WO2009002607A1 - Compositions and methods for identifying transforming and tumor suppressor genes - Google Patents

Compositions and methods for identifying transforming and tumor suppressor genes Download PDF

Info

Publication number
WO2009002607A1
WO2009002607A1 PCT/US2008/062230 US2008062230W WO2009002607A1 WO 2009002607 A1 WO2009002607 A1 WO 2009002607A1 US 2008062230 W US2008062230 W US 2008062230W WO 2009002607 A1 WO2009002607 A1 WO 2009002607A1
Authority
WO
WIPO (PCT)
Prior art keywords
protein
regulatable
composition
cell
cells
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2008/062230
Other languages
French (fr)
Inventor
Thomas M. Roberts
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Dana Farber Cancer Institute Inc
Original Assignee
Dana Farber Cancer Institute Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Dana Farber Cancer Institute Inc filed Critical Dana Farber Cancer Institute Inc
Publication of WO2009002607A1 publication Critical patent/WO2009002607A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6883Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
    • C12Q1/6886Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/1034Isolating an individual clone by screening libraries
    • C12N15/1079Screening libraries by altering the phenotype or phenotypic trait of the host
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/033Fusion polypeptide containing a localisation/targetting motif containing a motif for targeting to the internal surface of the plasma membrane, e.g. containing a myristoylation motif
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/40Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • C07K2319/43Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a FLAG-tag
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/178Oligonucleotides characterized by their use miRNA, siRNA or ncRNA

Definitions

  • Cancer is one of the leading causes of death in the United States. Each year, more than half a million Americans die from cancer and more than one million are newly diagnosed with the disease. Cancer develops from normal tissues through a stepwise accumulation of genetic mutations that causes a cell to escape from its normal growth regulatory mechanisms and proliferate in an uncontrolled manner. Tumor cells can metastasize to secondary sites if treatment of the primary tumor is either incomplete or not initiated before the disease progresses substantially. Early diagnosis and effective treatment of tumors are therefore essential for survival.
  • Cancer involves the clonal replication of cell populations that have gained a competitive advantage over normal cells through the alteration of regulatory gene expression.
  • Regulatory genes can be broadly classified into two categories including “oncogenes” which, when activated or overexpressed, promote unregulated cell proliferation and “tumor suppressor genes” which, when inactivated or underexpressed, fail to prevent abnormal cell proliferation.
  • oncogenes include, for example, Myc, Ras, Src, and HER2.
  • tumor suppressor genes have been identified that, when inactivated, are involved in the initiation or progression of human cancers.
  • Known tumor suppressor genes include, for example, RB, p53, DCC, APC/MCC, NFl, NF2, WTl, VHL, BRCAl, MSTl and WAF1/CIP1.
  • protein kinases are just one family of signaling pathway regulators whose members are known to cause malignant transformation when dysregulated. It is now appreciated that the total complement of human protein kinases is encoded by greater than 500 genes, making them the most populated class of potential draggable cancer targets.
  • This invention relates generally to compositions and methods useful for the dissection of signal transduction pathways that cause oncogenesis in humans and, more specifically, for the identification of genes that modulate cellular transformation that are both physiologically relevant to human cancers and therapeutically attractive for cancer treatment. Described herein are methods that comprise an essential tool to identify oncogenes and tumor suppressor genes.
  • compositions comprising one or more nucleic acids encoding one or at least two regulatable proteins, each linked to one or more regulatory signals, wherein expression of the regulatable proteins in a cell results in the regulatable protein being regulated, e.g., constitutively regulated.
  • the one or more nucleic acids may encode at least 1, 2, 3, 5, 10 or more regulatable proteins.
  • a regulatable protein may be a kinase, e.g., in Table 1, or a biologically active fragment thereof, such as an intracellular domain, e.g., a catalytic domain.
  • the regulatable proteins or biologically active portions thereof may be linked to an activation signal, such as a membrane targeting signal, e.g., a myristoylation signal. This signal may be linked to the N- or C-terminus of the kinases or biologically active portions thereof.
  • the kinase is a receptor tyrosine kinase that is linked to a membrane targeting signal.
  • a regulatable protein may also be linked to an activation signal that is an oligomerization, e.g., dimerization domain.
  • the dimerization domain may be an inducible dimerization domain, e.g., a dimerization domain that is induced to dimerize in the presence of a small molecule.
  • the oligomerization domain may be linked to the N- or C-terminus of the kinases or biologically active portions thereof.
  • a regulatable protein may be linked to both a membrane targeting signal and an oligomerization domain.
  • a regulatable protein may further be linked to a detectable peptide, such as a FLAG tag.
  • At least one regulatable protein may be linked directly to one or more regulatory signals.
  • At least one regulatable protein may be linked to one or more regulatory signals through a linker.
  • One or more nucleic acids may comprise one or more strong transcriptional regulatory sequences controlling the expression of the regulatable proteins.
  • the nucleic acids may be in an expression vector, e.g., a viral expression vector.
  • a composition comprises a reagent for introducing the composition into a cell.
  • a composition is in contact with or within a cell.
  • a cell may be an immortalized non-tumorigenic cell.
  • a cell may be a human cell.
  • a composition may also comprise at least 1, 2, 5, 10 or more nucleic acids, wherein each nucleic acid encodes a regulatable protein linked to one or more regulatory signals.
  • a composition may also comprise a library of nucleic acids encoding regulatable proteins linked to one or more regulatory signals.
  • compositions comprising one or more nucleic acids encoding one or at least two inhibitory mutants of proteins, wherein expression of the inhibitory mutants in a cell downregulates one or more biological activities associated with the corresponding wild- type proteins.
  • At least one protein may be a kinase, a phosphatase, an acetylase, or a deacetylase.
  • At least one inhibitory mutant of a protein may be a dominant negative mutant of the protein, a deletion mutant of the protein, a protein comprising a substitution of one or more amino acids, e.g., wherein one or more substitutions of amino acids results in a change in posttranslational modification of the protein.
  • a method comprising contacting one or more cells with a composition comprising one or more nucleic acids or proteins encoded thereby.
  • the cells may be contacted with the composition under conditions in which at least some of the nucleic acids of the composition are taken up by the cells.
  • the cells may be immortal but not tumorigenic cells.
  • the cells may comprises one or more of the following genes and oncogenes or proteins including, but not limited to: the catalytic sub unit of telomerase (hTERT), telomerase, human papilloma virus E6, Human papilloma virus E7, cyclin Dl, an R24C form of CDK4 (CDK4 R24C ), p53DD, MYC, phosphatidylinositol-3- kinase, adenovirus early region IA (ElA), E6, E7, MDM2, SV40 large T antigen, SV40 small T antigen, RAC/RHO, PDK, AKT, RAF, MEK, MEKDD, MAPK, RAL-GEFs, RAL, PLDl, H-RAS, an activated allele of H-RAS (H-RAS V12 ), ALT, CycDl/CDK4, or variants or fragments thereof that may be oncogenic or other such genes known in the art.
  • the cells may also comprise one or more inactivated or inhibited tumor suppressor genes or proteins, including, but not limited to: p53, retinoblastoma (Rb), PP2A, pl9ARF, pl6 iNK4A or PTEN tumor suppressor genes or variants or fragments thereof that maybe tumor suppressors or other such genes known in the art.
  • Quasi-transformed cells may also comprise a combination of one or more oncogenes and one or more inactivated tumor suppressor genes.
  • the method may further comprise determining whether the cells contacted with the composition are tumorigenic. This may comprise determining whether the cells contacted with the nucleic acids grow in an anchorage-independent manner and/or promote tumor formation in animal hosts.
  • the cells require a growth factor, e.g., IL-3, for growth and the method further comprises determining whether the cells contacted with the composition grow independently of the growth factor.
  • a method may comprise determining the level of the regulatable protein, e.g., IKK ⁇ , in a sample of a subject, wherein a higher or lower level and/or activity of the regulatable protein in the sample of the subject relative to that in a control indicates that the sample is or may become cancerous.
  • a method may also comprise determining the expression level of the regulatable protein in a tissue in a subject, wherein the presence of a higher or lower level of the regulatable protein in the tissue relative to a control indicates that the subject has or may develop cancer.
  • Determining the level of the regulatable protein may comprise (i) determining the protein level of the regulatable protein, e.g., by immunohistochemical staining or by activity such as a phosphorylation assay ; (ii) determining the level of RNA encoding the regulatable protein, e.g., by Northern blot or quantitative PCR; and/or (iii) detecting changes in copy number of genomic loci encoding the regulatable protein, e.g. by array comparative genome hybridization or fluorescence in situ hybridization.
  • a control may be the level of the regulatable protein in non-cancerous cells of the same origin as those of the potentially cancerous tissue sample.
  • the potentially cancerous tissue sample may be a cancerous tumor.
  • the method may further comprise first obtaining a biopsy of a tissue sample of the subject.
  • a method may comprise monitoring the level of a regulatable protein, e.g., IKK ⁇ , in a cancerous tumor of the subject over time, wherein an increase or decrease in the level of the regulatable protein in a cancerous tumor of the subject indicates that the cancer is progressing.
  • a regulatable protein e.g., IKK ⁇
  • kits comprising one or more agents for detecting the level of a regulatable protein, e.g., IKK ⁇ .
  • a kit may also comprise a control.
  • a control may be the level of the regulatable protein in a cancerous tumor or in a tissue of a healthy subject.
  • the agent for detecting the level of the regulatable protein may be an antibody or a variant, e.g., a fragment, thereof.
  • the agent for detecting the level of the regulatable protein may also comprise reagents necessary to detect the protein of the regulatable protein, the RNA encoding the regulatable protein and changes in copy number of genomic loci encoding the regulatable protein. Therapeutic methods are also provided herein.
  • FIG.l is a graph showing that activated MEKl and AKTl can cooperate to replace H- RAS in causing anchorage-independent microscopic/macroscopic colonies and tumor formation.
  • Anchorage-independent microscopic colonies 100 ⁇ m-200 nm, grey bars
  • macroscopic colonies >200 nm, blue bars
  • tumor formation number of tumors formed/tumor sites injected
  • Error bars represent the mean ⁇ standard deviation for 3 independent experiments.
  • FIGS.2A-C show the results of identifying putative oncogenes using a myristoylated kinase library.
  • FIG2A is a schematic diagram outlining the library generation and screening strategies.
  • FIG2B is a graph showing AI growth of pools named by their plate number (1-5) and row (A-H).
  • (-) and GFP indicate the number of colonies produced by mock- and GFP- vector-infected cells, respectively. Black line and red dotted line indicate the median and 2 standard deviations above the median, respectively.
  • FIG2C is a graph identifying putative kinase oncogenes from top scoring pools. Erorr bars indicate the mean ⁇ standard deviation for 3 independent experiments.
  • FIG2D shows tumor formation by IKBKE in HAlE-M cells. Tumorigenicity is indicated as the number of tumors formed/number of tumor sites injected and shown above the bars for each cell line.
  • FIGS3A-F show that IKBKE is amplified in breast cancer cell lines and patient- derived tumor samples.
  • FIG3A shows analysis of the IKBKE locus by single nucleotide polymorphism (SNP) arrays in 49 breast cancer cell lines. Colorgrams representing SNP copy number at Iq32 are shown. Red indicates allelic gain, while blue denotes allelic loss.
  • FIG3B shows clustering of array comparative genome hybridization (aCGH) data based on chromosome 1 copy number gain of 30 breast primary tumors. Colored rectangles indicate tumor grade (red- high, purple- intermediate, and blue- low grade) and lymph node (LN), estrogen receptor (ER), or HER2 status (red- positive, blue- negative, and gray- unknown).
  • aCGH array comparative genome hybridization
  • FIG3C shows fluorescence in situ hybridization (FISH) analysis of IKBKE amplification in UACC-812, ZR-75-1 and MCF-7 breast cancer cell lines and BWH-Tl 8 primary breast tumor.
  • Green signal indicates hybridization using an IKBKE-specific BAC probe, while red color indicates hybridization using a chromosome 1 -specific alpha satellite DNA probe (left panels) or chromosome 1 painting probe (right panels).
  • FIG3D shows quantiative RT-PCR (qRT-PCR) analysis of EKBKE expression in breaset cancer cell lines and patient samples. Carcinomas and cell lines are color-coded to indicate presence of amplified Iq32 (blue- non- amplified, red- amplified).
  • FIG3E shows immunoblotting for IKK ⁇ .
  • K-14 anti-IKK ⁇ antibody Santa Cruz
  • immunoblot in left panel compares breast cancer and immortalized breast cell lines lacking IKBKE copy number gain (MCFlOA, MCF10A.DCIS.COM) to breast cancer cell lines with low levels of IKBKE (MCF-7, MDA-MB-231) and the middle immunoblot compares breast cancer cell lines harboring different levels of IKBKE copy number gain.
  • FIGS4A-D show that IKBKE is an essential kinase in breast cancer cells.
  • FIG4A shows that IKBKE is essential for MCF-7 cell viability.
  • Lower panels show IKK ⁇ expression in MCF-7 cells expressing IKBKE-specific shRNAs or a control shRNA targeting GFP (shGFP).
  • FIG4B shows the effects of suppressing kinase genes located at Iq32.
  • MCF-7 cells were infected with shRNA constructs (5/gene) targeting 10 kinases (ETNK2, PIK3C2B, RIPK5, DYRK3, IKBKE, MAPKAP2, PCTK3, PFKFB2, NUCKSl and NUAK2) located at Iq32.
  • shRNA constructs (5/gene) targeting 10 kinases (ETNK2, PIK3C2B, RIPK5, DYRK3, IKBKE, MAPKAP2, PCTK3, PFKFB2, NUCKSl and NUAK2
  • FIG4C shows the effects of IKK ⁇ suppression on viability. Representative micrographs obtained 5 days after infection with the indicated shRNA are shown.
  • FIG4D shows the effects of IKK ⁇ suppression on proliferation. Cells were plated on day 0, infected with IKBKE shRNA 24 hours later and cumulative cell numbers determined for 11 days. The doubling time for each cell line was determined and then normalized to cells expressing a control, scrambled shRNA (shScr). Expression of IKK ⁇ is shown in lower panels for the indicated cell lines.
  • FIGS5A-D show that IKBKE activates the NF- ⁇ B pathway in transformation models.
  • FIG5A and FIG5B show the effects of IKK ⁇ expression on I ⁇ B ⁇ stability. Cytoplasmic I ⁇ B ⁇ levels in HAlE-M cells are shown and quantified.
  • FIG5C shows RT-PCR and immunoblot (Western blot) analysis of I ⁇ B ⁇ overexpression. MUT: I ⁇ B ⁇ super-repressor, wt: wt I ⁇ B ⁇ allele.
  • FIG5D and FIG5E show localization of NF- ⁇ B p50. The antibody used here detects both NF- ⁇ B p50 and the NF- ⁇ B p50 precursor (pi 05).
  • FIG5J and FIG5K show the effects of expressing MUT I ⁇ B ⁇ on the doubling time (FIG5J) and AI growth (FIG5K) of HAlE-M cells expressing either myr-DCBKE or myr-AKT.
  • FIG5L shows the effects of suppressing IKBKE on AI growth of AKT-transformed cells.
  • (-) indicates control cells.
  • FIGS6A-E show that IKBKE activates the NF- ⁇ B pathway in breast cancer.
  • FIG6A shows downregulation of NF- ⁇ B target genes in ZR-75-1 breast cancer cells after DCBKE suppression as determiend by quantitative RT-PCR.
  • FIG6B and FIG6C show the relative expression of MMP9 (FIG6B) and BCL2 (FIG6C) in breast cancer cell lines that harbor (UACC-812, ZR-75-1, MCF-7) or lack (SUM52) IKK ⁇ gain or amplification. UACC-812 cells do not express BCL2.
  • FIGD and FIG6E show examination of IKK ⁇ overexpression and NF- ⁇ B pathway activation in primary breast cancer specimens.
  • FIG6D shows representative IHC staining and scoring used to assess IKK ⁇ and nuclear c-REL expression. 0:no staining, l:low staining, 2:moderate staining, 3. 'high staining.
  • FIG6E shows co- expression of IKK ⁇ and nuclear c-REL. Each point represents one breast cancer specimen, p values were determined by Fisher's exact test.
  • FIGS7A-B shows the results of p WN-MF-DEST vector validation.
  • FIG7A shows the efficiency of retroviral infection of Gateway®-compatible retroviral vectors.
  • HAlE cells were infected with pBabe-GFP (green bars-left) or pBabe-YFP (yellow bars-left) constructs.
  • pWN-MF-DEST-YFP and pWN-MF-DEST-GFP were created by performing site-specific LR recombination reactions between pEntry-YFP or pEntry-GFP and pWN-MF-DEST.
  • FIG7B shows localization of ORFs expressed by pWN-MF-DEST. 293T cells were transfected with pBabe-GFP control vector or p WN-MF-DEST-GFP. GFP in this experiment occupies the position of a kinase ORF. Micrographs depict membrane localization of GFP, confirming that the myristoylation tag is in frame and functional.
  • FIGS9A-9E show that IKBKE activates the interferon pathway.
  • FIG9A shows the activity of the IRF3 -responsive interferon-regulated promoter element (ISRE) derived from the IFIT2 gene encoding ISG54 in HAlE-M cells harboring either a control vector or vectors encoding myr-IKBKE or WT IKBKE.
  • FIG9B and FIG9C show quantitative PCR analysis of interferon regulated genes, IFNBl and CCL5, in HAlE-M cells expressing myv-IKBKE (FIG9B) or HMEC-M cells expressing WT IKBKE (FIG9C). Raw values were normalized to GAPDH and to cells expressing a control vector.
  • ISRE interferon-regulated promoter element
  • FIG9D shows suppression of IRF3 in IKBKE-expressing cells by two /RF-5-specific shRNA (shIRF3-#l , shIRF3-#2).
  • FIG9E shows effects of suppressing IRF3 on IKBKE-induced transformation.
  • (-) indicates mock- infected cells. Error bars in A, B, and E represent mean ⁇ SD for 3 independent experiments.
  • FIGSl OA-I OB show a depiction of kinase activation by either myristoylation or dimerization.
  • FIGlOA shows a schematic diagram illustrating how kinase can be activated by either myristoylation or dimerization.
  • FIGlOB shows activation of cRaf, a serine/threonine kinase, by either a myristoylation or Tel tag.
  • FIGS11A-11B show a depiction of kinase activation mediated by fusions with TEL- domains.
  • FIGIlA shows a schematic diagram of ligand-independent dimerization of receptor tyrosine kinases (RTKs) mediated by Tel-domains.
  • FIGIlB shows the expression and activation of PDGFR ⁇ -Tel and FGFRl-TeI under growth factor free conditions.
  • Antibody 4G10 specifically recognizes phospho-Tyrosine.
  • compositions comprising a library of nucleic acids encoding regulatable proteins, e.g., kinase and kinase related proteins or biologically active portions thereof, optionally linked to one or more regulatory signals, wherein expression of the regulatable proteins or biologically active portions thereof in a cell results in the regulatable protein or biologically active portion thereof being regulated.
  • regulatable proteins e.g., kinase and kinase related proteins or biologically active portions thereof, optionally linked to one or more regulatory signals
  • expression of the regulatable proteins or biologically active portions thereof in a cell results in the regulatable protein or biologically active portion thereof being regulated.
  • methods using these complementing genes directly as markers for cancer diagnosis or predisposition and as targets for anti-neoplastic therapeutics.
  • methods for using changes caused by expression of the complementing genes
  • compositions comprising one or more nucleic acids encoding one or at least two regulatable proteins linked to one or more regulatory signals, wherein expression of the regulatable proteins in a cell results in the regulatable protein being regulated.
  • Compositions may comprise one or more nucleic acids encoding at least about 1 , 2, 3, 4, 5, 10, 20, 50, 100, 200, 300, or 500 or more regulatable proteins.
  • a composition may comprise a library of nucleic acids encoding regulatable proteins, or pools of nucleic acids thereof.
  • a pool of nucleic acids may encode about 5-10, 10-20, 10-30 or more regulatable proteins.
  • each regulatable protein is encoded by a separate nucleic acid.
  • a composition may comprise at least aboutl, 2, 3, 4, 5, 10, 20, 50, 100, 200, 300, or 500 nucleic acids, wherein each nucleic acid encodes one regulatable protein.
  • the nucleic acids do not need to be in one composition, hi particular, each member of a library of nucleic acids may be physically separated from the other members, e.g., by being present in a well of a multiwell plate.
  • each member of a library of nucleic acids encoding regulatable proteins is present in a separate well from the other nucleic acids of the library.
  • compositions comprising one or more regulatable proteins linked to one or more regulatory signals.
  • a composition can comprise at least about 1, 2, 3, 4, 5, 10, 20, 50, 100 or more proteins.
  • a composition may comprise a library of regulatable proteins or pools of proteins thereof.
  • a pool of proteins may comprise about 5-10, 10-20, 10- 30 or more proteins.
  • the members of the library do not need to be in a composition. Each member of the library may be in a separate vial or well of a multiwell dish.
  • a signal transduction pathway is a system within a cell that transmits information from outside the cell to the cell nucleus, resulting in a change in the expression of one or more genes.
  • Signal transduction pathways involve the interactions of protein factors that regulate enzymatic activities (e.g., phosphorylation, phosphatase and protease activity) or the association of signal transducing factors with other factors in a cascade of interactions, wherein the cascade serves to amplify and/or direct a signal to a particular set of genes.
  • a regulatable protein(s) regulates signal transduction pathways controlling cell growth, division, migration, survival or apoptosis.
  • These proteins may- comprise members of one or more of the following families of signaling-related proteins: cell surface receptor, kinase, phosphatase, G-protein, small GTPase, hydrolase, adapter (e.g. EF hand, SH2, SH3, PTB, TIR, FHA, MH2, WD40, BRCT, Polo-Box, FF, WW and PH domain- containing adapter and the like), ubiquitin ligase, methylase, demethylase, and transcription factors.
  • These regulatable proteins may be components of the same biological pathway or of different biological pathways.
  • a regulatable protein is a kinase or a kinase related protein or a biologically active fragment thereof.
  • a kinase or a kinase related protein is capable of modulating its own phosphorylation state (autophosphorylation) or the phosphorylation state of another cellular component, such as that of other proteins or polypeptides.
  • Such regulatable proteins may be involved in phosphorylation of proteins, lipids, carbohydrates, and/or nucleic acids.
  • a regulatable protein is a protein kinase, which is defined by the presence of at least one eukaryotic protein kinase (ePK) catalytic domain (e.g., see Manning et al.
  • ePK eukaryotic protein kinase
  • An ePK catalytic domain generally contains three motifs that are thought to be critical for catalytic function, each of which contains an almost invariant residue that is thought to be involved in catalysis. These three motifs include a "VAIK” motif in which K is thought to interact with the alpha and beta phosphates of ATP to anchor and orient them, an "HRD” motif in which D likely acts as a base acceptor during catalysis, and "DFG” in which D is thought to chelate Mg++ ions of ATP (see, e.g., Hardie, D.G., et al. (1995) The Protein Kinase Factsbook, Academic Press, London and Manning et al.
  • kinases that phosphorylate proteins can have a specificity for (i.e., a specificity to phosphorylate) serine/threonine residues, tyrosine residues, or both serine/threonine and tyrosine residues, e.g. the dual specificity kinases.
  • conserved structural motifs provide clear indication as to how the kinases transfer the ⁇ -phosphate of a purine nucleotide triphosphate to the hydroxyl groups of protein substrates.
  • the kinase domains that define protein kinases contain 12 conserved subdomains (I-XII) that fold into a common catalytic core structure, as revealed by the 3-dimensional structures of several kinases.
  • protein kinases include a kinase catalytic domain of about 20-400 amino acid residues in length, about 50-300 amino acid residues in length, about 100-300 amino acid residues in length, about 200-300 amino acid residues in length or about 250-300 amino acid residues in length.
  • Specificity of a protein kinase for phosphorylation of either tyrosine or serine/threonine can be predicted by the sequence of two of the subdomains (VIb and VIII) in which different residues are conserved in each class (as described in, for example, Hanks et al.
  • Protein kinases that have closely related catalytic domains define families and represent products of genes that have undergone relatively recent evolutionary divergence. Clustering appears to be of predictive value in the determination of the properties and function of novel protein kinases. Accordingly, members of a given family tend also to share related functions. This is manifested by similarities in overall structural topology, mode of regulation, and substrate specificity (see, generally, Hardie, D. G., et al. (1995) The Protein Kinase Factsbook, Academic Press, London).
