates have increased during the last years, be- cause phosphates may be used to maintain the structure and water-binding ability of low-salt products.
  • industry normally adds 0.2 wt-% phosphate (measured as P 2 O 5 ) to a meat product, which corresponds to 0.34 wt-% trisodiumpyrophosphate.
  • the meat substrate and/or product of the present invention may contain less than 0.2 wt-% phosphate, preferably it contains no more than 0.1 wt-% added phosphate (measured as P 2 O 5 ).
  • the meat substrate and/or product is phosphate-free, i.e. no phosphate has been added.
  • the meat substrate and or product is essentially phosphate free - i.e. the concentration of phosphate is less than 0.1% wt% phosphate.
  • a "foodstuff” as used herein refers to an edible composition which forms part of the human or animal diet.
  • a foodstuff can be used directly as a food, or used in the preparation of a food product. It is preferable that the foodstuff according to the present invention is a proteinaceous foodstuff.
  • the foodstuff is a meat foodstuff, i.e. a foodstuff which comprises meat, such as the meat referred herein, such as meat selected from the group consisting of pork (pig), beef, turkey, chicken, lamb or fish.
  • meat foodstuffs are pork and chicken, most preferably pork.
  • the meat foodstuff is the meat substrate referred to herein, which may be prepared by the comminuting methods referred to herein.
  • Food product refers to an edible composition which consists or comprises of one or more "foodstuffs". Typically, a food product comprises several "foodstuffs" which are combined and processed into a food product which are purchased (or eaten) directly by the consumer. In this regards, in one aspect a “food product” refers to a processed foodstuff.
  • the protein-cross-linked proteinaceous product referred to herein is a (meat) food product, or is subsequently used in the preparation of a meat food product.
  • the food product may be selected from one or more of the following food product categories:
  • Cooked meat For example ham, loin, picnic shoulder, bacon, pork belly.
  • Emulsified products for cold and hot consumption for example mortadella, frankfurter, luncheon meat, pate
  • Fresh meat muscle Whole injected meat muscles, for example loin, shoulder ham, marinated meat.
  • Poultry products For example chicken or turkey breast or reformed poultry, chicken nuggets, chicken sausages.
  • Retorted products Autoclaved meat products, for example picnic ham, luncheon meat, emulsified products.
  • Vegetarian & meat analogues For example vegetarian sausages, nuggets, burgers
  • the present invention utilises a first enzyme to remove inhibitors of a second enzyme from a proteinaceous substrate (composition).
  • the first enzyme treatment may be performed prior to or even during the second enzyme treatment.
  • the invention therefore relates to an enzyme system, wherein the enzyme system comprises a first enzyme and a second enzyme, wherein the first enzyme is capable of removing the inhibitor of a second enzyme from a substrate, such as a proteinaceous substrate.
  • the invention provides for an enzyme system comprising a first enzyme and a second enzyme, in which the first enzyme is an enzyme capable of removing free thiols from a proteinaceous substrate, and the second enzyme is a tyrosinase.
  • the first enzyme and or the second enzyme is in isolated form.
  • isolated refers to the isolation of the enzyme from the environment it is naturally found in.
  • the first enzyme and or the second enzyme is in purified form.
  • purified first and/or enzymes are used, i.e. the enzymes are purified prior to being added to the composition of the invention.
  • Enzyme purity is preferably determined using SDS-PAGE and densitometry.
  • a purified enzyme is at least 10% pure, such as at least 20% pure, such as at least 30% pure, such as at least 40% pure, such as at least 50% pure. It is recognized that a purified enzyme may however be formulated with other proteins, for example mixed with protein stabilizers such as BSA or other enzymes, the assessment of enzyme purity therefore excludes proteins added to the enzyme after purification.
  • the purity of the each (first or second) enzyme is calculated as if the other enzyme were not present.
  • the first and second enzyme are present within the same enzyme composition.
  • the first enzyme is isolated from the second enzyme (prior to use).
  • the enzyme system may be a single pot (part) system or a multiple pot (parts) (e.g. two) pot system.
  • the enzyme system may therefore be provided in the form of a kit, said kit comprising a first pot (part) which comprises the first enzyme, and a second pot (part) which comprises the second enzyme.
  • pot or part refers to a single compartment, isolated from the other pot/parts/or compartment(s).
  • the amount of the first enzyme present in the enzyme system may, for example be at least 0.001mg/g, such as at least 0.01mg/g, such as at least 0.1mg/g, such as at least lmg/g, such as at least 3mg/g, such as at least 5mg/g, such as at least 10mg/g.
  • a dosage of about 15mg/g or higher may be appropriate, for example up to 25mg/g, 50mg/g, up to 100mg/g, up to 200mg/g or even up to 300mg/g.
  • the amount of the second enzyme present in the enzyme system may, for example be at least 0.001mg/g, such as at least 0.01mg/g, such as at least 0. lmg/g, such as at least lmg/g, such as at least 3mg/g, such as at least 5mg/g, such as at least 10mg/g, such as at least 50mg/g, such as at least 100mg/g, such as at least 200mg/g, or even higher, such as up to 500mg/g, such as up to 400mg/g, or, for example up to 25mg/g, 50mg/g, up to 100mg/g, up to 200mg/g or even up to 300mg/g.
  • the enzyme system is in the form of a food processing aid, for the enzymatic treatment of proteinaceous food products.
  • the enzyme system or systems may any other ingredient typically used in enzyme formulation, such as food enzyme composition ingredients or carriers - for example it may contain an extender such as maltodextrin, a carbohydrate based material, a silica based material, a protein, a protein hydrolysate and/or an other protein based material, such as BSA.
  • an extender such as maltodextrin, a carbohydrate based material, a silica based material, a protein, a protein hydrolysate and/or an other protein based material, such as BSA.
  • 10 mg of the mix could contain 0.015mg SOX, 2mg tyrosinase and 7.985 mg extender.
  • 100 mg of the mix could contain 0.015mg SOX, 2mg tyrosinase and 97.985 mg extender.
  • one would add lOmg of the mix pr. gram of protein to be treated in the latter case one would add 100 mg of the mix pr. g of protein to be treated. If one assumes that the protein content of the meat product to be treated is 3%, one would in the first case add 300 mg of enzyme mix to 1 kg of meat product in the latter case one would add 3000 mg pr kg of meat product.
  • the invention provides for the use of the enzyme system of the invention for the preparation of a proteinaceous foodstuff which has enhanced water retention; and/or
  • the invention provides for the use of the enzyme system of the invention for the preparation of a proteinaceous foodstuff which has enhanced gel-strength; and/or
  • the invention provides for the use of the enzyme system of the invention for the preparation of a proteinaceous foodstuff which has enhanced texture or mouth-feel.
  • Gel formation - gel strength The product of the invention, such as the protein cross-linked proteinaceous product, may have an improved gel strength as compared to either the proteinaceous substrate, or a comparative product prepared without a treatment step a).
  • the improvement of gel strength is at least Ig such as at least 2g, at least 3g, at least 4g, at least 5g.
  • the product of the invention such as the protein cross-linked proteinaceous product, may have an improved water holding capacity as compared to either the proteinaceous substrate, or a comparative product prepared without a treatment step a).
  • the water holding capacity has been improved by at least 1%, such as at least 5%, such as at least 10%, such as at least 20%.
  • the degree of protein cross-linking of the product of the invention may have a degree of protein cross-linking of at least 5%, such as at least 10%, such as at least 20%, such as at least 30%, such as at least 40%, such as at least 50%, such as at least 60%, such as at least 70%, such as at least 80%, such as at least 90%, as compared to a non-treated proteinaceous substrate.
  • the degree of protein cross- linking may be obtained by densitometry analysis of SDS-PAGE (reducing conditions may be used) of the protein extracts obtained from the product of the invention, as compared to the proteinaceous substrate.
  • the degree of protein cross linking of the myosin protein present in the product may have a degree of protein cross-linking of at least 5%, such as at least 10%, such as at least 20%, such as at least 30% such as at least 40%, such as at least 50%, such as at least 60%, such as at least 70%, such as at least 80%, such as at least 90%, as compared to a non-treated proteinaceous substrate.
  • Enzyme preparations are produced in varying degrees of purity from animal, plant, and microbial sources. They may consist of whole killed cells, parts of cells, or cell- free extracts. They may also contain carriers, solvents, preservatives, and antioxidants.
  • the enzyme preparations may be formulated as liquid, semi-liquid, or dry solid preparations. Food enzyme preparations have traditionally been added directly to food during processing. For many applications, the components of the preparation remain in the processed food product. In recent years, enzymes immobilized on solid supports have gained importance. Immobilized enzyme preparations may range from those that contain a highly specific, purified enzyme, to those that contain whole killed cells or structurally intact viable cells. For some enzymatic processes, co-immobilization of enzymes and cells may be advantageous. Immobilized enzyme preparations are not intended to become food components.
  • the first enzyme and or the second enzyme are immobilised.
  • the second enzyme is not immobilised, i.e. the enzyme, possibly in inactive (e.g. heat deactivated form), remains in the food product.
  • Embodiment 1 An enzyme system comprising a first enzyme and a second enzyme, in which the first enzyme is an enzyme capable of removing free thiols from a proteinaceous substrate, and the second enzyme is a tyrosinase.
  • Embodiment 2 The enzyme system according to embodiment 1, in which the first enzyme and or the second enzyme is in isolated or purified form.
  • Embodiment 3 The enzyme system according to any of the preceding embodiments, in which the first enzyme is an oxidase.
  • Embodiment 4 The enzyme system according to embodiment 1 in which the first enzyme has an EC code 1.8.3.2. or 1.8.3.3.
  • Embodiment 5 The enzyme system according to embodiment 1 in which the first enzyme is sulfhydryl oxidase.
  • Embodiment 6 The enzyme system according to embodiment 1 in which the first enzyme is laccase
  • Embodiment 7 The enzyme system according to embodiment 1 in which the first enzyme is glutathione oxidase
  • Embodiment 8 The enzyme system according to embodiment 1 in which the first enzyme is disulfide isomerase.
  • Embodiment 9 The enzyme system according to embodiments 1 to 8, in which the first and second enzyme are present within the same enzyme composition.
  • Embodiment 10 The enzyme system according to any of the preceding embodiments, in which the first enzyme is isolated from the second enzyme prior to use.
  • Embodiment 11 The enzyme system according to embodiment 10, wherein the enzyme system is provided in the form of a kit, said kit comprising a first pot which comprises the first enzyme, and a second pot which comprises the second enzyme.
  • Embodiment 12 The enzyme system according to any one of the preceding embodiments, wherein the first enzyme is present in the enzyme system, prior to use, at a concentration of between 0.001 and 300mg/g.
  • Embodiment 13 The enzyme system according to any one of the preceding embodiments, wherein the second enzyme is present in the enzyme system, prior to use, at a concentration of between 0.001 and 500mg/g.
  • Embodiment 14 The enzyme system according to any one of the preceding embodiments, wherein the enzyme system is in the form of a food processing aid, for the enzymatic treatment of proteinaceous food products.
  • Embodiment 15 The enzyme system according to embodiment 14, wherein the enzyme system comprises a further component, such as one or more food enzyme composition ingredients and/or carriers.
  • Embodiment 16 The use of the first enzyme according to any one of the preceding embodiments, for reducing the concentration of free thiols in a proteinaceous substrate.
  • Embodiment 17 The use of the first enzyme according to embodiment 16, in which the proteinaceous substrate is a proteinaceous foodstuff, which preferably comprises myosin.
  • Embodiment 18 The use of the first enzyme according to embodiment 17, in which the proteinaceous food substrate contains or is derived from animal meat, such as mammalian, bird, or fish.
  • Embodiment 19 The use of the first enzyme according to embodiment 17, in which the proteinaceous food substrate contains or is derived from meat selected from the group consisting of pork, lamb, chicken, beef, turkey, cod, kangaroo, ostrich, shark.
  • Embodiment 20 The use of the first enzyme according to embodiment 17, in which the proteinaceous food substrate is pork, lamb, and chicken, most preferably pork.
  • Embodiment 21 The use of the first enzyme according to any of embodiments 16 to 20, which results in a reduction in the free thiol concentration of the proteinaceous substrate is of at least 5%.
  • Embodiment 22 The use of the first enzyme according to any of embodiments 16 to 21, which results in a reduction in the free thiol concentration of the proteinaceous substrate by at least l ⁇ M.
  • Embodiment 23 The use of the first enzyme according to any of embodiments 16 to 22, in which the reduction in free thiol concentration of the proteinaceous substrate is sufficient to enhance the ability of a second enzyme to cross link the protein present in the substrate, such as myosin.
  • Embodiment 24 The use of the first enzyme according to embodiment 23, in which the second enzyme is as defined in any one of embodiments 1 - 15.
  • Embodiment 25 A method for the preparation of a protein cross-linked foodstuff, said method comprising the steps:
  • step a) is performed prior to, or simultaneous to step b), and wherein step b) results in the cross-linking of proteins present in said proteinaceous food product.
  • Embodiment 26 A method according to embodiment 25 in which the enzyme capable of degrading or oxidising free thiols is as according to the first enzyme as defined in any one of embodiments 1 - 15.
  • Embodiment 27 A method according to embodiment 25 or 26, wherein step a) comprises the use of the first enzyme as according to any one of embodiments 16 - 24.
  • Embodiment 28 A method according to any one of embodiments 25 - 27, wherein the step a) results in a reduction in the free thiol concentration of the proteinaceous food substrate of at least 5%.
  • Embodiment 29 A method according to any one of embodiments 25 - 28, wherein the step a) results in a reduction in the free thiol concentration of the proteinaceous food substrate by at least l ⁇ M.
  • Embodiment 30 A method according to any one of embodiments 25 - 29, wherein the step a) results in a reduction in free thiol concentration of the proteinaceous food substrate which is sufficient to enhance the ability of the second enzyme to cross link the protein present in the food substrate, such as myosin.
  • Embodiment 31 A method according to any one of embodiments 25 - 30, wherein the second enzyme is as defined in any one of embodiments 1 - 15.
  • Embodiment 32 A method according to any one of embodiments 25 - 31, wherein the proteinaceous food product is as defined in any one of embodiments 17 - 20.
  • Embodiment 33 A method according to any one of embodiments 25 -32, wherein the proteinaceous foodstuff comprises myosin, and the degree of cross- linking of the myosin protein present in the treated proteinaceous food products, subsequent to steps a) and b) is at least 5%.
  • Embodiment 34 A method according to any one of embodiments 25 -33, wherein the gel strength or water holding capacity, or both, of the proteinaceous foodstuff after steps a) and b) are enhanced compared to the untreated proteinaceous food product.
  • Embodiment 35 The foodstuff prepared by any one of embodiments 25 - 34.
  • Embodiment 36 The proteinaceous foodstuff according to embodiment 35, wherein the concentration of free thiols present in said food product is no greater than 15 ⁇ M, or no greater than lO ⁇ M, or no greater than 5 ⁇ M.
  • Embodiment 37 The proteinaceous according to embodiment 35 to 36 in which the gel strength has been enhanced by at least 2g.
  • Embodiment 39 The proteinaceous foodstuff according to any of embodiments 35 to 38 in which at least 10% of the total myosin is cross linked.
  • Embodiment 40 The proteinaceous foodstuff according to any of embodiments 35 to 39 in which the concentration of free thiols has been reduced by at least 2 ⁇ M.
  • Embodiment 41 The proteinaceous foodstuff according to any of embodiments 35 to 40 in which the proteinaceous foodstuff is derived from animal meat, such as mammalian, bird, or fish.
  • Embodiment 42 The proteinaceous foodstuff according to any of embodiments 35 to 41 in which the food product is free from artificial additives, particularly additives such as phosphates.
  • Embodiment 43 A processed food product comprising the proteinaceous foodstuff according to any one of embodiments 35 to 42.
  • Embodiment 44 The processed food product according to embodiment 43, wherein the food product is selected from the group consisting of cooked meat, dry & semi-dry cured meat products, fermented products, emulsified products, fish & seafood products, fresh meat muscle, ground/restructered fresh meat, reformed meat, poultry products, retorted products, autoclaved meat products, vegetarian & meat analogue products.
  • Embodiment 45 The use of the enzyme system according to any one of embodiments 1 - 15 for the preparation of a proteinaceous foodstuff which has enhanced water retention.
  • Embodiment 46 The use of the enzyme system according to any one of embodiments 1 - 15 for the preparation of a proteinaceous foodstuff which has enhanced gel-strength.
  • Embodiment 47 The use of the enzyme system according to any one of embodiments 1 - 15 for the preparation of a proteinaceous foodstuff which has enhanced texture or mouth-feel.
  • a method for the preparation of a cross-linked proteinaceous substrate comprising the steps:
  • step a) is performed prior to, or simultaneous to step b), and wherein step b) results in the cross-linking of proteins present in said proteinaceous substrate and wherein the first enzyme and the second enzyme is not the same enzyme.