  • the complete repertoire of human kinases can be subdivided into "families”, according to a dendrogram-based organization of human kinases, e.g. as shown in Manning et al. (2002) Science 298: 1912-1919, which are distinguished from each other according to sequence comparison of kinase catalytic domains, comparison of sequence and protein structures outside of the catalytic domains, known biological functions, and classification of kinases in other species.
  • kinase families A6, ABCl, AbI, Ack, AKT, AIk, Alpha, AUR, AxI, BCR, BRD, BUB, Bud32, CAMKl, CAMK2, CAMKK, CAMKL, CAMK-Unique, CASK, CCK4, CDC7, CDK, CDKL, CKl, CK2, CLK, Csk, DAPK, DCAMKL, DDR, DMPK, DYRK, EGFR, Eph, Fak, FAST, Fer, FGFR, Gl 1, GRK, GSK, Hl 1, Haspin, IKK, InsR, IRAK, IRE, JakA, JakB, LISK, Lmr, LRRK, MAPK, MAPKAPK, MAST, Met, MLCK, MLK, MOS, Musk, NAK, NDR, NEK, NKFl, NKF2, NKF3, NKF4, NKF5, NRBP,
  • a regulatable protein comprises, consists essentially of, or consists of a kinase or kinase related protein in Table 1.
  • a regulatable protein may also be a kinase or kinase related protein that is not listed in Table 1.
  • a regulatable protein may also be an orthologue of a protein in Table 1 or other kinase or kinase related protein, e.g., a non- human orthologue, such as a mammalian, vertebrate, ovine, bovine, equine, feline, canine, mouse, or other orthologue.
  • Regulatable proteins may be components of the same biological pathway or of different biological pathways.
  • a composition comprises one or more regulatable proteins or nucleic acids encoding such, wherein at least some of the regulatable proteins are kinases or kinase related proteins with the proviso that the proteins are not specific proteins, e.g., proteins known in the art to have been linked to a regulatory signal, hi certain embodiments, one or more nucleic acids encode one or more regulatable proteins, e.g., kinases or kinase related proteins, with the proviso that the protein is not of a specific family of kinases, e.g., one of the families further described herein.
  • a regulatable protein may also be a fragment of a naturally occurring regulatable protein, e.g., a kinase or kinase related protein.
  • a fragment may be a biologically active fragment, such as a fragment that retains the catalytic activity of the protein, e.g., the ability to phosphorylate a target protein.
  • a regulatable protein may be a protein that comprises, consists essentially of, or consists of a catalytic kinase domain, such as those further described herein.
  • a fragment may comprise more than one conserved domain, e.g., a catalytic domain and a protein-protein interaction domain, an extracellular ligand binding domain, and/or a transmembrane domain of a receptor kinases.
  • a fragment may also comprise a catalytic kinase domain and about 1, 2, 3, 4, 5, 10, 15, 20, or 50 or more consecutive amino acids on the N- or C-terminus.
  • a fragment may also comprise a full length naturally occurring regulatable protein lacking 1, 2, 3, 4, S, 10, 15, 20, or 50 or more amino acids at the N- or C-terminus.
  • the term "regulatable protein” includes full length regulatable protein, such as they occur in nature, or biologically active fragments thereof or homologs thereof, such as a protein that can be used in or more of the complementation assays described herein.
  • FASTA FASTA
  • BLAST BLAST
  • ENTREZ is available through the National Center for Biotechnology Information, National Library of Medicine, National Institutes of Health, Bethesda, Md.
  • the percent identity of two sequences can be determined by the GCG program with a gap weight of 1, e.g., each amino acid gap is weighted as if it were a single amino acid or nucleotide mismatch between the two sequences.
  • MPSRCH uses a Smith- Waterman algorithm to score sequences on a massively parallel computer. This approach improves ability to pick up distantly related matches, and is especially tolerant of small gaps and nucleotide sequence errors.
  • Nucleic acid-encoded amino acid sequences can be used to search both protein and DNA databases.
  • Regulatory proteins may also be encoded by nucleic acids that hybridize, e.g., under stringent hybridization conditions, to a nucleic acid encoding a protein in Table 1 or other kinase or kinase related protein or biologically active fragment thereof. Hybridization may be under high stringency conditions of 0.2 to 1 x SSC at 65 °C followed by a wash at 0.2 x SSC at 65 °C.
  • nucleic acid hybridization is described, e.g., in S. Agrawal (ed.) Methods in Molecular Biology, volume 20; and Tijssen (1993) Laboratory Techniques in biochemistry and molecular biology-hybridization with nucleic acid probes, e.g., part I chapter 2 "Overview of principles of hybridization and the strategy of nucleic acid probe assays," Elsevier, New York provide a basic guide to nucleic acid hybridization.
  • variants of naturally occurring regulatable proteins are those that differ from the naturally-occurring protein in 1, 2, 3, 4, 5, 10, 20, 50 or more amino acid substitutions, deletions or additions.
  • the substitutions may be conservative substitutions or non- conservative substitutions.
  • Guidance in determining which amino acid residues may be substituted, inserted, or deleted without abolishing biological activity may be found using computer programs well known in the art, for example, LASERGENE software (DNASTAR).
  • a regulatable protein may also differ from a naturally occurring regulatable protein, e.g., a protein in Table 1, by the addition of 1, 2, 3, 4, 5, 10, 20, 50 or more consecutive amino acids having a sequence that is unrelated to, or not part of (e.g., heterologous to), the sequence of the naturally occurring regulatable protein.
  • a regulatable protein is a biologically active fragment of a naturally occurring regulatable protein to which 1, 2, 3, 4, 5, 10, 20, 50 or more consecutive amino acids are added to the N- and/or C- terminus of the protein, which consecutive amino acids form an amino acid sequence that is not present at the same place in the naturally occurring regulatable protein.
  • polypeptide refers to polymers of amino acids.
  • the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids.
  • the terms also encompass an amino acid polymer that has been modified by, for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component.
  • amino acid refers to either natural and/or unnatural or synthetic amino acids, including glycine and both the D or L optical isomers, and amino acid analogs and peptidomimetics.
  • Peptides and proteins may also comprise one or more non-naturally occurring amino acids.
  • nonclassical amino acids or chemical amino acid analogs can be introduced as a substitution or addition into peptides.
  • Non-classical amino acids include, but are not limited to, the D-isomers of the common amino acids, 2,4-diaminobutyric acid, alpha- amino isobutyric acid, 4-aminobutyric acid, Abu, 2-amino butyric acid, gamma-Abu, epsilon- Ahx, 6-amino hexanoic acid, Aib, 2-amino isobutyric acid, 3 -amino propionic acid, ornithine, norleucine, norvaline, hydroxyproline, sarcosine, citrulline, homocitrulline, cysteic acid, t- butylglycine, t-butylalanine, phenylglycine, cyclohexylalanine,
  • mimetopes of the subject peptides and proteins can be provided.
  • Peptidomimetics can have such attributes as being non-hydrolyzable (e.g., increased stability against proteases or other physiological conditions which degrade the corresponding peptide).
  • peptide analogs can be generated using, for example, benzodiazepines (e.g., see Freidinger et al. in Peptides: Chemistry and Biology, G.R. Marshall ed., ESCOM Publisher: Leiden, Netherlands, 1988), substituted gamma lactam rings (Garvey et al. in Peptides: Chemistry and Biology, G.R.
  • Peptides may comprise at least one amino acid or every amino acid that is a D stereoisomer.
  • Other peptides may comprise at least one amino acid that is reversed.
  • the amino acid that is reversed may be a D stereoisomer. Every amino acid of a peptide may be reversed and/or every amino acid may be a D stereoisomer.
  • a peptidomimetic in another illustrative embodiment, can be derived as a retro- enantio analog of a peptide.
  • Retro-enantio analogs such as this can be synthesized with commercially available D-amino acids (or analogs thereof) and standard solid- or solution- phase peptide-synthesis techniques, as described, e.g., in WO 00/01720. The final product may be purified by HPLC to yield the pure retro-enantio analog.
  • peptide derivatives which are differentially modified during or after synthesis, e.g., by benzylation, glycosylation, acetylation, phosphorylation, amidation, pegylation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to an antibody molecule or other cellular ligand, etc.
  • the peptides are acetylated at the N-terminus and/or amidated at the C-terminus.
  • Modifications that do not normally alter primary sequence include in vivo or in vitro chemical derivatization of polypeptides, e.g., acetylation, or carboxylation. Also included are modifications of glycosylation, e.g., those made by modifying the glycosylation patterns of a polypeptide during its synthesis and processing or in further processing steps; e.g., by exposing the polypeptide to enzymes which affect glycosylation, e.g., mammalian glycosylating or deglycosylating enzymes. Also embraced are proteins which have phosphorylated amino acid residues, e.g., phosphotyrosine, phosphoserine, or phosphothreonine.
  • nucleotide sequences encoding proteins with specific cellular activities or the proteins themselves may be modified in a number of ways as to make the proteins regulatable such that said cellular activities can be activated or inactivated independent of natural cellular regulatory mechanisms.
  • a regulatory protein is a protein that is active as a result of a modification, such as a modification that allows the protein to oligomerize or to be targeted to a particular compartment in a cell, e.g., the cell membrane.
  • Linking the regulatory protein to a regulatory signal will regulate, i.e., activate or repress, the protein, either, constitutively or inducibly. Its activity may be similar to, higher or lower relative to the naturally occurring corresponding regulatable protein.
  • a regulatable protein may be a kinase that is activated by being targeted to the cell membrane and/or by dimerization, events that will happen naturally in a cell under certain circumstances. Linking a kinase to a domain that will target it to the cell membrane or allow it to dimerize will allow the kinase to be active independently of whether the specific circumstances that usually activate kinase are present.
  • a regulatable protein e.g., a kinase
  • a regulatable protein is constitutively regulated, e.g., activated, by linking it to one or more of the following domains/signals: an oligomerization domain, a cellular membrane localizing signal, or a signal for covalent binding of lipid groups.
  • fatty acids will contain from between about 1 to 100 carbons or between about 12 to 24 carbons.
  • fatty acylation involves the covalent attachment of the 14-carbon saturated fatty acid myristate (myristoylation) by either N-myristoyltransferase 1 (NMT-I) or NMT-2 or the 16-carbon fatty acid palmitate (palmitoylation) to a regulatable protein.
  • NMT-I N-myristoyltransferase 1
  • NMT-2 16-carbon fatty acid palmitate
  • These regulatable proteins may be modified by myristate or palmitate, either alone or in combinations thereof.
  • Myristoylated proteins include the ⁇ subunit of some heterotrimeric G proteins, cAMP-dependent protein kinase, Src, myristoylated protein kinase C substrate (MARCKS) protein and numerous retroviral coat proteins.
  • myristoylated regulatable proteins contain a canonical myristoylation motif (MGXXXS/T, where X is an intervening amino acid residue). Additional information regarding myristoylation motifs can be found in, e.g., Towler et al. (1988) Ann. Rev. Biochem. 57: 69-99.
  • Exemplary myristoylation motifs that may be used includes MET GLY SER SER LYS SER LYS PRO LYS ASP PRO SER GLN ARG ARG ARG ARG ILE ARG GLY from c-src.
  • region 1 (approximately positions 1 -6) that fits the binding pocket of NMTs
  • region 2 (approximately positions 7- 10) that interact with the NMTs surface at the mouth of the catalytic cavity
  • region 3 (approximately positions 11-17) comprising a hydrophilic linker.
  • these residues, or the nucleotides that encode them can be modified according to known structure- function relationships to generate signals that will result in myristoylation of a given protein (e.g., Maurer-Stroh et al. (2002) J MoI. Biol. 317, 541-557).
  • Proteins can also be fatty acylated with palmitoyl moieties linked through thioester bonds to one or more cysteine residues. Because other medium- and long-chain fatty acids can also be attached to 'palmitoylated' proteins, the term S-acylation is often used. There is no consensus sequence for protein palmitoylation, although some modified sites can be predicted, hi addition, all of these motifs or their variants may also be found at the C-terminus or at any other position within the protein to signal myristoylation. Examples of C-terminal and internal myristoylation signals are well known in the art. Various DNA sources known in the art can be used to clone and encode such sequences.
  • prenylation can also be lipidated by prenylation, a process involving protein modification of lipid anchors comprising isoprene units (C 5 ).
  • prenylation may involve protein modification of lipid anchors composed of between 1 and 20 isoprene units.
  • prenylation can be conveniently subdivided into three types: (1) Farnesylation generally involves the linkage of a faraesyl (15-carbon) group(s) to cysteine residues at or near the C terminus of proteins.
  • One consensus target sequence for farnesylation is CAAX (where C is cysteine, A is an amino acid with a hydrophobic side chain and X is another amino acid). This sequence is recognized by farnesyltransferase (FT).
  • farnesylated cysteine palmitoylation of cysteines close to the farnesylated cysteine occurs in some proteins.
  • the farnesyl group is donated by farnesyl pyrophosphate, an intermediate in the sterol biosynthetic pathway.
  • the enzymology of farnesylation and its associated modifications appears to have been conserved in eukaryotes. These processes occur in both mammalian cells and in the budding yeast, S. cerevisiae.
  • Farnesylated proteins include G subunits of some heterotrimeric G proteins, ras proteins and the nuclear lamins. For example, it is well known in the art that it is possible to fuse the last eleven amino acids of a ras protein to a given protein and confer membrane association upon that protein.
  • Geranylgeranylation generally involves the addition of a geranylgeranyl (20-carbon) group(s) to the cysteine residues at or near the C terminus of proteins.
  • A is preferably an aliphatic amino acid and X is preferably L, F, I, V or M.
  • the enzyme which performs this type of geranylgeranylation is geranylgeranyl transferase I (GGTl), which contains a subunit that is common to farnesyl transferase. Proteins that undergo this modification include several ras-related G proteins, such as racl, rac2 and ralA and the G subunits of some heterotrimeric G proteins.
  • Geranylgeranylation can also be effected by geranylgeranyl transferase II (GGT2), which recognizes a variety of C terminal motifs.
  • C-terminal motifs include, but are not limited to, -CC, -CXC, - CCX, -CCXX, -CCXXX, and -CXXX (where C is cysteine and X is another amino acid).
  • GGT2 appears to be especially important for geranylgeranylation of Rab proteins, a large subgroup of Ras-related GTPases involved in vesicular trafficking.
  • these flexible amino acid motifs, or the nucleotides that encode them can be modified according to known structure- function relationships to generate signals that will result in either farnesylation or geranylgeranylation of a given protein (e.g., Maurer-Stroh and Eisenhaber (2005) Genome Biol. 6, R55).
  • motifs or their variants may also be found at the N- terminus or at any other position within the protein to signal prenylation.
  • Examples of N- terminal and internal prenylation signals are well known in the art.
  • Various DNA sources known in the art can be used to clone and encode such sequences.
  • Proteins can also be lipidated by post-translational addition of glycosylphosphatidylinositol (GPI) anchors and this process generally involves a transamidation reaction in which a GPI moiety is attached at or near the C-terminus of a polypeptide in the endoplasmic reticulum.
  • GPI signal sequence consists of a triplet of small amino acids (termed ⁇ , ⁇ +1, and ⁇ +2 in the art), a hydrophilic spacer sequence of 7-10 amino acids, and a C-terminal hydrophobic stretch.
  • the ⁇ amino acid constitutes the site of GPI attachment and this attachment is catalyzed by GPI transamidase (GPIT).
  • amino acid motif signals can be modified according to known structure- function relationships to generate signals that will result in GPI-modification of a given protein (e.g., Eisenhaber et al. (2001) Protein Eng. 14, 17-25 and references therein).
  • all of these motifs or their variants may also be found at the N-terminus or at any other position within the protein to signal GPI modification.
  • a regulatable protein is targeted to a membrane in an inducible fashion.
  • a regulatable protein is linked to a FRAP rapamycin binding (FRB) domain or a variant thereof. This FRB-regulatable protein fusion protein can then be induced to heterodimerize in the presence of a small molecule, e.g., rapamycin or a rapamycin analog, with an FKBP domain or a variant of FKBP 12 or its homo log.
  • FRB FRAP rapamycin binding
  • the FKBP domain(s) can be expressed at the membrane, for example, through linkage to a membrane targeting signal (e.g. myristoylation moiety) and will thus effect inducible membrane targeting of regulatable proteins upon exposure to said small molecule (e.g., Li et al (2002) Gene Therapy 9, 233- 244).
  • a membrane targeting signal e.g. myristoylation moiety
  • the basic FRB-rapamycin-FKBP strategy especially as applied in mammalian cells, has been extensively described in the art (e.g. Rivera (1998) Methods 14: 421-429 and Pollock and Rivera (1999) Methods Enzymol. 306: 263-281).
  • a regulatable protein can be fused to an FKBP domain or a variant thereof that can be induced to heterodimerize in the presence of a small molecule, e.g., rapamycin or a rapamycin analog, with an FRB domain or a variant thereof from FKBP 12 or its homo log such that expression of a membrane bound FRB domain, effected through linkage to a membrane targeting signal (e.g. myristoylation moiety), will effect membrane targeting of the regulatable protein.
  • Membrane targeting of regulatable proteins can be controlled by the availability of the small molecule, rapamycin, or its derivatives.
  • membrane binding of proteins post- translationally modified for membrane localization may be enhanced by the addition of one or more membrane targeting modifications.
  • membrane binding of the Src kinase is mediated by an N-terminal myristoylation in addition to a polybasic residue domain (Sigal et al. (1994) Proc. Natl. Acad. ScL USA 91, 12253-12257).
  • An activation signal may also comprise, consist essentially of or consist of a dimerization or oligomerization domain that allows homo- and hetero-dimerization or oligomerization of a regulatable protein with itself or with additional regulatable proteins.
  • Homodimerization and homo-oligomerization refer to the association of like components to form dimers or oligomers.
  • Heterodimerization and hetero-oligomerization refer to the association of dissimilar components to form dimers or oligomers.
  • Homo-oligomers thus comprise an association of multiple copies of a particular components, while hetero- oligomers comprise an association of copies of different components.
  • "Oligomerization”, “oligomerize” and “oligomer”, with or without prefixes, are intended to encompass “dimerization”, “dimerize” and "dimer”.
  • Oligomerization brings the action domains of the encompassed components into close proximity with one another thus triggering cellular processes normally associated with the respective action domain, such as kinase-mediated signal transduction.
  • cellular processes normally associated with the respective action domain, such as kinase-mediated signal transduction.
  • An oligomerization domain can be linked to the N- terminus, C-terminus or internally to the regulatable protein. Oligomerization may be enhanced by the addition of two or more oligomerization domains.
  • such oligomerization domains may replace or be used in conjunction with membrane localizing domains in order to activate or enhance the activity of kinases whose activities are influenced by dimerization and which are minimally or completely nonresponsive to membrane localization.
  • dimerization and oligomerization domains can be conveniently subdivided into two types: (1) domains whose associations are constitutive and (2) domains whose associations are regulated.
  • domains whose associations are constitutive can be fused to regulatable proteins to allow heterologous homo- and hetero-dimerization or oligomerization in a constitutive manner upon expression.
  • heterologous domains whose associations are constitutive are well known in the art. Examples described in the art include, but are not limited to, heterodimerization of PDZ domains from the mammalian proteins neuronal nitric oxide synthase (nNOS) and syntrophin (Ung et al. (2001) EMBOJ.
  • the activation domain consists of the TEL protein or an oligomerization domain thereof, which is a member of the Ets family of transcription factors, or the helix-loop-helix (HLH) domain of TEL.
  • An exemplary TEL sequence comprises the amino acid sequence MSETPAQCSDCQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRL
  • TEL-kinase fusion proteins form HLH-dependent homo-oligomers in vitro, a process critical for constitutive tyrosine kinase phosphorylation, and hence, constitutive activation (Golub et al. (1996) MoI. Cell. Biol. 16, 4107-4116).
  • oligomerization domains can be fused to regulatable proteins to allow heterologous homo- and hetero-dimerization or oligomerization in a regulated manner.
  • heterologous domains whose associations are regulated, rather than constitutive, are well known in the art. Examples include, but are not limited to, the Gyrase B-coumermycin system, the FKBP-rapamycin-FRAP system, and their variants.
  • these heterologous domains are domains from naturally occurring proteins or truncated active portions thereof.
  • the binding domain can be small ( ⁇ 25 kDa to allow efficient transfection in viral vectors), nonimmunogenic and accessible to cell permeable, nontoxic ligands.
  • a regulatable protein is fused to bacterial Gyrase B polypeptide or a fragment or derivatives thereof (e.g. amino acids 1-220 of E. coli GyrB) that can be induced to dimerize in the presence of coumermycin or a coumermycin analog (Farrar et al. (1996) Nature 383, 178-181 and Farrar et al., US Patent 6,916,846).
  • bacterial Gyrase B polypeptide or a fragment or derivatives thereof e.g. amino acids 1-220 of E. coli GyrB
  • a regulatable protein is fused to the FRB (FRAP rapamycin binding) domain(s) or its variants of FRAP/mTOR or to an FKBP domain(s) or its variants of FKBP 12 or its homologs, such that expression of a chimeric protein comprising the regulatable protein fused to the FRB domain and identical regulatory proteins or other regulatory proteins fused to FKBP, or vice versa, can dimerize in the presence of rapamycin or a rapamycin analog
  • the linking ligand can have different receptor binding molecules with different epitopes to mediate oligomerization of chimeric proteins having the same or different binding domains.
  • the ligand may comprise rapamycin or a rapamycin- type moiety and a cyclosporinA or cyclosporin type moiety. Both moieties may be covalently attached to a common linker moiety.
  • a ligand would be useful for mediating the oligomerization of a first and second chimeric protein where the first chimeric protein contains a receptor domain, such as an FKBP domain from FKBP 12 or its homo log that is capable of binding to the rapamycin or rapamycin-type moiety, and the second chimeric protein contains a receptor domain, such as cyclophilin, that is capable of binding to the cyclosporin A or cyclosporin type moiety.
  • a receptor domain such as an FKBP domain from FKBP 12 or its homo log that is capable of binding to the rapamycin or rapamycin-type moiety
  • the second chimeric protein contains a receptor domain, such as cyclophilin, that is capable of binding to the cyclo
  • Detection and confirmation of protein-protein interactions resulting from dimerization or oligomerization can be accomplished in a number of manners well known in the art. These approaches generally employ the affinities between interacting proteins to isolate and analyze proteins in a bound state or the distance between interacting proteins. Examples of such methods include, but are not limited to, non-reducing SDS-PAGE, chromatography, density gradient densitometry, microscopy including transmission electron microscopy, mass spectrometry, immunoprecipitation employing dimerization- or oligomerization-specific antibodies, bioluminescence resonance energy transfer (BRET), fluorescence resonance energy transfer (FRET) and the like.
  • BRET bioluminescence resonance energy transfer
  • FRET fluorescence resonance energy transfer
  • compositions comprising one or more nucleic acids encoding at least 1, 2, 3, 4, 5, 10, 20, 50, 100, 500 or more inhibitory mutants of proteins, wherein expression of the inhibitory mutants in a cell downregulates one or more biological activities associated with the corresponding wild-type or naturally occurring proteins.
  • a composition may comprise a library of nucleic acids encoding inhibitory mutant proteins, or pools of nucleic acids thereof (a "dead library").
  • a pool of nucleic acids may encode about 5-10, 10-20, 10-30 or more inhibitory mutants.
  • each inhibitory mutant is encoded by a separate nucleic acid.
  • a composition may comprise at least about 1, 2, 3, 4, 5, 10, 20, 50, 100, 200, 300, or 500 nucleic acids, wherein each nucleic acid encodes one inhibitory mutant.
  • the nucleic acids do not need to be in one composition, hi particular, each member of a library of nucleic acids may be physically separated from the other members, e.g., by being present in a well of a multiwell plate.
  • each member of a library of nucleic acids encoding inhibitory mutants is present in a separate well from the other nucleic acids of the library.
  • An inhibitory mutant may be a mutant of a protein involved in signal transduction, e.g., a kinase or a phosphatase.
  • An inhibitory mutant may be a dominant negative mutant, a deletion mutant, a mutant comprising one or more substitution or addition of amino acids.
  • a protein, e.g., a kinase, in a cell is inactivated by introducing into the cell an inhibitory mutant of the protein, such that the inhibitory mutant downregulates one or more biological activities associated with the corresponding wild-type protein.
  • Such mutants can be generated by the following, but are not limited to, mutation, deletion, modification or rearrangement of nucleotide sequences that encode domains used to define the protein family with which the protein is associated (e.g. the kinase domain of kinase proteins), regulatory elements, protein-protein interaction domains, residues that are targets of cell signaling (e.g. phosphorylation), protein degradation signal domains and cellular localization domains.
  • these inhibitory mutants are dominant negative mutants.
  • a dominant negative mutant is a mutant polypeptide which, when expressed, disrupts the activity of the wild type protein. It may act by binding to the active protein and rendering it inactive or inhibited, or where it is an enzyme, by binding the target protein without enzymatically activating the protein, thus blocking and preventing, the active enzymes from binding and activating the target protein.
  • a dominant negative-protein is encoded by a dominant negative gene, which is itself derived from a change with regard to at least one position in its sequence relative to the corresponding wild type version of the gene.
  • a dominant negative gene encodes a product that disrupts an endogenous genetic process of a host cell which expresses the gene and that is effective in a single copy or may produce an effect due to overexpression of the gene either by increased production of the gene product, or by coexpression of multiple copies of the gene.
  • a change can occur due to alternative splicing of gene products, which have lost an important site or domain, and thus become enzymatically inactive or inhibited.
  • a change can occur at a position that encodes a changed amino acid residue position at an active site required for biological and/or pharmacological activity in the native peptide, as can happen, for example, due to amino acid alterations in residues critical for catalytic function of kinase domains.
  • the dominant negative mutants are the result of substitutions in one or more amino acids that causes a change in posttranslational modification of the protein (e.g. a change in acetylation, glycosylation, phosphorylation, ubiquitination, alkylation, glutamylation, acylation, isoprenylation, lipoylation, phosphopantetheinylation, sulfation, selenation, or C-terminal amidation).
  • These inhibitory proteins are said to be "constitutively regulated” because they do not exhibit specific activity despite potential stimulation by natural factors and do not produce any of the cellular responses normally induced by said natural factors even with potential stimulation by these natural factors.
  • compositions comprising one or more nucleic acids comprising or capable of expressing at least 1, 2, 3, 4, 5, 10, 20, 50, 100, 500 or more small nucleic acids or antisense oligonucleotides or derivatives thereof, wherein said small nucleic acids or antisense oligonucleotides or derivatives thereof in a cell specifically hybridize (e.g., bind) under cellular conditions, with small nucleic acids (e.g., small RNAs and microRNAs), with cellular mRNA and/or genomic DNA encoding one or more cellular proteins, hi one embodiment, expression of the small nucleic acids or antisense oligonucleotides or derivatives thereof in a cell can enhance or upregulate one or more biological activities associated with the corresponding wild-type, naturally occurring, or synthetic small nucleic acids.
  • small nucleic acids e.g., small RNAs and microRNAs
  • the small nucleic acids or antisense oligonucleotides or derivatives thereof can be single or double stranded and are at least six nucleotides in length and are less than about 1000, 900, 800, 700, 600, 500, 400, 300, 200, 100, 50, 40, 30, 25, 24, 23, 22, 21,20, 19, 18, 17, 16, 15, or 10 nucleotides in length.
  • a composition may comprise a library of nucleic acids comprising or capable of expressing small nucleic acids or antisense oligonucleotides or derivatives thereof, or pools of said small nucleic acids or antisense oligonucleotides or derivatives thereof.
  • a pool of nucleic acids may comprise about 5-10, 10-20-, 10-30 or more nucleic acids comprising or capable of expressing small nucleic acids or antisense oligonucleotides or derivatives thereof.
  • each small nucleic acid or antisense oligonucleotide or derivative thereof is generated by a separate nucleic acid.
  • a composition may comprise at least about 1, 2, 3, 4, 5, 10, 20, 50, 100, 200, 300, or 500 nucleic acids, wherein each nucleic acid generates a small nucleic acid or antisense oligonucleotide or derivative thereof.
  • the nucleic acids do not need to be in one composition.
  • each member of a library of nucleic acids may be physically separated from the other members, e.g., by being present in a well of a multiwell plate.
  • each member of a library of nucleic acids that generate a small nucleic acid or antisense oligonucleotide or derivative thereof is present in a separate well from the other nucleic acids of the library.
  • Such nucleic acids may be used alone or in combinations with regulatable proteins and/or inactive mutants described herein.
  • Small nucleic acids and/or antisense constructs of the methods and compositions presented herein can be delivered, for example, as an expression plasmid which, when transcribed in the cell, produces RNA which is complementary to at least a unique portion of cellular nucleic acids (e.g., small RNAs, mRNA, and/or genomic DNA).
  • Small nucleic acids and/or antisense constructs are oligonucleotide probes that are generated ex vivo and which, when introduced into the cell, results in hybridization with cellular nucleic acids (e.g., small RNAs, mRNA, and/or genomic DNA).
  • Such oligonucleotide probes are preferably modified oligonucleotides that are resistant to endogenous nucleases, e.g., exonucleases and/or endonucleases, and are therefore stable in vivo.
  • Exemplary nucleic acid molecules for use as small nucleic acids and/or antisense oligonucleotides are phosphoramidate, phosphothioate and methylphosphonate analogs of DNA (see also U.S. Patents 5,176,996; 5,264,564; and 5,256,775). Additionally, general approaches to constructing oligomers useful in antisense therapy have been reviewed, for example, by Van der Krol et al. (1988) BioTechniques 6:958-976; and Stein et al. (1988) Cancer Res 48:2659-2668.
  • Antisense approaches may involve the design of oligonucleotides (either DNA or RNA) that are complementary to cellular nucleic acids (e.g., small RNAs, mRNA, and/or genomic DNA). Absolute complementarity is not required. In the case of double-stranded antisense nucleic acids, a single strand of the duplex DNA may thus be tested, or triplex formation may be assayed. The ability to hybridize will depend on both the degree of complementarity and the length of the antisense nucleic acid.
  • the longer the hybridizing nucleic acid the more base mismatches with a nucleic acid (e.g., RNA) it may contain and still form a stable duplex (or triplex, as the case may be).
  • a nucleic acid e.g., RNA
  • One skilled in the art can ascertain a tolerable degree of mismatch by use of standard procedures to determine the melting point of the hybridized complex.
  • Oligonucleotides that are complementary to the 5' end of the mRNA should work most efficiently at inhibiting translation.
  • sequences complementary to the 3' untranslated sequences of mRNAs have recently been shown to be effective at inhibiting translation of mRNAs as well. (Wagner, R. (1994) Nature 372:333). Therefore, oligonucleotides complementary to either the 5 ' or 3' untranslated, non-coding regions of genes could be used in an antisense approach to inhibit translation of endogenous mRNAs.
  • Oligonucleotides complementary to the 5' untranslated region of the mRNA may include the complement of the AUG start codon.
  • Antisense oligonucleotides complementary to mRNA coding regions are less efficient inhibitors of translation but could also be used in accordance with the methods and compositions presented herein. Whether designed to hybridize to the 5', 3' or coding region of cellular mRNAs, small nucleic acids and/or antisense nucleic acids should be at least six nucleotides in length, and can be less than about 1000, 900, 800, 700, 600, 500, 400, 300, 200, 100, 50, 40, 30, 25, 24, 23, 22, 21,20, 19, 18, 17, 16, 15, or 10 nucleotides in length.
  • in vitro studies are first performed to quantitate the ability of the antisense oligonucleotide to inhibit gene expression.
  • these studies utilize controls that distinguish between antisense gene inhibition and nonspecific biological effects of oligonucleotides.
  • these studies compare levels of the target nucleic acid or protein with that of an internal control nucleic acid or protein. Additionally, it is envisioned that results obtained using the antisense oligonucleotide are compared with those obtained using a control oligonucleotide.
  • control oligonucleotide is of approximately the same length as the test oligonucleotide and that the nucleotide sequence of the oligonucleotide differs from the antisense sequence no more than is necessary to prevent specific hybridization to the target sequence.
  • Small nucleic acids and/or antisense oligonucleotides can be DNA or RNA or chimeric mixtures or derivatives or modified versions thereof, single-stranded or double- stranded.
  • Small nucleic acids and/or antisense oligonucleotides can be modified at the base moiety, sugar moiety, or phosphate backbone, for example, to improve stability of the molecule, hybridization, etc., and may include other appended groups such as peptides (e.g., for targeting host cell receptors), or agents facilitating transport across the cell membrane (see, e.g., Letsinger et al. (1989) Proc. Natl. Acad. Sci. U.S.A. 86:6553-6556; Lemaitre et al. (1987) Proc. Natl. Acad. Sci. 84:648-652; PCT Publication No.
  • small nucleic acids and/or antisense oligonucleotides may be conjugated to another molecule, e.g., a peptide, hybridization triggered cross-linking agent, transport agent, hybridization-triggered cleavage agent, etc.
  • small nucleic acids and/or antisense oligonucleotides may comprise at least one modified base moiety which is selected from the group including but not limited to 5- fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xantine, 4- acetylcytosine, 5-(carboxyhydroxytiethyl) uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6- isopentenyiadenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiour
  • Small nucleic acids and/or antisense oligonucleotides may also comprise at least one modified sugar moiety selected from the group including but not limited to arabinose, 2-fluoroarabinose, xylulose, and hexose.
  • Small nucleic acids and/or antisense oligonucleotides can also contain a neutral peptide-like backbone.
  • Such molecules are termed peptide nucleic acid (PNA)-oligomers and are described, e.g., in Perry-O'Keefe et al. (1996) Proc. Natl. Acad. Sci. U.S.A. 93:14670 and in Eglom et al. (1993) Nature 365:566.
  • PNA peptide nucleic acid
  • One advantage of PNA oligomers is their capability to bind to complementary DNA essentially independently from the ionic strength of the medium due to the neutral backbone of the DNA.
  • small nucleic acids and/or antisense oligonucleotides comprises at least one modified phosphate backbone selected from the group consisting of a phosphorothioate, a phosphorodithioate, a phosphoramidothioate, a phosphoramidate, a phosphordiamidate, a methylphosphonate, an alkyl phosphotriester, and a formacetal or analog thereof.
  • small nucleic acids and/or antisense oligonucleotides are ⁇ - anomeric oligonucleotides.
  • An ⁇ -anomeric oligonucleotide forms specific double-stranded hybrids with complementary RNA in which, contrary to the usual b-units, the strands run parallel to each other (Gautier et al. ( 1987) Nucl. Acids Res. 15.6625-6641 ).
  • the oligonucleotide is a 2'-0-methylribonucleotide (Inoue et al. (1987) Nucl. Acids Res. 15:6131- 6148), or a chimeric RNA-DNA analogue (Inoue et al. (1987) FEBS Lett. 215:327-330).
  • Small nucleic acids and/or antisense oligonucleotides of the methods and compositions presented herein may be synthesized by standard methods known in the art, e.g., by use of an automated DNA synthesizer (such as are commercially available from Biosearch, Applied Biosystems, etc.).
  • an automated DNA synthesizer such as are commercially available from Biosearch, Applied Biosystems, etc.
  • phosphorothioate oligonucleotides may be synthesized by the method of Stein et al. (1988) Nucl. Acids Res. 16:3209
  • methylphosphonate olgonucleotides can be prepared by use of controlled pore glass polymer supports. (Sarin et al. (1988) Proc. Natl. Acad. Sci. U.S.A. 85:7448-7451), etc.
  • Small nucleic acids and/or antisense oligonucleotides can be delivered to cells in vivo.
  • a number of methods have been developed for delivering small nucleic acids and/or antisense oligonucleotides DNA or RNA to cells; e.g., antisense molecules can be injected directly into the tissue site, or modified antisense molecules, designed to target the desired cells (e.g., antisense linked to peptides or antibodies that specifically bind receptors or antigens expressed on the target cell surface) can be administered systematically.
  • small nucleic acids and/or antisense oligonucleotides may comprise or be generated from double stranded small interfering RNAs (siRNAs), in which sequences fully complementary to cellular nucleic acids (e.g. mRNAs) sequences mediate degradation or in which sequences incompletely complementary to cellular nucleic acids (e.g., mRNAs) mediate translational repression when expressed within cells.
  • siRNAs double stranded small interfering RNAs
  • double stranded siRNAs can be processed into single stranded antisense RNAs that bind single stranded cellular RNAs (e.g., microRNAs) and inhibit their expression.
  • RNA interference is the process of sequence-specific, post-transcriptional gene silencing in animals and plants, initiated by double-stranded RNA (dsRNA) that is homologous in sequence to the silenced gene.
  • dsRNA double-stranded RNA
  • long dsRNA is cleaved by ribonuclease III to generate 21- and 22-nucleotide siRNAs. It has been shown that 21 -nucleotide siRNA duplexes specifically suppress expression of endogenous and heterologous genes in different mammalian cell lines, including human embryonic kidney (293) and HeLa cells (Elbashir et al. Nature 2001 ;411(6836):494-8).
  • RNAs having a length of about 15 to 30 nucleotides or of about 18 to 21 nucleotides or of about 19 to 21 nucleotides can be introduced into a target cell (see, e.g., McManus et al. (2002) RNA 8:842; Xia et al. (2002) Nature Biotechnology 20: 1006; and Brummelkamp et al. (2002) Science
  • Ribozyme molecules designed to catalytically cleave cellular mRNA transcripts can also be used to prevent translation of cellular mRNAs and expression of cellular polypeptides, or both (See, e.g., PCT International Publication WO90/11364, published October 4, 1990; Sarver et al. (1990) Science 247:1222-1225 and U.S. Patent No. 5,093,246). While ribozymes that cleave mRNA at site specific recognition sequences can be used to destroy cellular mRNAs, the use of hammerhead ribozymes is preferred. Hammerhead ribozymes cleave mRNAs at locations dictated by flanking regions that form complementary base pairs with the target mRNA.
  • the target mRNA have the following sequence of two bases: 5'-UG-3'.
  • the construction and production of hammerhead ribozymes is well known in the art and is described more fully in Haseloff and Gerlach (1988) Nature 334:585-591.
  • the ribozyme may be engineered so that the cleavage recognition site is located near the 5' end of cellular mRNAs; i.e., to increase efficiency and minimize the intracellular accumulation of non- functional mRNA transcripts.
  • RNA endoribonucleases such as the one which occurs naturally in Tetrahymena thermophila (known as the IVS, or L-19 IVS RNA) and which has been extensively described by Thomas Cech and collaborators (Zaug, et al. (1984) Science 224:574-578; Zaug, et al. (1986) Science 231. "470-475; Zaug, et al. (1986) Nature 324:429- 433; published International patent application No. WO88/04300 by University Patents Inc.; Been, et al. (1986) Cell 47:207-216).
  • Cech-type ribozymes such as the one which occurs naturally in Tetrahymena thermophila (known as the IVS, or L-19 IVS RNA) and which has been extensively described by Thomas Cech and collaborators (Zaug, et al. (1984) Science 224:574-578; Zaug, et al. (1986) Science 231. "470-475; Zaug,
  • the Cech-type ribozymes have an eight base pair active site which hybridizes to a target RNA sequence whereafter cleavage of the target RNA takes place.
  • the methods and compositions presented herein encompasses those Cech-type ribozymes which target eight base-pair active site sequences that are present in cellular genes.
  • the ribozymes can be composed of modified oligonucleotides (e.g., for improved stability, targeting, etc.) and should be delivered to cells which express Foxo genes in vivo.
  • a preferred method of delivery involves using a DNA construct "encoding" the ribozyme under the control of a strong constitutive pol III or pol II promoter, so that transfected cells will produce sufficient quantities of the ribozyme to destroy endogenous cellular messages and inhibit translation. Because ribozymes unlike antisense molecules, are catalytic, a lower intracellular concentration is required for efficiency.
  • Nucleic acid molecules to be used in triple helix formation for the inhibition of transcription of cellular genes are preferably single stranded and composed of deoxyribonucleotides.
  • the base composition of these oligonucleotides should promote triple helix formation via Hoogsteen base pairing rules, which generally require sizable stretches of either purines or pyrimidines to be present on one strand of a duplex.
  • Nucleotide sequences may be pyrimidine-based, which will result in TAT and CGC triplets across the three associated strands of the resulting triple helix.
  • the pyrimidine-rich molecules provide base complementarity to a purine-rich region of a single strand of the duplex in a parallel orientation to that strand.
  • nucleic acid molecules may be chosen that are purine- rich, for example, containing a stretch of G residues. These molecules will form a triple helix with a DNA duplex that is rich in GC pairs, in which the majority of the purine residues are located on a single strand of the targeted duplex, resulting in CGC triplets across the three strands in the triplex.
  • RNA molecules may be generated by in vitro and in vivo transcription of DNA sequences encoding the antisense RNA molecule. Such DNA sequences may be incorporated into a wide variety of vectors which incorporate suitable RNA polymerase promoters such as the T7 or SP6 polymerase promoters.
  • Non-limiting examples of label peptide or polypeptide moieties useful for detection in the invention include, without limitation, suitable enzymes such as horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; epitope tags, such as FLAG, MYC, HA, or HIS tags; fluorophores such as green fluorescent protein; dyes; radioisotopes; digoxygenin; biotin; antibodies; polymers; as well as others known in the art, for example, in Principles of Fluorescence Spectroscopy, Joseph R. Lakowicz (Editor), Plenum Pub Corp, 2nd edition (July 1999).
  • suitable enzymes such as horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase
  • epitope tags such as FLAG, MYC, HA, or HIS tags
  • fluorophores such as green fluorescent
  • Regulatable proteins and inhibitory mutants may be encoded by one or more nucleic acids or variants thereof.
  • Small nucleic acids and antisense oligonucleotides can comprise or be expressed by one or more nucleic acids or variants thereof.
  • polynucleotide and nucleic acid are used interchangeably. They refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof.
  • polynucleotides coding or non-coding regions of a gene or gene fragment, loci (locus) defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers.
  • a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs.
  • modifications to the nucleotide structure may be imparted before or after assembly of the polymer.
  • the sequence of nucleotides may be interrupted by non-nucleotide components.
  • a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
  • the term "recombinant" polynucleotide means a polynucleotide of genomic, cDNA, semisynthetic, or synthetic origin which either does not occur in nature or is linked to another polynucleotide in a nonnatural arrangement.
  • oligonucleotide may be used to refer to a single stranded polynucleotide having less than about 100 nucleotides, less than about, e.g, 75, 50, 25, or 10 nucleotides.
  • Nucleic acids described herein may also be variants, e.g., variants of those in Table 1.
  • the term "variant,” when used in the context of a polynucleotide sequence, may encompass a polynucleotide sequence related to that of a particular gene or the coding sequence thereof. This definition may also include, for example, "allelic,” “splice,” “species,” or “polymorphic” variants.
  • a splice variant may have significant identity to a reference molecule, but will generally have a greater or lesser number of polynucleotides due to alternate splicing of exons during mRNA processing.
  • the corresponding polypeptide may possess additional functional domains or an absence of domains.
  • a nucleic acid that encodes a protein described herein may be linked to a regulatory element, e.g., a promoter, enhancer, silencer, and termination signal, as further described herein.
  • a regulatory element e.g., a promoter, enhancer, silencer, and termination signal.
  • the term "vector” refers to a nucleic acid capable of transporting another nucleic acid to which it has been linked.
  • One type of vector which may be used in accord with the invention is an episome, i.e., a nucleic acid capable of extra-chromosomal replication.
  • Other vectors include those capable of autonomous replication and expression of nucleic acids to which they are linked.
  • expression vectors capable of directing the expression of genes to which they are operatively linked are referred to herein as "expression vectors".
  • operably linked refers to a linkage of polynucleotide elements in a functional relationship. For instance, a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the coding sequence.
  • two DNA molecules are said to be "operably linked” if the nature of the linkage between the two polynucleotides does not (1) result in the introduction of a frame-shift mutation or (2) interfere with the ability of the polynucleotide containing the promoter to direct the transcription of the coding polynucleotide
  • expression vectors of utility in recombinant DNA techniques are often in the form of "plasmids” which refer to circular double stranded DNA molecules which, in their vector form are not bound to the chromosome, hi the present specification, "plasmid” and “vector” are used interchangeably as the plasmid is the most commonly used form of vector.
  • plasmid vector is introduced in a precipitate, such as a calcium phosphate precipitate, or in a complex with a charged lipid. If the vector is a virus, it may be packaged in vitro using an appropriate packaging cell line and then transduced into cells.
  • the vector may be, for example, a phage, plasmid, viral or retroviral.
  • Exemplary viral and retroviral vectors include adenovirus vectors, adeno-associated virus vectors, lentivirus vectors, herpes simplex virus (HSV) vectors, human immunodeficiency virus (HIV) vectors, bovine immunodeficiency virus (BIV), murine leukemia virus (MLV), and the like.
  • Retroviral vectors may be replication competent or replication defective, hi the latter case, viral propagation generally will occur only in complementing host cells, hi a preferred - embodiment, the vector is a recombinant retroviral vector.
  • a gene delivery vehicle can optionally comprise viral sequences such as a viral origin of replication or packaging signal.
  • viral sequences can be selected from viruses such as astrovirus, coronavirus, orthomyxovirus, papovavirus, paramyxovirus, parvovirus, picornavirus, poxvirus, retrovirus, togavirus or adenovirus.
  • viruses such as astrovirus, coronavirus, orthomyxovirus, papovavirus, paramyxovirus, parvovirus, picornavirus, poxvirus, retrovirus, togavirus or adenovirus.
  • Recombinant retroviruses and various uses thereof have been described in numerous references including, for example, Mann et al., Cell 33: 153, 1983, Cane and Mulligan, Proc. Nat'l. Acad. Sci. USA 81 :6349, 1984, Miller et al., Human Gene Therapy 1:5-14, 1990, U.S. Patent Nos. 4,405,712, 4,861,719, and 4,980,289, and PCT Application Nos.
  • Numerous retroviral gene delivery vehicles can be utilized in the present invention, including for example those described in EP 0,415,731; WO 90/07936; WO 94/03622; WO 93/25698; WO 93/25234;
  • viral vector systems that can be used to deliver a polynucleotide of the invention have been derived from Moloney murine leukemia virus, e.g., Morgenstern and Land, Nucleic Acids Res. 18:3587-3596, 1990, herpes virus, e.g., Herpes Simplex Virus (U.S. Patent No. 5,631,236 by Woo et al., issued May 20, 1997 and WO 00/08191 by Neurovex), vaccinia virus (Ridgeway (1988) Ridgeway, "Mammalian expression vectors," hi: Rodriguez R L, Denhardt D T, ed. Vectors: A survey of molecular cloning vectors and their uses.
  • Modifications may include individual nucleotide substitutions to a constitutively regulated vector or insertions or deletions of one or more nucleotides in the vector sequences. Modifications or operable linkages to a constitutively regulated vector that alter (i.e., increase or decrease) expression of a sequence interval (e.g., alternative promoters), provide greater cloning flexibility (e.g.
  • an expression vector of the invention may be modified to replace a Gateway® cloning cassette with a multi-cloning sequence, containing restriction enzyme sites for insertion of potential enhancers through standard ligation.
  • a “promoter” herein refers to a DNA sequence recognized by the synthetic machinery of the cell required to initiate the specific transcription of a gene
  • an expression vector of the invention may be modified to eliminate the strong CMV promoter sequence, to allow testing of an enhancer-promoter combination, including the endogenous gene promoter, inducible promoter, cell type-specific promoter, minimal promoter or other alternative enhancer-promoter sequences known to the skilled artisan. It is also known that many proteins, e.g., kinases, can be activated simply by being overexpressed in a given cell.
  • the strong CMV promoter sequence can be replaced with an even stronger promoter or coupled with an improved enhancer or the like in order to cause increased expression of wild type or regulatable proteins
  • increased expression of wild type or regulatable proteins can be effected through coexpression of multiple copies of the gene with standard promoters.
  • an expression vector will further contain sites for transcription initiation, termination and, in the transcribed region, a ribosome binding site for translation.
  • the coding portion of the mature transcripts expressed by the constructs will preferably include a translation initiating site at the beginning and a termination codon (UAA, UGA or UAG) appropriately positioned at the end of the polypeptide to be translated.
  • a vector of the invention may be modified to include reporter genes, including genes encoding fluorescent proteins or enzymes, such as ⁇ -galactosidase and alkaline phosphatase.
  • fluorescent reporters may be replaced with alternate fluorescent reporters with shorter or longer protein half-life allowing more precise evaluation of the timing of regulatory control.
  • a reporter may also be replaced by cassettes encoding protein substrates that allow observation (direct or indirect) of response based on cell/biochemical activity, e.g., in screens of chemical libraries to identify potential therapeutic chemical targets/leads.
  • an expression vector can include at least one selectable marker.