  • Aspect 2 The method according to aspect 1, wherein the second enzyme is selected from the group consisting of a tyrosinase, laccase, lipoxygenase and protein lysin 6-oxidase (lysyl oxidase).
  • the second enzyme is selected from the group consisting of a tyrosinase, laccase, lipoxygenase and protein lysin 6-oxidase (lysyl oxidase).
  • Aspect 3 The method according to aspect 2, wherein the second enzyme is selected from the group consisting of lipoxygenase and protein lysin 6-oxidase (lysyl oxidase).
  • Aspect 4 The method according to any one of aspects 1-3, wherein the second enzyme is laccase.
  • Aspect 5 The method according to any one of aspects 1-3, wherein the second enzyme is a tyrosinase.
  • Aspect 6 The method according to any one of aspects 1-5, in which the first enzyme and/or the second enzyme is in isolated or purified form.
  • Aspect 7 The method according to any one of aspects 1-6, in which the first enzyme is an oxidase.
  • Aspect 8 The method according to any one of aspects 1-6, wherein the first enzyme is not laccase.
  • Aspect 9 The method according to any one of aspects 1-6, in which the first enzyme has an EC code 1.8.3.2. or 1.8.3.3.
  • Aspect 10 The method according to any one of aspects 1-6, in which the first enzyme is sulfhydryl oxidase.
  • Aspect 11 The method according to any one of aspects 1-6, in which the first enzyme is glutathione oxidase
  • Aspect 12 The method according to any one of aspects 1-6, in which the first enzyme is disulfide isomerase.
  • Aspect 13 The method according to any one of aspects 1 - 12, in which the proteinaceous substrate is a proteinaceous foodstuff, which preferably comprises myosin.
  • Aspect 14 The method according to aspect 13, in which the proteinaceous foodstuff contains or is derived from animal meat, such as mammalian, bird, or fish.
  • Aspect 15 The method according to aspect 14, in which the proteinaceous foodstuff contains or is derived from meat selected from the group consisting of pork, lamb, chicken, beef, turkey, cod, kangaroo, ostrich, shark.
  • Aspect 16 The method according to aspect 15, in which the proteinaceous foodstuff is selected from the group consisting of pork, lamb, and chicken, most preferably pork.
  • Aspect 17 The method according to any one of aspects 1-16, in which the first and second enzyme are present within the same enzyme composition.
  • Aspect 18 The method according to any one of aspects 1-17, in which the first enzyme is isolated from the second enzyme prior to use.
  • Aspect 19 The method according to any one of aspects 1-18, wherein the first enzyme and the second enzyme is provided as an enzyme system in the form of a kit, said kit comprising a first pot which comprises the first enzyme, and a second pot which comprises the second enzyme.
  • Aspect 20 The method according to aspect 19, wherein the first enzyme is present in the form of an enzyme system, prior to use, at a concentration of between 0.001 and 300mg/g.
  • Aspect 21 The method according to any one of aspects 19-20, wherein the second enzyme is present in the form of an enzyme system, prior to use, at a concentration of between 0.001 and 500mg/g.
  • Aspect 22 The method according to any one of aspects 19-21, wherein the enzyme system is in the form of a food processing aid, for the enzymatic treatment of proteinaceous food products.
  • Aspect 23 The method according to aspect 22, wherein the enzyme system comprises a further component, such as one or more food enzyme composition ingredients and/or carriers.
  • Aspect 24 The method according to any one of aspects 1-23, wherein the removal of free thiols in step a) results in a reduction in the free thiol concentration of the proteinaceous substrate of at least 5%.
  • Aspect 25 A method according to any one of aspects 1-24, wherein the removal of free thiols in step a) results in a reduction in the free thiol concentration of the proteinaceous substrate by at least l ⁇ M.
  • Aspect 26 Use of the first enzyme as defined in any one of the preceding aspects, for reducing the concentration of free thiols in a proteinaceous substrate.
  • Aspect 27 The use of the first enzyme according to aspect 26, in which the proteinaceous substrate is a proteinaceous foodstuff, which preferably comprises myosin.
  • Aspect 28 The use of the first enzyme according to aspect 27, in which the proteinaceous foodstuff contains or is derived from animal meat, such as mammalian, bird, or fish.
  • Aspect 29 The use of the first enzyme according to aspect 28, in which the proteinaceous foodstuff contains or is derived from meat selected from the group consisting of pork, lamb, chicken, beef, turkey, cod, kangaroo, ostrich, and shark.
  • Aspect 30 The use of the first enzyme according to aspect 29, in which the proteinaceous foodstuff is selected from the group consisting of pork, lamb, and chicken, most preferably pork.
  • Aspect 31 The use of the first enzyme according to any of aspects 26 to 30, which results in a reduction in the free thiol concentration of the proteinaceous substrate of at least 5%.
  • Aspect 32 The use of the first enzyme according to any of aspects 26 to 31, which results in a reduction in the free thiol concentration of the proteinaceous substrate by at least l ⁇ M.
  • Aspect 33 The use of the first enzyme according to any of aspects 26 to 32, in which the reduction in free thiol concentration of the proteinaceous substrate is sufficient to enhance the ability of a second enzyme to cross link the protein present in the substrate, such as myosin.
  • Aspect 34 The use of the first enzyme according to aspect 33, in which the second enzyme is as defined in any one of aspects 1 - 25.
  • a method for improving the enzymatic activity on a proteinaceous substrate comprising free thiols by a second enzyme, the activity of which is inhibited by the presence of free thiols comprising treatment of the proteinaceous substrate with a first enzyme capable of removing free thiols; wherein the treatment with the first enzyme is performed prior to, or simultaneous with a treatment with the second enzyme and wherein the first enzyme and the second enzyme is not the same enzyme.
  • Aspect 36 The method according to aspect 35, wherein the enzymatic activity results in the cross-linking of proteins present in said proteinaceous substrate.
  • Aspect 37 The method according to any one of the aspects 35-36, wherein the first enzyme is as defined in any one of aspects 1 - 26.
  • Aspect 38 The method according to any one of aspects 35-37, wherein the second enzyme is selected from the group consisting of tyrosinase, laccase, lipoxygenase, galactose oxidase, protein lysin 6-oxidase (lysyl oxidase), galactolipase and lysophospholipase,
  • Aspect 39 The method according to any one of aspects 35 - 38, wherein the proteinaceous substrate is as defined in any one of aspects 1 - 26.
  • a method for the preparation of a protein cross-linked foodstuff comprising the steps:
  • step b) treatment of the proteinaceous foodstuff with a second enzyme; wherein step a) is performed prior to, or simultaneous to step b), and wherein step b) results in the cross-linking of proteins present in said proteinaceous food product.
  • Aspect 41 The method according to aspect 40 in which the enzyme capable of degrading or oxidising free thiols is as defined in any one of aspects 1 - 25.
  • Aspect 42 The method according to aspect 40 or 41, wherein step a) comprises the use of the first enzyme according to any one of aspects 26 - 34.
  • Aspect 43 The method according to any one of aspects 40 - 42, wherein the step a) results in a reduction in the free thiol concentration of the proteinaceous foodstuff of at least 5%.
  • Aspect 44 The method according to any one of aspects 40 - 43, wherein the step a) results in a reduction in the free thiol concentration of the proteinaceous foodstuff by at least l ⁇ M.
  • Aspect 45 The method according to any one of aspects 40 - 44, wherein the step a) results in a reduction in free thiol concentration of the proteinaceous foodstuff which is sufficient to enhance the ability of the second enzyme to cross link the protein present in the food substrate, such as myosin.
  • Aspect 46 The method according to any one of aspects 40 - 45, wherein the second enzyme is as defined in any one of aspects 1 - 25.
  • Aspect 47 The method according to any one of aspects 40 - 46, wherein the proteinaceous food product is as defined in any one of aspects 27 - 30.
  • Aspect 48 The method according to any one of aspects 40 - 47, wherein the proteinaceous foodstuff comprises myosin, and the degree of cross-linking of the myosin protein present in the treated proteinaceous food products, subsequent to steps a) and b) is at least 5%.
  • Aspect 49 The method according to any one of aspects 40 -48, wherein the gel strength or water holding capacity, or both, of the proteinaceous foodstuff after steps a) and b) are enhanced compared to the untreated proteinaceous food product.
  • Aspect 50 The foodstuff prepared by any one of aspects 40 - 49.
  • Aspect 51 The proteinaceous foodstuff according to aspect 50, wherein the concentration of free thiols present in said food product is no greater than 15 ⁇ M, or no greater than lO ⁇ M, or no greater than 5 ⁇ M.
  • Aspect 52 The proteinaceous according to aspect 50 to 51, in which the gel strength has been enhanced by at least 2g.
  • Aspect 53 The proteinaceous foodstuff according to any of aspects 50 to 52, in which the water holding capacity has been enhanced by at least 5%, such as at least 10%.
  • Aspect 54 The proteinaceous foodstuff according to any of aspects 50 to 53, in which at least 10% of the total myosin is cross linked.
  • Aspect 55 The proteinaceous foodstuff according to any of aspects 50 to 54, in which the concentration of free thiols has been reduced by at least 2 ⁇ M.
  • Aspect 56 The proteinaceous foodstuff according to any of aspects 50 to 55, in which the proteinaceous foodstuff is derived from animal meat, such as mammalian, bird, or fish.
  • Aspect 57 The proteinaceous foodstuff according to any of aspects 50 to 56, in which the food product is free from artificial additives, particularly additives such as phosphates.
  • a processed food product comprising the proteinaceous foodstuff according to any one of aspects 50 to 57.
  • Aspect 60 The use of the method according to any one of aspects 1 - 25 for the preparation of a proteinaceous foodstuff which has enhanced water retention.
  • Aspect 61 The use of the method according to any one of aspects 1 - 25 for the preparation of a proteinaceous foodstuff which has enhanced gel-strength.
  • Aspect 62 The use of the method according to any one of aspects 1 - 25 for the preparation of a proteinaceous foodstuff which has enhanced texture or mouth- feel.
  • Minced meat from pork (3-7% fat), beef (9-12 % fat), lamb (8-10% fat), chicken (3-6% fat), turkey (3-7% fat), and cod (fat content unknown) were all purchased at local stores.
  • the meat-brine suspension was centrifuged for 60 min at 10000 g and
  • the fat particles were removed by filtering the supernatant through a 0.8 mm grid
  • the meat-protein extract (supernatant) was stored at -18°C
  • Dialysis was carried out in Slide-A-Lyzer Dialysis Cassette from Pierce (Order nr: 66810). The dialysis was carried out at 4°C overnight with one shift of dialysis buffer.
  • Ellmans Reagent I 3mM EDTA (0.558g); 0,2M Tris (12,14g) was dissolved in ca 400 ml water, and adjusted to pH to 8 with HCI and filled up to 500ml with water.
  • Ellmans Reagent II DTNB (Sigma D-8130) 8 mG was dissolved in 20 ml Ellmans I and stored in the dark and used within 1 day.
  • DTT dithiotreitol
  • Total nitrogen content in percent was determined according to the Kjeldahl method (Ma T S & Zuazaga G. Micro-Kjeldahl determination of nitrogen. Ind. Eng. Chem. (Analytical Edition) 14: 280-2, 1942). Protein content was determined by multiplying the total nitrogen % by the factor 6.25 (http://www.foodcomp.dk/fvdb_aboutfooddata_proximates.asp# Protein).
  • Enzyme treatment of the protein extracts prior to SDS-PAGE analysis was done as follows: Tyrosinase was added to a final concentration of 15.5 nkat/ml extract (corresponding to 0.015 mg tyrosinase per ml extract) and incubated for 60 min at 40 0 C. TGase was added to a final concentration of 2.5 nkat/ml extract (corresponding to 0.015 mg TGase pr. ml extract) and incubated for 60 min at 40 0 C.
  • sulfhydryl oxidase was added to a final concentration of 0.0033 (low sulfhydryl oxidase) or 0.033 (high sulfhydryl oxidase) nkat/ml. It was always added prior to or simultaneously with other enzyme treatment. If added prior to other enzyme treatment, an incubation time of 60 min at room temperature was applied.
  • SDS-PAGE was carried out on Pre-cast Novex Bis-Tris gels (Invitrogen, Carlsbad CA, USA) according to manufacturers' protocol. For non-reducing SDS-PAGE, DTT was left out of the sample buffer.
  • Heat induced meat protein gels were produced according to the following method :
  • a gel was produced by heating at 80 0 C for 60min
  • TPA analysis was carried out on the gel in the tube using Texture analyser (TI-XT2, Stable micro systems) with the following settings: Pre speed 2 mm/sek, Test sped 5 mm/sek, trigger force: 3g, travel distance 3 mm, time between compressions 5 sec, Load cell 5 kg, probe: PO.5
  • the water holding capacity (WHC) was calculated as follows:
  • W R is the weight of water released from the gel and W To t is the total weight of the gel
  • Figure 1 shows SDS-PAGE gels of all the meat protein extracts, which were produced. Each extract was treated with TGase (first lane of a specific extract), Tyrosinase (second lane of a specific extract) and no enzyme (third lane of a specific extract). The band at a MW of around 188 KDa is myosin.
  • FIG 2 shows SDS-PAGE analysis of extracts from pork, which were dialysed prior to electrophoresis.
  • the extract was dialysed against a brine solution similar to the brine used for the extraction except that it contained no STPP.
  • lanes 4-6 the extract was dialysed against a brine solution identical to the one used for extraction.
  • extracts were treated with both TGase (lane 1 and 4) and TrTyr2 (lane 2 and 5).
  • Table 1 lists the protein and free thiol concentration measured in each of the extracts (average of two determinations). The results show large differences in both protein and free thiol content of the different extracts. There does not seem to be any correlation between protein content and free thiol concentration. Free thiol content of pork and beef extracts after treatment with 0.033 nkat/ml sulfhydryl oxidase for 60 minutes was also determined.
  • Table 1 Protein content and free thiol concentration of the different protein extracts.
  • FIG. 3 shows SDS-PAGE analysis of pork (a) and beef (b) extracts, which were treated with sulfhydryl oxidase to remove free thiols before addition of cross- linking enzyme.
  • Figure 4 illustrates that both gel-strength and WHC of gels made from the different meat extracts are positively correlated with protein content. Note that this figure only depicts reference samples (no enzyme treatment). The gel made from cod extract was inhomogeneous, which gives large variations in gel strength measurement. However, it was consistently lower than for the other gels.
  • Figure 5a and b depicts gel strength and WHC of heat induced gels from different protein extracts with various enzymatic treatments.
  • Remarkably positive effects on gel strength were observed on gels from pork, chicken and lamb when treated with both sulfhydryl oxidase and TrTyr2.
  • treatment with sulfhydryl oxidase- ⁇ - Tyrosinase gave similar results as treatment with tyrosinase alone.
  • Gel strength results for cod were omitted due to very inhomogeneous gels.
  • the tendencies observed for gel WHC were similar to gel strength except that WHC for chicken gels was unaltered regardless of treatment. WHC for cod could be measured even though the gels were inhomogeneous. TGase treatments were run for reference.
  • TGase a well-known protein cross-linking enzyme
  • lane 1, 4, 7, 13, 16 in Figure 1 It is seen that TGase catalysed cross- linking is efficient in all extracts.
  • TGase activity was not influenced by any further treatment.
  • Myosin is a very conserved protein in the animal kingdom, and therefore the myosin substrate is considered to be equivalent between the different meat samples.
  • Phosphates are potential inhibitors of tyrosinase since they may collate with copper atoms, which are essential for catalytic activity of tyrosinases.
  • the phosphate STPP is present at a level of 0.3% in all extracts. However, it is unlikely that STPP is the cause of inhibition, since it is still present after dialysis. Moreover, it is present in extracts from all species, also the ones where tyrosinase catalysed cross-linking is efficient. Nevertheless, pork extract was dialysed against a solution free of STPP.
  • tyrosinase activity was spotted with and without different concentrations of cysteine in the assay medium. Tyrosinase was clearly inhibited by cysteine at concentrations above 10 ⁇ M. Subsequently, the free thiol content (which includes free cysteine) in the different protein extracts was measured (Table 1). It was observed that the highest concentration of free thiol was present in the extract from pork and that the concentration (18.4 ⁇ M) was substantially above the limit of inhibition observed with cysteine. It is not known how much of the free thiol present in the samples originates from free cysteine.
  • Protein extracts from different types of meat show very different characteristics with regard to tyrosinase catalysed cross-linking. The differences correlate to different levels of free thiol in the samples. Treating with sulfhydryl oxidase prior to tyrosinase treatment eliminated low efficiency of tyrosinase catalysed cross- linking in meat extracts with significant inhibition, such as extracts from pork.
  • Tyrosinase alone may improve both strength and WHC of heat induced protein gels made from extracts with a low free thiol content (beef and turkey). Such improvements in gels produced from extracts with high thiol content (pork and chicken) were only possible if free thiol was removed (by sulfhydryl oxidase) before tyrosinase action.
  • the concept is also applicable in whole meat products. This was shown by adding different combinations of SOX and tyrosinase to a model chicken sausage recipe containing minced chicken meat. It was shown that when tyrosinase was added subsequent to a SOX treatment, both product hardness and water holding capacity of the product increased significantly compared to the control product. This was not the case when any of the two enzymes were used alone. The tyrosinase-SOX combination produced significantly higher product hardness and water holding capacity than transglutaminase at a dose recommended by the supplier (results not shown).

Landscapes

  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Health & Medical Sciences (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • General Engineering & Computer Science (AREA)
  • Food Science & Technology (AREA)
  • Polymers & Plastics (AREA)
  • Nutrition Science (AREA)
  • Microbiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Meat, Egg Or Seafood Products (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

The invention relates to the enzymatic treatment of a proteinaceous substratewith a first enzyme, such as a sulfhydryl oxidase. The first enzyme removes enzyme inhibitors, such as free thiols, present in the proteinaceous substrate. The removal of the inhibitory compounds in the substrateallows for an effective enzymatic action of a second enzyme such as protein cross-linking of the protein present in the substrate by tyrosinase enzymes.

Description

TITLE OF INVENTION
IMPROVING ENZYMATIC TREATMENT OF A PROTEINACEOUS SUBSTRATE BY ENZYMATIC REMOVAL OF FREE THIOLS
FIELD OF THE INVENTION
The invention relates to the enzymatic treatment of proteinaceous substrates with a first enzyme, such as a sulfhydryl oxidase. The first enzyme removes enzyme inhibitors, such as free thiols, present in the proteinaceous substrate. The removal of the inhibitory compounds in the substrate allows for an effective enzymatic action of a second enzyme such as protein cross-linking of the protein present in the substrate by a tyrosinase.
BACKGROUND OF THE INVENTION
WO02/14484 and WO02/14595 reports on a tyrosinase enzyme isolated from Pseudomonadaceae, and its use for protein cross-linking, particularly of protein fibres which as wool fibres.
WO2006/084953 reports on a tyrosinase enzyme obtainable from Trichoderma spp. and its use in cross-linking food proteins.
Sulfhydryl oxidases catalyze the oxidation of sulfhydryl groups to disulfides, according to the general reaction : 2RSH + 02 -> RS-SR + H2O2
Numerous sulfhydryl oxidases are known in the art for example: Sulfhydryl oxidases derived from yeast are available commercially, for example from X-Zyme (Ervlp and Ervlp - Xl) GmbH (Duesseldorf/Germany)
Figure imgf000002_0001
z^mτe_xgjττ/d_e/Brø^uctsJτtrrjl); R. S. de Ia Motte and F. W. Wagner, Biochemistry 26 (1987)7363-7371 provides a sulfhydryl oxidase from Aspergillus niger; US 4,087,328 reports on a sulfhydryl oxidase prepared from milk; US 4,632,905 reports on a sulfhydryl oxidase obtained from Aspergillus sojae; US 4,894,340 reports on a sulfhydryl oxidase from Aspergillus niger; Hoober et al., 1996, Journal of Biological Chemistry 271 No 48 pp 30510-30516 provides a chicken egg white sulfhydryl oxidase.
The use of sulfhydryl oxidases in food preparation is known, for example for use in baking : EP 0 321 81 IB discloses that sulfhydryl oxidases may be used to strengthen dough, apparently in combination with a glucose oxidase. EP 0 705 538B reports that bovine and microbial sulfhydryl oxidases have been used as an enzyme additive for dough in the combination with a hemicellulose. WO 2006/046146 indicates sulfhydryl oxidase may be used in the preparation of a durum wheat flour baked product.
WO 2007/093674 reports on a method of preparing a low-ingredient meat product by adding tyrosinase, and to a low-ingredient meat product modified by tyrosinase. The tyrosinase is used to modify texture or water binding properties of low-ingredient meat products which have a low content of at least salt, phosphate or meat.
Lantto et al., LWT 389 (2006) 1117-1124 reports on the application of a microbial transglutaminase, mushroom tyrosinase and apple powder containing both polyphenol oxidase and transglutaminase, in pork meat. It reports that all enzyme preparations were able to improve gel hardness of unheated meat homogenates. Added cysteine affected positively on hardness of apple powder treated pork meat but negatively on the mushroom tyrosinase and microbial transglutaminase treated meats.
SUMMARY OF THE INVENTION
The present invention is based upon the discovery that inhibitory agents, such as free thiols, which are naturally present in proteinaceous substrates, such as proteinaceous foodstuffs, are responsible for the inhibition of several enzymes such as tyrosinases, and that the use of a first enzyme, which may be capable of reducing or eliminating such agents, such as sulfhydryl oxidases, allow enzymes such as tyrosinases inhibited by inhibitory agents to be utilised effectively for example to cross link protein present in the proteinaceous substrate, which may improve the gel strength, water holding capacity and/or improve the texture of the proteinaceous substrate.
In one aspect, the invention relates to the treatment of proteinaceous substrates with a first enzyme, such as a sulfhydryl oxidase prior to, or simultaneous with treatment with a second enzyme, the activity of which is inhibited by free thiols. The first enzyme removes enzyme inhibitors, such as free thiols, present in the proteinaceous substrate. The removal of the inhibitory compounds in the substrate may allow for a more effective action of the second enzyme, such as protein cross-linking of the protein present in the substrate by tyrosinase enzymes.
The invention provides in another aspect for a method for the preparation of a cross-linked proteinaceous substrate, said method comprising the steps:
a. treatment of a proteinaceous substrate comprising free thiols with a first enzyme capable of removing free thiols;
b. treatment of the proteinaceous substrate with a second enzyme, the activity of which is inhibited by free thiols;
wherein step a) is performed prior to, or simultaneous to step b), and wherein step b) results in the cross-linking of proteins present in said proteinaceous substrate.
The invention provides in another aspect for an enzyme system comprising a first enzyme and a second enzyme, in which the first enzyme is an enzyme capable of removing free thiols from a proteinaceous substrate, and the second enzyme is a tyrosinase.
The invention provides further for the use of a first enzyme for reducing the concentration of free thiols in a proteinaceous substrate, such as a sulfhydryl oxidase. The invention provides in another aspect for a method for improving the enzymatic activity on a proteinaceous substrate comprising free thiols by a second enzyme, the activity of which is inhibited by the presence of free thiols, said method comprising treatment of the proteinaceous substrate with a first enzyme capable of removing free thiols; wherein the treatment with the first enzyme is performed prior to, or simultaneous with a treatment with the second enzyme and wherein the first enzyme and the second enzyme is not the same enzyme.
In a further aspect, the invention provides for a method for the preparation of a cross-linked proteinaceous product, said method comprising the steps:
a. treatment of a proteinaceous substrate with a first enzyme capable of degrading or oxidising free thiols;
b. treatment of the proteinaceous substrate with a second enzyme;
wherein step a) is performed prior to, or simultaneous to step b), and wherein step b) results in the cross-linking of proteins present in said proteinaceous substrate.
The above method results in the preparation of a protein-cross linked proteinaceous product.
The proteinaceous substrate may be a proteinaceous foodstuff.
The proteinaceous product may be a proteinaceous protein cross-linked foodstuff.
The invention also provides for the cross linked proteinaceous product prepared by the above method, and, in the case where the proteinaceous substrate is a proteinaceous foodstuff, the invention also provides for food products which comprise the proteinaceous protein cross linked foodstuff product.
The invention also provides for a proteinaceous foodstuff or food product comprising myosin protein, which exhibits an enhanced water holding capacity and/or an increased gel strength, and in which at least a proportion of the myosin protein present in the proteinaceous food product is cross-linked. Water holding capacity and gel strength of the product may be compared to similar products made without use of the method of the invention, or as otherwise defined herein.
BRIEF DESCRIPTION OF FIGURES
Figure 1 : Meat extracts treated with TrTyr2 and TGase. The lanes contain the following extract/treatment: 1) turkey/TGase, 2) turkey/TrTyr2, 3) turkey/reference, 4) cod/TGase, 5) cod/TrTyr2, 6) cod/reference, 7) beef/TGase, 8) beef/TrTyr2, 9) beef/reference, 10) pork/TGase, 11) pork/TrTyr2, 12) pork/reference 13) chicken/TGase, 14)chicken/TrTyr2, 15) chicken/reference, 16) lamb/TGase, 17) lamb/TrTyr2, 18) lamb/reference.
Figure 2 : Pork extracts dialysed against buffers with (lanes 1-3) and without (lanes 4-6) STPP. Extracts are treated with TGase (lanes 1 and 4), with TrTyr2 (lanes 2 and 5) or are references (lanes 3 and 6).
Figure 3: SDS-PAGE gels of extracts treated with sulfhydryl oxidase before further enzyme treatment. "High SOX" stands for a treatment with 0.33U/ml. Low SOX stands for 0.033 nkat/ml. a) extracts from pork. Lanes contain (first enzyme treatment/second enzyme treatment): 1) high sulfhydryl oxidase/TGase, 2) high sulfhydryl oxidase/TrTyr2, 3) high sulfhydryl oxidase/no treatment, 4) low sulfhydryl oxidase/TGase, 5) low sulfhydryl oxidase/TrTyr2, 6) low sulfhydryl oxidase/ no treatment, 7) no treatment/TGase, 8) no treatment/TrTyr2, 9) no treatment/ no treatment, b) extracts from beef. Lanes contain (first enzyme treatment/second enzyme treatment) : 1) high sulfhydryl oxidase/TGase, 2) high sulfhydryl oxidase/TrTyr2, 3) high sulfhydryl oxidase/no treatment, 4) low sulfhydryl oxidase/TGase, 5) low sulfhydryl oxidase/TrTyr2, 6) low sulfhydryl oxidase/ no treatment, 7) no treatment/TGase, 8) no treatment/TrTyr2, 9) no treatment/ no treatment.
Figure 4 illustrates that both gel-strength and WHC of gels made from the different meat extracts are positively correlated with protein content. Note that this figure only depicts reference samples (no enzyme treatment). The gel made from cod extract was inhomogeneous, which gives large variations in gel strength measurement. However, it was consistently lower than for the other gels.
Figure 5: a: gel-strengths of different heat induced gels produced from protein extracts, which were treated with either water (Ref; n = 3), Tyrosinase alone (TrTyr2; n = 2), tyrosinase and sulfhydryl oxidase simultaneously (TrTyr2 + sulfhydryl oxidase; n = l) or transglutaminase (TGase n = 2). b: Similar to a but depicting WHC. Error bars represent the standard deviation.
DETAILED DESCRIPTION OF THE INVENTION
In one aspect a method is disclosed for the preparation of a cross-linked proteinaceous substrate, said method comprising the steps:
a. treatment of a proteinaceous substrate comprising free thiols with a first enzyme capable of removing free thiols;
b. treatment of the proteinaceous substrate with a second enzyme, the activity of which is inhibited by free thiols;
wherein step a) is performed prior to, or simultaneous to step b), and wherein step b) results in the cross-linking of proteins present in said proteinaceous substrate and wherein the first enzyme and the second enzyme is not the same enzyme.
In a further aspect, a method is disclosed for improving the enzymatic activity on a proteinaceous substrate comprising free thiols by a second enzyme, the activity of which is inhibited by the presence of free thiols, said method comprising treatment of the proteinaceous substrate with a first enzyme capable of removing free thiols; wherein the treatment with the first enzyme is performed prior to, or simultaneous with a treatment with the second enzyme and wherein the first enzyme and the second enzyme is not the same enzyme.
The present inventors have found that the inhibition of tyrosinase enzymes in proteinaceous substrates may be due to the presence of free thiols present in the proteinaceous substrate. The present invention is based upon the removal of at least part of the free thiol content of the proteinaceous substrate, thereby alleviating, at least partially, the inhibition of the second enzyme such as tyrosinase.
The invention is particularly relevant to the meat processing industry, where tyrosinases are considered as suitable processing aids for increasing water retention, improving gel strength and improving texture and mouth-feel of processed meat products.
Enzymatic treatment
The invention provides for a method for the preparation of a cross-linked proteinaceous substrate, said method comprising the steps:
a. treatment of a proteinaceous substrate comprising free thiols with a first enzyme capable of removing free thiols;
b. treatment of the proteinaceous substrate with a second enzyme, the activity of which is inhibited by free thiols;
wherein step a) is performed prior to, or simultaneous to step b), and wherein step b) results in the cross-linking of proteins present in said proteinaceous substrate and wherein the first enzyme and the second enzyme is not the same enzyme.
The invention further provides for a method for the preparation of a cross-linked protein product, such as protein cross-linked foodstuff, said method comprising the steps:
a. treatment of a proteinaceous substrate with a first enzyme capable of degrading or oxidising free thiols;
b. treatment of the proteinaceous substrate with a second enzyme; wherein step a) is performed prior to, or simultaneous to step b), and wherein step b) results in the cross-linking of proteins present in said proteinaceous substrate to produce the cross-linked protein product.
The invention further provides for a method for improving the enzymatic activity on a proteinaceous substrate comprising free thiols by a second enzyme, the activity of which is inhibited by the presence of free thiols, said method comprising treatment of the proteinaceous substrate with a first enzyme capable of removing free thiols; wherein the treatment with the first enzyme is performed prior to, or simultaneous with a treatment with the second enzyme and wherein the first enzyme and the second enzyme is not the same enzyme.
In one embodiment, the treatment with the first enzyme such as in step a) results in a reduction in the free thiol concentration of the proteinaceous substrate of at least 5%.
In one embodiment, the treatment with the first enzyme such as in step a) results in a reduction in the free thiol concentration of the proteinaceous substrate by at least lμM.
In one embodiment, the treatment with the first enzyme such as in step a) results in a reduction in free thiol concentration of the proteinaceous substrate which is sufficient to enhance the ability of the second enzyme to cross link the protein, which may be myosin, present in the substrate, such as a proteinaceous foodstuff.
Cross-linking of protein present in the cross-linked proteinaceous product may be determined by SDS-PAGE analysis of i) the proteins present in the proteinaceous substrate as compared to ii) the cross-linked proteinaceous product of the invention obtained by the method of the invention. An increase in the average size of proteins in the SDS-PAGE in ii) as compared to i) is indicative of a protein cross- linked product. Reduced SDS-PAGE is appropriate as the protein cross-links formed by the activity of tyrosinase are not affected by reducing agents such as dithiothreitol or mercaptoethanol. In one embodiment, the proteinaceous foodstuff comprises myosin, and the degree of cross-linking of the myosin protein present in the treated {i.e. cross- linked) proteinaceous food products, subsequent to steps a) and b) is at least 5%.
The above method can be used for enhancing the gel strength or water holding capacity, or both, of the proteinaceous substrate (e.g. foodstuff) - so that after steps a) and b) are performed one or more of these parameters are enhanced in the protein cross linked proteinaceous product as compared to the proteinaceous substrate.
The First Enzyme
The first enzyme is typically selected as an enzyme which is capable of alleviating the inhibition of the second enzyme within a proteinaceous substrate, such as a meat extract, for example a pork meat extract. The examples provide protocols of how such meat extracts may be performed. The tyrosinase spot assay, as disclosed in the examples, may be used to measure tyrosinase inhibition, and alleviation thereof, using either free cysteine as a control inhibitor, or a meat extract, such as a pork meat extract as prepared according to the examples.
From the present analysis, it is considered that one of, or the key inhibitor species present in proteinaceous substrates is free thiol, such as free cysteine. Therefore, in such an embodiment, the enzyme, which is capable of removing free thiols from a proteinaceous substrate, is referred to as the 'first enzyme' herein.
It should be recognised that the term 'removing free thiols' refers to the decrease (i.e. reduction) in concentration of free thiols present in the proteinaceous substrate, which may, suitably, be performed using a first enzyme, which may be an oxidase.
It should therefore be considered that the term Yemoving free thiols' does not relate, necessarily, to the preparation of proteinaceous substrates/products which lack any free thiols, just that the concentration of free thiols is reduced. In one embodiment, the term Yemoving free thiols' or 'reducing the concentration of free thiols' refers to the 'oxidation of free thiols'.
Therefore, the invention provides for the use of the first enzyme, for reducing the concentration of free thiols in a proteinaceous substrate, such as a proteinaceous foodstuff.
The removal of free thiols from the proteinaceous substrate may be performed using an enzyme, which is capable of removing free thiols from a proteinaceous substrate. Such enzymes may be identified using a free thiol depletion assay. In one embodiment, the free thiol depletion assay is used with a minced pork substrate extraction prepared as according to the Examples.
One unit of enzyme activity is defined as the amount of enzyme that consumes 1 μmol of free thiol groups, such as free cysteine or glutathione, per minute with 1 mM as substrate at pH 7.4 and 3O0C in phosphate buffer.
The catalytic activity may also be defined in katal (SI unit for catalytic activity) which is the amount of enzyme needed to convert 1 mol of substrate pr. second at a pre-defined substrate concentration, temperature and pH.
Thus 1 nkat/g is equivalent to a specific enzyme activity of 0.06 units/g or 1 unit/g is equivalent to 16.6nkat/g.
One method of removing free thiols from a proteinaceous substrate is to oxidise the free thiol component, or part thereof - therefore in such an embodiment, the first enzyme is preferably an oxidase (oxido-reductase) enzyme.
In one embodiment, the first enzyme is an oxidase enzyme, such as an enzyme which exhibits one or more of the following activities: sulfhydryl oxidase, laccase (E. C. 1.10.3.2), glutathione oxidase, and disulphide isomerase.
In one embodiment, the first enzyme exhibits an enzyme activity selected from the group consisting of: EC 1.8.3.2 and 1.8.3.3. In one embodiment, the first enzyme is a sulfhydryl oxidase, or exhibits sulfhydryl oxidase activity, i.e. E. C. 1.8.3.2.
In one embodiment, the first enzyme is an enzyme capable of generating hydrogen peroxide, such as a carbohydrate oxidase, such as glucose oxidase or hexose oxidase. In such as embodiment, the inventors consider that the hydrogen peroxide generated oxidises the free thiols present, thereby alleviating the inhibition of the tyrosinase.
The term sulfydryl oxidase (SOX) is defined by the enzyme classification E. C. 1.8.3.2 as set out by the Nomenclature Committee of the International Union of Biochemistry and Molecular Biology (IUBMB) as an enzyme which converts thiol compounds to their corresponding disulfides according to the equation : 2 RSH + O2 → RSSR + H2O2.
Numerous sulfhydryl oxidases are known in the art, and may be used for the purposes of the present invention. In one embodiment, the sulfhydryl oxidase may be isolated from, or derived from a microbial source, such as a fungus, such as yeast or Aspergillus. EP 0 321 881 EP 0 338 452 and EP 0 705 538 report on the use of microbial sulfydryl oxidases in bakery application.
A preferred sulfhydryl oxidase may be derived from Aspergillus niger, such as the sulfydryl oxidase described in de Ia Motte and Wagner Biochemistry 26 (1987) 7363 - 737.
US 4,632,905, provides a sulfydryl oxidase from Aspergillus sojae hereby incorporated by reference.
Other sulfydryl oxidases include bovine sulfydryl oxidase.
Aspergillus SOX Enzymes - NCBI Accession Numbers - The following records are hereby incorporated by reference.
1: CAB58940. unnamed protein p ... [gi : 6090366]
2: EAU34803. FAD-linked sulfhy ... [gi : 114193103 ]
3: XP_754731. FAD dependent sul ... [gi : 71000028 ]
4: XP 749041. FAD dependent sul ... [gi : 70987121 ] 5: XP_001213534. FAD-linked sulfhy ... [gi : 115395790 ]
6: EAL92693. FAD dependent sul ... [gi : 66852368 ]
7: EAL87003. FAD dependent sul ... [gi : 66846671 ]
8: XP_001273306. FAD dependent sul ... [gi : 121711381 ]
9: XP_001270904. FAD dependent sul ... [gi : 121705282 ]