  • markers include dihydrofolate reductase, neomycin or puromycin resistance for eukaryotic cell culture and tetracycline, kanamycin, or ampicillin resistance genes for culturing in E. coli and other bacteria.
  • Representative examples of appropriate hosts include, but are not limited to, bacterial cells, such as E. coli, Streptomyces and Salmonella typhimurium cells; fungal cells, such as yeast cells; insect cells such as Drosophila S2 and Sf9 cells; animal cells such as CHO, COS and Bowes melanoma cells; and plant cells. Appropriate culture mediums and conditions for the above-described host cells are known in the art.
  • nucleic acids or proteins described herein may be present in one or more compositions.
  • nucleic acids or proteins may be present in wells of a multiwell plate or in individual tubes or devices. They may also be present, e.g., linked, to a solid surface.
  • devices comprising a location, wherein the location comprises one or more nucleic acids described herein, e.g., a nucleic acid encoding a regulatable protein linked to one or more regulatory signals, wherein expression of the regulatable proteins in a cell results in the regulatable protein or biologically active portion thereof being constitutively regulated.
  • a cell comprising one or more proteins, e.g., regulatable proteins linked to one or more regulatory signals or inhibitory mutants, or nucleic acid encoding these.
  • a cell may be an isolated cell or it may be a cell that is part of a tissue or an organism.
  • a cell may be a eukaryotic or a prokaryotic cell.
  • a eukaryotic cell may be a human or a non-human mammalian or vertebrate cell, e.g., a simian, ovine, bovine, equine, porcine, canine, feline, rat or mouse cell.
  • a prokaryotic cell may be a bacterial cell. Cells may comprise one or more nucleic acids or proteins. Exemplary cells are further described herein.
  • contacting a cell with a nucleic acid or a protein described herein may be under conditions in which the nucleic acid or protein is taken up by the cell.
  • a cell may be contacted with a nucleic acid, or a pool of nucleic acids, under conditions resulting in transient transfection, in which the nucleic acids are essentially not integrated into the genome of the cell.
  • Nucleic acids may also be contacted with a cell under conditions for stable transfection, resulting in one or more nucleic acids being integrated into the genome of the cell or in the form of an episome.
  • the presence of an introduced nucleic acid or a protein in a cell can be determined according to methods known in the art.
  • kits comprising one or more nucleic acids described herein, e.g., encoding a regulatable protein linked to one or more regulatory signals, wherein expression of the regulatable proteins in a cell results in the regulatable protein or biologically active portion thereof being constitutively regulated and packaging for said kit.
  • Said kit may comprise one or more reagents necessary to express the regulatable proteins.
  • the kit may further comprise a reference standard, e.g., a nucleic acid encoding a protein that does not affect or regulate signaling pathways controlling cell growth, division, migration, survival or apoptosis.
  • a reference standard e.g., a nucleic acid encoding a protein that does not affect or regulate signaling pathways controlling cell growth, division, migration, survival or apoptosis.
  • control proteins including, but not limited to, common molecular tags (e.g.
  • a method may comprise contacting one or more cells with a nucleic acid or protein described herein. The method may further comprise determining whether a characteristic of the cells has changed. In one embodiment, a method comprises providing a cell that is not transformed and introducing into the cell one or more regulatable proteins linked to one or more regulatory signals or one or more nucleic acids encoding such. The method may further comprise determining whether the cell is transformed. In an illustrative embodiment, a pool of nucleic acids encoding about 10-100 regulatable proteins each linked to one or more regulatory signals is introduced into cells that are not transformed.
  • the cells are cultured under conditions that allow the nucleic acids to express the encoded proteins and then the method comprises determining whether the cells have been transformed as a result of the presence and expression of the nucleic acids. If the cells have been transformed, the nucleic acids are divided into subpools, e.g., of about 10-20 nucleic acids, and these are introduced into the same or other non-transformed cells such that the encoded proteins are expressed. The method then comprises determining again whether the cells have been transformed. If the cells have been transformed, it indicates that one or more nucleic acids encodes a protein that has transforming capacity. The nucleic acids can then progressively combined into smaller pools and introduced into cell and the above-described steps are reiterated until the nucleic acid that causes the cell to become transformed has been identified.
  • subpools e.g., of about 10-20 nucleic acids
  • the regulatable protein encoded by the nucleic acid can be identified using well known techniques.
  • members of the regulatable protein library are administered in pools to determine whether any individual species within the set of pooled species is capable of altering characteristics of cellular transformation and/or tumorigenesis.
  • transient expression or stable cell lines expressing individual species from each pool can be generated and analyzed for the ability to alter characteristics of cellular transformation and/or tumorigenesis.
  • pools consisting of about 1-2, 1-5, 1-10, 1-20, 1-30, 1-40, 1-50, 1-100, 1-150, 1- 300, 1-600 or 1-1200 unique regulatable proteins are contacted simultaneously with cells.
  • pools may be divided according to a dendrogram-based organization of human kinases as described, for example, by Manning et al. (2002) Science 298: 1912-1919.
  • Manning et al. (2002) Science 298: 1912-1919 One of skill in the art may expect to identify some regulatable proteins that will induce alterations in characteristics of cellular transformation in any cell type and others that display cell type-specificity with regard to such alterations.
  • a cell comprises one or more of the following genes and oncogenes or proteins: the catalytic subunit of telomerase (hTERT), telomerase, human papilloma virus E6, Human papilloma virus E7, cyclin Dl, an R24C form of CDK4 (CDK4 R24C ), p53DD, MYC, phosphatidylinositol-3-kinase, adenovirus early region IA (ElA), E6, E7, MDM2, SV40 large T antigen, SV40 small T antigen, RAC/RHO, PBK, AKT, RAF, MEK, MEKDD, MAPK, RAL-GEFs, RAL, PLDl, H-RAS, an activated allele of H-RAS (H-RAS V12 ),
  • a quasi- transformed cell may comprise hTERT, SV40 large T antigen and SV40 small T antigen.
  • Other cells are those in which one or more tumor suppressor genes are inhibited or inactivated.
  • a cell may have, for example, an inhibited or inactivated copy of p53, retinoblastoma (Rb), PP2A, pi 9ARF, pl6 1NK4A or PTEN tumor suppressor genes or proteins or variants or fragments thereof that may be tumor resppressors or other such genes known in the art (see, e.g., Zhao et al., Trends MoI Med., 10:344-350, 2004; Hunter, Cell, 64:249-270, 1991; and references incorporated therein).
  • Quasi-transformed cells may also comprise a combination of one or more oncogenes and one or more inactivated tumor suppressor genes.
  • cells express, although not limited to, c-myc, H-RAS, hTERT individually or together with loss of function of the p53, retinoblastoma (RB) or PTEN tumor suppressor genes individually or in various combinations to cause transformation and/or tumorigenicity.
  • Quasi-transformed cells can also be created by inactivating an oncogene or by activating inactivated tumor suppressor genes.
  • the quasi-transformed cell may be of human or non-human origin.
  • Exemplary cells include human kidney epithelial (HEK) cells, human mammary epithelial cells (HMEC) and human prostate epithelial cells (HPEC).
  • HEK human kidney epithelial
  • HMEC human mammary epithelial cells
  • HPEC human prostate epithelial cells
  • a quasi-transformed cell is an HEK cell comprising SV40 large and small T antigen and hTERT (HAlE cell).
  • HSE cell SV40 large and small T antigen and hTERT
  • Other quasi- transformed cells are described in the Examples.
  • the constitutive expression of the catalytic subunit of telomerase ⁇ hTERT) and the Large T (LT) and Small T (ST) oncoprotein of the SV40 Early Region (SV40ER) is sufficient to render a wide range of human cells transformed and/or tumorigenic, if supplied with an activated allele of H-RAS (H-RASV 12 , H-RAS) (Zhao et al. (2004) Trends MoI Med. 10, 344-350). It is known that LT contributes to cell transformation by binding to and inactivating the retinoblastoma (RB) and p53 tumor suppressor pathways.
  • RB retinoblastoma
  • this set of proteins is expressed in human kidney epithelial (HEK), human mammary epithelial (HMEC) and human prostate epithelial cells (HPEC) (Berger et al. (2004) Cancer Res. 64, 8867-8875; Elenbaas and Weinberg (2001) Exp. Cell Res. 264, 169-184; Lundberg et al. (2002) Oncogene 21, 4577-4586; MacKenzie et al. (2002) Oncogene 21, 4200-4211; Rich et al. (2001) Cancer Res.
  • HEK human kidney epithelial
  • HMEC human mammary epithelial
  • HPEC human prostate epithelial cells
  • Other embodiments include experimental models containing defined combinations of cancer-associated mutations that are able to transform human cells without viral oncoproteins (Boehm et al. (2005) MoI. Cell. Biol. 25, 6464-6474; Kendall et al. (2005) Cancer Res. 65, 9824-9828; Zhao et al. (2005) Proc. Natl. Acad. ScL USA 102, 18443-18448) or experimental models that recapitulate particular tumor stages and types (Berger et al. (2004) Cancer Res. 64, 8867-8875; Chudnovsky et al. (2005) Nat. Genet.
  • the methods involve identifying genes and proteins affect cellular characteristics of transformation and/or tumorigenicity through the use of transformed and/or tumorigenic cells that are caused by undefined mutations or through the use of untransformed cells. Methods described herein may be referred to as complementing methods. As used herein, the term "complement" refers to the ability of a gene or gene product to substitute for the expression of another gene or gene product to affect cellular characteristics of transformation and/or tumorigenicity.
  • non-transformed and/or non-tumorigenic cells are contacted with and made to take up and express compositions capable of expressing regulatable or inhibitory protein(s), either alone or in combinations thereof, to alter characteristics of cellular transformation and/or tumorigenicity and thereby identify proteins that can complement existing genetic changes that together cause transformation and/or tumorigenesis.
  • transformed and/or tumorigenic cells with undefined mutations can be contacted with and made to take up and express compositions capable of expressing either a regulatable or inhibitory protein(s), either alone or in combinations thereof, to identify proteins that can complement undefined mutations in altering transformation characteristics of the cell.
  • the activation or inactivation of an expressed kinase in a transformed cell may cause a transformed cell whose growth is no longer regulated by dependence on IL3 to become IL3-dependent.
  • non-transformed cells can be contacted with and made to take up compositions capable of expressing a regulatable protein or inhibitory protein(s), either alone or in combinations thereof, to identify proteins that can complement wild type proteins in altering transformation characteristics of the cell.
  • the activation or inactivation of an expressed kinase may cause a non- transformed cell whose growth is IL3-dependent to no longer be regulated by IL3 for growth.
  • cytokines or growth factors can be similarly used, including, but not limited to, members of the platelet-derived growth factor (PDGF), epidermal growth factor (EGF), fibroblast growth factor (FGF), bone morphogenetic proteins (BMPs), nerve growth factor (NGF), erythropoietin, insulin-like growth factor (IGF), tumor necrosis factor (TNF), colony stimulating factor (CSF), neurotrophin, transforming growth factor beta (TGF ⁇ ), IL-2, interferon (IFN), IL-10, IL-I, and IL- 17 families.
  • PDGF platelet-derived growth factor
  • EGF epidermal growth factor
  • FGF fibroblast growth factor
  • BMPs bone morphogenetic proteins
  • NGF nerve growth factor
  • IGF insulin-like growth factor
  • TNF tumor necrosis factor
  • CSF colony stimulating factor
  • TGF ⁇ transforming growth factor beta
  • IFN interferon
  • IL-10 IL-10
  • IL-I interferon
  • a transformed cell is contacted with one or more nucleic acids encoding one or more inhibitory mutants of proteins.
  • Expression of one or more inhibitory mutants of proteins may downregulate one or more biological activities associated with the corresponding wild-type proteins.
  • cells can be contacted with pools of nucleic acids, such that the nucleic acids enter the cells and are expressed therein. The cell is then tested for loss of transforming capacity. Subpools of nucleic acids are then introduced into the same or different cells and the cells are tested for modulation, e.g. loss, of transforming capacity. These steps are reiterated until a nucleic acid encoding a protein that modulates, e.g. reverses, transformation is identified.
  • the well described tumor formation assay in immunocompromised (“nude”) animals constitutes an in vivo transformation assay. Clones from colonies that grow in soft agar or as tumors in animals can be re-isolated by PCR on genomic DNA using vector-specific primers. Re-introduction of re-isolated regulatable proteins into the parental cells can serve to confirm that they reproducibly confer a transformed phenotype.
  • An assay may rely on changes in expression characteristics of the gene identified in the above assay in human cancer specimens or cell lines derived from human cancer specimens relative to normal counterparts including, but not limited to, copy number gain, increased transcript levels, increased protein levels and oncogene addiction (Weinstein and Joe (2006) Nat. Clin. Pr act. Oncol. 3, 448-457).
  • Increased gene copy number can be detected by standard techniques currently known in the art and include for example, high-density SNP array (Zhao et al. (2004) Cancer Res.
  • transcript levels can be detected by standard techniques currently known in the art and include, for example, serial analysis of gene expression (SAGE), transcript expression microarray, publicly or privately available transcript expression databases, quantitative reverse transcription-coupled polymerase chain reaction (qRT-PCR), Northern blot, and/or RNase protection analyses.
  • SAGE serial analysis of gene expression
  • qRT-PCR quantitative reverse transcription-coupled polymerase chain reaction
  • Northern blot and/or RNase protection analyses.
  • the degree of differences in expression levels need only be large enough to be visualized or measured via standard characterization techniques.
  • Oncogene addiction is a phenomenon in which the expression of many oncogenes renders cancer cells unusually dependent upon the expression of the oncogene for cell proliferation or viability (Weinstein and Joe (2006) Nat. Clin. Pract. Oncol. 3, 448-457).
  • the degree of oncogene addiction maybe assessed by determining the extent to which cell proliferation or viability is affected when the cell is deprived of the functional oncoprotein. This may be achieved, for example, using RNA interference (RNAi), immunodepletion, dominant negative mutations, or loss-of function mutations directed against the oncoprotein itself or the messenger RNA transcript or DNA gene encoding the oncoprotein.
  • RNA interference RNA interference
  • Regulatable proteins that alter characteristics of cellular transformation and/or tumorigenesis and were, e.g., identified by the methods described herein, can be used as a marker for the detection of disorders or diseases, e.g., cancer, that are associated with abnormal expression of the regulatable protein or generally for predicting whether a subject has or is likely to develop such as disorder or disease
  • a regulatable protein causing cellular transformation identified as described herein is expressed in a cell and the phosphorylation profile (i.e., the phosphorylation status of proteins within the cell) of the cell is determined. Comparison of the phosphorylation profile to that of a cell that was not transformed with the transforming regulatable protein will indicate a specific set of proteins that are phosphorylated only in the transformed cell. This phosphorylation profile can then be used as a point of comparison to determine whether a cell is transformed, e.g., by this particular transforming regulatable protein.
  • an inhibitory protein e.g. a dominant negative protein, causing cellular transformation identified as described herein is expressed in a cell and the phosphorylation profile (i.e., the phosphorylation status of proteins within the cell) of the cell is determined. Comparison of the phosphorylation profile to that of a cell that was not transformed with the inhibitory protein will indicate a specific set of proteins that are phosphorylated only in the transformed cell. This phosphorylation profile can then be used as a point of comparison to determine whether a cell is transformed, e.g., by this particular inhibitory protein.
  • gene expression products of a cell in which a transforming regulatable protein is expressed are determined. By comparison with a cell that does not express the transforming regulatable protein, a specific set of gene expression products that are up- or down-regulated by the regulatable protein can be identified. This expression profile can then be used as a point of comparison to determine whether a cell is transformed , e.g., by this particular transforming regulatable protein.
  • gene expression products of a cell in which a transforming inhibitory protein is expressed are determined. By comparison with a cell that does not express the transforming inhibitory protein, a specific set of gene expression products that are up- or down-regulated by the inhibitory protein can be identified. This expression profile can then be used as a point of comparison to determine whether a cell is transformed, e.g., by this particular inhibitory protein.
  • Determination of gene expression products from cells can be performed using common methods in the art (see, e.g., U.S. Patent Application Nos: 20030013208A1; 20020155493A1, 20030017515 and U.S. Pat. Nos: 6,329,209; 6,365,418, 6,618,6796; 6,379,897; 6,664,377; 6,451,536; 548,257; U.S. 20030157485 and Schena et al. (1995) Science 20, 467-470; Gerhold et al. (1999) Trends In Biochem. Sci. 24, 168-173; and Lennon et al. (2000) Drug Discovery Today 5, 59-65, which are herein incorporated by reference in their entirety).
  • genes and proteins identified may be used for treating or preventing cancer, e.g., by down-regulating or up-regulating the levels of said identified genes and proteins.
  • the genes and proteins identified can also be used to determine if the expression of such genes and proteins (e.g. a particular gene splice variant or a protein with a particular phosphorylation state) is associated with: 1) the identity of a sample (i.e. tumor or normal); 2) the state of differentiation; or 3) the predicted clinical outcome (e.g., either non-recurrence of tumor after surgery or recurrence).
  • a biological sample can be classified with respect to a phenotypic effect, e.g.
  • samples can be classified as belonging to (i.e. derived from) an individual who has or is likely to develop cancer. In a preferred embodiment, this cancer is breast cancer.
  • gene expression products include proteins, peptides and nucleic acid molecules (e.g., mRNA, tRNA, rRNA, or cRNA).
  • the nucleic acid molecule levels measured can be derived directly from the gene or, alternatively, from a corresponding regulatory gene. All forms of gene expression products can be measured, including, for example, splice variants or states of protein modificationm (e.g., phosphorylated versus unphosphorylated states of a given protein).
  • gene expression can be measured by assessing the level of protein or derivative thereof translated from mRNA.
  • the sample to be assessed can be any sample that contains a gene expression product.
  • Suitable sources of gene expression products can include cells, lysed cells, cellular material for determining gene expression, or material containing gene expression products.
  • samples can include blood, plasma, lymph, urine, tissue, mucus, sputum, saliva or other cell samples. Methods of obtaining such samples are known in the art.
  • the sample is derived from an individual who has been clinically diagnosed as having cancer or at risk of developing cancer.
  • obtaining means acquiring a sample, either by directly procuring a sample from a patient or a sample (tissue biopsy, primary cell, cultured cells), or by receiving the sample from one or more people who procured the sample from the patient or sample and determining the gene expression levels therein.
  • Protein levels can be detected by standard techniques currently known in the art and include, for example, quantitative Western blot analyses using antibodies that detect either the protein itself or a peptide tag associated with the protein. Such antibodies, if directed against modified proteins (e.g. phosphorylated protein forms), are useful for detecting modified protein species that may be differentially present in cancer cells relative to appropriate controls.
  • modified proteins e.g. phosphorylated protein forms
  • transcript and protein levels of a given gene may be altered due to alterations in the copy of number of that gene in the genome.
  • expression of numerous genes can be measured simultaneously, using genome-wide methods known in the art and that the assessment of numerous genes provides for a more accurate evaluation of the sample because there are more genes that can assist in classifying the sample.
  • the gene expression levels of the sample are obtained, the levels are compared or evaluated against appropriate controls, and the sample is classified. The evaluation of the sample determines whether or not the sample should be assigned to the particular phenotypic class being studied.
  • the gene expression value measured or assessed can be interpreted using a number of methods familiar to the skilled artisan. For example, numeric expression values can be quantified and analyzed with software (e.g., Microsoft Excel® spreadsheet and Affymetrix GENECHIP® software). Phenotype classification (e.g. presence or absence of cancer, diagnostic risk assessment for developing cancer or state of therapeutic outcome) can be made by comparing the gene expression profile of the sample with respect to one or more informative genes, proteins and modified proteins with one or more appropriate control gene expression profiles (e.g., in a database). For example, a level of a regulatable protein, e.g., IKK ⁇ , that is higher or lower in a sample of a subject relative to a control sample indicates that the subject may have or is likely to develop cancer.
  • a regulatable protein
  • informative genes can be cancer identification genes, for example, all or a subset of the genes having increased or decreased expression in immediately transformed cells relative to appropriate controls; cancer differentiation genes, for example, all or a subset of the genes having increased or decreased expression in established transformed cells relative to appropriate controls; and tumor recurrence genes, for example, all or a subset of genes having increased or decreased expression in recurrent tumors relative to appropriate controls.
  • cancer identification genes for example, all or a subset of the genes having increased or decreased expression in immediately transformed cells relative to appropriate controls
  • cancer differentiation genes for example, all or a subset of the genes having increased or decreased expression in established transformed cells relative to appropriate controls
  • tumor recurrence genes for example, all or a subset of genes having increased or decreased expression in recurrent tumors relative to appropriate controls.
  • the correlation between gene expression criteria used to classify a sample and class distinction can be used to evaluate the effectiveness of the given gene expression criteria as a diagnostic marker for a given class distinction.
  • This correlation can be determined using a variety of methods. For example, methods of defining classes and classifying samples are known in the art, as exemplified in U.S. patent application Ser. No. 09/544,627, filed Apr. 6, 2000 by Golub et al.
  • a baseline gene expression profile from an individual at risk for cancer or having cancer can be determined, and repeated gene expression profiles can be determined at various time points during cancer treatment. For example, a shift in gene expression profile from a profile correlated with poor treatment outcome to a profile correlated with improved treatment outcome is evidence of an effective therapeutic regimen, while a repeated profile correlated with poor treatment outcome is evidence of an ineffective therapeutic regimen.
  • tumor metastasis refers to the condition of spread of cancer from the organ of origin to additional distal sites in the patient.
  • the process of tumor metastasis is a multistage event involving local invasion and destruction of intercellular matrix, intravasation into blood vessels, lymphatics or other channels of transport, survival in the circulation, extravasation out of the vessels in the secondary site and growth in the new location (Fidler, et al, Adv. Cancer Res. 28, 149-250 (1978), Liotta, et al., Cancer Treatment Res. 40, 223-238 (1988), Nicolson, Biochim. Biophy. Acta 948, 175-224 (1988) and Zetter, N. Eng. J. Med. 322, 605-612 (1990)).
  • an "isolate" of a biological sample refers to a material or composition (e.g., a biological material or composition) which has been separated, derived, extracted, purified or isolated from the sample and additionally may be substantially free of undesirable compositions and/or impurities or contaminants associated with the biological sample.
  • tissue sample includes a portion, piece, part, segment, or fraction of a tissue which is obtained or removed from an intact tissue of a subject, preferably a human subject.
  • a “primary tumor” is a tumor appearing at a first site within the subject and can be distinguished from a “metastatic tumor” which appears in the body of the subject at a remote site from the primary tumor.
  • level refers to the qualitative and/or quantitative amount and/or activity of, for example, a regulatable protein in a given specimen, cell, tissue, organ, subject, etc.
  • Determining the level of a regulatable protein in a cell or a biological sample includes qualitatively or quantitatively determining the level and/or the activity of the protein of the regulatable protein or degradation product thereof, the level of mRNA or pre-mRNA encoding said regulatable protein, the number of genomic loci encoding said regulatable protein, or the level and/or activity of any biological molecule or product that is indicative of expression of said regulatable protein, or degradation product thereof.
  • the regulatable protein may be sufficient to detect the presence of the regulatable protein rather than determining its level and comparing it to a standard or control level, as the levels of the regulatable protein may be relatively low in normal cells and tissues and may not be detectable by standard methods of detection, e.g., immunohistochemistry.
  • a test sample and a normal control sample may be of the same type, that is, obtained from the same biological source.
  • a normal control sample can also be a standard sample that contains the same concentration of a regulatable protein that is normally found in a biological sample of the same type and that is obtained from a healthy individual, e.g., an individual who does not have cancer, e.g., breast cancer.
  • a standard normal control sample for the amounts of a regulatable protein normally found in a cell or tissue.
  • statically significant refers to statistical significance and generally means a two standard deviation (2SD) or larger difference in regulatable protein levels of the marker in the experimental sample relative to the control.
  • the levels of the regulatable protein can be represented by arbitrary units, for example, as units obtained from a densitometer, luminometer, or an ELISA plate reader.
  • Levels of a regulatable protein e.g., IKK ⁇
  • a regulatable protein e.g., IKK ⁇
  • a control value or sample may then be obtained from the same type of cells.
  • cancers include, but are not limited to, epithelial cancers, urogenital cancer, e.g., urinary bladder cancer, transitional cell carcinoma (TCC), prostate cancer, lung carcinoma, breast carcinoma, thyroid carcinoma, brain cancers (cerebellum, medulloblastoma, astrocytoma, ependymoma, glioblastoma), pancreatic carcinoma, ovarian carcinoma, uterine cancer, eye cancer (retinoblastoma), muscle (rhabdosarcoma), lymphoma, stomach cancer, liver cancer, and colon cancer.