10: EAW11880. FAD dependent sul ... [gi : 119401457 ]
11: EAW09478. FAD dependent sul ... [gi : 119399050 ]
12: CAK40401. sulphydryl oxidas ... [gi : 134078459]
13: XP_001401908. hypothetical prot ... [gi : 145257982 ]
14: CAK38806. unnamed protein p ... [gi : 134074512 ]
15: CAL00471. unnamed protein p... [gi 134083103]
16: CAK49098. unnamed protein p... [gi 134078570]
17: XP_001397560. hypothetical prot.. [gi:145252094]
18: BAE55270. unnamed protein p ... [gi : 83765127 ]
19: XP_001402401. hypothetical prot.. [gi:145256027]
20: XP 001208942. augmenter of live.. [gi:115384790]
21: EAU38334. augmenter of live ... [gi : 114196634 ]
22: XP_661363. hypothetical prot. . [gi:67526603]
23: XP 660631. hypothetical prot. . [gi:67525139]
24: EAA63598. hypothetical prot.. [gi:40744422]
25: EAA59967. hypothetical prot ... [gi : 40740777 ]
Yeast SOX - Enzymes - NCBI Accession Numbers- The following records are hereby incorporated by reference.
i EDN61625sulfhydryl oxidas... [gi : 151943312 ]
2 EDN61173sulfhydryl oxidas... [gi : 151942827 ] 3 P27882Mitochondrial FAD. [gi:2506175] 4 Q12284FAD-linked sulfhy. [gi:2492823] 5 lJRA_DChain D, Crystal . [gi:18158801] 6 lJRA_CChain C, Crystal . [gi:18158800] 7 lJRA_BChain B, Crystal . [gi:18158799] lJRA_AChain A, Crystal . [gi:18158798]
9 lJR8_BChain B, Crystal [gi:18158797]
10 lJR8_AChain A, Crystal ... [gi:18158796]
11 P55789FAD-linked sulfhy.. [gi:2492821]
12 CAA92143unknown [Saccharo... [gi:1072405]
13 AAB48659regulatory protei ... [gi: 172378]
14 CAB16284sulfhydryl oxidas... [gi:2408079]
15 P36046Intermembrane spa.. [gi:90110034]
16 CAB46757sulfhydryl oxidas... [gi:5441486]
17 NP_011543Ervlp [Saccharomy... [gi:6681846]
18 NP_015362Erv2p [Saccharomy... [gi:6325296]
19 CAA97017ERV1 [Saccharomyc ... [gi:1945314]
20 CAA97016ERV1 [Saccharomyc.. [gi:1945313]
21 CAA48192ERV1 [Saccharomyc.. [gi:404218]
22 CAA94987unknown [Saccharo... [gi:1314111]
23 CAA43129regulatory protei... [gi:4305]
24 CAH56919unnamed protein p... [gi:52747921]
25 NP_005685COX17 homolog, cy... [gi:5031645]
26 XP_570710thiol oxidase [Cr... [gi:58267108]
27 AAW43403thiol oxidase, pu ... [gi:57226944]
28 CAL00471unnamed protein p... [gi:134083103]
29 NP_005253ervl-like growth ... [gi:54112432]
30 CAK38806unnamed protein p ... [gi : 134074512 ]
31 XP 001397560hypothetical prot ... [gi : 145252094 ] 32: AAA96390ERV1 [Homo sapien ... [gi : 6136037]
33: CAD25469PROTEIN OF THE ER... [gi: 19069001]
34: XP_001644445hypothetical prot ... [gi:156842152]
35: XP_001642797hypothetical prot... [gi:156837548]
36: ED016587hypothetical prot... [gi: 156115088]
37: ED014939hypothetical prot... [gi: 156113366]
38: XP_001382524predicted protein... [gi:150863891]
39: XP_001383309predicted protein... [gi:126133569]
40: ABN64495predicted protein ... [gi : 149385147]
41: ABN65280predicted protein ... [gi : 126095458]
42: XP_570522hypothetical prot... [gi :58266732]
43: AAW43215conserved hypothe ... [gi : 57226755]
A suitable sulfyhryl oxidase is provided by EP 0 565 172, hereby incorporated by reference, as shown in SEQ ID NO 1
SEQ ID NO 1 :
>gi I 134078459 I emb ICAK40401.1 I sulphydryl oxidase Sox from patent EP565172- Al-Aspergillus niger
MAPKSLFYSLFSTISVALASSIPQTDYDVIWGGGPAGLSVLSSLGRMRRKTVMFDSGEYRNGVTREMHD VLGFDGTPPAQFRGLARQQISKYNSTSVIDIKIDSITPVEDAAANSSYFRAVDANGTQYTSRKWLGTGL VDVI PDVPGLREAWGKGIWWCPWCDGYEHRDEPLGILGGLPDWGSVMETHTLYSDI IAFTNGTYTPANE VALAAKYPNWKQQLEAWNVGIDNRSIASIERLQDGDDHRDDTGRQYDIFRVHFTDGSSWRNTFITNYPT AQRSTLPEELSLVMVDNKIDTTDYTGMRTSLSGVYAVGDCNSDGSTNVPHAMFSGKRAGVYVHVEMSREE SNAAISKRDFDRRALEKQTERMVGNEMEDLWKRVLENHHRRS
Laccase (EC 1.10.3.2) has been reported to oxidize SH groups directly (Ref: Applied and Environmental Microbiology, February 2000, p. 524-528, Vol. 66, No. 2). Therefore, in one embodiment, the first enxyme is a laccase, or exhibits laccase activity.
The term "laccase activity" is defined by the enzyme classification EC 1.10.3.2
(laccase) as set out by the Nomenclature Committee of the International Union of Biochemistry and Molecular Biology (IUBMB); or enzyme classification EC 1.10.3.1 (catechol oxidase), enzyme classification EC 1.10.3.4 (o- aminophenol oxidase), or enzyme classification EC 1.3.3.5 (bilirubin oxidase).
Numerous laccase enzymes are known in the art, for example those disclosed in : WO2007/054034A - which reports on a laccase from Streptomyces coelicolor, particularly the laccase represented by 1 to 343 of SEQ ID NO: 2 of WO2007/054034A, hereby incorporated by reference. In one embodiment, of the invention the oxidase is a laccase, such as a Polyporus sp. laccase such as the Polyporus pinisitus laccase (also called Trametes villosa laccase) described in WO 96/00290 (from Novo Nordisk Biotech., inc.) or a Myceliophthera sp. laccase especially the Myceliophthera thermophila laccase described in WO 95/33836 (from Novo Nordisk Biotech inc.). Further, the laccase may be a Scytalidium sp. laccase, such as the S. thermophilium laccase described in WO 95/33837 (from Novo Nordisk Biotech inc.) or a Pyricularia sp. laccase, such as the Pyricularia oryzae laccase which can be purchased from SIGMA under the trade name SIGMA no. L5510, or a Coprinus sp. laccase, such as a C. cinereus laccase, especially a C. cinereus IFO 30116 laccase, or a Rhizoctonia sp. laccase, such as a Rh. solani laccase, especially the neutral Rh. solani laccase described WO 95/07988 (from Novo Nordisk A/S) having a pH optimum in the range from 6.0 to 8.5. The laccase may also be derived from a fungi such as Collybia, Fomes, Lentinus, Pleurotus, Aspergillus, Neurospora, Podospora, Phlebia, e. g. P. radiata (WO 92/01046), Coriolus sp., e. g. C. hirsitus (JP 2-238885), or Botrytis. Further laccases are disclosed in WO01/83770.
The term "glutathione oxidase" (GOX) is defined as enzyme classification (E. C. 1.8.3.3) as set out by the Nomenclature Committee of the International Union of Biochemistry and Molecular Biology (IUBMB) as an enzyme which catalyses the reaction 2 glutathione + 0(2) = oxidized glutathione + 1-1(2)0(2), and may also catalyse the oxidation of cysteine and several other thiols. In one embodiment, glutathione activity may be determined by measuring the disappearance of glutathione in buffer solution in the presence of oxygen. In such an embodiment, one λGOX' unit is the amount of enzyme needed to oxidize 1 μmole glutathione per minute at 300C and pH 7.
First enzyme dosages:
In one embodiment, the first enzyme has a specific activity of at least 0.01nkat/mg, such as at least O.lnkat/mg, such as at least lnkat/mg, such as at least 10nkat/mg, such as at least 50nkat/mg, such as at least 100nkat/mg, such as at least 200nkat/mg, such as at least 300nkat/mg. In one embodiment, the first enzyme has a specific activity of no greater than 500nkat/mg, such as no greater than 300nkat/mg, such as no greater than 100nkat/mg, such as no greater than 10nkat/mg, such as no greater than 5nkat/mg, such as no greater than lnkat/mg.
In one embodiment, the first enzyme is added to the proteinaceous substrate, in an amount of between 0.00001mg/g and 100mg/g of proteinaceous substrate, such as between 0.01mg/g and 10mg/g, such as between 0.10mg/g and 5mg/g. In one embodiment, at least O.OOOOlmg of the first enzyme is added per g of proteinaceous substrate, such as at least 0.0001mg/g, such as at least 0.001mg/g, such as at least 0.01mg/g. In one embodiment, up to lOmg of the first enzyme is added per g of proteinaceous substrate, such as up to 5mg/g, such as up to 1 mg/g, such as up to 0.5mg/g, such as up to 0.2mg/g.
In one embodiment, the amount of first enzyme added is between 0.01 and 1 nkat/g of proteinaceous substrate (or foodstuff), such as between 0.02 and 0.5nkat/g.
The second enzyme
The removal of the inhibitory compounds in the proteinaceous substrate may allow for a more effective action of the second enzyme, such as a more effective protein cross-linking of the protein present in the substrate e.g. by tyrosinase.
In one embodiment, the second enzyme is an enzyme which catalytic action is inhibited by the presence of free thiols. In one embodiment, the catalytic action of the second enzyme such as tyrosinase in a proteinaceous substrate will result in cross-linking of proteins.
In one embodiment, the term "improvement" is defined by an increase in the catalytic activity of the second enzyme in the product treated according to the invention as compared to the catalytic activity of the second enzyme in the product without treatment with the first enzyme.
In one embodiment, the term "improvement" is defined by a change in a measurable parameter (such as gel strength), which will be perceived as an improvement by the manufacturer or consumer. In one embodiment, the term "improvement" is defined by an improvement in water holding capacity in the product treated according to the invention as compared to the water holding capacity in the product without treatment with the first enzyme.
In another embodiment, the term "improvement" is defined by an improvement in cross-linking in the product treated according to the invention as compared to the cross-linking in the product without treatment with the first enzyme.
In another embodiment, the term "improvement" is defined by an improvement in the texture of the product treated according to the invention as compared to the texture of the product without treatment with the first enzyme.
In one embodiment, the enzymatic activity results in the cross-linking of proteins present in a proteinaceous substrate such as meat. An example of a second enzyme which is suitable for use for cross-linking of proteins in a proteinaceous substrate such as meat is tyrosinase.
In one embodiment, the first enzyme and the second enzyme is not the same enzyme.
In one embodiment, the second enzyme is selected from the group consisting of a tyrosinase, laccase, lipoxygenase, galactose oxidase, protein lysin 6-oxidase (lysyl oxidase), galactolipase and lysophospholipase,
In one embodiment, the second enzyme is selected from the group consisting of a tyrosinase, laccase, lipoxygenase and protein lysin 6-oxidase (lysyl oxidase), In a further embodiment, the second enzyme is selected from the group consisting of lipoxygenase and protein lysin 6-oxidase (lysyl oxidase). In a further embodiment, the second enzyme is laccase. Most preferably the enzyme is a tyrosinase belonging to the group described by the EC number: 1.14.18.1.
In one aspect, the second enzyme is tyrosinase, which is defined by the enzyme classification EC E. C. 1.14.18.1 as set out by the Nomenclature Committee of the International Union of Biochemistry and Molecular Biology (IUBMB) (also referred to a monophenyl monoxoygenase).
Tyrosinase belongs to the group of phenol oxidases, which use oxygen as electron acceptor. Traditionally tyrosinases can be distinguished from other phenol oxidases, i.e. laccases, on the basis of substrate specificity and sensitivity to inhibitors. However, the differentiation is nowadays based on structural features. Structurally the major difference between tyrosinases and laccases is that tyrosinase has a binuclear copper site with two type III coppers in its active site, while laccase has altogether four copper atoms (type I and M coppers, and a pair of type III coppers) in the active site. Tyrosinase oxidizes various phenolic compounds to the corresponding quinones. The quinones are highly reactive and may react further non- enzymatically. A typical substrate of tyrosinase is tyrosine (or tyrosine residue in proteins), which is first hydroxylated into DOPA (dihydroxyphenylalanine or DOPA residue in proteins)), which is then further oxidized by the enzyme to dopaquinone (or dopaquinone residue in proteins).
Dopaquinone may react non-enzymatically with a number of chemical structures, such as other dopaquinones, thiol and amino groups. Tyrosinase thus has two enzyme activities in one and the same protein, i.e. monophenol monooxyganase activity (EC 1.14.18.1) and catechol oxidase activity (EC 1.10.3.1) as shown below.
Figure imgf000018_0001
The substrate specificity of tyrosinase is relatively broad, and the enzyme is capable of oxidizing a number of polyphenols and aromatic amines. Contrary to laccase (EC 1.10.3.2), however, tyrosinase does not oxidize syringaldazin. At least tyrosine, lysine and cysteine residues in proteins form covalent bonds with active dopaquinones catalysed by tyrosinase.
Tyrosinase activity can be measured by techniques generally known in the art. L- DOPA or L-tyrosine can be used as a substrate, whereafter dopachrome formation may be monitored spectrofotometrically, or alternatively substrate consumption may be monitored by following the oxygen consumption.
Tyrosinases are widely distributed in nature, and they are found in animals, plants, fungi and bacteria. Especially vegetables and fruits susceptible of browning are rich in tyrosinase. The only commercialiy available tyrosinase at present is derived from the mushroom Agaricus bisporus. The tyrosinase used in the present invention may originate from any animal, plant, fungus or microbe capable of producing tyrosinase. According to one embodiment of the invention, the tyrosinase is derived from a filamentous fungus. It may for example be an extracellular tyrosinase obtainable from Trichoderma reesei (WO 2006/084953) hereby incorporated by reference.
Tyrosinases catalyse the reaction L-tyrosine + L-dopa + 0(2) --> L-dopa + dopaquinone + 1-1(2)0.
In one embodiment, the tyrosinase is isolated or derived from a fungal species, such as Trichoderma or Hypocrea.
Selinheimo et al., FEBS Lett. 273, 4322-4335 (2006), hereby incorporated by reference, provides a tyrosinase from Trichoderma.
In one embodiment, the tyrosinase is as disclosed in SEQ ID NO 2, taking into account co- and post-translational modifications, such as signal peptide cleavage:
SEQ ID NO 2
>gi I 118764455 I emb ICAL90884.1 I tyrosinase 2 [Hypocrea jecorina]
MLLSASLSALALATVSLAQGTTHIPVTGVPVSPGAAVPLRQNINDLAKSGPQWDLYVQAMYNMSKMDSHD PYSFFQIAGIHGAPYIEYNKAGAKSGDGWLGYCPHGEDLFI SWHRPYVLLFEQALVSVAKGIANSYPPSV RAKYQAAAASLRAPYWDWAADSSVPAVTVPQTLKINVPSGSSTKTVDYTNPLKTYYFPRMSLTGSYGEFT GGGNDHTVRCAASKQSYPATANSNLAARPYKSWIYDVLTNSQNFADFASTSGPGINVEQIHNAIHWDGAC GSQFLAPDYSGFDPLFFMHHAQVDRMWAFWEAIMPSSPLFTASYKGQSRFNSKSGSTITPDSPLQPFYQA NGKFHTSNTVKSIQGMGYSYQGIEYWQKSQAQIKSSVTTIINQLYGPNSGKKRNAPRDFLSDIVTDVENL IKTRYFAKISVNVTEVTVRPAEINVYVGGQKAGSLIVMKLPAEGTVNGGFTIDNPMQSILHGGLRNAVQA FTEDIEVEILSKDGQAIPLETVPSLSIDLEVANVTLPSALDQLPKYGQRSRHRAKAAQRGHRFAVPHIPP L
The full sequence and the details of the signal peptide processing are described in WO06/084953, hereby incorporated by reference.
One unit of tyrosinase activity - 1 nkat is defined as the amount of enzyme that converts 1 nmol of L-DOPA into DOPA-quinone pr. second at pH 7 and 250C.
In one embodiment, the second enzyme is a laccase as defined above.
In one embodiment, the second enzyme is a lipoxygenase defined by the enzyme classification EC 1.13.11. Lipoxygenases are a class of iron-containing dioxygenases, which catalyzes the hydroperoxidation of lipids, containing a cis,cis- 1,4-pentadiene structure. The primary products are hydroperoxy fatty acids, which usually are rapidly reduced to hydroxy derivatives.
In one embodiment, the second enzyme is galactose oxidase. A galactose oxidase enzyme catalyzes the stereospecific oxidation of primary alcohols to the corresponding aldehydes. The biologically most relevant substrate of the enzyme is not known as the enzyme exhibits broad substrate specificity. In one embodiment, galactose is a substrate.
In one embodiment, the second enzyme is a lysin 6-oxidase (lysyl oxidase) defined by the enzyme classification EC 1.4.3.13. A lysyl oxidase is an extracellular copper-dependent enzyme that catalyzes the oxidative deamination of peptidyl lysine residues in precursors of various collagens and elastins. The deaminated lysines are then able to form aldehyde cross-links.
In one embodiment, the second enzyme is a galactolipase defined by the enzyme classification E. C. 3.1.1.26. A galactolipase is capable of hydrolysing at least 1,2- diacyl-3-beta-D-galactosyl-sn-glycerol. Generally galactolipases are also able to hydrolyse 2,3-di-0-acyl-l-0-(6-0-α-D-galactosyl-β-D-galactosyl)-D-glycerol, and phosphatidylcholine and other phospholipids. However, they are incapable, or substantially incapable, of hydrolysing a triglyceride and/or a 1-monoglyceride.
In one embodiment, the second enzyme is a lysophospholipase defined by the enzyme classification EC 3.1.1.5. A lysophospholipase is an enzyme that catalyzes the hydrolysis of a single fatty acid ester bond in lysoglycerophosphatidates with the formation of glyceryl phosphatidates and a fatty acid.
Second enzyme dosages.
The dosage of the second enzyme used such as tyrosinase may be, for example at least 20, at least 40, at least 80, at least 160, at least 320 or at least 640 nkat/g of protein. We find that an amount between 100 and 500, such as between 200- 200, or 250-350 or (about) 300 nkat/g of meat protein is usually suitable for cross-linking of meat proteins.
In one embodiment, the second enzyme such as tyrosinase has a specific activity of at least 0.1nkat/mg, such as at least lnkat/mg, such as at least 10nkat/mg, such as at least 100nkat/mg, such as at least 200nkat/mg, such as at least 250nkat/mg, such as at least 300nkat/mg.
In one embodiment, the second enzyme such as tyrosinase has a specific activity of no greater than 1000nkat/mg, such as no greater than 800nkat/mg, such as no greater than 500nkat/mg. The enzyme used in the examples (derived from SEQ ID NO 2) has a specific activity of about 300nkat/mg.
In one embodiment, the second enzyme is added to the proteinaceous substrate, in an amount of between 0.00001mg/g and 100mg/g of proteinaceous substrate, such as between 0.01mg/g and 10mg/g, such as between 0.10mg/g and 5mg/g. In one embodiment, at least O.OOOOlmg of the second enzyme is added per g of proteinaceous substrate, such as at least 0.0001mg/g, such as at least
0.001mg/g, such as at least 0.01mg/g. In one embodiment, up to lOmg of the second enzyme is added per g of proteinaceous substrate, such as up to 5mg/g, such as up to 1 mg/g, such as up to 0.5mg/g, such as up to 0.2mg/g. In one embodiment, the amount of second enzyme added is between 0.001 and 10 nkat/ml, such as between 0.01nkat/ml and lnkat/ml, of proteinaceous substrate (or foodstuff), such as between 0.02 and 0.5nkat/ml.
Enzymes and their preparation
The first and second enzymes may be isolated from their natural source or prepared by synthetic or recombinant techniques.
With regards the amino acid sequence of the enzymes referred to herein, and referring to the sequences disclosed or referenced herein, it is recognised that the sequences may be variants, homologues or fragments - these terms are used as defined in EP 1 704 240B. Suitably the enzyme may have a homology of at least 70%, such as at least 80%, such as at least 90%, such as at least 95%, such as at least 98% homologous or 100% homologous to the (mature) sequences as disclosed or referenced herein.
Typically, the expression of the first and or second enzyme is a eukaryotic host, such as native of a foreign host cell, results in the co and post-translational modifications, such as signal peptide cleavage.
EP 1 704 240B provides a description of the standard recombinant technology which can be employed for the expression and preparation of enzymes.
Free thiols
Thiols contain the -SH group, which also known as the thiol group. A free thiol, is a thiol containing compound, such as an amino acid, or a short peptide with a molecular weight of less than lOOOg/mol, such as less than 500g/mol, such as less than 350g/mol, such as less than 200g/mol.
Free thiols, which may typically be present or formed in a proteinaceous substrate include, cysteine, glutathione, preferably cysteine. In one embodiment, the free thiol is a -SH group containing (free) amino acid, such as free cysteine - i.e. cysteine which is present as an amino acid monomer, and not part of a polypeptide chain.
In one embodiment, the λfree thiol' is a peptide, comprising one or more thiol groups, wherein the peptide consists of between 2 - 8 amino acids residues in lengths, such as a peptide consisting of 2, 3, 4, 5, 6, 7 or 8 amino acids, such as di-or tri- peptides, such as glutathione. Suitably, in a preferred embodiment the peptide comprises one or more cysteine residues.
The presence or concentration of free thiols present in a proteinaceous substrate may be determined by the free thiol assay provided in the examples - please note that the protocol for the preparation of a meat extract can also be used with other proteinaceous substrates.
In one embodiment, the free thiol concentration in the proteinaceous (food) substrate, which may be treated with the first enzyme, has a free thiol concentration, prior to treatment with the first enzyme, of at least 2μM, such as at least 3 μM, such as at least 4 μM, such as at least 5 μM, such as at least 6 μM, such as at least 7 μM, such as at least 8 μM, such as at least 9 μM, such as at least 10 μM, such as at least 11 μM, such as at least 12 μM, such as at least 13 μM, such as at least 14 μM, such as at least 15 μM, such as at least 16 μM, such as at least 17 μM.
In one embodiment, the free thiol concentration in the proteinaceous (food) substrate, which may be treated with the first enzyme, has a free thiol concentration, prior to treatment with the first enzyme of between 5 - 25μM, such as between 10 - 25μM, such as between 15 - 20μM.
In one embodiment, the free thiol concentration of the proteinaceous (food) substrate is reduced by at least 5%, such as at least 10%, such as at least 20%, such as at least 30%, such as at least 40%, such as at least 50%, such as at least 60%, such as at least 70%, such as at least 80%, by the treatment with the first enzyme (such as after step a)). In one embodiment, the free thiol concentration of the proteinaceous (food) substrate after the treatment with the first enzyme (such as after step a)), is less than 15μM, such as less than lOμM, such as less than 9μM, such as less than 8μM, such as less than 7μM, such as less than 6μM, such as less than 5μM, such as less than 4μM, such as less than 3μM.
In one embodiment, the reduction in the free thiol concentration of the proteinaceous food substrate is (such as after step a) at least lμM, such as at least 2μM, at least 3μM, at least 4μM, at least 5μM, at least 6μM, at least 7μM, at least 8μM, at least 9μM , at least lOμM , at least llμM , at least 12μM , at least lBμM ^ at least 14μM, at least 15μM, such as at least 16μM.
In one embodiment, the reduction in free thiol concentration of the proteinaceous food substrate is sufficient to enhance the ability of a second enzyme to cross link the protein present in the food substrate, such as myosin.
Proteinaceous substrate
A proteinaceous food substrate may be in the form of a foodstuff or food product, preferably a foodstuff. Preferably, the proteinaceous (food) substrate comprises meat or meat protein.
In a further embodiment, the proteinaceous substrate is flour, dough, a cereal derived product, milk, a milk derived product, a dairy product, soy protein, soy milk, or a vegetable derived product.
The proteinaceous substrate is, in one embodiment a foodstuff.
In one embodiment, the proteinaceous substrate comprises or consists of animal meat.
In one embodiment, the proteinaceous substrate, such as the meat substrate, comprises myosin. The term "proteinaceous" as used herein, refers to a substrate or composition which has a protein content of at least 1%, such as at least 2%, such as at least 3%, such as at least 4%, such as at least 5%, such as at least 10% by weight, such as at least 10% by weight, such as at least 20% by weight, such as at least 30% by weight, such as at least 40% by weight, such as at least 50% by weight.
In a preferred embodiment, the proteinaceous substrate or composition comprises the protein myosin, such as at least 1%, at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50% of the protein present in the proteinaceous substrate or composition is myosin.
The term myosin as used herein refers to the motor protein found in eukaryotic muscle, i.e. the major protein found in meat. Myosin is identified as a 188kDa protein by SDS-PAGE analysis. The proportion of myosin protein can therefore be determined by SDS-PAGE analysis.
The term "meat" refers to the flesh of animals which is used as food, preferably comprising muscle flesh optionally with associated fat and connective tissues.
Meat as used herein includes any kind of meat of livestock, game, poultry, fish and other edible sea animals. The meat may be e.g. pork, beef, mutton, kangaroo, chicken, turkey, ostrich, fish, molluscs, shark and shellfish etc. "Meat product" refers to any material comprising meat or meat protein as an essential ingredient, such as sausages, hams, restructured meat products, surimi, etc.
The proteinaceous substrate may, in one embodiment be a meat substrate.
In one embodiment, the proteinaceous food substrate contains or is derived from animal meat, such as mammalian, bird, or fish.
In one embodiment, the proteinaceous food source is obtained from a mammal (commonly referred to as red meat), such as pork, lamb, beef, goat, horse, kangaroo etc.
In one embodiment, the proteinaceous food substrate is obtained from a bird, such as poultry, such as chicken, turkey, ostrich. In one embodiment, the proteinaceous food substrate contains or is derived from fish, such as white fish, cod, haddock, coley etc, cartilaginous fish such as shark, swordfish, sea water fish, tuna, mackerel, sardines, anchovies, herring, salmon, freshwater fish, trout, etc.
In one embodiment, the proteinaceous food substrate contains or is, or comprises, or is derived from meat selected from the group consisting of pork, lamb, chicken, beef, turkey, cod, kangaroo, ostrich, shark.
In one embodiment, the proteinaceous food substrate is, or comprises, or is derived from pork, lamb, and chicken, most preferably pork.
The term pork refers to meat obtained from the carcass of a pig. The term beef refers to meat obtained from the carcass of a cow (male of female bovine). The term lamb refers to meat obtained from a sheep.
Conveniently the meat substrate (or product) may contain at least 20%, at least 30%, at least 40% or at least 45 wt-% (wet) meat. The meat substrate (or product) may contain up to 100% wt-% meat (wet), such as up to 50%, up to 60%, up to 70%, up to 80% and up to 90% meat. For example, 1 restructured meat substrate may in practice comprise up to 100 wt-% meat.
The proteinaceous substrate typically comprises water, such as between lwt% and 95wt% water. Meat (animal muscle) typically comprises about 60-75% water, although meat from different sources and different species may contain differing amounts of water.
In one embodiment, exogenous water is added to the proteinaceous substrate, for example water is added prior to or during steps a) and/ or b) of the method of the invention. In the context of a meat substrate, exogenous water, is, for example water which is not naturally present in or derived from the meat obtained from the animal. In one embodiment, the amount of exogenous water is between 1% and 90% of the original weight of the proteinaceous substrate {i.e. prior to addition of exogenous water), such as between 10 and 80%. The amount of exogenous or added water may be up to 90%, up to 80%, up to 70%, up to 60%, up to 50%, up to 40%, up to 30%, up to 20%, up to 10%. The amount of added water may be at least 1%, such as at least 5%, such as at least 10%, such as at least 20%, such as at least 30%, such as at least 40%, such as at least 50%.
The exogenous water added to the substrate prior to or during the steps a) and/or b) may comprise other ingredients.
It is recognised that exogenous water may become incorporated into the proteinaceous substrate (such as meat substrate) by the method of the invention, to produce a product (such as a meat product) which has enhanced water content as compared to the proteinaceous substrate. Excess water which has not been incorporated into the product may be separated and removed.
Therefore, it is recognised that the method according to the invention may be used to enhance the water holding capacity of a meat product. In this regards, in one preferred embodiment, the water content of the proteinaceous substrate is increased by the enzymatic treatment according to the present invention. For example the water content of the meat product obtained from the method according to the invention, is higher that the water content of the meat substrate prior to enzymatic treatment. Suitably the increase in water content, may, in one embodiment be at least 1%, such as at least 5%, such as at least lOsuch as at least 15%, such as at least 20%.
The particle size of the comminuted meat (substrate) depends on the type of meat product to be prepared. For the manufacture of restructured meat products, the meat is cut into recognizable pieces with edges of usually several cm, whereas the meat in hams and sausages is usually ground, chopped and/or minced or otherwise homogenized. Typically ham contains coarsely ground meat with particles of several mm up to one or a few cm, whereas sausages contain finely ground meat.
The meat protein {i.e. present in the meat substrate) may be in the form of mechanically separated or recovered meat, and/or meat which has been mechanically disrupted, e.g. by homogenised, mincing, grinding, dicing, liquidising etc (collectively referred to as "comminuting"). In one embodiment, the proteinaceous food substrate is in the form of a meat slurry, reconstituted meat or emulsified meat.
In one embodiment, the meat substrate contains from about 1 to about 30 percent by weight ("% w/w") animal protein, based on the dry weight of such protein.
In one embodiment, the meat substrate comprises, based on about 100% w/w of the food product, from about 1 % w/w to about 30% w/w muscle protein (myosin), from about 30% w/w to about 80% w/w water, up to about 50% w/w fat.
In one embodiment, the proteinaceous substrate, such as meat substrate, is obtained by comminuting meat, optionally in the presence of water.
Meat slurry is typically prepared by a process where the meat is first finely ground and mixed with water. The mixture is then used in a centrifuge or with an emulsifier to separate the fats and myoglobin from the muscle. The product is then allowed to settle into three layers: meat, excess water, and fat. The meat layer is then separated off and either used directly as a foodstuff in the preparation of food products, such as chicken nuggets, sausage, burgers, reconstituted meats etc, or stored for future use (e.g. by freezing).
Mechanically separated meat (MSM), also known as mechanically recovered meat (MRM) is a paste-like and batter-like meat product produced by forcing animal (e.g. beef, pork or chicken) bones, with attached edible meat, under high pressure through a sieve or similar device to separate the bone from the edible meat tissue. Since the advent of BSE disease, the use of mechanically separated meat is less favoured, and recovered meat is preferred.
Recovered meat refers to the residual meat trimmings which are extracted from bones and other carcass materials, without mixing the bone and meat tissues. This meat is comparable in appearance, texture, and composition to meat trimmings and similar meat products derived by hand. The meat is separated from bone by scraping, shaving, or pressing the meat from the bone without breaking or grinding the bone. The "meat-substrate" comprises meat. In addition, it may, comprise "other ingredients" which encompass any conventional additives, such as NaCI, phosphates, and/or water. Further, the term other ingredients includes e.g. salts other than NaCI and phosphates, spices, preservatives, antioxidants, stabilizers, sugar, sweeteners, gums, binders, extenders, starch, dextrin-type of carbohydrates, animal or vegetable fats and oils, fat substitutes and/or other non- meat ingredients such as soy, casein, and whey, wheat proteins and other non- meat proteins etc.
In one embodiment, the "meat-substrate" consists or comprises of meat and water. The meat substrate may be communited meat.
The Meat Product
The term "meat product" refers to the product prepared by the method according to the invention, wherein the proteinaceous substrate is a "meat substrate". The proteinaceous protein-cross linked proteinaceous product may therefore be a meat product.
In the context of the present invention the product prepared by the method of the invention may be a meat product prepared by binding communited meat by the activity of a second enzyme (tyrosinase). Such meat products may be referred to as restructured (reconstituted). The communited meat is either before or during tyrosinase treatment, treated with a first enzyme according to the invention.
In one embodiment, the meat product prepared may be a fat-reduced product containing 15-18 wt-% fat, or a low-fat meat product containing up to 10 wt-% fat, or a lean meat product containing up to 5 wt-% fat. Preferably the fat content of the meat product is no more than 18 wt-%, preferably no more than 10 wt-%, and most preferably no more than 5 wt-% or even no more than 3 wt-%.
In one embodiment, the meat product may comprise less than 2.0 wt-% of salt, preferably less than 1.5 wt-%. Meat products comprising no more than 1.2 wt-% salt are generally considered as low-salt products. The meat product of the invention therefore preferably contains no more than 1.2 wt-% salt, and, according to one embodiment of the invention, no more than 1.0 wt-%. "Salt" in this respect refers to sodium chloride (NaCI). In one embodiment, the meat substrate and or product is essentially salt free - i.e. the concentration of phosphate is less than 0.1% wt% salt.
The addition of phosphates has increased during the last years, be- cause phosphates may be used to maintain the structure and water-binding ability of low-salt products. Nowadays industry normally adds 0.2 wt-% phosphate (measured as P2O5) to a meat product, which corresponds to 0.34 wt-% trisodiumpyrophosphate. The meat substrate and/or product of the present invention may contain less than 0.2 wt-% phosphate, preferably it contains no more than 0.1 wt-% added phosphate (measured as P2O5). Most preferably the meat substrate and/or product is phosphate-free, i.e. no phosphate has been added.
In one embodiment, the meat substrate and or product is essentially phosphate free - i.e. the concentration of phosphate is less than 0.1% wt% phosphate.
Foodstuff
The term a "foodstuff" as used herein refers to an edible composition which forms part of the human or animal diet. A foodstuff can be used directly as a food, or used in the preparation of a food product. It is preferable that the foodstuff according to the present invention is a proteinaceous foodstuff.
In a preferred embodiment, the foodstuff is a meat foodstuff, i.e. a foodstuff which comprises meat, such as the meat referred herein, such as meat selected from the group consisting of pork (pig), beef, turkey, chicken, lamb or fish. Preferably meat foodstuffs are pork and chicken, most preferably pork.
In one embodiment, the meat foodstuff is the meat substrate referred to herein, which may be prepared by the comminuting methods referred to herein.
Food product The term "food product" as used herein refers to an edible composition which consists or comprises of one or more "foodstuffs". Typically, a food product comprises several "foodstuffs" which are combined and processed into a food product which are purchased (or eaten) directly by the consumer. In this regards, in one aspect a "food product" refers to a processed foodstuff.
In one embodiment, the protein-cross-linked proteinaceous product referred to herein is a (meat) food product, or is subsequently used in the preparation of a meat food product.
In a non limiting example, the food product may be selected from one or more of the following food product categories:
- Cooked meat - For example ham, loin, picnic shoulder, bacon, pork belly.
- Dry & semi-dry cured meat - Fermented products, dry-cured and fermented with starter cultures, for example dry sausages, salami, pepperoni, dry ham
- Emulsified products for cold and hot consumption, for example mortadella, frankfurter, luncheon meat, pate
-Fish & seafood - shrimps, salmon, reformed fish products, frozen cold-packed fish.
- Fresh meat muscle - Whole injected meat muscles, for example loin, shoulder ham, marinated meat.
- Ground/restructered fresh meat- Reformed meat. Upgraded cut-away meat by cold-setting gel or binding, for example raw, uncooked loin chops, steaks, roasts, fresh sausages, beef burgers, meat balls, pelmeni.
- Poultry products - For example chicken or turkey breast or reformed poultry, chicken nuggets, chicken sausages. - Retorted products - Autoclaved meat products, for example picnic ham, luncheon meat, emulsified products.
- Vegetarian & meat analogues - For example vegetarian sausages, nuggets, burgers
Enzyme system
The present invention utilises a first enzyme to remove inhibitors of a second enzyme from a proteinaceous substrate (composition). The first enzyme treatment may be performed prior to or even during the second enzyme treatment. The invention therefore relates to an enzyme system, wherein the enzyme system comprises a first enzyme and a second enzyme, wherein the first enzyme is capable of removing the inhibitor of a second enzyme from a substrate, such as a proteinaceous substrate.
In a preferred embodiment, the invention provides for an enzyme system comprising a first enzyme and a second enzyme, in which the first enzyme is an enzyme capable of removing free thiols from a proteinaceous substrate, and the second enzyme is a tyrosinase.
In one embodiment, the first enzyme and or the second enzyme is in isolated form.
The term "isolated" refers to the isolation of the enzyme from the environment it is naturally found in.
In one embodiment, the first enzyme and or the second enzyme is in purified form.
It is preferred that purified first and/or enzymes are used, i.e. the enzymes are purified prior to being added to the composition of the invention. Enzyme purity is preferably determined using SDS-PAGE and densitometry. A purified enzyme is at least 10% pure, such as at least 20% pure, such as at least 30% pure, such as at least 40% pure, such as at least 50% pure. It is recognized that a purified enzyme may however be formulated with other proteins, for example mixed with protein stabilizers such as BSA or other enzymes, the assessment of enzyme purity therefore excludes proteins added to the enzyme after purification. For the purpose of the enzyme system where both the first and second enzymes are present within the same compartment (1 pot system), the purity of the each (first or second) enzyme is calculated as if the other enzyme were not present.
In one embodiment, the first and second enzyme are present within the same enzyme composition.
However, in one embodiment, the first enzyme is isolated from the second enzyme (prior to use).
In this regards the enzyme system may be a single pot (part) system or a multiple pot (parts) (e.g. two) pot system.
The enzyme system may therefore be provided in the form of a kit, said kit comprising a first pot (part) which comprises the first enzyme, and a second pot (part) which comprises the second enzyme.
The term pot or part, as used above, refers to a single compartment, isolated from the other pot/parts/or compartment(s).
The amount of the first enzyme present in the enzyme system (or individual pot) may, for example be at least 0.001mg/g, such as at least 0.01mg/g, such as at least 0.1mg/g, such as at least lmg/g, such as at least 3mg/g, such as at least 5mg/g, such as at least 10mg/g. Suitably a dosage of about 15mg/g or higher may be appropriate, for example up to 25mg/g, 50mg/g, up to 100mg/g, up to 200mg/g or even up to 300mg/g.
The amount of the second enzyme present in the enzyme system (or individual pot) may, for example be at least 0.001mg/g, such as at least 0.01mg/g, such as at least 0. lmg/g, such as at least lmg/g, such as at least 3mg/g, such as at least 5mg/g, such as at least 10mg/g, such as at least 50mg/g, such as at least 100mg/g, such as at least 200mg/g, or even higher, such as up to 500mg/g, such as up to 400mg/g, or, for example up to 25mg/g, 50mg/g, up to 100mg/g, up to 200mg/g or even up to 300mg/g.
In one embodiment, the enzyme system is in the form of a food processing aid, for the enzymatic treatment of proteinaceous food products.
The enzyme system or systems may any other ingredient typically used in enzyme formulation, such as food enzyme composition ingredients or carriers - for example it may contain an extender such as maltodextrin, a carbohydrate based material, a silica based material, a protein, a protein hydrolysate and/or an other protein based material, such as BSA.
In one embodiment, by way of example, 10 mg of the mix could contain 0.015mg SOX, 2mg tyrosinase and 7.985 mg extender. Alternatively 100 mg of the mix could contain 0.015mg SOX, 2mg tyrosinase and 97.985 mg extender. In the first case one would add lOmg of the mix pr. gram of protein to be treated, in the latter case one would add 100 mg of the mix pr. g of protein to be treated. If one assumes that the protein content of the meat product to be treated is 3%, one would in the first case add 300 mg of enzyme mix to 1 kg of meat product in the latter case one would add 3000 mg pr kg of meat product.
We note that using protein as an extender could further have the benefit of adding additional substrate for the tyrosinase leading to further cross-linking.
In one embodiment the invention provides for the use of the enzyme system of the invention for the preparation of a proteinaceous foodstuff which has enhanced water retention; and/or
In one embodiment the invention provides for the use of the enzyme system of the invention for the preparation of a proteinaceous foodstuff which has enhanced gel-strength; and/or
In one embodiment the invention provides for the use of the enzyme system of the invention for the preparation of a proteinaceous foodstuff which has enhanced texture or mouth-feel. Gel formation - gel strength. The product of the invention, such as the protein cross-linked proteinaceous product, may have an improved gel strength as compared to either the proteinaceous substrate, or a comparative product prepared without a treatment step a). In one embodiment, the improvement of gel strength is at least Ig such as at least 2g, at least 3g, at least 4g, at least 5g.