  • epithelial cancers e.g., urinary bladder cancer, transitional cell carcinoma (TCC), prostate cancer, lung carcinoma, breast carcinoma, thyroid carcinoma, brain cancers (cerebellum, medulloblastoma, astrocytoma, ependymoma, glioblastoma), pancreatic carcinoma, ovarian carcinoma, uterine cancer, eye cancer (retinoblasto
  • cancers may be cancers of the prostate, lung, breast, thyroid, brain (e.g., cerebellum, medulloblastoma, astrocytoma, ependymoma, glioblastoma), pancreas, ovary, eye (e.g., retinoblastoma), muscle (e.g., rhabdosarcoma), lymph, stomach, liver, colon, bladder, uterus, and kidney.
  • brain e.g., cerebellum, medulloblastoma, astrocytoma, ependymoma, glioblastoma), pancreas, ovary, eye (e.g., retinoblastoma), muscle (e.g., rhabdosarcoma), lymph, stomach, liver, colon, bladder, uterus, and kidney.
  • brain e.g., cerebellum, medulloblastoma, astrocytoma
  • a method may further comprise comparing the observed levels of the regulatable protein to a control or to levels of the regulatable protein found in a normal control sample, for example, a sample obtained from a subject that does not have cancer.
  • a normal control sample for example, a sample obtained from a subject that does not have cancer.
  • the presence of regulatable protein at levels that are higher or lower than those observed in an appropriate control indicate the presence of cancer or the likelihood of developing cancer.
  • methods provided herein also include methods for monitoring the progression of cancer in a subject, comprising, e.g., monitoring the presence or level of the regulatable protein in a cell, e.g., in a cancerous cell or tumor, of the subject over time.
  • a change in the regulatable protein over time indicates that the cancer is progressing or retreating.
  • a reference reading is taken after an operation involving the cancer and others taken at regular intervals subsequent to the operation. Any change in the level of the regulatable protein over time indicates that the cancer is progressing or retreating.
  • a method may comprise (i) determining the level of a regulatable protein, e.g., IKK ⁇ , in a cancerous tumor of a subject; and (ii) if the level of the regulatable protein is higher or lower in the cancerous tumor of the subject relative to a control, treating the subject aggressively, whereas if the level of the regulatable protein in the cancerous tumor of a subject is statistically within the range of an appropriate control, treating the subject less aggressively.
  • An aggressive therapy may comprise surgical removal of cancer cells or a tissue comprising the cancer cells, e.g., mastectomy in the case of breast cancer, chemotherapy, radiation, or a combination thereof. Surgical removal may be followed by early systematic therapy. The treatment may then be followed by continued monitoring of the levels of the regulatable protein.
  • the levels of the regulatable protein in cancer patients can be easily added in the pathology report with other pathological predictors including tumor size, grade, subtype, and stage for the patient's outcome information and clinical treatment. Determining the level of a regulatable protein, e.g., IKK ⁇ , may also be combined with the detection of one or more other biomarkers for which increased or decreased expression correlates with cancer.
  • the selected biomarker can be a general diagnostic or prognostic marker useful for multiple types of cancer, such as CA 125, CEA or LDH, or can be a cancer- specific diagnostic or prognostic marker, such as a breast cancer marker (for example, CA 15- 2.
  • Her-2/neu and CA 27.29 Her-2/neu and CA 27.29), colon cancer marker (for example, sialosyl-TnCEA, CAl 9-9, or LASA), ovarian cancer marker (for example, CA72-4), lung cancer (for example, neuron- specific enolase (NSE) and tissue polypeptide antigen (TPA)), prostate cancer (for example, PSA, prostate-specific membrane antigen and prostatic acid phosphatase), melanoma (for example, S-100 and TA-90), as well as other biomarkers specific for other types of cancer.
  • NSE neuron- specific enolase
  • TPA tissue polypeptide antigen
  • PSA prostate-specific membrane antigen and prostatic acid phosphatase
  • melanoma for example, S-100 and TA-90
  • kits for determining the level of a regulatable protein, e.g. IKK ⁇ , in a subject or in a biological sample of a subject.
  • a kit may comprise any agent useful for qualitatively or quantitatively detecting the regulatable protein, RNA (including pre-mRNA and mRNA) encoding the regulatable protein, or changes in copy number of genomic loci encoding the regulatable protein, such as agents further described herein.
  • a kit may further comprise a control, such as a control value or control sample or control tissue.
  • a control may be protein or nucleic acid attached to a solid support.
  • a kit may also comprise additional components or reagents necessary for the detection of the regulatable protein, such as secondary antibodies for use in immunohistochemistry.
  • the protein level of a regulatable protein is measured. It is generally preferred to use antibodies, or antibody equivalents, to detect the regulatable protein. Methods for the detection of protein are well known to those skilled in the art, and include ELISA (enzyme linked immunosorbent assay), RIA (radioimmunoassay), Western blotting, and immunohistochemistry. Immunoassays, such as ELISA or RIA, which can be extremely rapid, are more generally preferred. Antibody arrays or protein chips can also be employed, see for example U.S. Patent Application Nos: 20030013208A1; 20020155493 Al, 20030017515 and U.S. Pat. Nos: 6,329,209; 6,365,418, herein incorporated by reference in their entirety.
  • ELISA and RIA procedures may be conducted such that a protein standard for the regulatable protein is labeled (with a radioisotope such as 125 I or 35 S, or an assayable enzyme, such as horseradish peroxidase or alkaline phosphatase), and, together with the unlabelled sample, brought into contact with the corresponding antibody, whereon a second antibody is used to bind the first, and radioactivity or the immobilized enzyme assayed (competitive assay).
  • a radioisotope such as 125 I or 35 S, or an assayable enzyme, such as horseradish peroxidase or alkaline phosphatase
  • the regulatable protein in the sample is allowed to react with the corresponding immobilized antibody, radioisotope- or enzyme-labeled antibody that specifically recognizes the regulatable protein is allowed to react with the system, and radioactivity or the enzyme assayed (ELIS A-sandwich assay).
  • radioactivity or the enzyme assayed may also be employed as suitable.
  • a “one-step” assay involves contacting antigen with immobilized antibody and, without washing, contacting the mixture with labeled antibody.
  • a “two-step” assay involves washing before contacting, the mixture with labeled antibody.
  • Other conventional methods may also be employed as suitable.
  • a method for measuring the levels of a regulatable protein comprises the steps of: contacting a biological specimen with an antibody or variant (e.g., fragment) thereof which selectively binds the regulatable protein, and detecting whether said antibody or variant thereof is bound to said sample and thereby measuring the levels of the regulatable protein.
  • an antibody or variant e.g., fragment
  • Enzymatic and radiolabeling of the regulatable protein and/or the antibodies may be effected by conventional means.
  • Such means will generally include covalent linking of the enzyme to the antigen or the antibody in question, such as by glutaraldehyde, specifically so as not to adversely affect the activity of the enzyme, by which is meant that the enzyme must still be capable of interacting with its substrate, although it is not necessary for all of the enzyme to be active, provided that enough remains active to permit the assay to be effected.
  • some techniques for binding enzyme are non-specific (such as using formaldehyde), and will only yield a proportion of active enzyme.
  • Enzymes employable for labeling are not particularly limited, but may be selected from the members of the oxidase group, for example. These catalyze production of hydrogen peroxide by reaction with their substrates, and glucose oxidase is often used for its good stability, ease of availability and cheapness, as well as the ready availability of its substrate (glucose). Activity of the oxidase may be assayed by measuring the concentration of hydrogen peroxide formed after reaction of the enzyme-labeled antibody with the substrate under controlled conditions well-known in the art.
  • a regulatable protein may be detected according to a practitioner's preference based upon the present disclosure.
  • One such technique is Western blotting (Towbin et at., Proc. Nat. Acad. Sci. 76:4350 (1979)), wherein a suitably treated sample is run on an SDS-PAGE gel before being transferred to a solid support, such as a nitrocellulose filter.
  • Antibodies that bind the regulatable protein (unlabeled) are then brought into contact with the support and assayed by a secondary immunological reagent, such as labeled protein A or antiimmunoglobulin (suitable labels including 125 I, horseradish peroxidase and alkaline phosphatase). Chromatographic detection may also be used.
  • Immunohistochemistry may be used to detect expression of the regulatable protein, e.g., in a biopsy sample.
  • a suitable antibody is brought into contact with, for example, a thin layer of cells, washed, and then contacted with a second, labeled antibody.
  • Labeling may be by fluorescent markers, enzymes, such as peroxidase, avidin, or radiolabelling. The assay is scored visually, using microscopy.
  • Antibodies that bind the regulatable protein may also be used for imaging purposes, for example, to detect the presence of the regulatable protein in cells and tissues of a subject.
  • Suitable labels include radioisotopes, iodine ( 125 1, 121 I), carbon ( 14 C), sulphur ( 35 S), tritium ( 3 H), indium ( 12 In), and technetium (“mTc), fluorescent labels, such as fluorescein and rhodamine, and biotin.
  • antibodies are not detectable, as such, from outside the body, and so must be labeled, or otherwise modified, to permit detection.
  • Markers for this purpose may be any that do not substantially interfere with the antibody binding, but which allow external detection.
  • Suitable markers may include those that may be detected by X- radiography, NMR or MRI.
  • suitable markers include any radioisotope that emits detectable radiation but that is not overtly harmful to the patient, such as barium or cesium, for example.
  • Suitable markers for NMR and MRI generally include those with a detectable characteristic spin, such as deuterium, which may be incorporated into the antibody by suitable labeling of nutrients for the relevant hybridoma, for example.
  • the size of the subject, and the imaging system used, will determine the quantity of imaging moiety needed to produce diagnostic images, hi the case of a radioisotope moiety, for a human subject, the quantity of radioactivity injected will normally range from about 5 to 20 millicuries of technetium-99 m.
  • the labeled antibody or antibody fragment will then preferentially accumulate at the location of cells which contain the regulatable protein. The labeled antibody or antibody fragment can then be detected using known techniques.
  • Antibodies that may be used to detect a regulatable protein include any antibody, whether natural or synthetic, full length or a fragment thereof, monoclonal or polyclonal, that binds sufficiently strongly and specifically to the regulatable protein to be detected.
  • An antibody may have a Kd of at most about 10 -6 M, 10 -7 M, 10 -8 M, 10 -9 M, 10 -10 M, 10 -11 M, 10- 12 M.
  • the phrase "specifically binds" refers to binding of, for example, an antibody to an epitope or antigen or antigenic determinant in such a manner that binding can be displaced or competed with a second preparation of identical or similar epitope, antigen or antigenic determinant.
  • An antibody may bind preferentially to the regulatable protein relative to other proteins, such as related proteins, including homologs of the regulatable protein.
  • Such antibodies may be commercially available or may be prepared according to methods known in the art.
  • Antibodies and derivatives thereof that may be used encompass polyclonal or monoclonal antibodies, chimeric, human, humanized, primatized (CDR-grafted), veneered or single-chain antibodies as well as functional fragments, i.e., binding fragments a regulatable protein, of antibodies.
  • antibody fragments capable of binding to the regulatable protein or portions thereof including, but not limited to, Fv, Fab, Fab' and F (ab 1 ) 2 fragments can be used.
  • Such fragments can be produced by enzymatic cleavage or by recombinant techniques. For example, papain or pepsin cleavage can generate Fab or F (ab 1 ) 2 fragments, respectively.
  • agents that specifically bind to a regulatable protein e.g., IKK ⁇ , other than antibodies are used, such as peptides.
  • Peptides that specifically bind to the regulatable protein can be identified by any means known in the art. For example, specific peptide binders of the regulatable protein can be screened for using peptide phage display libraries.
  • agents that are capable of detecting protein of the regulatable protein such that the presence of the regulatable protein is detected and/or quantitated, may be used.
  • an "agent” refers to a substance which is capable of identifying or detecting the regulatable protein in a biological sample (e.g., identifies or detects protein of or nucleic acid encoding the regulatable protein), m one embodiment, the agent is a labeled or labelable antibody that specifically binds to the regulatable protein.
  • labeled or labelable refers to the attaching or including of a label (e.g., a marker or indicator) or ability to attach or include a label (e.g., a marker or indicator).
  • Markers or indicators include, but are not limited to, for example, radioactive molecules, colorimetric molecules, and enzymatic molecules which produce detectable changes in a substrate.
  • the regulatable protein may be detected using Mass Spectrometry such as MALDI/TOF (time-of-flight), SELDI/TOF, liquid chromatography-mass spectrometry (LC- MS), gas chromatography-mass spectrometry (GC-MS), high performance liquid chromatography-mass spectrometry (HPLC-MS), capillary electrophoresis-mass spectrometry, nuclear magnetic resonance spectrometry, or tandem mass spectrometry (e.g., MS/MS, MS/MS/MS, ESI-MS/MS, etc.). See for example, U.S. Patent Application Nos: 20030199001, 20030134304, 20030077616, which are herein incorporated by reference.
  • MALDI Metal-organic laser desorption ionization
  • the substrate surface is modified so that it is an active participant in the desorption process.
  • the surface is derivatized with adsorbent and/or capture reagents that selectively bind the protein of interest.
  • the surface is derivatized with energy absorbing molecules that are not desorbed when struck with the laser.
  • the surface is derivatized with molecules that bind the protein of interest and that contain a photo lytic bond that is broken upon application of the laser, hi each of these methods, the derivatizing agent generally is localized to a specific location on the substrate surface where the sample is applied (see, e.g., Hutchens and Yip, U.S. Pat. No. 5,719,060 and Hutchens and Yip, WO 98/59361).
  • the two methods can be combined by, for example, using a SELDI affinity surface to capture an analyte and adding matrix-containing liquid to the captured analyte to provide the energy absorbing material.
  • Detection of the presence of a marker or other substances will typically involve detection of signal intensity. This, in turn, can reflect the quantity and character of a polypeptide bound to the substrate. For example, in certain embodiments, the signal strength of peak values from spectra of a first sample and a second sample can be compared (e.g., visually or by computer analysis) to determine the relative amounts of particular biomolecules. Software programs such as the Biomarker Wizard program (Ciphergen Biosystems, Inc., Fremont, Calif.) can be used to aid in analyzing mass spectra. The mass spectrometers and their techniques are well known to those of skill in the art.
  • a mass spectrometer e.g., desorption source, mass analyzer, detect, etc.
  • sample preparations can be combined with other suitable components or preparations described herein, or to those known in the art.
  • a control sample may contain heavy atoms (e.g. 13 C) thereby permitting the test sample to be mixed with the known control sample in the same mass spectrometry run.
  • a laser desorption time-of-flight (TOF) mass spectrometer is used. In laser desorption mass spectrometry, a substrate with a bound marker is introduced into an inlet system.
  • TOF laser desorption time-of-flight
  • the marker is desorbed and ionized into the gas phase by laser from the ionization source.
  • the ions generated are collected by an ion optic assembly, and then in a time-of-flight mass analyzer, ions are accelerated through a short high voltage field and let drift into a high vacuum chamber. At the far end of the high vacuum chamber, the accelerated ions strike a sensitive detector surface at a different time. Since the time-of-flight is a function of the mass of the ions, the elapsed time between ion formation and ion detector impact can be used to identify the presence or absence of molecules of specific mass to charge ratio.
  • the relative amounts of one or more biomolecules present in a first or second sample is determined, in part, by executing an algorithm with a programmable digital computer.
  • the algorithm identifies at least one peak value in the first mass spectrum and the second mass spectrum.
  • the algorithm compares the signal strength of the peak value of the first mass spectrum to the signal strength of the peak value of the second mass spectrum of the mass spectrum.
  • the relative signal strengths are an indication of the amount of the biomolecule that is present in the first and second samples.
  • a standard containing a known amount of a biomolecule can be analyzed as the second sample to provide better quantification of the amount of the biomolecule present in the first sample.
  • the identity of the biomolecules in the first and second sample can also be determined.
  • detecting or determining levels of a regulatable protein comprises detecting or determining the levels of RNA encoding the regulatable protein.
  • one or more cells from the subject to be tested are obtained and RNA is isolated from the cells.
  • a sample containing predominantly cells of the desired type e.g., a sample of cells in which at least about 50%, preferably at least about 60%, even more preferably at least about 70%, 80% and even more preferably, at least about 90% of the cells are of the desired type.
  • Tissue samples can be obtained according to methods known in the art. It is also possible to obtain a cell sample from a subject, and then to enrich it in the desired cell type.
  • cells can be isolated from other cells using a variety of techniques, such as isolation with an antibody binding to an epitope on the cell surface of the desired cell type. Where the desired cells are in a solid tissue, particular cells can be dissected out, e.g., by microdissection.
  • RNA is obtained from a single cell.
  • a cell can be isolated from a tissue sample by laser capture microdissection (LCM). Using this technique, a cell can be isolated from a tissue section, including a stained tissue section, thereby assuring that the desired cell is isolated ⁇ see, e.g., Bonner et al. (1997) Science 278: 1481; Emmert- Buck et al.
  • Murakami et al. describe isolation of a cell from a previously immunostained tissue section.
  • RNA in the tissue and cells may quickly become degraded. Accordingly, in a preferred embodiment, the tissue or cells obtained from a subject is snap frozen as soon as possible.
  • RNA can be extracted from the tissue sample by a variety of methods, e.g., the guanidium thiocyanate lysis followed by CsCl centrifugation (Chirgwin et al., 1979, Biochemistry 18:5294-5299).
  • RNA from single cells can be obtained as described in methods for preparing cDNA libraries from single cells, such as those described in Dulac, C. (1998) Curr. Top. Dev. Biol. 36, 245 and Jena et al. (1996) J. Immunol. Methods 190:199. Care to avoid RNA degradation must be taken, e.g., by inclusion of RNAsin.
  • RNA sample can then be enriched in particular species, hi one embodiment, poly(A)+ RNA is isolated from the RNA sample.
  • poly(A)+ RNA is isolated from the RNA sample.
  • purification takes advantage of the poly- A tails on mRNA.
  • poly-T oligonucleotides may be immobilized within on a solid support to serve as affinity ligands for mRNA. Kits for this purpose are commercially available, e.g., the MessageMaker® kit (Life Technologies, Grand Island, NY).
  • the RNA population is enriched in sequences encoding a regulatable protein, e.g., DCK ⁇ .
  • Enrichment can be undertaken, e.g., by primer-specific cDNA synthesis, or multiple rounds of linear amplification based on cDNA synthesis and template- directed in vitro transcription (see, e.g., Wang et al. (1989) PNAS 86, 9717; Dulac et al., supra, and Jena et al., supra).
  • the population of RNA, enriched or not in particular species or sequences, can further be amplified.
  • an "amplification process" is designed to strengthen, increase, or augment a molecule within the RNA.
  • RNA is mRNA
  • an amplification process such as RT-PCR can be utilized to amplify the mRNA, such that a signal is detectable or detection is enhanced.
  • RT-PCR can be utilized to amplify the mRNA, such that a signal is detectable or detection is enhanced.
  • Such an amplification process is beneficial particularly when the biological, tissue, or tumor sample is of a small size or volume.
  • RNAscribe mRNA into cDNA followed by polymerase chain reaction RT-PCR
  • RT-AGLCR reverse transcribe mRNA into cDNA followed by symmetric gap ligase chain reaction
  • amplification methods which can be utilized herein include but are not limited to the so-called "NASBA” or “3SR” technique described in PNAS USA 87: 1874- 1878 (1990) and also described in Nature 350 (No. 6313): 91-92 (1991); Q-beta amplification as described in published European Patent Application (EPA) No. 4544610; strand displacement amplification (as described in G. T. Walker et al., Clin. Chem. 42: 9-13 (1996) and European Patent Application No.
  • In situ hybridization visualization may also be employed, wherein a radioactively labeled antisense RNA probe is hybridized with a thin section of a biopsy sample, washed, cleaved with RNase and exposed to a sensitive emulsion for autoradiography.
  • the samples may be stained with haematoxylin to demonstrate the histological composition of the sample, and dark field imaging with a suitable light filter shows the developed emulsion.
  • Nonradioactive labels such as digoxigenin may also be used.
  • mRNA expression can be detected on a DNA array, chip or a microarray. Labeled nucleic acids of a test sample obtained from a patient may be hybridized to a solid surface comprising DNA encoding a regulatable protein.
  • Positive hybridization signal is obtained with the sample containing RNA transcripts, DNA or cDNA encoding the regulatable protein.
  • Methods of preparing DNA arrays and their use are well known in the art (see, e.g., U.S. Pat. Nos: 6,618,6796; 6,379,897; 6,664,377; 6,451,536; 548,257; U.S.
  • Serial Analysis of Gene Expression can also be performed (See for example U.S. Patent Application 20030215858).
  • SAGE Serial Analysis of Gene Expression
  • mRNA is extracted from the biological sample to be tested, reverse transcribed, and fluorescently-labeled cDNA probes are generated.
  • microarrays capable of hybridizing to cDNA generated from transcripts encoding a regulatable protein are then probed with the labeled cDNA probes, the slides scanned and fluorescence intensity measured. This intensity correlates with the hybridization intensity and expression levels.
  • probes that can be used in the methods described herein include cDNA, riboprobes, synthetic oligonucleotides and genomic probes.
  • the type of probe used will generally be dictated by the particular situation, such as riboprobes for in situ hybridization, and cDNA for Northern blotting, for example.
  • the probe is directed to nucleotide regions unique to the RNA.
  • the probes may be as short as is required to differentially recognize mRNA transcripts of a regulatable protein, and may be as short as, for example, 15 bases; however, probes of at least 17, 18, 19 or 20 or more bases can be used.
  • the primers and probes hybridize specifically under stringent conditions to a DNA fragment having the nucleotide sequence corresponding to the gene encoding the regulatable protein.
  • stringent conditions means hybridization will occur only if there is at least 95% identity in nucleotide sequences. In another embodiment, hybridization under "stringent conditions” occurs when there is at least 97% identity between the sequences.
  • the form of labeling of the probes may be any that is appropriate, such as the use of radioisotopes, for example, 32 P and 35 S. Labeling with radioisotopes may be achieved, whether the probe is synthesized chemically or biologically, by the use of suitably labeled bases.
  • a change in copy number of genomic loci encoding a regulatable protein is detected.
  • the biological sample is tested for the presence of copy number changes in genomic loci encoding the regulatable protein.
  • a copy number of at least 3, 4, 5, 6, 7, 8, 9, or 10 is indicative of the presence of cancer or the likelihood of developing cancer.
  • Methods of evaluating the copy number of a particular biomarker or chromosomal region associated with a regulatable protein include, but are not limited to, hybridization-based assays.
  • Hybridization-based assays include, but are not limited to, traditional "direct probe” methods, such as Southern blots, in situ hybridization ⁇ e.g., FISH and FISH plus SKY) methods, and "comparative probe” methods, such as comparative genomic hybridization (CGH), e.g., cDNA-based or oligonucleotide-based CGH.
  • CGH comparative genomic hybridization
  • the methods can be used in a wide variety of formats including, but not limited to, substrate (e.g. membrane or glass) bound methods or array-based approaches.
  • evaluating the copy number of a gene encoding a regulatable protein in a sample involves a Southern Blot.
  • the genomic DNA typically fragmented and separated on an electrophoretic gel
  • a probe specific for the target region e.g., IKBKE or chromosome Iq32.
  • Comparison of the intensity of the hybridization signal from the probe for the target region with control probe signal from analysis of normal genomic DNA ⁇ e.g., a non-amplified portion of the same or related cell, tissue, organ, etc.
  • a Northern blot may be utilized for evaluating the copy number of encoding nucleic acid in a sample.
  • RNA is hybridized to a probe specific for the target region. Comparison of the intensity of the hybridization signal from the probe for the target region with control probe signal from analysis of normal RNA (e.g., a non- amplified portion of the same or related cell, tissue, organ, etc.) provides an estimate of the relative copy number of the target nucleic acid.
  • normal RNA e.g., a non- amplified portion of the same or related cell, tissue, organ, etc.
  • control probe signal from analysis of normal RNA e.g., a non- amplified portion of the same or related cell, tissue, organ, etc.
  • Alternatively, other methods well known in the art to detect RNA encoding the regulatable protein can be used, such that higher or lower expression relative to an appropriate control (e.g., a non-amplified portion of the same or related cell tissue, organ, etc.) provides an estimate of the relative copy number of the target nucleic acid.
  • An alternative means for determining genomic copy number is in situ hybridization
  • in situ hybridization comprises the following steps: (1) fixation of tissue or biological structure to be analyzed; (2) prehybridization treatment of the biological structure to increase accessibility of target DNA, and to reduce nonspecific binding; (3) hybridization of the mixture of nucleic acids to the nucleic acid in the biological structure or tissue; (4) post-hybridization washes to remove nucleic acid fragments not bound in the hybridization and (5) detection of the hybridized nucleic acid fragments.
  • the reagent used in each of these steps and the conditions for use vary depending on the particular application.
  • cells are fixed to a solid support, typically a glass slide.
  • the cells are typically denatured with heat or alkali.
  • the cells are then contacted with a hybridization solution at a moderate temperature to permit annealing of labeled probes specific to the nucleic acid sequence encoding the protein.
  • the targets e.g., cells, are then typically washed at a predetermined stringency or at an increasing stringency until an appropriate signal to noise ratio is obtained.
  • the probes are typically labeled, e.g., with radioisotopes or fluorescent reporters. In one embodiment, probes are sufficiently long so as to specifically hybridize with the target nucleic acid(s) under stringent conditions.
  • the repetitive sequences in both the reference and test DNAs are either removed or their hybridization capacity is reduced by some means, for example by prehybridization with appropriate blocking nucleic acids and/or including such blocking nucleic acid sequences for said repetitive sequences during said hybridization.
  • the bound, labeled DNA sequences are then rendered in a form that is visualizable, if necessary.
  • Chromosomal regions in the test cells which are at increased or decreased copy number, can be identified by detecting regions where the ratio of signal from the two DNAs is altered. For example, those regions that have decreased in copy number in the test cells will show relatively lower signal from the test DNA than the reference compared to other regions of the genome. Regions that have been increased in copy number in the test cells will show relatively higher signal from the test DNA.
  • CGH array CGH
  • the immobilized chromosome element is replaced with a collection of solid support bound target nucleic acids on an array, allowing for a large or complete percentage of the genome to be represented in the collection of solid support bound targets.
  • Target nucleic acids may comprise cDNAs, genomic DNAs, oligonucleotides (e.g., to detect single nucleotide polymorphisms) and the like.
  • Array-based CGH may also be performed with single-color labeling (as opposed to labeling the control and the possible tumor sample with two different dyes and mixing them prior to hybridization, which will yield a ratio due to competitive hybridization of probes on the arrays).
  • the control is labeled and hybridized to one array and absolute signals are read
  • the possible tumor sample is labeled and hybridized to a second array (with identical content) and absolute signals are read. Copy number difference is calculated based on absolute signals from the two arrays.
  • amplification-based assays can be used to measure copy number.
  • the nucleic acid sequences act as a template in an amplification reaction (e.g., Polymerase Chain Reaction (PCR).
  • PCR Polymerase Chain Reaction
  • the amount of amplification product will be proportional to the amount of template in the original sample.
  • Comparison to appropriate controls, e.g. healthy tissue, provides a measure of the copy number.
  • Quantitative amplification involves simultaneously co-amplifying a known quantity of a control sequence using the same primers. This provides an internal standard that may be used to calibrate the PCR reaction.
  • quantitative PCR involves simultaneously co-amplifying a known quantity of a control sequence using the same primers. This provides an internal standard that may be used to calibrate the PCR reaction.
  • Detailed protocols for quantitative PCR are provided in Innis, et al. (1990) PCR Protocols, A Guide to Methods and Applications, Academic Press, Inc. N. Y.). Measurement of DNA copy number at microsatellite loci using quantitative PCR analysis is described in Ginzonger, et al. (2000) Cancer Research 60:5405-5409.
  • the known nucleic acid sequence for the genes is sufficient to enable one of skill in the art to routinely select primers to amplify any portion of the gene.
  • Fluorogenic quantitative PCR may also be used in the methods of the invention. In fluorogenic quantitative PCR, quantitation is based on amount of
  • LCR ligase chain reaction
  • LCR ligase chain reaction
  • Genomics 4 560, Landegren, et al. (1988) Science 241:1077, and Barringer et al. (1990) Gene 89: 117
  • transcription amplification Kwoh, et al. (1989) Proc. Natl. Acad. ScL USA 86: 1173
  • self-sustained sequence replication Guatelli, et al. (1990) Proc. Nat. Acad. Sci. USA 87: 1874
  • dot PCR and linker adapter PCR, etc.
  • LOC Loss of heterozygosity
  • 64(1):64-71; Seymour, A. B., et al. (1994) Cancer Res 54, 2761-4; Hahn, S. A., et al. (1995) Cancer Res 55, 4670-5; Kimura, M., et al. (1996) Genes Chromosomes Cancer 17, 88-93) may also be used to identify regions of amplification or deletion.
  • a method for treating or preventing cancer comprises reducing the level of expression of a regulatable protein.
  • a method may include reducing the level of nucleic acid encoding the regulatable protein, reducing the amount of the regulatable protein , or inhibiting the activity of the regulatable protein.
  • a method for treatment one may decrease levels and/or activity of the regulatable protein or the nucleic acid encoding it in a tumor, e.g., a primary tumor.
  • a method for preventing cancer one may decrease levels and/or activity of the regulatable protein or the nucleic acid encoding it in tissue likely to develop cancer. Prophylaxis may be appropriate even at very early stages of the disease, to prevent tumorigenesis or metastasis.
  • administration of an agent that decreases levels and/or activity of a regulatable protein or the nucleic acid encoding it may be effected as soon as cancer is diagnosed, and treatment continued for as long as is necessary, generally until the threat of the disease has been removed.
  • Such treatment may also be used prophylactically in individuals at high risk for development of certain cancers, e.g., breast cancer.
  • levels of nucleic acid encoding a regulatable protein are decreased by administration of or expression in a subject, e.g., in cells or a tissue of the subject, of one or more siRNAs.
  • RNA molecules specific to mRNA encoding the regulatable protein which mediate RNAi, are antagonists useful in the method of the present invention (see, e.g., U.S. Patent Application Nos: 20030153519A1; 20030167490A1; and U.S. Pat. Nos: 6,506,559; 6,573,099, which are herein incorporated by reference in their entirety).
  • the RNA is comprised of, or capable of being cleaved to, short interfering or small interfering RNAs (siRNAs).
  • siRNAs short interfering RNAs
  • siRNA short interfering RNAs
  • siRNA is intended to refer to any nucleic acid molecule capable of mediating RNAi or gene silencing.
  • siRNA is intended to encompass various naturally generated or synthetic compounds, with RNAi function.
  • Such compounds include, without limitation, duplex synthetic oligonucleotides, of about 21 to 23 base pairs with terminal overlaps of 2 or 3 base pairs; hairpin structures of one oligonucleotide chain with sense and complementary, hybridizing, segments of 21-23 base pairs joined by a loop of 3-5 base pairs; and various genetic constructs leading to the expression of the preceding structures or functional equivalents.
  • Such genetic constructs are usually prepared in vitro and introduced in the test system, but can also include siRNA from naturally occurring siRNA precursors encoded by the genome of the host cell or animal.
  • siRNA is intended to be equivalent to any term in the art defined as a molecule capable of mediating sequence-specific RNAi.
  • equivalents include, for example, double-stranded RNA (dsRNA), microRNA (miRNA), short hairpin RNA (shRNA), short interfering oligonucleotide, endoribonuclease-prepared siRNA (esiRNA), and post-transcriptional gene silencing RNA (ptgsRNA).
  • siRNAs may be introduced into cells to suppress gene expression for therapeutic or prophylactic purposes as described in International Publication Number WO 0175164.
  • Such molecules may be introduced into cells to suppress gene expression for therapeutic or prophylactic purposes as described in various patents, patent applications and papers.
  • RNAi technology includes, but are not limited to, the following: U.S. Pat. No. 6,686,463, U.S. Pat. No. 6,673,611, U.S. Pat. No. 6,623,962, U.S. Pat. No. 6,506,559, U.S. Pat. No. 6,573,099, and U.S. Pat. No.
  • a composition comprising an siRNA effective to inhibit expression of nucleic acid encoding a regulatable protein may include an RNA duplex comprising a sense sequence encoding the regulatable protein.
  • the RNA duplex comprises a first strand comprising a sense sequence encoding the regulatable protein and a second strand comprising a reverse complement of the sense sequence encoding the regulatable protein.
  • the sense sequence encoding the regulatable protein comprises of from 10 to 25 nucleotides in length.
  • the sense sequence encoding the regulatable protein comprises of from 19 to 25 nucleotides in length.
  • the sense sequence encoding the regulatable protein comprises of from 21 to 23 nucleotides in length.
  • an siRNA of the present invention may comprise a sense sequence encoding the regulatable protein or the reverse complement of the sense sequence encoding the regulatable protein which is less than perfectly complementary to each other or to the targeted region encoding the regulatable protein.
  • the siRNA may comprise mismatches or bulges within the sense or reverse complement sequence.
  • the sense sequence or its reverse complement may not be entirely contiguous.
  • the sequence or sequences may comprise one or more substitutions, deletions, and/or insertions.
  • the only requirement of the present invention is that the siRNA sense sequence possess enough complementarity to its reverse complement and to the targeted region of the regulatable protein to allow for RNAi activity.
  • siRNA of the present invention It is an object of the present invention, therefore, to provide for sequence modifications of an siRNA of the present invention that retain sufficient complementarity to allow for RNAi activity.
  • One of skill in the art may predict that a modified siRNA composition of the present invention will work based on the calculated binding free energy of the modified sequence for the complement sequence and targeted region encoding the regulatable protein. Methods for calculating binding free energies for nucleic acids and the effect of such values on strand hybridization are known in the art.
  • a wide variety of delivery systems are available for use in delivering an siRNA of the present invention to a target cell in vitro and in vivo.
  • An siRNA of the present invention may be introduced directly or indirectly into a cell in which inhibition of the nucleic acid encoding the regulatable protein is desired.
  • An siRNA may be directly introduced into a cell by, for example, injection.
  • a composition comprising an siRNA effective to inhibit the nucleic acid encoding the regulatable protein in injectable, dosage unit form.
  • An siRNA of the present invention may be injected intravenously or subcutaneously, as an example, for therapeutic use in conjunction with the methods and compositions of the present invention.
  • Such treatment may include intermittent or continuous administration until therapeutically effective levels are achieved to inhibit expression of the nucleic acid encoding the regulatable protein in the desired tissue.
  • an expressible DNA sequence or sequences that encode the siRNA may be introduced into a cell and the siRNA, thereafter, transcribed from the DNA sequence or sequences. It is an object of the present invention, therefore, to provide for compositions comprising a DNA sequence or sequences which encode an siRNA effective to inhibit the regulatable protein expression.
  • a DNA composition of the present invention comprises a first DNA sequence which encodes a first RNA sequence comprising a sense sequence of a regulatable protein, e.g., IKBKE, and a second DNA sequence which encodes a second RNA sequence comprising the reverse complement of the sense sequence encoding the regulatable protein.
  • the first and second RNA sequences when hybridized, form an siRNA duplex capable of forming an RNA-induced silencing complex, the RNA-induced silencing complex being capable of inhibiting expression of the nucleic acid encoding the regulatable protein.
  • the first and second DNA sequences may be chemically synthesized or synthesized by PCR using appropriate primers to the regulatable protein.
  • the DNA sequences may be obtained by recombinant manipulation using cloning technology, which is well known in the art. Once obtained, the DNA sequences may be purified, combined, and then introduced into a cell in which inhibition of the regulatable protein is desired. Alternatively, the sequences may be contained in a single vector or separate vectors and the vector or vectors introduced into the cell in which inhibition of the regulatable protein is desired.
  • Delivery systems available for use in delivering a DNA composition of the present invention to a target cell include, for example, viral and non-viral systems.
  • suitable viral systems include, for example, adenoviral vectors, adeno-associated virus, lentivirus, poxvirus, retroviral vectors, vaccinia, herpes simplex virus, HIV, the minute virus of mice, hepatitis B virus and influenza virus.
  • Non- viral delivery systems may also be used, for example using, uncomplexed DNA, DNA-liposome complexes, DNA-protein complexes and DNA-coated gold particles, bacterial vectors such as salmonella, and other technologies such as those involving VP22 transport protein, Co-X-gene, and replicon vectors.
  • a viral or non- viral vector in the context of the present invention may express the antigen of interest.
  • the level of nucleic acid encoding a regulatable protein is decreased by administration or the expression of antisense molecules in a subject or tissue or cell thereof.
  • Gene expression can be controlled through triple-helix formation or antisense DNA or RNA, both of which methods are based on binding of a polynucleotide to DNA or RNA.
  • An antisense nucleic acid molecule which is complementary to a nucleic acid molecule encoding the regulatable protein can be designed based upon the isolated nucleic acid molecules encoding the regulatable protein.
  • An antisense nucleic acid molecule can comprise a nucleotide sequence which is complementary to a coding strand of a nucleic acid, e.g. complementary to an mRNA sequence, constructed according to the rules of Watson and Crick base pairing, and can hydrogen bond to the coding strand of the nucleic acid.
  • the antisense sequence complementary to a sequence of an mRNA can be complementary to a sequence in the coding region of the mRNA or can be complementary to a 5 ' or 3' untranslated region of the mRNA.
  • an antisense nucleic acid can be complementary in sequence to a regulatory region of the gene encoding the mRNA, for instance, a transcription initiation sequence or regulatory element.
  • an antisense nucleic acid complementary to a region preceding or spanning the initiation codon or in the 3' untranslated region of an mRNA is used.
  • An antisense nucleic acid can be designed based upon the nucleotide sequence encoding the regulatable protein.
  • a nucleic acid is designed which has a sequence complementary to a sequence of the coding or untranslated region of the regulatable protein.
  • an antisense nucleic acid can be designed based upon sequences of gene(s) encoding the regulatable protein, which can be identified by screening a genomic DNA library with an isolated nucleic acid of the invention. For example, the sequence of an important regulatory element can be determined by standard techniques and a sequence which is antisense to the regulatory element can be designed.
  • the antisense nucleic acids and oligonucleotides of the invention can be constructed using chemical synthesis and enzymatic ligation reactions using procedures known in the art.
  • the antisense nucleic acid or oligonucleotide can be chemically synthesized using naturally occurring nucleotides or variously modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed between the antisense and sense nucleic acids. For example, phosphorothioate derivatives and acridine substituted nucleotides can be used.
  • the antisense nucleic acids and oligonucleotides can be produced biologically using an expression vector into which a nucleic acid has been subcloned in an antisense orientation (i.e. nucleic acid transcribed from the inserted nucleic acid will be of an antisense orientation to a target nucleic acid of interest).
  • the antisense expression vector is introduced into cells in the form of a recombinant plasmid, phagemid or attenuated virus in which antisense nucleic acids are produced under the control of a high efficiency regulatory region, the activity of which can be determined by the cell type into which the vector is introduced.
  • a high efficiency regulatory region the activity of which can be determined by the cell type into which the vector is introduced.
  • ribozymes can be used to inhibit in vitro expression of nucleic acids encoding a regulatable protein, e.g., IKBKE.
  • the nucleic acids of the invention can further be used to design ribozymes which are capable of cleaving a single-stranded nucleic acid encoding the regulatable protein, such as an mRNA transcript encoding the regulatable protein.
  • a catalytic RNA (ribozyme) having ribonuclease activity can be designed which has specificity for an mRNA encoding the regulatable protein based upon the sequence of a nucleic acid of the invention.
  • a derivative of a Tetrahymena L- 19 IVS RNA can be constructed in which the base sequence of the active site is complementary to the base sequence to be cleaved in an mRNA encoding the regulatable protein (see, e.g., Cech et al., U.S. Pat. No. 4,987,071; Cech, et al., U.S. Pat. No. 5,116,742).
  • a nucleic acid of the invention could be used to select a catalytic RNA having a specific ribonuclease activity from a pool of RNA molecules (see, e.g., Bartel and Szostak (1993) Science 261, 1411-1418).
  • levels and/or activity of a regulatable protein are reduced by administration to or expression in a subject or a cell or tissue thereof, of blocking antibodies or aptamers against the regulatable protein.
  • Antibodies, or their equivalents and derivatives, e.g., intrabodies, or other antagonists of the regulatable protein may be used in accordance with the present invention for the treatment or prophylaxis of cancers. Administration of a suitable dose of the antibody or the antagonist may serve to block the activity of the protein and this may provide a crucial time window in which to treat malignant growth.
  • a method of treatment involves attachment of a suitable toxin to the antibodies which then target the area of the tumor.
  • a suitable toxin may comprise toxic radioisotopes, heavy metals, enzymes and complement activators, as well as such natural toxins as ricin which are capable of acting at the level of only one or two molecules per cell. It may also be possible to use such a technique to deliver localized doses of suitable physiologically active compounds, which may be used, for example, to treat cancers.
  • inhibitors In addition to using antibodies to inhibit the levels and/or activity of the regulatable protein, it may also be possible to use other forms of inhibitors. For example, it may be possible to identify antagonists that functionally inhibit the regulatable protein, hi addition, it may also be possible to interfere with the binding of the regulatable protein to target proteins. Other suitable inhibitors will be apparent to the skilled person.
  • the antibody (or other inhibitors or intrabody) can be administered by a number of methods.
  • One method is set forth by Marasco and Haseltine in PCT WO94/02610, which is incorporated herein by reference. This method discloses the intracellular delivery of a gene encoding the antibody.
  • a gene encoding a single chain antibody is used.
  • the antibody would contain a nuclear localization sequence (e.g. an SV40 nuclear localization signal).
  • Compounds that inhibit the activity of a regulatable protein may also be used.
  • Such compounds include small molecules, e.g., molecules that interact with the active site or a binding site of the protein, e.g., an ATP binding site or substrate binding site. Small molecules can also act as allosteric inhibitors of the protein. Such compounds may be identified according to methods known in the art.
  • Formulations may be any that are appropriate to the route of administration, and will be apparent to those skilled in the art.
  • the formulations may contain a suitable carrier, such as saline, and may also comprise bulking agents, other medicinal preparations, adjuvants and any other suitable pharmaceutical ingredients. Catheters constitute another mode of administration.
  • pharmaceutically acceptable refers to compounds and compositions which may be administered to mammals without undue toxicity.
  • exemplary pharmaceutically acceptable salts include mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like.
  • antibodies, nucleic acids or antagonists of the invention may be administered orally, topically, or by parenteral means, including subcutaneous and intramuscular injection, implantation of sustained release depots, intravenous injection, intranasal administration, and the like. Accordingly, antibodies or nucleic acids of the invention may be administered as a pharmaceutical composition comprising the antibody or nucleic acid of the invention in combination with a pharmaceutically acceptable carrier. Such compositions may be aqueous solutions, emulsions, creams, ointments, suspensions, gels, liposomal suspensions, and the like.
  • Suitable carriers include water, saline, Ringer's solution, dextrose solution, and solutions of ethanol, glucose, sucrose, dextran, mannose, mannitol, sorbitol, polyethylene glycol (PEG), phosphate, acetate, gelatin, collagen, Carbopol Registered TM, vegetable oils, and the like.
  • suitable preservatives, stabilizers, antioxidants, antimicrobials, and buffering agents for example, BHA, BHT, citric acid, ascorbic acid, tetracycline, and the like.
  • Cream or ointment bases useful in formulation include lanolin, Silvadene Registered TM (Marion), Aquaphor Registered TM (Duke Laboratories), and the like.
  • Other topical formulations include aerosols, bandages, and other wound dressings.
  • Other devices include indwelling catheters and devices such as the Alzet Registered TM minipump.
  • Ophthalmic preparations may be formulated using commercially available vehicles such as Sorbi-care Registered TM (Allergan), Neodecadron Registered TM (Merck, Sharp & Dohme), Lacrilube Registered TM, and the like, or may employ topical preparations such as that described in U.S. Pat. No. 5,124,155, incorporated herein by reference. Further, one may provide an antagonist in solid form, especially as a lyophilized powder. Lyophilized formulations typically contain stabilizing and bulking agents, for example human serum albumin, sucrose, mannitol, and the like. A thorough discussion of pharmaceutically acceptable excipients is available in Remington's Pharmaceutical Sciences (Mack Pub. Co.).
  • antibody, nucleic acid or inhibitor required to treat any particular disorder will of course vary depending upon the nature and severity of the disorder, the age and condition of the subject, and other factors readily determined by one of ordinary skill in the art.
  • the present invention provides methods for using a regulatable protein, e.g., IKK ⁇ , or an immunoreactive polypeptide thereof (or DNA encoding the protein or polypeptides) for immunotherapy of cancer in a patient.
  • a regulatable protein e.g., IKK ⁇
  • an immunoreactive polypeptide thereof or DNA encoding the protein or polypeptides
  • a patient refers to any warm-blooded animal, preferably a human.
  • a patient may be afflicted with a disease, or may be free of detectable disease.
  • the regulatable protein or an immunoreactive polypeptide thereof may be used to treat cancer or to inhibit the development of cancer.
  • the protein, polypeptide or DNA is generally present within a pharmaceutical composition and/or a vaccine.
  • Pharmaceutical compositions may comprise the full length protein or one or more immunogenic polypeptides, and a physiologically acceptable carrier.
  • the vaccines may comprise the full length protein or one or more immunogenic polypeptides and a non-specific immune response enhancer, such as an adjuvant, biodegradable microsphere (PLG) or a liposome (into which the polypeptide is incorporated).
  • a non-specific immune response enhancer such as an adjuvant, biodegradable microsphere (PLG) or a liposome (into which the polypeptide is incorporated).
  • the DNA may be introduced using a viral expression system (e.g., vaccinia or other pox virus, retrovirus, or adenovirus), which may involve the use of a non-pathogenic (defective), replication competent virus.
  • a viral expression system e.g., vaccinia or other pox virus, retrovirus, or adenovirus
  • Suitable systems are disclosed, for example, in Fisher-Hoch et al., PNAS 86:317-321, 1989; Flexner et al., Ann. N.Y Acad. Sci. 569:86-103, 1989; Flexner et al., Vaccine 8:17-21, 1990; U.S. Pat. Nos. 4,603,112, 4,769,330, and 5,017,487; WO 89/01973; U.S. Pat. No.
  • compositions and vaccines may be administered by injection (e.g., intracutaneous, intramuscular, intravenous or subcutaneous), intranasally (e.g., by aspiration) or orally. Between 1 and 10 doses may be administered over a 3-24 week period. In one embodiment, 4 doses are administered, at an interval of 3 months, and booster administrations may be given periodically thereafter. Alternative protocols may be appropriate for individual patients.
  • a suitable dose is an amount of polypeptide or DNA that is effective to raise an immune response (cellular and/or humoral) against tumor cells, e.g., kidney tumor cells, in a treated patient.
  • the regulatable protein or an immunogenic polypeptide thereof can be used in cell based immunotherapies, i.e. stimulation of dendritic cells with the regulatable protein or fusion with cells expressing the regulatable protein.
  • the modified dendritic cells once injected into the patient, are a cellular vaccine, where the dendritic cells activate an immune response against the cancer expressing the regulatable protein.
  • the type of carrier will vary depending on the mode of administration.
  • the carrier can comprise water, saline, alcohol, a fat, a wax and/or a buffer.
  • any of the above carriers or a solid carrier such as mannitol, lactose, starch, magnesium stearate, sodium saccharine, talcum, cellulose, glucose, sucrose, and/or magnesium carbonate, may be employed.
  • Biodegradable microspheres e.g., polyleptic galactide
  • suitable biodegradable microspheres are disclosed, for example, in U.S. Pat. Nos. 4,897,268 and 5,075,109.
  • non-specific immune response enhancers may be employed in the vaccines of this invention.
  • an adjuvant may be included.
  • Most adjuvants contain a substance designed to protect the antigen from rapid catabolism, such as aluminum hydroxide or mineral oil, and a nonspecific stimulator of immune response, such as lipid A, Bordella pertussis or Mycobacterium tuberculosis.
  • lipid A lipid A
  • Bordella pertussis or Mycobacterium tuberculosis lipid A
  • Such adjuvants are commercially available as, for example. Freund's Incomplete Adjuvant and Complete Adjuvant® (Difco Laboratories. Detroit, Mich.) and Merck Adjuvant 65® (Merck and Company, Inc., Rahway, N.J.).
  • H-RAS V12 immortalized human embryonic kidney (HEK) epithelial cells expressing hTERT, LT and ST (HAlE)
  • H-RAS V12 Hahn et al. (1999) Nature 436, 117-122
  • Activation of Ras stimulates many effector pathways including, but not limited to, the MAPK, PBK and RALGDS pathways (Downward (2003) Nat. Rev. Cancer 3, 11-22).