Water retention. The product of the invention, such as the protein cross-linked proteinaceous product, may have an improved water holding capacity as compared to either the proteinaceous substrate, or a comparative product prepared without a treatment step a). In one embodiment, the water holding capacity has been improved by at least 1%, such as at least 5%, such as at least 10%, such as at least 20%.
Cross-linking. The degree of protein cross-linking of the product of the invention, such as the protein cross-linked proteinaceous product, may have a degree of protein cross-linking of at least 5%, such as at least 10%, such as at least 20%, such as at least 30%, such as at least 40%, such as at least 50%, such as at least 60%, such as at least 70%, such as at least 80%, such as at least 90%, as compared to a non-treated proteinaceous substrate. The degree of protein cross- linking may be obtained by densitometry analysis of SDS-PAGE (reducing conditions may be used) of the protein extracts obtained from the product of the invention, as compared to the proteinaceous substrate.
In one embodiment, the degree of protein cross linking of the myosin protein present in the product may have a degree of protein cross-linking of at least 5%, such as at least 10%, such as at least 20%, such as at least 30% such as at least 40%, such as at least 50%, such as at least 60%, such as at least 70%, such as at least 80%, such as at least 90%, as compared to a non-treated proteinaceous substrate.
Enzyme composition
Enzyme preparations are produced in varying degrees of purity from animal, plant, and microbial sources. They may consist of whole killed cells, parts of cells, or cell- free extracts. They may also contain carriers, solvents, preservatives, and antioxidants. The enzyme preparations may be formulated as liquid, semi-liquid, or dry solid preparations. Food enzyme preparations have traditionally been added directly to food during processing. For many applications, the components of the preparation remain in the processed food product. In recent years, enzymes immobilized on solid supports have gained importance. Immobilized enzyme preparations may range from those that contain a highly specific, purified enzyme, to those that contain whole killed cells or structurally intact viable cells. For some enzymatic processes, co-immobilization of enzymes and cells may be advantageous. Immobilized enzyme preparations are not intended to become food components.
It is therefore recognised that in one aspect the first enzyme and or the second enzyme are immobilised. However, in considering the activity of the second enzyme it is preferably that the second enzyme is not immobilised, i.e. the enzyme, possibly in inactive (e.g. heat deactivated form), remains in the food product.
FURTHER EMBODIMENTS AND ASPECTS
Embodiment 1. An enzyme system comprising a first enzyme and a second enzyme, in which the first enzyme is an enzyme capable of removing free thiols from a proteinaceous substrate, and the second enzyme is a tyrosinase.
Embodiment 2. The enzyme system according to embodiment 1, in which the first enzyme and or the second enzyme is in isolated or purified form.
Embodiment 3. The enzyme system according to any of the preceding embodiments, in which the first enzyme is an oxidase.
Embodiment 4. The enzyme system according to embodiment 1 in which the first enzyme has an EC code 1.8.3.2. or 1.8.3.3.
Embodiment 5. The enzyme system according to embodiment 1 in which the first enzyme is sulfhydryl oxidase. Embodiment 6. The enzyme system according to embodiment 1 in which the first enzyme is laccase
Embodiment 7. The enzyme system according to embodiment 1 in which the first enzyme is glutathione oxidase
Embodiment 8. The enzyme system according to embodiment 1 in which the first enzyme is disulfide isomerase.
Embodiment 9. The enzyme system according to embodiments 1 to 8, in which the first and second enzyme are present within the same enzyme composition.
Embodiment 10. The enzyme system according to any of the preceding embodiments, in which the first enzyme is isolated from the second enzyme prior to use.
Embodiment 11. The enzyme system according to embodiment 10, wherein the enzyme system is provided in the form of a kit, said kit comprising a first pot which comprises the first enzyme, and a second pot which comprises the second enzyme.
Embodiment 12. The enzyme system according to any one of the preceding embodiments, wherein the first enzyme is present in the enzyme system, prior to use, at a concentration of between 0.001 and 300mg/g.
Embodiment 13. The enzyme system according to any one of the preceding embodiments, wherein the second enzyme is present in the enzyme system, prior to use, at a concentration of between 0.001 and 500mg/g.
Embodiment 14. The enzyme system according to any one of the preceding embodiments, wherein the enzyme system is in the form of a food processing aid, for the enzymatic treatment of proteinaceous food products. Embodiment 15. The enzyme system according to embodiment 14, wherein the enzyme system comprises a further component, such as one or more food enzyme composition ingredients and/or carriers.
Embodiment 16. The use of the first enzyme according to any one of the preceding embodiments, for reducing the concentration of free thiols in a proteinaceous substrate.
Embodiment 17. The use of the first enzyme according to embodiment 16, in which the proteinaceous substrate is a proteinaceous foodstuff, which preferably comprises myosin.
Embodiment 18. The use of the first enzyme according to embodiment 17, in which the proteinaceous food substrate contains or is derived from animal meat, such as mammalian, bird, or fish.
Embodiment 19. The use of the first enzyme according to embodiment 17, in which the proteinaceous food substrate contains or is derived from meat selected from the group consisting of pork, lamb, chicken, beef, turkey, cod, kangaroo, ostrich, shark.
Embodiment 20. The use of the first enzyme according to embodiment 17, in which the proteinaceous food substrate is pork, lamb, and chicken, most preferably pork.
Embodiment 21. The use of the first enzyme according to any of embodiments 16 to 20, which results in a reduction in the free thiol concentration of the proteinaceous substrate is of at least 5%.
Embodiment 22. The use of the first enzyme according to any of embodiments 16 to 21, which results in a reduction in the free thiol concentration of the proteinaceous substrate by at least lμM.
Embodiment 23. The use of the first enzyme according to any of embodiments 16 to 22, in which the reduction in free thiol concentration of the proteinaceous substrate is sufficient to enhance the ability of a second enzyme to cross link the protein present in the substrate, such as myosin.
Embodiment 24. The use of the first enzyme according to embodiment 23, in which the second enzyme is as defined in any one of embodiments 1 - 15.
Embodiment 25. A method for the preparation of a protein cross-linked foodstuff, said method comprising the steps:
a. treatment of a proteinaceous foodstuff with a first enzyme capable of degrading or oxidising free thiols;
b. treatment of the proteinaceous foodstuff with a second enzyme;
wherein step a) is performed prior to, or simultaneous to step b), and wherein step b) results in the cross-linking of proteins present in said proteinaceous food product.
Embodiment 26. A method according to embodiment 25 in which the enzyme capable of degrading or oxidising free thiols is as according to the first enzyme as defined in any one of embodiments 1 - 15.
Embodiment 27. A method according to embodiment 25 or 26, wherein step a) comprises the use of the first enzyme as according to any one of embodiments 16 - 24.
Embodiment 28. A method according to any one of embodiments 25 - 27, wherein the step a) results in a reduction in the free thiol concentration of the proteinaceous food substrate of at least 5%.
Embodiment 29. A method according to any one of embodiments 25 - 28, wherein the step a) results in a reduction in the free thiol concentration of the proteinaceous food substrate by at least lμM. Embodiment 30. A method according to any one of embodiments 25 - 29, wherein the step a) results in a reduction in free thiol concentration of the proteinaceous food substrate which is sufficient to enhance the ability of the second enzyme to cross link the protein present in the food substrate, such as myosin.
Embodiment 31. A method according to any one of embodiments 25 - 30, wherein the second enzyme is as defined in any one of embodiments 1 - 15.
Embodiment 32. A method according to any one of embodiments 25 - 31, wherein the proteinaceous food product is as defined in any one of embodiments 17 - 20.
Embodiment 33. A method according to any one of embodiments 25 -32, wherein the proteinaceous foodstuff comprises myosin, and the degree of cross- linking of the myosin protein present in the treated proteinaceous food products, subsequent to steps a) and b) is at least 5%.
Embodiment 34. A method according to any one of embodiments 25 -33, wherein the gel strength or water holding capacity, or both, of the proteinaceous foodstuff after steps a) and b) are enhanced compared to the untreated proteinaceous food product.
Embodiment 35. The foodstuff prepared by any one of embodiments 25 - 34.
Embodiment 36. The proteinaceous foodstuff according to embodiment 35, wherein the concentration of free thiols present in said food product is no greater than 15μM, or no greater than lOμM, or no greater than 5μM.
Embodiment 37. The proteinaceous according to embodiment 35 to 36 in which the gel strength has been enhanced by at least 2g. Embodiment 38. The proteinaceous foodstuff according to any of embodiments 35 to 37 in which the water holding capacity has been enhanced by at least 5%, such as at least 10%.
Embodiment 39. The proteinaceous foodstuff according to any of embodiments 35 to 38 in which at least 10% of the total myosin is cross linked.
Embodiment 40. The proteinaceous foodstuff according to any of embodiments 35 to 39 in which the concentration of free thiols has been reduced by at least 2μM.
Embodiment 41. The proteinaceous foodstuff according to any of embodiments 35 to 40 in which the proteinaceous foodstuff is derived from animal meat, such as mammalian, bird, or fish.
Embodiment 42. The proteinaceous foodstuff according to any of embodiments 35 to 41 in which the food product is free from artificial additives, particularly additives such as phosphates.
Embodiment 43. A processed food product comprising the proteinaceous foodstuff according to any one of embodiments 35 to 42.
Embodiment 44. The processed food product according to embodiment 43, wherein the food product is selected from the group consisting of cooked meat, dry & semi-dry cured meat products, fermented products, emulsified products, fish & seafood products, fresh meat muscle, ground/restructered fresh meat, reformed meat, poultry products, retorted products, autoclaved meat products, vegetarian & meat analogue products.
Embodiment 45. The use of the enzyme system according to any one of embodiments 1 - 15 for the preparation of a proteinaceous foodstuff which has enhanced water retention. Embodiment 46. The use of the enzyme system according to any one of embodiments 1 - 15 for the preparation of a proteinaceous foodstuff which has enhanced gel-strength.
Embodiment 47. The use of the enzyme system according to any one of embodiments 1 - 15 for the preparation of a proteinaceous foodstuff which has enhanced texture or mouth-feel.
Aspect 1. A method for the preparation of a cross-linked proteinaceous substrate, said method comprising the steps:
a. treatment of a proteinaceous substrate comprising free thiols with a first enzyme capable of removing free thiols;
b. treatment of the proteinaceous substrate with a second enzyme, the activity of which is inhibited by free thiols;
wherein step a) is performed prior to, or simultaneous to step b), and wherein step b) results in the cross-linking of proteins present in said proteinaceous substrate and wherein the first enzyme and the second enzyme is not the same enzyme.
Aspect 2. The method according to aspect 1, wherein the second enzyme is selected from the group consisting of a tyrosinase, laccase, lipoxygenase and protein lysin 6-oxidase (lysyl oxidase).
Aspect 3. The method according to aspect 2, wherein the second enzyme is selected from the group consisting of lipoxygenase and protein lysin 6-oxidase (lysyl oxidase).
Aspect 4. The method according to any one of aspects 1-3, wherein the second enzyme is laccase.
Aspect 5. The method according to any one of aspects 1-3, wherein the second enzyme is a tyrosinase. Aspect 6. The method according to any one of aspects 1-5, in which the first enzyme and/or the second enzyme is in isolated or purified form.
Aspect 7. The method according to any one of aspects 1-6, in which the first enzyme is an oxidase.
Aspect 8. The method according to any one of aspects 1-6, wherein the first enzyme is not laccase.
Aspect 9. The method according to any one of aspects 1-6, in which the first enzyme has an EC code 1.8.3.2. or 1.8.3.3.
Aspect 10. The method according to any one of aspects 1-6, in which the first enzyme is sulfhydryl oxidase.
Aspect 11. The method according to any one of aspects 1-6, in which the first enzyme is glutathione oxidase
Aspect 12. The method according to any one of aspects 1-6, in which the first enzyme is disulfide isomerase.
Aspect 13. The method according to any one of aspects 1 - 12, in which the proteinaceous substrate is a proteinaceous foodstuff, which preferably comprises myosin.
Aspect 14. The method according to aspect 13, in which the proteinaceous foodstuff contains or is derived from animal meat, such as mammalian, bird, or fish.
Aspect 15. The method according to aspect 14, in which the proteinaceous foodstuff contains or is derived from meat selected from the group consisting of pork, lamb, chicken, beef, turkey, cod, kangaroo, ostrich, shark. Aspect 16. The method according to aspect 15, in which the proteinaceous foodstuff is selected from the group consisting of pork, lamb, and chicken, most preferably pork.
Aspect 17. The method according to any one of aspects 1-16, in which the first and second enzyme are present within the same enzyme composition.
Aspect 18. The method according to any one of aspects 1-17, in which the first enzyme is isolated from the second enzyme prior to use.
Aspect 19. The method according to any one of aspects 1-18, wherein the first enzyme and the second enzyme is provided as an enzyme system in the form of a kit, said kit comprising a first pot which comprises the first enzyme, and a second pot which comprises the second enzyme.
Aspect 20. The method according to aspect 19, wherein the first enzyme is present in the form of an enzyme system, prior to use, at a concentration of between 0.001 and 300mg/g.
Aspect 21. The method according to any one of aspects 19-20, wherein the second enzyme is present in the form of an enzyme system, prior to use, at a concentration of between 0.001 and 500mg/g.
Aspect 22. The method according to any one of aspects 19-21, wherein the enzyme system is in the form of a food processing aid, for the enzymatic treatment of proteinaceous food products.
Aspect 23. The method according to aspect 22, wherein the enzyme system comprises a further component, such as one or more food enzyme composition ingredients and/or carriers.
Aspect 24. The method according to any one of aspects 1-23, wherein the removal of free thiols in step a) results in a reduction in the free thiol concentration of the proteinaceous substrate of at least 5%. Aspect 25. A method according to any one of aspects 1-24, wherein the removal of free thiols in step a) results in a reduction in the free thiol concentration of the proteinaceous substrate by at least lμM.
Aspect 26. Use of the first enzyme as defined in any one of the preceding aspects, for reducing the concentration of free thiols in a proteinaceous substrate.
Aspect 27. The use of the first enzyme according to aspect 26, in which the proteinaceous substrate is a proteinaceous foodstuff, which preferably comprises myosin.
Aspect 28. The use of the first enzyme according to aspect 27, in which the proteinaceous foodstuff contains or is derived from animal meat, such as mammalian, bird, or fish.
Aspect 29. The use of the first enzyme according to aspect 28, in which the proteinaceous foodstuff contains or is derived from meat selected from the group consisting of pork, lamb, chicken, beef, turkey, cod, kangaroo, ostrich, and shark.
Aspect 30. The use of the first enzyme according to aspect 29, in which the proteinaceous foodstuff is selected from the group consisting of pork, lamb, and chicken, most preferably pork.
Aspect 31. The use of the first enzyme according to any of aspects 26 to 30, which results in a reduction in the free thiol concentration of the proteinaceous substrate of at least 5%.
Aspect 32. The use of the first enzyme according to any of aspects 26 to 31, which results in a reduction in the free thiol concentration of the proteinaceous substrate by at least lμM.
Aspect 33. The use of the first enzyme according to any of aspects 26 to 32, in which the reduction in free thiol concentration of the proteinaceous substrate is sufficient to enhance the ability of a second enzyme to cross link the protein present in the substrate, such as myosin. Aspect 34. The use of the first enzyme according to aspect 33, in which the second enzyme is as defined in any one of aspects 1 - 25.
Aspect 35. A method for improving the enzymatic activity on a proteinaceous substrate comprising free thiols by a second enzyme, the activity of which is inhibited by the presence of free thiols, said method comprising treatment of the proteinaceous substrate with a first enzyme capable of removing free thiols; wherein the treatment with the first enzyme is performed prior to, or simultaneous with a treatment with the second enzyme and wherein the first enzyme and the second enzyme is not the same enzyme.
Aspect 36. The method according to aspect 35, wherein the enzymatic activity results in the cross-linking of proteins present in said proteinaceous substrate.
Aspect 37. The method according to any one of the aspects 35-36, wherein the first enzyme is as defined in any one of aspects 1 - 26.
Aspect 38. The method according to any one of aspects 35-37, wherein the second enzyme is selected from the group consisting of tyrosinase, laccase, lipoxygenase, galactose oxidase, protein lysin 6-oxidase (lysyl oxidase), galactolipase and lysophospholipase,
Aspect 39. The method according to any one of aspects 35 - 38, wherein the proteinaceous substrate is as defined in any one of aspects 1 - 26.
Aspect 40. A method for the preparation of a protein cross-linked foodstuff, said method comprising the steps:
a. treatment of a proteinaceous foodstuff with a first enzyme capable of degrading or oxidising free thiols;
b. treatment of the proteinaceous foodstuff with a second enzyme; wherein step a) is performed prior to, or simultaneous to step b), and wherein step b) results in the cross-linking of proteins present in said proteinaceous food product.
Aspect 41. The method according to aspect 40 in which the enzyme capable of degrading or oxidising free thiols is as defined in any one of aspects 1 - 25.
Aspect 42. The method according to aspect 40 or 41, wherein step a) comprises the use of the first enzyme according to any one of aspects 26 - 34.
Aspect 43. The method according to any one of aspects 40 - 42, wherein the step a) results in a reduction in the free thiol concentration of the proteinaceous foodstuff of at least 5%.
Aspect 44. The method according to any one of aspects 40 - 43, wherein the step a) results in a reduction in the free thiol concentration of the proteinaceous foodstuff by at least lμM.
Aspect 45. The method according to any one of aspects 40 - 44, wherein the step a) results in a reduction in free thiol concentration of the proteinaceous foodstuff which is sufficient to enhance the ability of the second enzyme to cross link the protein present in the food substrate, such as myosin.
Aspect 46. The method according to any one of aspects 40 - 45, wherein the second enzyme is as defined in any one of aspects 1 - 25.
Aspect 47. The method according to any one of aspects 40 - 46, wherein the proteinaceous food product is as defined in any one of aspects 27 - 30.
Aspect 48. The method according to any one of aspects 40 - 47, wherein the proteinaceous foodstuff comprises myosin, and the degree of cross-linking of the myosin protein present in the treated proteinaceous food products, subsequent to steps a) and b) is at least 5%. Aspect 49. The method according to any one of aspects 40 -48, wherein the gel strength or water holding capacity, or both, of the proteinaceous foodstuff after steps a) and b) are enhanced compared to the untreated proteinaceous food product.
Aspect 50. The foodstuff prepared by any one of aspects 40 - 49.
Aspect 51. The proteinaceous foodstuff according to aspect 50, wherein the concentration of free thiols present in said food product is no greater than 15μM, or no greater than lOμM, or no greater than 5μM.
Aspect 52. The proteinaceous according to aspect 50 to 51, in which the gel strength has been enhanced by at least 2g.
Aspect 53. The proteinaceous foodstuff according to any of aspects 50 to 52, in which the water holding capacity has been enhanced by at least 5%, such as at least 10%.
Aspect 54. The proteinaceous foodstuff according to any of aspects 50 to 53, in which at least 10% of the total myosin is cross linked.
Aspect 55. The proteinaceous foodstuff according to any of aspects 50 to 54, in which the concentration of free thiols has been reduced by at least 2μM.
Aspect 56. The proteinaceous foodstuff according to any of aspects 50 to 55, in which the proteinaceous foodstuff is derived from animal meat, such as mammalian, bird, or fish.
Aspect 57. The proteinaceous foodstuff according to any of aspects 50 to 56, in which the food product is free from artificial additives, particularly additives such as phosphates.
Aspect 58. A processed food product comprising the proteinaceous foodstuff according to any one of aspects 50 to 57. Aspect 59. The processed food product according to aspect 58, wherein the food product is selected from the group consisting of cooked meat, dry & semi-dry cured meat products, fermented products, emulsified products, fish & seafood products, fresh meat muscle, g round/ restructered fresh meat, reformed meat, poultry products, retorted products, autoclaved meat products, vegetarian & meat analogue products.
Aspect 60. The use of the method according to any one of aspects 1 - 25 for the preparation of a proteinaceous foodstuff which has enhanced water retention.
Aspect 61. The use of the method according to any one of aspects 1 - 25 for the preparation of a proteinaceous foodstuff which has enhanced gel-strength.
Aspect 62. The use of the method according to any one of aspects 1 - 25 for the preparation of a proteinaceous foodstuff which has enhanced texture or mouth- feel.
EXAMPLES
Example 1
Materials and methods
Ingredients:
Minced meat from pork (3-7% fat), beef (9-12 % fat), lamb (8-10% fat), chicken (3-6% fat), turkey (3-7% fat), and cod (fat content unknown) were all purchased at local stores. Sodium tripolyphosphate (STPP) Tyrosinase (TrTyr2; VTT, Finland, 1067 nkat/ml according to supplier), TGase (Activa MP; Ajinomoto; 1666 nkat/g according to supplier), Sulfhydryl oxidase (Aspergillus spp/Aspergillus niger; 325 nkat/g; measured activity)
Protein extractions:
1. Brine was made using 2% NaCI and 0.3% STPP 2. 20 g portions of meat were placed in 250 ml baffled shake flasks
3. 60 ml of brine were added to each shake flask.
4. The shake flasks were placed on a rotary shaker (Certomat R, Braun Int.); 120 min at room temperature and 180 rpm
5. The meat-brine suspension was centrifuged for 60 min at 10000 g and
5°C
6. The fat particles were removed by filtering the supernatant through a 0.8 mm grid
7. The meat-protein extract (supernatant) was stored at -18°C
Gel filtration/dialysis
Dialysis was carried out in Slide-A-Lyzer Dialysis Cassette from Pierce (Order nr: 66810). The dialysis was carried out at 4°C overnight with one shift of dialysis buffer.
Determination of free thiol concentration
Ellmans Reagent I: 3mM EDTA (0.558g); 0,2M Tris (12,14g) was dissolved in ca 400 ml water, and adjusted to pH to 8 with HCI and filled up to 500ml with water. Ellmans Reagent II: DTNB (Sigma D-8130) 8 mG was dissolved in 20 ml Ellmans I and stored in the dark and used within 1 day.
For removal of protein bound thiol and for clarification of the sample: The meat extract (0.5ml) and 0.5% Trichloraceticacid (0.5ml) was mixed in an eppendorf tube. The tube was centrifuged 5min at 1000Og. 0.3 ml supernatant was transferred to a new tube and neutralised with 40μl_ IM NaOH.
Analysis: lOOμL protein free sample was mixed with 170μl Ellmans Reagent II in a microtiter tray well. The samples were mixed using a plate shaker. The plate was incubated at room temperature inside the microtiter plate reader (to keep in dark) and AbS42O was measured exactly 2 min after addition of Ellmanns Reagent II.
Calculation of thiol concentration:
ε = Extinction coefficient
(2-nitro-5-thiobenzoate; NTB) = 13600 M'^cm"1
r = radius of well = 0.35cm
v = volume sample in well = 0.27ml_
Light path = I = v/(ε *r2) = 0.27/(ε *0.352) = 0.70 cm
Thiol concentration (mol/L) = Abs420/(l*ε) = Abs420/(0.70*13600)
All determinations were made in duplicate.
Measurement of Sulfhvdryl oxidase activity:
Measured as drop in dithiotreitol (DTT) concentration (according to above) after adding sulfhydryl oxidase. The activity is defined as nmol DTT oxidised per second.
Determination of protein content
Total nitrogen content in percent was determined according to the Kjeldahl method (Ma T S & Zuazaga G. Micro-Kjeldahl determination of nitrogen. Ind. Eng. Chem. (Analytical Edition) 14: 280-2, 1942). Protein content was determined by multiplying the total nitrogen % by the factor 6.25 (http://www.foodcomp.dk/fvdb_aboutfooddata_proximates.asp# Protein).
Sample preparation/enzyme treatment for SDS-PAGE analysis
Enzyme treatment of the protein extracts prior to SDS-PAGE analysis was done as follows: Tyrosinase was added to a final concentration of 15.5 nkat/ml extract (corresponding to 0.015 mg tyrosinase per ml extract) and incubated for 60 min at 400C. TGase was added to a final concentration of 2.5 nkat/ml extract (corresponding to 0.015 mg TGase pr. ml extract) and incubated for 60 min at 400C. sulfhydryl oxidase was added to a final concentration of 0.0033 (low sulfhydryl oxidase) or 0.033 (high sulfhydryl oxidase) nkat/ml. It was always added prior to or simultaneously with other enzyme treatment. If added prior to other enzyme treatment, an incubation time of 60 min at room temperature was applied.
SDS-Paqe analysis:
SDS-PAGE was carried out on Pre-cast Novex Bis-Tris gels (Invitrogen, Carlsbad CA, USA) according to manufacturers' protocol. For non-reducing SDS-PAGE, DTT was left out of the sample buffer.
Tyrosinase spot assay and test of inhibition
Spot assay of tyrosinase activity was determined by adding llnkat of tyrosinase to 1 ml of skimmed milk. Red colour formation within 5-10 seconds is an indication of high of tyrosinase activity. To test for tyrosinase inhibition, either the inhibitor is mixed with tyrosinase before addition to the milk or the inhibitor is added to the milk prior to tyrosinase addition. The inhibitors tested were free cysteine at final concentrations of 1 or 0.1 mM or meat extracts diluted 10 times in the final sample.
Production of meat protein gels for texture and WHC assessment
Heat induced meat protein gels were produced according to the following method :
1. 12 g meat-protein extract was placed in 50 ml screw top plastic centrifuge tubes
2. Enzyme treatment: Either 180 μl_ TrTyr2 (1067nkat/ml) + 180 μL water,
180 μL sulfhydryl oxidase (lmg/ml) + 180 μl_ TrTyr2 (1067nkat/ml), 180 μl_ sulfhydryl oxidase (lmg/ml)+ 180 μl_ water or 360 μl_ water (reference) was added to the meat-protein extract
3. The samples were incubated for Ih at 400C
4. A gel was produced by heating at 800C for 60min
5. The gel was stored at 5°C overnight
6. The gel was tempered at 35°C for 2 hours
7. A TPA analysis was carried out on the gel in the tube using Texture analyser (TI-XT2, Stable micro systems) with the following settings: Pre speed 2 mm/sek, Test sped 5 mm/sek, trigger force: 3g, travel distance 3 mm, time between compressions 5 sec, Load cell 5 kg, probe: PO.5
(5mm ebonite)
8. A cross was cut in the gel and the tubes were centrifuged (Hettich Rotina 46) for 10 min at 4000 rpm
9. Supernatant was poured off and weighed
The water holding capacity (WHC) was calculated as follows:
I -*"'
WHC = W T1ot
WR is the weight of water released from the gel and WTot is the total weight of the gel
Results
Figure 1 shows SDS-PAGE gels of all the meat protein extracts, which were produced. Each extract was treated with TGase (first lane of a specific extract), Tyrosinase (second lane of a specific extract) and no enzyme (third lane of a specific extract). The band at a MW of around 188 KDa is myosin.
Figure 2 shows SDS-PAGE analysis of extracts from pork, which were dialysed prior to electrophoresis. For the first three lanes, the extract was dialysed against a brine solution similar to the brine used for the extraction except that it contained no STPP. For lanes 4-6, the extract was dialysed against a brine solution identical to the one used for extraction. As in Figure 1, extracts were treated with both TGase (lane 1 and 4) and TrTyr2 (lane 2 and 5).
Table 1 lists the protein and free thiol concentration measured in each of the extracts (average of two determinations). The results show large differences in both protein and free thiol content of the different extracts. There does not seem to be any correlation between protein content and free thiol concentration. Free thiol content of pork and beef extracts after treatment with 0.033 nkat/ml sulfhydryl oxidase for 60 minutes was also determined.
Table 1 : Protein content and free thiol concentration of the different protein extracts.
Free thiol Free thiol after Protein
(μM) sulfhydryl % oxidase- treatment (μM)
Pork 18.4 2.6 3.1
Beef 6.0 2.3 2.5
Turkey 6.4 - 2.1
Chicken 14.5 - 3.3
Lamb 12.3 - 2.6
Cod 3.4 - 1.9
Activity spot tests showed that free cysteine down to a concentration of about 10 μM gave a pronounced inhibition of the tyrosinase. The cysteine and enzyme were in contact with each other for about 1 min before adding the substrate. Figure 3 shows SDS-PAGE analysis of pork (a) and beef (b) extracts, which were treated with sulfhydryl oxidase to remove free thiols before addition of cross- linking enzyme.
Figure 4 illustrates that both gel-strength and WHC of gels made from the different meat extracts are positively correlated with protein content. Note that this figure only depicts reference samples (no enzyme treatment). The gel made from cod extract was inhomogeneous, which gives large variations in gel strength measurement. However, it was consistently lower than for the other gels.
Figure 5a and b, respectively, depicts gel strength and WHC of heat induced gels from different protein extracts with various enzymatic treatments. Remarkably positive effects on gel strength were observed on gels from pork, chicken and lamb when treated with both sulfhydryl oxidase and TrTyr2. For gels made from beef and turkey extracts, treatment with sulfhydryl oxidase-ι- Tyrosinase gave similar results as treatment with tyrosinase alone. Gel strength results for cod were omitted due to very inhomogeneous gels. The tendencies observed for gel WHC were similar to gel strength except that WHC for chicken gels was unaltered regardless of treatment. WHC for cod could be measured even though the gels were inhomogeneous. TGase treatments were run for reference.
The experiments with pork extract and the combination of sulfhydryl oxidase and tyrosinase were repeated with similar results. However, the second experiment was run with a new protein extract, giving different levels of both gel strength and WHC. Hence, the results were not included in Figure 5. Also, a sample was run with sulfhydryl oxidase alone. In this case no difference on gel strength and WHC was observed compared to the reference sample.
DISCUSSION
The effects of tyrosinase treatment on meat protein extracts from different species of animals are not similar (Figure 1). Most noticeably, no cross-linking seems to take place upon tyrosinase treatment in extracts from pork (compare lane 11 - tyrosinase treated, with lane 12 - reference), while in extracts from e.g. beef, HMW protein bands in the top of the gel are observed upon tyrosinase treatment, indicating protein cross-linking (compare lane 8 - tyrosinase treated, with lane 9 - reference). Concomitantly there is a reduction in the intensity of the myosin band (at 188 KDa), which indicates that it is mainly this protein, which is cross-linked. Except for pork, tyrosinase treatment produces high MW protein aggregates in extracts from all species. However, the efficiency of the cross-linking activity seems to vary. In cod extract the myosin band disappears entirely, indicating a very efficient cross-linking. While for beef, turkey, chicken and lamb there are varying degrees of myosin-band fading, indicating varying degrees of cross-linking efficiency.
TGase, a well-known protein cross-linking enzyme, is always included as a positive reference (lane 1, 4, 7, 13, 16 in Figure 1). It is seen that TGase catalysed cross- linking is efficient in all extracts. In the results described herein, TGase activity was not influenced by any further treatment.
Myosin is a very conserved protein in the animal kingdom, and therefore the myosin substrate is considered to be equivalent between the different meat samples.
We have identified that the low tyrosinase activity in meat substrates such as pork or chicken, is due to the presence of tyrosinase inhibition in the different extracts. This notion was substantiated by two simple tests: 1) Ten times dilution of the pork extract prior to tyrosinase treatment rendered the enzyme active (observed as a high MW band and myosin fading on SDS-PAGE; results not shown). 2) Tyrosinase makes milk turn red due to formation of quinones. This is used as a simple tyrosinase activity spot test. If tyrosinase was mixed with pork extract before addition to the milk, no colour formation was observed. Both tests indicate an inhibitory effect of the extract.
In addition we have attempted to enhance the texture of protein gels made from protein extracts of minced pork, but it was observed that very high tyrosinase concentrations were necessary in order to obtain texture enhancements. This result also supports that tyrosinase is being inhibited from some component in the pork extract. A dialysis of the pork extract was carried out (Figure 2). It is seen that dialysis against the exact same solution as was used for extraction of the proteins rendered the tyrosinase active (compare lanes 5 and 6). This indicates that the inhibition originates from a low MW compound.
Phosphates are potential inhibitors of tyrosinase since they may collate with copper atoms, which are essential for catalytic activity of tyrosinases. The phosphate STPP is present at a level of 0.3% in all extracts. However, it is unlikely that STPP is the cause of inhibition, since it is still present after dialysis. Moreover, it is present in extracts from all species, also the ones where tyrosinase catalysed cross-linking is efficient. Nevertheless, pork extract was dialysed against a solution free of STPP. Consistent with the above mentioned, no further efficiency of tyrosinase cross-linking was observed (compare lane 2 and 5; one should not draw conclusions upon small differences in band intensities since the SDS sample solutions were viscous, reducing pipetting accuracy). Addition of extra copper also did not seem to enhance tyrosinase activity (results not shown).
A literature study revealed two potential inhibitors, which are likely to be encountered in the meat extracts. One is triglycerides with a total number of double bonds exceeding 4, the other is free cysteine.
First, attempts were made by different procedures to remove the potentially inhibitory lipids from the meat before extraction. These included washing with solvents (hexane, acetem, tributyrin, or water) and treatment with lipase. In general, the results from these experiments were inconclusive, and by no means gave any indication that lipids were the main cause of the tyrosinase inhibition.
To follow up on the potential inhibitory effect of cysteine, tyrosinase activity was spotted with and without different concentrations of cysteine in the assay medium. Tyrosinase was clearly inhibited by cysteine at concentrations above 10 μM. Subsequently, the free thiol content (which includes free cysteine) in the different protein extracts was measured (Table 1). It was observed that the highest concentration of free thiol was present in the extract from pork and that the concentration (18.4 μM) was substantially above the limit of inhibition observed with cysteine. It is not known how much of the free thiol present in the samples originates from free cysteine. However, it is likely that the tyrosinase is inhibited by low MW free thiols in general, rather than free cysteine alone. In extracts from chicken and lamb, the free thiol concentration was also above the inhibitory level found for cysteine. These samples from chicken and lamb extracts are also the ones where the least extensive fading of the myosin band occurs (Figure 1), i.e. tyrosinase seems to be inhibited to some extent. Cod extract has the lowest content of free thiol and is also the extract in which the fading of the myosin band is most pronounced. All in all, this is strong evidence that free thiols are responsible for tyrosinase inhibition.
In an attempt to circumvent the inhibitory effect of free thiols, the extracts were treated with sulfhydryl oxidase, which oxidises free thiols to disulfide compounds. After treatment of extract from pork with a sulfhydryl oxidase (0.33 or 0.033 nkat/ml), tyrosinase was no longer inhibited, as seen from the formation of high MW protein aggregates and substantial fading of the myosin band on the SDS- PAGE analysis in Figure 3a (compare lane 2, 5, and 8). Sulfhydryl oxidase alone did not cause any observable protein cross-linking (compare lane 3, 6 and 9). We considered the possibility that the sulfhydryl oxidase produces disulfide cross-links between proteins, which may not observable on the gels in Figure 3, due to the presence of the reducing agent DTT in the SDS sample buffer. Hence, a SDS-PAGE analysis was carried out under non-reducing conditions (without DTT). However, no cross-linking effect of sulfhydryl oxidase alone was observed (results not shown). For beef extract (Figure 3b), tyrosinase was able to cross-link proteins, regardless of whether the extract had received sulfhydryl oxidase-treatment or not. This shows that sulfhydryl oxidase itself does not have a negative effect on tyrosinase activity.
Cross-linking of meat proteins may enhance textural and sensorial properties of meat products. In the earlier study it was found contrary to expectations that tyrosinase alone did not enhance gel strength and WHC of heat induced protein gels, made from pork extracts, notably. As a continuation of the above results, it was tested whether removal of free thiol in protein extracts could boost the functional effects expected by tyrosinase catalysed cross-linking. It was seen (Figure 5) that tyrosinase alone may improve both strength and WHC of heat induced protein gels made from extracts with a low free thiol content (beef and turkey). Such improvements in gels produced from extracts with high thiol content (pork and chicken) were only possible if free thiol was removed (by sulfhydryl oxidase) before tyrosinase action.
There are very pronounced differences in the level of gel strength and WHC between the different extracts. This is a consequence of different protein contents in the extracts (Figure 4)
Conclusion
Protein extracts from different types of meat show very different characteristics with regard to tyrosinase catalysed cross-linking. The differences correlate to different levels of free thiol in the samples. Treating with sulfhydryl oxidase prior to tyrosinase treatment eliminated low efficiency of tyrosinase catalysed cross- linking in meat extracts with significant inhibition, such as extracts from pork.
Tyrosinase alone may improve both strength and WHC of heat induced protein gels made from extracts with a low free thiol content (beef and turkey). Such improvements in gels produced from extracts with high thiol content (pork and chicken) were only possible if free thiol was removed (by sulfhydryl oxidase) before tyrosinase action.
We note that most meats have a detectable and in many cases significant free thiol content, therefore even in meats where it is possible to obtain a satisfactory gel strength or water holding capacity, the use of the sulfydryl oxidase enzyme will allow for a reduced dosage of tyrosinase, and/or shorter or more desirable enzymatic incubation conditions.
The concept is also applicable in whole meat products. This was shown by adding different combinations of SOX and tyrosinase to a model chicken sausage recipe containing minced chicken meat. It was shown that when tyrosinase was added subsequent to a SOX treatment, both product hardness and water holding capacity of the product increased significantly compared to the control product. This was not the case when any of the two enzymes were used alone. The tyrosinase-SOX combination produced significantly higher product hardness and water holding capacity than transglutaminase at a dose recommended by the supplier (results not shown).