  • MAPK MAPK
  • PBK PBK
  • RALGDS pathways Downward (2003) Nat. Rev. Cancer 3, 11-22.
  • myr myristoylated
  • AKTl myr-AKT
  • shRNA short hairpin RNA
  • kinases To identify such kinases, a library of 354 human kinases and kinase-related open reading frames (ORFs), including 256 kinases, was cloned into Gateway®-compatible entry vectors (Rual et al., (2004) Genome Res. 14, 2128-2135). Because membrane recruitment via the addition of a myr sequence activates both the PDK pi 10a subunit and AKT (Klippel et al. (1996) MoI. Cell. Biol. 16, 4117-4127; Kohn et al. (1996) J. Biol. Chem.
  • pWN-MF-DEST a Gateway®-compatible retroviral destination vector, pWN-MF-DEST, was created which adds a myr sequence and a FLAG-epitope tag (MF) to each introduced ORF. It was confirmed that this destination vector and myr tag were functional (FIG7). Each ORF was subsequently transferred individually into p WN-MF-DEST (FIG2A).
  • Each of these kinase genes (AKTl, IKBKE, DAK, TSSK6 and CSNKlE) also induced tumor formation (FIG2D). Since it was previously shown that myr-AKT cooperates with MEKDD to transform these immortalized cells, the identification of AKTl in this screen validated this screening approach. Thus, using a library of myristoylated kinases in retroviral vectors, four novel kinases were identified that cooperate with activated MEKl to replace H-RAS V12 in human cell transformation.
  • Example 4- Consequences of suppressing IKBKE in breast cancer cells Because the findings described above implicate IKBKE as a breast cancer oncogene, the question of whether breast cancer cells are functionally dependent on IKK ⁇ expression was asked. The upregulated expression of many oncogenes renders cancer cells unusually dependent upon the continued function of the oncogene for cell proliferation or viability. This property of oncogenes, termed oncogene addiction, provides a rationale for targeting oncogenes therapeutically. To determine whether the presence of IKBKE amplifications and overexpression induces oncogene addiction, the effects of RNA interference (RNAi) targeting IKBKE and other genes were examined.
  • RNA interference RNA interference
  • RNAi The data generated in the high throughput RNAi was next examined in order screen was examined in order to determine whether any other kinase encoded within the Iq32 amplicon was similarly required for MCF-7 viability.
  • RNAi-mediated suppression of these other kinase genes failed to induce a statistically significant decrease in viability of MCF-7 cells (FIG4B).
  • Three of four shRNA targeting NUAK2 partially inhibited the proliferation of MCF-7 cells but failed to satisfy the criteria employed in the high throughput RNAi screen.
  • shRNA targeting each of these IKK family members were introduced into MCF-7, ZR-75 and PC3 cells. It was required that more than one shRNA construct targeting the gene to decrease viability and it was found that IKK ⁇ was the only IKK family member required for proliferation of ZR-75-1 cells, while both IKK ⁇ and TBKl were required for the proliferation of MCF-7 cells (FIG8). Suppression of TBKl, but not IKK ⁇ , inhibited the proliferation of PC3 cells.
  • IKK ⁇ in the innate immune response to viral infections, as it activates the interferon pathway in part by stimulating the activity of the transcription factor IRF3 (Fitzgerald et al. (2003) Nat. Immunol. 4, 491-496; Sharma et al. (2003) Science 300, 1148-1151). It was tested whether cells expressing IKBKE displayed evidence of increased IRF3 transcriptional activity and a 3-5-fold activation of the IRF3-responsibe interferon- regulated promoter element (ISRE) of the IFIT2 gene in HAlE-M cells expressing either the myr or WT allele of IKBKE (FIG9A) was found. HAlE-M and HMEC-M cells expressing these IKBKE alleles also showed increased transcription of two known interferon responsive genes, IFNB 1 and CCL5 (encoding RANTES) (FIG9B and FIG9C).
  • IRF3 interferon-regulated promoter element
  • IKBKE interferon-responsive promoters
  • IRF3-specific shRNA constructs were introduced into transformed HAlE-M cells expressing myr-IKBKE (FIG9D). Suppression of IRF3 failed to suppress AI growth (FIG9E).
  • IKBKE has also been reported to activate the NF- ⁇ B pathway (Peters et al. (2000) MoI. Cell 5, 513-522). It was therefore next determined whether the transforming activity of IKBKE is mediated by NF- ⁇ B.
  • IKBKE destabilized the cytoplasmic pool of I ⁇ B ⁇ .
  • HAlE-M cells expressing myr-IKBKE displayed a 43% reduction in cytoplasmic I ⁇ B ⁇ compared to levels observed in cells expressing a control vector (FIG5A and FIG5B).
  • I ⁇ B ⁇ was overexpressed in these IKBKE-expressing cells, increased I ⁇ B ⁇ protein expressed was not observed (FIG5C), indicating that IKK ⁇ effectively drives I ⁇ B ⁇ degradation.
  • I ⁇ B ⁇ degradation is the translocation of NF- ⁇ B transcription factors from the cytoplasm to the nucleus.
  • HAlE-M cells expressing myr- IKBKE displayed a 32% reduction in cytoplasmic NF- ⁇ B p50 (FIG5A and FIG5B), and 71% of these cells displayed nuclear NF- ⁇ B p50 compared to 8% in cells harboring a control vector (FIG5D and FIG5E). It was also tested whether overexpression of IKBKE induced NF- ⁇ B transcriptional activity. HAlE-M cells expressing myr-IKBKE exhibited a 5-fold higher level of NF- ⁇ B transcriptional activity compared to cells expressing a control vector, as assessed by measuring the activity of a synthetic NF- ⁇ B reporter gene (FIG5F).
  • IKBKE was initially identified as a kinase that replaced AKTl in cellular transformation (FIG2A). Since AKT has also been reported to activate the NF- ⁇ B pathway (Ozes et al. (1999) Nature 401, 82-85; Romashkova and Makarov (1999) Nature 401, 86-90), it was next determined if the NF- ⁇ B pathway is similarly required for AKT-dependent transformation. Introduction of the MUT I ⁇ B ⁇ allele increased the doubling time of HEK cells transformed by AKT (FIG5J) and suppressed AI growth by 73.9% (FIG5K). It was next examined whether IKBKE contributed to cell transformation induced by AKT.
  • c-REL was expressed at very low levels or was predominantly located in the cytoplasm in 12 of 13 (92%) of breast tumors that do not exhibit increased IKK ⁇ expression (FIG6D and FIG6E). This correlation between IKK ⁇ expression and nuclear localization of c-REL was statistically significant (p ⁇ 0.0084). Taken together, these observations demonstrated that IKK ⁇ activates the NF- ⁇ B pathway in braest cancer. Moreover, while the clinical evidence for IKBKE gain-of-function in cancer comes from the amplification or overexpression of this gene, IKBKE and other candidates were only scored in the oncogenic transformation assay using the myr-kinase library. Overexpression of the cDNA for IKBKE failed in the primary screen. No candidate gene was scored when either a cDNA or ORF library was tested in the primary screen, suggesting that activated kinase library provides more robust signals.
  • HEK cells Hahn et al. (1999) Nature 436, 117-122) and HMECs expressing hTERT (Elenbaas and Weinberg (2001) Exp. Cell Res. 264, 169-184) have been described.
  • retroviral pBabe, pWzl, pMKO
  • pLKO lentiviral
  • Retroviruses and lentiviruses were generated as described (Boehm et al., (2005) MoI. Cell. Biol. 25, 6464-6474; Moffat et al., (2006) Cell 124, 1283-1298). Growth conditions for HEK cells have been described (Hahn et al., (2002) MoI Cell. Biol, 22, 2111-2123). HMEC cells were maintained in 1:1 DMEM:F12 (Invitrogen Corp., Carlsbad, CA) supplemented with 10 ng/mL epidermal growth factor (Sigma-Aldrich, St. Louis, MO), 0.5 ⁇ g/mL hydrocortisone (Sigma- Aldrich, St. Louis, MO), and 10 ⁇ g/mL insulin (Sigma-Aldrich, St. Louis, MO). Tumor specimens and breast cancer cell lines were obtained as described (Yao et al., (2006) Cancer Res. 66, 4065-4078)
  • ORFs were cloned into Gateway® compatible pEntry vectors by performing site- specific BP recombination reactions as described (Rual et al., (2004) Genome Res. 14, 2128- 2135).
  • pWzl-Neo-Myr-Flag DEST (p WN-MF-DEST) was created by inserting an N-terminal myristoylation-FLAG tag and the Gateway® selectable cassette into the pWzl-Neo retroviral vector (Morgenstern and Land (1990) Nucleic Acids Res. 18, 3587-3596).
  • site-specific LR recombination reactions were performed individually, as described (Rual et al., (2004) Genome Res. 14, 2128-2135).
  • pBabe-GFP-Myr-Flag-PI3K 110a allele and pBabe- GFP-Myr-Flag-AKTl were created by introducing the Myr-Flag-PI3K 110a (Zhao et al., (2003) Cancer Cell 3, 483-495) or the Myr-Flag-AKTl allele (Ramaswamy et al. (1999) Proc. Natl. Acad. ScL USA 96, 2110-2115) into pBabe-GFP.
  • pBabe-Puro-RAS V12 has been described (Serrano et al. (1997) Cell 88, 593-602).
  • pBabe-Puro-Myr-FLAG-IKBKE, pBabe- Puro-Flag-IKBKE, pBabe-Neo-Myr-Flag-QCBKE and pBabe-Neo-Flag-IKBKE were generated by PCR cloning Myr-Flag-IKBKE or Flag-DCBKE from pWN-DEST-MF-IKBKE into pBabe-Puro or pBabe-Neo, and were fully sequenced.
  • MEKX)D Myr-Flag-IKBKE, Flag-IKBKE, and Myr-Flag-AKT were introduced into HAlE cells using pBabe-HcRed-MEKDD (FIG5) or pBabe-Puro-MEKDD (FIG2D), pBabe-Puro-Myr-Flag-IKBKE, pBabe-Puro-Flag-IKBKE and pBabe-GFP-Myr- Flag-AKTl and HMECs using pBabe-Puro-MEKDD, pBabe-Neo-Myr-Flag-IKBKE and pBabe-Neo-Flag-IKBKE.
  • MUT I ⁇ B ⁇ or wt I ⁇ B ⁇ pBabe-GFP-MUT I ⁇ B ⁇
  • FIG5C pBabe-Puro-MUT I ⁇ B ⁇ (FIG5J and FIG5K), or pBabe-GFP-wt I ⁇ B ⁇ (FIG5C) was used, which were created by cloning MUT I ⁇ B ⁇ or wt I ⁇ B ⁇ (gift from K. Steigmeier, Dana- Farber Cancer Institute) into pBabe-GFP or pBabe-Puro.
  • Retroviral infection Infections were performed serially by using drug selection or fluorescence-activated cell sorting to purify cell populations 48 hours after injection.
  • puromycin selection 2 ⁇ g/mL (HEK cells) or 0.5 ⁇ g/mL (HMEL cells) was used.
  • neomycin selection 150 ng/mL (HMEL cells) was used.
  • Immunoblotting was performed as described (Boehm et al., (2005) MoI. Cell. Biol. 25, 6464-6474). The following antibodies were used: anti-IKK ⁇ C-14 (Santa Cruz Biotech, Inc., Santa Cruz, CA) or anti-IKK ⁇ c-terminal (Sigma-Aldrich, St.
  • NFKBIA forward; 5 '-GCCTGGACTCCATGAAAGAC-3' , reverse; 5'- GACACGTGTGGCCATTGTAG-3'
  • MYC forward; 5'-TTCGGGTAGTGGAAAACCAG-3', reverse; 5'- CAGCAGCTCGAATTTCTTCC-3'
  • PTGS2 forward; 5'-TGAGCATCTACGGTTTGCTG-3', reverse; 5'-
  • ILIA forward; 5'-AATGACGCCCTCAATCAAAG-3', reverse; 5'-
  • VEGF forward; S'-CCCACTGAGGAGTCCAACAT-3', reverse; 5'-
  • BIRC2 forward; 5'-CCAGGTCCCTCGTATCAAAA-3', reverse; 5'- AAACCAGCACGAGCAAGACT-3'
  • BCL2 forward; 5'-GAGGATTGTGGCCTTCTTTG-3' , reverse; 5'-
  • IFNBl forward; 5'-ACTGCCTCAAGGACAGGATG-3', reverse; 5'-
  • SYBR-Green Applied Biosystems, Foster City, CA.
  • Bacterial artificial chromosome (BAC) clone CTD 2229G19 containing IKBKE Bacterial artificial chromosome (BAC) clone CTD 2229G19 containing IKBKE (Invitrogen Corp., Carlsbad, CA) was labeled with digoxigenin (Roche Diagnostics Corp., Indianapolis, IN) using the enzyme mix from the BioNick labeling kit (Invitrogen Corp., Carlsbad, CA) as described (Zhao et al. (1995) MoI. Cell. Biol. 15, 4353-4363). The probe was detected according to the manufacturer's recommendations (Cytocell Technologies Ltd.,
  • pLKO.l lentiviral shRNA constructs generated by TRC were used. Lentiviral infections were performed as described (Moffat et al. (2006) Cell 124, 1283-1298).
  • Cell Titer GIo Promega Corp., Madison, WI was used to measure viability 5 days after lentiviral infection.
  • shRNA specific for the following IRF3 seuqences using pLKO.l lentiviral vectors were introduced: shIRF3 #l: CCCTTCATTGTAGATCTGATT shIRF3 #2: GCCAACCTGGAAGAGGAATTT
  • shRNA specific for the following IKBKE sequences using pLKO.l lentiviral vectors were introducted (Moffat et al. (2006) Cell 124, 1283-1298): shIKBKE #3: TGGGCAGGAGCTAATGTTTCG shIKBKE #4: GTCCTTAGTCACACACGGCAA shIKBKE #5: GAGCATTGGAGTGACCTTGTA N. Reporter Assays
  • NF- ⁇ B or interferon reporter assays 3x10 4 cells were seeded in triplicate in 24- well plates. 12 hours after seeding, 100 ng of pNF- ⁇ B-luciferase (BD Biosciences) or pISRE- luciferase (Stratagene) plus 500 ng renilla-encoding plasmid (pRL-TK, gift from L. Poling, Dana-Farber Cancer Institute) was transfected in triplicate using Fugene (Roche), Media was replaced after 6 hours, and luciferase and renilla signals were measured 24 hours after transfection using the Dual Luciferase Reporter Assay Kit (Promega).
  • pNF- ⁇ B-luciferase BD Biosciences
  • pISRE- luciferase pISRE- luciferase
  • pRL-TK 500 ng renilla-encoding plasmid
  • kinase libraries described herein to identify kinases and signaling pathways that establish resistance to PDK inactivation.
  • the screens using the kinase libraries employ cells that harbor a specific knockout of PIK3CA, which is the PD Kinase catalytic subunit which uses ATP to phosphorylate phosphatydinositol molecules.
  • PIK3CA is the PD Kinase catalytic subunit which uses ATP to phosphorylate phosphatydinositol molecules.
  • Akt, Raf, MATK and MAP3K8 kinases
  • MAP3K8 kinases
  • Akt, Raf, MATK and MAP3K8 a number of kinases, e.g. Akt, Raf, MATK and MAP3K8 that could drive oncogenic transformation of these cells even when PIK3CA is inactivated, providing a potential resistance mechanism for PDK inhibitors in cancer treatment.
  • PIK3CA is frequently mutated in many types of human cancer and these mutations are oncogenic.
  • PDK inhibitors are being developed to target cancers carrying PIK3CA mutations.
  • these cancer cells also harbor activated Akt, Raf, MATK or MAP3K8, they may not respond to PDK inhibitors and combination therapy may be proposed.
  • TeI-HLH helix-loop-helix domain of the Tel transcription factor
  • TKs tyrosine kinases
  • the human genome contains roughly 90 tyrosine kinases (TKs). Since most TKs are not efficiently activated by myrsitoylation, but can usually be activated by dimerization, a ligand-independent dimerization system was employed to make chimeric proteins that contain TKs fused at their C-termini to the TeI-HLH domain (FIGlO).
  • TeI-HLH was isolated as an element fused to PDGR in patients with chronic myelomonocytic leukemia.
  • the HLH domain of the transcription factor Tel mediates the dimerzation of the Tel/PDGFR fusion protein and leads to the constitutive activation of PDGFR, resulting in cellular transformation (Carroll et al, (1996) Proc. Natl. Acad. Sci. U.S.A. 93:14845-14850). Similar to the construction of myristoylated kinase library as described in Example 6, a retroviral-based, Gateway-compatible DEST-vector containing elements encoding HLH domain of Tel fused in frame with a Flag-epitope, pWN-TelF-DEST was constructed.
  • TKs expressed from pWN-TelF-DEST vector feature a full-length protein kinase fused in frame with the TeI-HLH domain and a Flag epitope.
  • TeI-TK clones were introduced into 293T cells, which were then starved for growth factors and lysed. The resulting lysates were then analyzed by western blotting. The blots were developed with Flag antibodies to check for protein expression and with the 4G10 antibody to assess for tyrosine phosphorylation of these TeI-TKs (FIGIl).
  • ACVRL1 activin A receptor type ll-tike 1 132 ADK adenosine kinase 156 ADRBK1 adrenergic, beta, receptor kinase 1 157 ADRBK2 adrenergic, beta, receptor kinase 2
  • AKT2 v-akt murine thymoma viral oncogene homolog 2 238 ALK anaplastic lymphoma kinase (Ki-1 ) 269 AMHR2 anti-Mullerian hormone receptor, type Il 369 ARAF 1 v-raf murine sarcoma 3611 viral oncogene homolog 1 472 ATM ataxia telangiectasia mutated (includes complementation groups A, C and D) 545 ATR ataxia telangiectasia and Rad3 related 558 AXL AXL receptor tyrosine kinase 613 BCR breakpoint cluster region 640 BLK B lymphoid tyrosine kinase
  • CDK7 cyclin-dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk-activating kinase)
  • CDK9 cyclin-dependent kinase 9 (CDC2-related kinase) 1111 CHEK1 CHK1 checkpoint homolog (S. pombe) 1119 CHKA choline kinase alpha 1120 CHKB choline kinase beta 1147 CHUK conserved helix-loop-helix ubiquitous kinase 1152 CKB creatine kinase, brain 1158 CKM creatine kinase, muscle 1159 CKMT1 creatine kinase, mitochondrial 1 (ubiquitous) 1160 CKMT2 creatine kinase, mitochondrial 2 (sarcomeric) 1163 CKS1B CDC28 protein kinase regulatory subunit 1B 1164 CKS2 CDC28 protein kinase regulatory subunit 2 1195 CLK1 CDC-like kinase 1 1196 CLK2 CDC-hke kinase 2
  • MAPK 1432 MAPK 14 mitogen-activated protein kinase 14 colony stimulating factor 1 receptor, formerly McDonough feline sarcoma viral (v-fms)
  • DLG3 discs large homolog 3 (neuroendoc ⁇ ne-dlg, Drosoph ⁇ la),DLG3 1760 DMPK dystrophia myotonica-protein kinase
  • FGFR1 fibroblast growth factor receptor 1 (fms-related tyrosine kinase 2, Pfeiffer syndrome)
  • FGFR3 fibroblast growth factor receptor 3 (achondroplasia, thanatophoric dwarfism) fibroblast growth factor receptor 2 (bacteria-expressed kinase, keratmocyte growth factor receptor, craniofacial dysostosis 1 , Crouzo ⁇ syndrome, Pfeiffer syndrome, Jackson-
  • GTF2H1 general transcription factor HH, polypeptide 1 , 62kDa;GTF2H1
  • JAK3 Janus kinase 3 (a protein tyrosine kinase, leukocyte)
  • MPP3 membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3);MPP3 4486 MST1R macrophage stimulating 1 receptor (c-met-related tyrosine kinase)
  • PAK1 p21/Cdc42/Rad -activated kinase 1 (STE20 homolog, yeast)
  • PDGFRL platelet-derived growth factor receptor-like.PDGFRL 5159 PDGFRB platelet-derived growth factor receptor, beta polypeptide
  • PRKAB2 protein kinase 5565 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 5566 PRKACA protein kinase, cAMP-dependent, catalytic, alpha
  • PRKAR1A protein kinase 5573 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1)
  • PRKAR2A protein kinase 5576 PRKAR2A protein kinase, cAMP-dependent, regulatory, type II, alpha
  • RNASEL ribonuclease L (2',5'-ol ⁇ go ⁇ soadenylate synthetase-dependent)
  • TEK tyrosine kinase endothelial (venous malformations, multiple cutaneous and
  • TGFBR1 transforming growth factor beta receptor I (activin A receptor type ll-like kinase, 53kDa)
  • TGFBR3 transforming growth factor, beta receptor III (betaglycan, 300kDa);TGFBR3 7075 TIE1 tyrosine kinase with immunoglobulin-like and EGF-like domains 1
  • PDXK pyridoxal pyridoxine, vitamin B6
  • kinase 8569 MKNK1 MAP kinase interacting serine/threonine kinase 1
  • NME7 non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase)
  • FASTKD5 FAST kinase domains 5.FASTKD5

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Microbiology (AREA)
  • Molecular Biology (AREA)
  • Pathology (AREA)
  • Analytical Chemistry (AREA)
  • Immunology (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Biomedical Technology (AREA)
  • Oncology (AREA)
  • Bioinformatics & Computational Biology (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Hospice & Palliative Care (AREA)
  • Plant Pathology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)

Abstract

Provided herein are nucleic acids, proteins, vectors, cells, kits, devices and methods useful for identifying regulatable proteins that are able to complement components of cellular signaling pathways. Also provided are compositions and methods using these complementing genes directly as markers for cancer diagnosis or prognosis and as targets for anti-neoplastic therapeutics. Further provided are methods for using changes caused by expression of the complementing genes to indirectly identify associated genes to be used as markers for cancer diagnosis or prognosis and as targets for anti-neoplastic therapeutics.

Description

COMPOSITIONS AND METHODS FOR IDENTIFYING TRANSFORMING AND
TUMOR SUPPRESSOR GENES
Related Applications This application claims the benefit of U.S. Provisional Application Serial No.
60/927,066 filed on May 1, 2007; the entire contents of the application is incorporated herein by reference.
Statement of Rights This invention was made with government support under Grants KOl CA94223, P50
CAl 12962, CA30002, CA89021 and CA015607 awarded by the National Institutes of Health and BC051565 awarded by the Department of Defense. The government has certain rights in the invention.
Background of the Invention
Cancer is one of the leading causes of death in the United States. Each year, more than half a million Americans die from cancer and more than one million are newly diagnosed with the disease. Cancer develops from normal tissues through a stepwise accumulation of genetic mutations that causes a cell to escape from its normal growth regulatory mechanisms and proliferate in an uncontrolled manner. Tumor cells can metastasize to secondary sites if treatment of the primary tumor is either incomplete or not initiated before the disease progresses substantially. Early diagnosis and effective treatment of tumors are therefore essential for survival.
Cancer involves the clonal replication of cell populations that have gained a competitive advantage over normal cells through the alteration of regulatory gene expression. Regulatory genes can be broadly classified into two categories including "oncogenes" which, when activated or overexpressed, promote unregulated cell proliferation and "tumor suppressor genes" which, when inactivated or underexpressed, fail to prevent abnormal cell proliferation. A handful of oncogenes have been identified that, when abnormally activated, are involved in the initiation or progression of human cancers. Known oncogenes include, for example, Myc, Ras, Src, and HER2. Similarly, a handful of tumor suppressor genes have been identified that, when inactivated, are involved in the initiation or progression of human cancers. Known tumor suppressor genes include, for example, RB, p53, DCC, APC/MCC, NFl, NF2, WTl, VHL, BRCAl, MSTl and WAF1/CIP1. In contrast to the small handful of characterized oncogenes and tumor suppressor genes, the recent completion of the human genome sequence has revealed the existence of upwards of 30,000 genes that may contain critical, unidentified oncogenes and tumor suppressor genes. For example, protein kinases are just one family of signaling pathway regulators whose members are known to cause malignant transformation when dysregulated. It is now appreciated that the total complement of human protein kinases is encoded by greater than 500 genes, making them the most populated class of potential draggable cancer targets.