Claims

1. A method for the preparation of a cross-linked proteinaceous substrate, said method comprising the steps:
a. treatment of a proteinaceous substrate comprising free thiols with a first enzyme capable of removing free thiols;
b. treatment of the proteinaceous substrate with a second enzyme, the activity of which is inhibited by free thiols;
wherein step a) is performed prior to, or simultaneous to step b), and wherein step b) results in the cross-linking of proteins present in said proteinaceous substrate and wherein the first enzyme and the second enzyme is not the same enzyme.
2. The method according to claim 1, wherein the second enzyme is selected from the group consisting of a tyrosinase, laccase, lipoxygenase and protein lysin 6-oxidase (lysyl oxidase).
3. The method according to claim 2, wherein the second enzyme is selected from the group consisting of lipoxygenase and protein lysin 6-oxidase (lysyl oxidase).
4. The method according to any one of claims 1-3, wherein the second enzyme is laccase.
5. The method according to any one of claims 1-3, wherein the second enzyme is a tyrosinase.
6. The method according to any one of claims 1-5, in which the first enzyme and/or the second enzyme is in isolated or purified form.
7. The method according to any one of claims 1-6, in which the first enzyme is an oxidase.
8. The method according to any one of claims 1-6, wherein the first enzyme is not laccase.
9. The method according to any one of claims 1-6, in which the first enzyme has an EC code 1.8.3.2. or 1.8.3.3.
10. The method according to any one of claims 1-6, in which the first enzyme is sulfhydryl oxidase.
11. The method according to any one of claims 1-6, in which the first enzyme is glutathione oxidase
12. The method according to any one of claims 1-6, in which the first enzyme is disulfide isomerase.
13. The method according to any one of claims 1 - 12, in which the proteinaceous substrate is a proteinaceous foodstuff, which preferably comprises myosin.
14. The method according to claim 13, in which the proteinaceous foodstuff contains or is derived from animal meat, such as mammalian, bird, or fish.
15. The method according to claim 14, in which the proteinaceous foodstuff contains or is derived from meat selected from the group consisting of pork, lamb, chicken, beef, turkey, cod, kangaroo, ostrich, shark.
16. The method according to claim 15, in which the proteinaceous foodstuff is selected from the group consisting of pork, lamb, and chicken, most preferably pork.
17. The method according to any one of claims 1-16, in which the first and second enzyme are present within the same enzyme composition.
18. The method according to any one of claims 1-17, in which the first enzyme is isolated from the second enzyme prior to use.
19. The method according to any one of claims 1-18, wherein the first enzyme and the second enzyme is provided as an enzyme system in the form of a kit, said kit comprising a first pot which comprises the first enzyme, and a second pot which comprises the second enzyme.
20. The method according to claim 19, wherein the first enzyme is present in the form of an enzyme system, prior to use, at a concentration of between 0.001 and 300mg/g.
21. The method according to any one of claims 19-20, wherein the second enzyme is present in the form of an enzyme system, prior to use, at a concentration of between 0.001 and 500mg/g.
22. The method according to any one of claims 19-21, wherein the enzyme system is in the form of a food processing aid, for the enzymatic treatment of proteinaceous food products.
23. The method according to claim 22, wherein the enzyme system comprises a further component, such as one or more food enzyme composition ingredients and/or carriers.
24. The method according to any one of claims 1-23, wherein the removal of free thiols in step a) results in a reduction in the free thiol concentration of the proteinaceous substrate of at least 5%.
25. A method according to any one of claims 1-24, wherein the removal of free thiols in step a) results in a reduction in the free thiol concentration of the proteinaceous substrate by at least lμM.
26. Use of the first enzyme as defined in any one of the preceding claims, for reducing the concentration of free thiols in a proteinaceous substrate.
27. The use of the first enzyme according to claim 26, in which the proteinaceous substrate is a proteinaceous foodstuff, which preferably comprises myosin.
28. The use of the first enzyme according to claim 27, in which the proteinaceous foodstuff contains or is derived from animal meat, such as mammalian, bird, or fish.
29. The use of the first enzyme according to claim 28, in which the proteinaceous foodstuff contains or is derived from meat selected from the group consisting of pork, lamb, chicken, beef, turkey, cod, kangaroo, ostrich, and shark.
30. The use of the first enzyme according to claim 29, in which the proteinaceous foodstuff is selected from the group consisting of pork, lamb, and chicken, most preferably pork.
31. The use of the first enzyme according to any of claims 26 to 30, which results in a reduction in the free thiol concentration of the proteinaceous substrate of at least 5%.
32. The use of the first enzyme according to any of claims 26 to 31, which results in a reduction in the free thiol concentration of the proteinaceous substrate by at least lμM.
33. The use of the first enzyme according to any of claims 26 to 32, in which the reduction in free thiol concentration of the proteinaceous substrate is sufficient to enhance the ability of a second enzyme to cross link the protein present in the substrate, such as myosin.
34. The use of the first enzyme according to claim 33, in which the second enzyme is as defined in any one of claims 1 - 25.
35. A method for improving the enzymatic activity on a proteinaceous substrate comprising free thiols by a second enzyme, the activity of which is inhibited by the presence of free thiols, said method comprising treatment of the proteinaceous substrate with a first enzyme capable of removing free thiols; wherein the treatment with the first enzyme is performed prior to, or simultaneous with a treatment with the second enzyme and wherein the first enzyme and the second enzyme is not the same enzyme.
36. The method according to claim 35, wherein the enzymatic activity results in the cross-linking of proteins present in said proteinaceous substrate.
37. The method according to any one of the claims 35-36, wherein the first enzyme is as defined in any one of claims 1 - 26.
38. The method according to any one of claims 35-37, wherein the second enzyme is selected from the group consisting of tyrosinase, laccase, lipoxygenase, galactose oxidase, protein lysin 6-oxidase (lysyl oxidase), galactolipase and lysophospholipase,
39. The method according to any one of claims 35 - 38, wherein the proteinaceous substrate is as defined in any one of claims 1 - 26.
40. A method for the preparation of a protein cross-linked foodstuff, said method comprising the steps:
a. treatment of a proteinaceous foodstuff with a first enzyme capable of degrading or oxidising free thiols;
b. treatment of the proteinaceous foodstuff with a second enzyme;
wherein step a) is performed prior to, or simultaneous to step b), and wherein step b) results in the cross-linking of proteins present in said proteinaceous food product.
41. The method according to claim 40 in which the enzyme capable of degrading or oxidising free thiols is as defined in any one of claims 1 - 25.
42. The method according to claim 40 or 41, wherein step a) comprises the use of the first enzyme according to any one of claims 26 - 34.
43. The method according to any one of claims 40 - 42, wherein the step a) results in a reduction in the free thiol concentration of the proteinaceous foodstuff of at least 5%.
44. The method according to any one of claims 40 - 43, wherein the step a) results in a reduction in the free thiol concentration of the proteinaceous foodstuff by at least lμM.
45. The method according to any one of claims 40 - 44, wherein the step a) results in a reduction in free thiol concentration of the proteinaceous foodstuff which is sufficient to enhance the ability of the second enzyme to cross link the protein present in the food substrate, such as myosin.
46. The method according to any one of claims 40 - 45, wherein the second enzyme is as defined in any one of claims 1 - 25.
47. The method according to any one of claims 40 - 46, wherein the proteinaceous food product is as defined in any one of claims 27 - 30.
48. The method according to any one of claims 40 - 47, wherein the proteinaceous foodstuff comprises myosin, and the degree of cross-linking of the myosin protein present in the treated proteinaceous food products, subsequent to steps a) and b) is at least 5%.
49. The method according to any one of claims 40 - 48, wherein the gel strength or water holding capacity, or both, of the proteinaceous foodstuff after steps a) and b) are enhanced compared to the untreated proteinaceous food product.
50. The foodstuff prepared by any one of claims 40 - 49.
51. The proteinaceous foodstuff according to claim 50, wherein the concentration of free thiols present in said food product is no greater than 15μM, or no greater than lOμM, or no greater than 5μM.
52. The proteinaceous according to claim 50 to 51, in which the gel strength has been enhanced by at least 2g.
53. The proteinaceous foodstuff according to any of claims 50 to 52, in which the water holding capacity has been enhanced by at least 5%, such as at least 10%.
54. The proteinaceous foodstuff according to any of claims 50 to 53, in which at least 10% of the total myosin is cross linked.
55. The proteinaceous foodstuff according to any of claims 50 to 54, in which the concentration of free thiols has been reduced by at least 2μM.
56. The proteinaceous foodstuff according to any of claims 50 to 55, in which the proteinaceous foodstuff is derived from animal meat, such as mammalian, bird, or fish.
57. The proteinaceous foodstuff according to any of claims 50 to 56, in which the food product is free from artificial additives, particularly additives such as phosphates.
58. A processed food product comprising the proteinaceous foodstuff according to any one of claims 50 to 57.
59. The processed food product according to claim 58, wherein the food product is selected from the group consisting of cooked meat, dry & semi-dry cured meat products, fermented products, emulsified products, fish & seafood products, fresh meat muscle, ground/restructered fresh meat, reformed meat, poultry products, retorted products, autoclaved meat products, vegetarian & meat analogue products.
60. The use of the method according to any one of claims 1 - 25 for the preparation of a proteinaceous foodstuff which has enhanced water retention.
61. The use of the method according to any one of claims 1 - 25 for the preparation of a proteinaceous foodstuff which has enhanced gel-strength.
62. The use of the method according to any one of claims 1 - 25 for the preparation of a proteinaceous foodstuff which has enhanced texture or mouth- feel.
PCT/EP2009/052558 2008-03-04 2009-03-04 Improving enzymatic treatment of a proteinaceous substrate by enzymatic removal of free thiols WO2009109602A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
JP2010549140A JP5706695B2 (en) 2008-03-04 2009-03-04 Improving enzymatic treatment of proteinaceous substrates by enzymatic removal of free thiols
EP09716617A EP2259686A1 (en) 2008-03-04 2009-03-04 Improving enzymatic treatment of a proteinaceous substrate by enzymatic removal of free thiols
CN200980113111.0A CN102006783B (en) 2008-03-04 2009-03-04 Improving enzymatic treatment of a proteinaceous substrate by enzymatic removal of free thiols
US12/875,206 US20110123676A1 (en) 2008-03-04 2010-09-03 Enzymatic treatment of a proteinaceous substrate by enzymatic removal of free thiols

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US3361208P 2008-03-04 2008-03-04
US61/033,612 2008-03-04
DKPA200800320 2008-03-04
DKPA200800320 2008-03-04

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US12/875,206 Continuation-In-Part US20110123676A1 (en) 2008-03-04 2010-09-03 Enzymatic treatment of a proteinaceous substrate by enzymatic removal of free thiols

Publications (1)

Publication Number Publication Date
WO2009109602A1 true WO2009109602A1 (en) 2009-09-11

Family

ID=39760828

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2009/052558 WO2009109602A1 (en) 2008-03-04 2009-03-04 Improving enzymatic treatment of a proteinaceous substrate by enzymatic removal of free thiols

Country Status (5)

Country Link
US (1) US20110123676A1 (en)
EP (1) EP2259686A1 (en)
JP (2) JP5706695B2 (en)
CN (1) CN102006783B (en)
WO (1) WO2009109602A1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016094359A1 (en) * 2014-12-08 2016-06-16 Wisconsin Alumni Research Foundation Oxygen scavenging stabilizes color in meats in low oxygen
US20200345034A1 (en) * 2014-04-28 2020-11-05 International Dehydrated Foods, Inc. Concentrated protein compositions and methods of their making and use

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8584978B2 (en) * 2010-03-29 2013-11-19 Weiler And Company, Inc. Separator for a grinding machine
WO2015027388A1 (en) * 2013-08-27 2015-03-05 福建安井食品股份有限公司 Method for improving gelling of surimi product based on sulfydryl oxidization of sulfydryl protease
JP7543588B1 (en) 2024-04-01 2024-09-02 長谷川香料株式会社 Method for improving the flavor of processed seafood foods

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1995000636A1 (en) * 1993-06-28 1995-01-05 Novo Nordisk A/S A fungal protein disulfide isomerase
WO2002014484A1 (en) * 2000-08-15 2002-02-21 Valtion Teknillinen Tutkimuskeskus A tyrosinase enzyme
US20040029225A1 (en) * 2000-09-05 2004-02-12 Akiko Sugio Lipoxygenase
WO2007141385A1 (en) * 2006-06-07 2007-12-13 Valtion Teknillinen Tutkimuskeskus Milk product and method for its preparation

Family Cites Families (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US2971851A (en) * 1958-11-25 1961-02-14 Miles Lab Scavenger packet
US4087328A (en) * 1975-10-10 1978-05-02 Research Triangle Institute Purification and immobilization of sulfhydryl oxidase
US4632905A (en) * 1985-05-29 1986-12-30 Novo Laboratories, Inc. Microbial sulfhydryl oxidase
US4894340A (en) * 1987-12-21 1990-01-16 Suomen Sokeri Oy Microbial sulfhydryl oxidase and method
EP0321811B2 (en) * 1987-12-21 1999-12-22 Dsm N.V. Method for improving flour dough
US5543164A (en) * 1994-06-17 1996-08-06 The Regents Of The University Of California Water-insoluble protein-based edible barrier coatings and films
JP4137224B2 (en) * 1998-03-31 2008-08-20 天野エンザイム株式会社 Protein cross-linking method
EP0988859A1 (en) * 1998-09-03 2000-03-29 Basf Aktiengesellschaft Active substance preparations and a process for producing the same
US6174682B1 (en) * 1999-03-08 2001-01-16 Millenium Pharmaceuticals, Inc. Thioredoxin family active site molecules and uses therefor
US6451553B1 (en) * 1999-09-08 2002-09-17 Novozymes A/S Method for the separation of flour
NL1019931C2 (en) * 2002-02-08 2003-08-11 Tno Saturation generating food.
US20030219853A1 (en) * 2002-03-01 2003-11-27 Szu-Yi Chou Method of cross-linking a compound
EP1809122A1 (en) * 2004-08-12 2007-07-25 Nederlandse Organisatie voor toegepast-natuurwetenschappelijk Onderzoek TNO A method for enzymatic cross-linking of a protein, cross-linked protein thus obtained and use thereof
US20060289354A1 (en) * 2005-06-15 2006-12-28 Buckman Laboratories International, Inc. Method and composition to control the growth of microorganisms in aqueous systems and on substrates
FI20065109L (en) * 2006-02-14 2007-08-15 Valtion Teknillinen Low content meat products and a method for their preparation

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1995000636A1 (en) * 1993-06-28 1995-01-05 Novo Nordisk A/S A fungal protein disulfide isomerase
WO2002014484A1 (en) * 2000-08-15 2002-02-21 Valtion Teknillinen Tutkimuskeskus A tyrosinase enzyme
US20040029225A1 (en) * 2000-09-05 2004-02-12 Akiko Sugio Lipoxygenase
WO2007141385A1 (en) * 2006-06-07 2007-12-13 Valtion Teknillinen Tutkimuskeskus Milk product and method for its preparation

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
CABALLERO ET AL: "Improvement of dough rheology, bread quality and bread shelf-life by enzymes combination", JOURNAL OF FOOD ENGINEERING, BARKING, ESSEX, GB, vol. 81, no. 1, 31 January 2007 (2007-01-31), pages 42 - 53, XP005738765, ISSN: 0260-8774 *
LANTTO ET AL: "Effects of transglutaminase, tyrosinase and freeze-dried apple pomace powder on gel forming and structure of pork meat", LEBENSMITTEL WISSENSCHAFT UND TECHNOLOGIE, ACADEMIC PRESS, LONDON, GB, vol. 39, no. 10, 1 December 2006 (2006-12-01), pages 1117 - 1124, XP005502582, ISSN: 0023-6438 *
RAIJA LANTTO ET AL: "Effect of laccase and transglutaminase on the textural and water-binding properties of cooked chicken breast meat gels", EUROPEAN FOOD RESEARCH AND TECHNOLOGY ; ZEITSCHRIFT FÜR LEBENSMITTELUNTERSUCHUNG UND -FORSCHUNG A, SPRINGER, BERLIN, DE, vol. 225, no. 1, 27 June 2006 (2006-06-27), pages 75 - 83, XP019488876, ISSN: 1438-2385 *

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20200345034A1 (en) * 2014-04-28 2020-11-05 International Dehydrated Foods, Inc. Concentrated protein compositions and methods of their making and use
US11779032B2 (en) * 2014-04-28 2023-10-10 International Dehydrated Foods, Inc. Concentrated protein compositions and methods of their making and use
WO2016094359A1 (en) * 2014-12-08 2016-06-16 Wisconsin Alumni Research Foundation Oxygen scavenging stabilizes color in meats in low oxygen

Also Published As

Publication number Publication date
JP2011512831A (en) 2011-04-28
JP2015107119A (en) 2015-06-11
CN102006783B (en) 2015-01-21
CN102006783A (en) 2011-04-06
EP2259686A1 (en) 2010-12-15
JP5706695B2 (en) 2015-04-22
US20110123676A1 (en) 2011-05-26

Similar Documents

Publication Publication Date Title
Buchert et al. Crosslinking food proteins for improved functionality
Chaurasiya et al. Efficacy of reverse micellar extracted fruit bromelain in meat tenderization
Yarnpakdee et al. Antioxidant and sensory properties of protein hydrolysate derived from Nile tilapia (Oreochromis niloticus) by one-and two-step hydrolysis
Zhang et al. A review of recent progress in reducing NaCl content in meat and fish products using basic amino acids
Li et al. Oxidation-induced unfolding facilitates myosin cross-linking in myofibrillar protein by microbial transglutaminase
Xu et al. Physical and chemical changes of silver carp sausages during fermentation with Pediococcus pentosaceus
Centenaro et al. Antioxidant activity of protein hydrolysates of fish and chicken bones
Broncano et al. Use of proteases to improve oxidative stability of fermented sausages by increasing low molecular weight compounds with antioxidant activity
RU2473246C2 (en) Method for manufacture of treated meat product ot seafood product and enzyme preparation for improvement of treated meat product or seafood product
JP2015107119A (en) Improvement of enzymatic treatment of a proteinaceous substrate by enzymatic removal of free thiol
US20090053364A1 (en) Low-ingredient meat products and method for their preparation
WO2013172447A1 (en) Enzyme preparation for modifying food material
Yin et al. Optimum processing conditions for slowly heated surimi seafood using protease-laden Pacific whiting surimi
US20200245640A1 (en) Use of enzymes to deflavor pea protein
Wanasundara et al. Preparation and characterization of hydrolyzed proteins from defibrinated bovine plasma
Toldrá et al. Enzymes in meat and fish
Muzaddadi et al. Seafood enzymes and their application in food processing
Zheng et al. Preparation and characterisation of the pearl oyster (Pinctada martensii) meat protein hydrolysates with a high Fischer ratio
Yin et al. Improvement of the functionality of minced mackerel by hydrolysis and subsequent lactic acid bacterial fermentation
US6001398A (en) Processed meat product and process for preparing same
Chen et al. Antioxidative activities of hydrolysates from duck egg white using enzymatic hydrolysis
Buchert et al. Using crosslinking enzymes to improve textural and other properties of food
JP5035586B2 (en) Meat softener containing proteolytic enzyme powder and method for modifying meat using the meat softener
Lantto Protein cross-linking with oxidative enzymes and transglutaminase: effects in meat protein systems
AU2004304884B2 (en) Food product and process for reducing oil and fat content in cooked food

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200980113111.0

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 09716617

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2010549140

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

REEP Request for entry into the european phase

Ref document number: 2009716617

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2009716617

Country of ref document: EP