Despite the potential for discovering critical oncogenes and tumor suppressor genes that the human genome has allowed, the route to realizing this potential has been blocked by the fact that most human cancers, particularly epithelial cancers, exhibit global genomic alterations and karyotypic abnormalities that make it difficult to identify specific mutations critical for cell transformation. Moreover, abundant evidence suggests that multiple mutations are required to program the transformed phenotype. These facts underscore the importance of dissecting the molecular interactions taking place in cells as they develop increasing numbers of mutations. There exists a need, therefore, both to identify novel oncogenes and tumor suppressor genes and to dissect and better characterize the interactions among members of each class.
Summary of the Invention
This invention relates generally to compositions and methods useful for the dissection of signal transduction pathways that cause oncogenesis in humans and, more specifically, for the identification of genes that modulate cellular transformation that are both physiologically relevant to human cancers and therapeutically attractive for cancer treatment. Described herein are methods that comprise an essential tool to identify oncogenes and tumor suppressor genes.
Provided herein are compositions comprising one or more nucleic acids encoding one or at least two regulatable proteins, each linked to one or more regulatory signals, wherein expression of the regulatable proteins in a cell results in the regulatable protein being regulated, e.g., constitutively regulated. The one or more nucleic acids may encode at least 1, 2, 3, 5, 10 or more regulatable proteins. A regulatable protein may be a kinase, e.g., in Table 1, or a biologically active fragment thereof, such as an intracellular domain, e.g., a catalytic domain. The regulatable proteins or biologically active portions thereof may be linked to an activation signal, such as a membrane targeting signal, e.g., a myristoylation signal. This signal may be linked to the N- or C-terminus of the kinases or biologically active portions thereof. Li one embodiment, the kinase is a receptor tyrosine kinase that is linked to a membrane targeting signal.
A regulatable protein may also be linked to an activation signal that is an oligomerization, e.g., dimerization domain. The dimerization domain may be an inducible dimerization domain, e.g., a dimerization domain that is induced to dimerize in the presence of a small molecule. The oligomerization domain may be linked to the N- or C-terminus of the kinases or biologically active portions thereof. A regulatable protein may be linked to both a membrane targeting signal and an oligomerization domain. A regulatable protein may further be linked to a detectable peptide, such as a FLAG tag. At least one regulatable protein may be linked directly to one or more regulatory signals. At least one regulatable protein may be linked to one or more regulatory signals through a linker.
One or more nucleic acids may comprise one or more strong transcriptional regulatory sequences controlling the expression of the regulatable proteins. The nucleic acids may be in an expression vector, e.g., a viral expression vector. hi certain embodiments, a composition comprises a reagent for introducing the composition into a cell. In certain embodiments, a composition is in contact with or within a cell. A cell may be an immortalized non-tumorigenic cell. A cell may be a human cell. A composition may also comprise at least 1, 2, 5, 10 or more nucleic acids, wherein each nucleic acid encodes a regulatable protein linked to one or more regulatory signals. A composition may also comprise a library of nucleic acids encoding regulatable proteins linked to one or more regulatory signals.
Also provided are kits, e.g., kits comprising a nucleic acid encoding a regulatable protein linked to one or more regulatory signals and packaging for said kit. Also provided are devices, e.g., devices comprising a location, wherein the location comprises a nucleic acid encoding a regulatable protein linked to one or more regulatory. A device may be a multiwell device and the location may be a well.
Further provided are compositions comprising one or more nucleic acids encoding one or at least two inhibitory mutants of proteins, wherein expression of the inhibitory mutants in a cell downregulates one or more biological activities associated with the corresponding wild- type proteins. At least one protein may be a kinase, a phosphatase, an acetylase, or a deacetylase. At least one inhibitory mutant of a protein may be a dominant negative mutant of the protein, a deletion mutant of the protein, a protein comprising a substitution of one or more amino acids, e.g., wherein one or more substitutions of amino acids results in a change in posttranslational modification of the protein. One or more substitutions of amino acids may result in a change in a posttranslational modification of the protein, such as acetylation, glycosylation or phosphorylation. The following exemplary methods are also encompassed. A method comprising contacting one or more cells with a composition comprising one or more nucleic acids or proteins encoded thereby. The cells may be contacted with the composition under conditions in which at least some of the nucleic acids of the composition are taken up by the cells. The cells may be immortal but not tumorigenic cells. The cells may comprises one or more of the following genes and oncogenes or proteins including, but not limited to: the catalytic sub unit of telomerase (hTERT), telomerase, human papilloma virus E6, Human papilloma virus E7, cyclin Dl, an R24C form of CDK4 (CDK4R24C), p53DD, MYC, phosphatidylinositol-3- kinase, adenovirus early region IA (ElA), E6, E7, MDM2, SV40 large T antigen, SV40 small T antigen, RAC/RHO, PDK, AKT, RAF, MEK, MEKDD, MAPK, RAL-GEFs, RAL, PLDl, H-RAS, an activated allele of H-RAS (H-RASV12), ALT, CycDl/CDK4, or variants or fragments thereof that may be oncogenic or other such genes known in the art. The cells may also comprise one or more inactivated or inhibited tumor suppressor genes or proteins, including, but not limited to: p53, retinoblastoma (Rb), PP2A, pl9ARF, pl6iNK4A or PTEN tumor suppressor genes or variants or fragments thereof that maybe tumor suppressors or other such genes known in the art. Quasi-transformed cells may also comprise a combination of one or more oncogenes and one or more inactivated tumor suppressor genes. The method may further comprise determining whether the cells contacted with the composition are tumorigenic. This may comprise determining whether the cells contacted with the nucleic acids grow in an anchorage-independent manner and/or promote tumor formation in animal hosts. In one method, the cells require a growth factor, e.g., IL-3, for growth and the method further comprises determining whether the cells contacted with the composition grow independently of the growth factor.
Also provided herein are methods for determining whether a subject has or is likely to develop a disease or disorder, e.g. cancer, associated with a regulatable protein identified herein. A method may comprise determining the level of the regulatable protein, e.g., IKKε, in a sample of a subject, wherein a higher or lower level and/or activity of the regulatable protein in the sample of the subject relative to that in a control indicates that the sample is or may become cancerous. A method may also comprise determining the expression level of the regulatable protein in a tissue in a subject, wherein the presence of a higher or lower level of the regulatable protein in the tissue relative to a control indicates that the subject has or may develop cancer. Determining the level of the regulatable protein may comprise (i) determining the protein level of the regulatable protein, e.g., by immunohistochemical staining or by activity such as a phosphorylation assay ; (ii) determining the level of RNA encoding the regulatable protein, e.g., by Northern blot or quantitative PCR; and/or (iii) detecting changes in copy number of genomic loci encoding the regulatable protein, e.g. by array comparative genome hybridization or fluorescence in situ hybridization. A control may be the level of the regulatable protein in non-cancerous cells of the same origin as those of the potentially cancerous tissue sample. The potentially cancerous tissue sample may be a cancerous tumor. The method may further comprise first obtaining a biopsy of a tissue sample of the subject.
Other methods provided herein are methods for monitoring the progression of a cancer in a subject. A method may comprise monitoring the level of a regulatable protein, e.g., IKKε, in a cancerous tumor of the subject over time, wherein an increase or decrease in the level of the regulatable protein in a cancerous tumor of the subject indicates that the cancer is progressing.
Further provided herein are kits, e.g., kits comprising one or more agents for detecting the level of a regulatable protein, e.g., IKKε. A kit may also comprise a control. A control may be the level of the regulatable protein in a cancerous tumor or in a tissue of a healthy subject. The agent for detecting the level of the regulatable protein may be an antibody or a variant, e.g., a fragment, thereof. The agent for detecting the level of the regulatable protein may also comprise reagents necessary to detect the protein of the regulatable protein, the RNA encoding the regulatable protein and changes in copy number of genomic loci encoding the regulatable protein. Therapeutic methods are also provided herein. An exemplary method for treating a subject having a cancer associated with abnormal levels or activity of a regulatable protein, e.g. high levels of IKKε, relative to an appropriate control, comprises administering to the subject a therapeutically effective amount of an agent that modulates the level of the regulatable protein, e.g.. reduces the level of IKKε.
Brief Description of the Drawings
FIG.l is a graph showing that activated MEKl and AKTl can cooperate to replace H- RAS in causing anchorage-independent microscopic/macroscopic colonies and tumor formation. Anchorage-independent microscopic colonies (100 μm-200 nm, grey bars), macroscopic colonies (>200 nm, blue bars) and tumor formation (number of tumors formed/tumor sites injected) are shown for HEK cells expressing hTERT, the SV40 ER, and the indicated genes. Error bars represent the mean±standard deviation for 3 independent experiments. FIGS.2A-C show the results of identifying putative oncogenes using a myristoylated kinase library. FIG2A is a schematic diagram outlining the library generation and screening strategies. FIG2B is a graph showing AI growth of pools named by their plate number (1-5) and row (A-H). (-) and GFP indicate the number of colonies produced by mock- and GFP- vector-infected cells, respectively. Black line and red dotted line indicate the median and 2 standard deviations above the median, respectively. FIG2C is a graph identifying putative kinase oncogenes from top scoring pools. Erorr bars indicate the mean±standard deviation for 3 independent experiments. FIG2D shows tumor formation by IKBKE in HAlE-M cells. Tumorigenicity is indicated as the number of tumors formed/number of tumor sites injected and shown above the bars for each cell line. FIGS3A-F show that IKBKE is amplified in breast cancer cell lines and patient- derived tumor samples. FIG3A shows analysis of the IKBKE locus by single nucleotide polymorphism (SNP) arrays in 49 breast cancer cell lines. Colorgrams representing SNP copy number at Iq32 are shown. Red indicates allelic gain, while blue denotes allelic loss. FIG3B shows clustering of array comparative genome hybridization (aCGH) data based on chromosome 1 copy number gain of 30 breast primary tumors. Colored rectangles indicate tumor grade (red- high, purple- intermediate, and blue- low grade) and lymph node (LN), estrogen receptor (ER), or HER2 status (red- positive, blue- negative, and gray- unknown). FIG3C shows fluorescence in situ hybridization (FISH) analysis of IKBKE amplification in UACC-812, ZR-75-1 and MCF-7 breast cancer cell lines and BWH-Tl 8 primary breast tumor. Green signal indicates hybridization using an IKBKE-specific BAC probe, while red color indicates hybridization using a chromosome 1 -specific alpha satellite DNA probe (left panels) or chromosome 1 painting probe (right panels). FIG3D shows quantiative RT-PCR (qRT-PCR) analysis of EKBKE expression in breaset cancer cell lines and patient samples. Carcinomas and cell lines are color-coded to indicate presence of amplified Iq32 (blue- non- amplified, red- amplified). Asterisks (*) indicate patient samples with corresponding aCGH data in FIG 3B. Raw values were normalized to RPL39 levels determined in parallel. Fold changes are referenced to values obtained with the normal sample with the highest IKBKE expression, N050702. FIG3E shows immunoblotting for IKKε. Using the K-14 anti-IKKε antibody (Santa Cruz), immunoblot in left panel compares breast cancer and immortalized breast cell lines lacking IKBKE copy number gain (MCFlOA, MCF10A.DCIS.COM) to breast cancer cell lines with low levels of IKBKE (MCF-7, MDA-MB-231) and the middle immunoblot compares breast cancer cell lines harboring different levels of IKBKE copy number gain. The immunoblot on the right was performed with a different anti-IKKε antibody (Sigma C-terminal). FIG 3F shows AI growth of HMEC-M cells harboring either a control vector (vector) or myr-IKBKE. Bar represents 2mm. Colony number reflects large macroscopic colonies (>1 mm). FIG3G shows immunblotting for IKKε in the indicated breast cancer cell lines or HMEC-M cells expressing myr- or wild-type IKBKE.
FIGS4A-D show that IKBKE is an essential kinase in breast cancer cells. FIG4A shows that IKBKE is essential for MCF-7 cell viability. Lower panels show IKKε expression in MCF-7 cells expressing IKBKE-specific shRNAs or a control shRNA targeting GFP (shGFP). FIG4B shows the effects of suppressing kinase genes located at Iq32. MCF-7 cells were infected with shRNA constructs (5/gene) targeting 10 kinases (ETNK2, PIK3C2B, RIPK5, DYRK3, IKBKE, MAPKAP2, PCTK3, PFKFB2, NUCKSl and NUAK2) located at Iq32. Solid line represents the median, dotted lines indicate 1 and 1.5 SD below the median. shRNA targeting IKBKE (red), NUAK2 (blue), PFKFB2 (yellow), and ETNK2 (black) or the other genes (gray) are shown. FIG4C shows the effects of IKKε suppression on viability. Representative micrographs obtained 5 days after infection with the indicated shRNA are shown. FIG4D shows the effects of IKKε suppression on proliferation. Cells were plated on day 0, infected with IKBKE shRNA 24 hours later and cumulative cell numbers determined for 11 days. The doubling time for each cell line was determined and then normalized to cells expressing a control, scrambled shRNA (shScr). Expression of IKKε is shown in lower panels for the indicated cell lines.
FIGS5A-D show that IKBKE activates the NF-κB pathway in transformation models. FIG5A and FIG5B show the effects of IKKε expression on IκBα stability. Cytoplasmic IκBα levels in HAlE-M cells are shown and quantified. FIG5C shows RT-PCR and immunoblot (Western blot) analysis of IκBα overexpression. MUT: IκBα super-repressor, wt: wt IκBα allele. FIG5D and FIG5E show localization of NF-κB p50. The antibody used here detects both NF-κB p50 and the NF-κB p50 precursor (pi 05). FIG5F shows NF-κB reporter activity in the indicated cell lines. FIG5G shows changes in expression of selected NF-κB-regulated genes in HAlE-M cells harboring either a control vector (-) or myr-IKBKE (+). FIG5H shows changes in expression of selected NF-κB-regulated genes in HMEC-M cells harboring either a control vector (-) or WT IKBKE (+). FIG5I shows an analysis of cyclin Dl protein levels in HAlE cells expressing MEKDD and/or the indicated genes. FIG5J and FIG5K show the effects of expressing MUT IκBα on the doubling time (FIG5J) and AI growth (FIG5K) of HAlE-M cells expressing either myr-DCBKE or myr-AKT. FIG5L shows the effects of suppressing IKBKE on AI growth of AKT-transformed cells. (-) indicates control cells. FIGS6A-E show that IKBKE activates the NF-κB pathway in breast cancer. FIG6A shows downregulation of NF-κB target genes in ZR-75-1 breast cancer cells after DCBKE suppression as determiend by quantitative RT-PCR. FIG6B and FIG6C show the relative expression of MMP9 (FIG6B) and BCL2 (FIG6C) in breast cancer cell lines that harbor (UACC-812, ZR-75-1, MCF-7) or lack (SUM52) IKKε gain or amplification. UACC-812 cells do not express BCL2. FIGD and FIG6E show examination of IKKε overexpression and NF-κB pathway activation in primary breast cancer specimens. FIG6D shows representative IHC staining and scoring used to assess IKKε and nuclear c-REL expression. 0:no staining, l:low staining, 2:moderate staining, 3. 'high staining. FIG6E shows co- expression of IKKε and nuclear c-REL. Each point represents one breast cancer specimen, p values were determined by Fisher's exact test.
FIGS7A-B shows the results of p WN-MF-DEST vector validation. FIG7A shows the efficiency of retroviral infection of Gateway®-compatible retroviral vectors. HAlE cells were infected with pBabe-GFP (green bars-left) or pBabe-YFP (yellow bars-left) constructs. pWN-MF-DEST-YFP and pWN-MF-DEST-GFP were created by performing site-specific LR recombination reactions between pEntry-YFP or pEntry-GFP and pWN-MF-DEST. HAlE cells were infected with pWN-MF-DEST-GFP (green bars-right) and p WN-MF- DEST-YFP (yellow bars-right). The percentage of GFP- or YFP -positive cells was determined by fluorescence activated cell sorting after a single retroviral infection. FIG7B shows localization of ORFs expressed by pWN-MF-DEST. 293T cells were transfected with pBabe-GFP control vector or p WN-MF-DEST-GFP. GFP in this experiment occupies the position of a kinase ORF. Micrographs depict membrane localization of GFP, confirming that the myristoylation tag is in frame and functional.
FIG8 shows the effects of suppressing the expression of IKK family members. ZR- 75-1, MCF-7 or PC3 cells were infected with shRNA constructs targeting IKBKA (IKKα), IKBKB (IKKβ), IKBKG (IKKγ, NEMO), IKBKE, and TBKl and viability was determined. Analysis and dotted lines as in FIG4B. shRNAs are color coded according to their target {IKBKE-red, TBKl-teal, IKBKA-black, IKBKB-gold, IKBKG-green). Relative viability was calculated by normalizing to luminescence scores obtained from the mean of 7 parallel cultures infected with control shRNA constructs (targeting GFP). To determine if a given gene was essential it was required that more than one shRNA construct targeting the gene decreased viability. Essential genes are indicated below each cell line.
FIGS9A-9E show that IKBKE activates the interferon pathway. FIG9A shows the activity of the IRF3 -responsive interferon-regulated promoter element (ISRE) derived from the IFIT2 gene encoding ISG54 in HAlE-M cells harboring either a control vector or vectors encoding myr-IKBKE or WT IKBKE. FIG9B and FIG9C show quantitative PCR analysis of interferon regulated genes, IFNBl and CCL5, in HAlE-M cells expressing myv-IKBKE (FIG9B) or HMEC-M cells expressing WT IKBKE (FIG9C). Raw values were normalized to GAPDH and to cells expressing a control vector. FIG9D shows suppression of IRF3 in IKBKE-expressing cells by two /RF-5-specific shRNA (shIRF3-#l , shIRF3-#2). FIG9E shows effects of suppressing IRF3 on IKBKE-induced transformation. AI colony formation for HAlE-M cells expressing myr-IKBKE plus shIRF3-#l or shIRF3-#2. (-) indicates mock- infected cells. Error bars in A, B, and E represent mean ± SD for 3 independent experiments. FIGSl OA-I OB show a depiction of kinase activation by either myristoylation or dimerization. FIGlOA shows a schematic diagram illustrating how kinase can be activated by either myristoylation or dimerization. FIGlOB shows activation of cRaf, a serine/threonine kinase, by either a myristoylation or Tel tag.
FIGS11A-11B show a depiction of kinase activation mediated by fusions with TEL- domains. FIGIlA shows a schematic diagram of ligand-independent dimerization of receptor tyrosine kinases (RTKs) mediated by Tel-domains. FIGIlB shows the expression and activation of PDGFRβ-Tel and FGFRl-TeI under growth factor free conditions. Antibody 4G10 specifically recognizes phospho-Tyrosine.
Detailed Description of the Invention The present invention pertains, at least in part, to compositions comprising a library of nucleic acids encoding regulatable proteins, e.g., kinase and kinase related proteins or biologically active portions thereof, optionally linked to one or more regulatory signals, wherein expression of the regulatable proteins or biologically active portions thereof in a cell results in the regulatable protein or biologically active portion thereof being regulated. Provided herein are nucleic acids, proteins, vectors, cells, kits, devices and methods for identifying genes that are able to complement genes in signaling pathways (e.g. PI3K signaling). Also provided are methods using these complementing genes directly as markers for cancer diagnosis or predisposition and as targets for anti-neoplastic therapeutics. Further provided are methods for using changes caused by expression of the complementing genes to indirectly identify associated genes to be used as markers for cancer diagnosis or predisposition and as targets for anti-neoplastic therapeutics.
Various aspects of the invention are described in further detail herein.
I. Regulatable Proteins
Described herein are compositions comprising one or more nucleic acids encoding one or at least two regulatable proteins linked to one or more regulatory signals, wherein expression of the regulatable proteins in a cell results in the regulatable protein being regulated. Compositions may comprise one or more nucleic acids encoding at least about 1 , 2, 3, 4, 5, 10, 20, 50, 100, 200, 300, or 500 or more regulatable proteins. In one embodiment, a composition may comprise a library of nucleic acids encoding regulatable proteins, or pools of nucleic acids thereof. A pool of nucleic acids may encode about 5-10, 10-20, 10-30 or more regulatable proteins.
In one embodiment, each regulatable protein is encoded by a separate nucleic acid. For example, a composition may comprise at least aboutl, 2, 3, 4, 5, 10, 20, 50, 100, 200, 300, or 500 nucleic acids, wherein each nucleic acid encodes one regulatable protein. As further discussed below, the nucleic acids do not need to be in one composition, hi particular, each member of a library of nucleic acids may be physically separated from the other members, e.g., by being present in a well of a multiwell plate. In one embodiment, each member of a library of nucleic acids encoding regulatable proteins is present in a separate well from the other nucleic acids of the library.
Also provided herein are compositions comprising one or more regulatable proteins linked to one or more regulatory signals. A composition can comprise at least about 1, 2, 3, 4, 5, 10, 20, 50, 100 or more proteins. A composition may comprise a library of regulatable proteins or pools of proteins thereof. A pool of proteins may comprise about 5-10, 10-20, 10- 30 or more proteins. The members of the library do not need to be in a composition. Each member of the library may be in a separate vial or well of a multiwell dish.
A "regulatable protein" refers to a protein whose activity can be regulated, e.g., by targeting the protein to the cell membrane or by oligomerization. A regulatable protein may be a naturally occurring protein, or a protein that is not naturally occurring, e.g., one which differs from the naturally occurring form by one or more amino acid deletions, additions or substitutions. A regulatable protein may be a biologically active fragment of a naturally occurring regulatable protein. In one embodiment, a regulatable protein is a protein that is involved in a signal transduction pathway. As it is known in the art, a signal transduction pathway is a system within a cell that transmits information from outside the cell to the cell nucleus, resulting in a change in the expression of one or more genes. Signal transduction pathways involve the interactions of protein factors that regulate enzymatic activities (e.g., phosphorylation, phosphatase and protease activity) or the association of signal transducing factors with other factors in a cascade of interactions, wherein the cascade serves to amplify and/or direct a signal to a particular set of genes.
In one embodiment, a regulatable protein(s) regulates signal transduction pathways controlling cell growth, division, migration, survival or apoptosis. These proteins may- comprise members of one or more of the following families of signaling-related proteins: cell surface receptor, kinase, phosphatase, G-protein, small GTPase, hydrolase, adapter (e.g. EF hand, SH2, SH3, PTB, TIR, FHA, MH2, WD40, BRCT, Polo-Box, FF, WW and PH domain- containing adapter and the like), ubiquitin ligase, methylase, demethylase, and transcription factors. These regulatable proteins may be components of the same biological pathway or of different biological pathways. hi one embodiment, a regulatable protein is a kinase or a kinase related protein or a biologically active fragment thereof. A kinase or a kinase related protein is capable of modulating its own phosphorylation state (autophosphorylation) or the phosphorylation state of another cellular component, such as that of other proteins or polypeptides. Such regulatable proteins may be involved in phosphorylation of proteins, lipids, carbohydrates, and/or nucleic acids. In one embodiment, a regulatable protein is a protein kinase, which is defined by the presence of at least one eukaryotic protein kinase (ePK) catalytic domain (e.g., see Manning et al. (2002) Science 298: 1912-1919). An ePK catalytic domain generally contains three motifs that are thought to be critical for catalytic function, each of which contains an almost invariant residue that is thought to be involved in catalysis. These three motifs include a "VAIK" motif in which K is thought to interact with the alpha and beta phosphates of ATP to anchor and orient them, an "HRD" motif in which D likely acts as a base acceptor during catalysis, and "DFG" in which D is thought to chelate Mg++ ions of ATP (see, e.g., Hardie, D.G., et al. (1995) The Protein Kinase Factsbook, Academic Press, London and Manning et al. (2002) Science 298: 1912-1919), although kinases with different motif sequences are known in the art. A "kinase related protein" is a protein that comprises an amino acid sequence that has sequence or structural similarity to an ePK domain or a known atypical protein kinase (aPK) domain (e.g., see Manning et al. (2002) Science 298: 1912-1919) or contains the word "kinase" in its name but does not exhibit said sequence or structural features. An exemplary kinase related protein is an atypical protein kinase (aPK), such as an atypical protein kinase C, e.g., the mammalian p62-atypical protein kinase C.
Most kinases that phosphorylate proteins can have a specificity for (i.e., a specificity to phosphorylate) serine/threonine residues, tyrosine residues, or both serine/threonine and tyrosine residues, e.g. the dual specificity kinases. Conserved structural motifs provide clear indication as to how the kinases transfer the γ-phosphate of a purine nucleotide triphosphate to the hydroxyl groups of protein substrates. The kinase domains that define protein kinases contain 12 conserved subdomains (I-XII) that fold into a common catalytic core structure, as revealed by the 3-dimensional structures of several kinases. The central core of the catalytic domain, the region with greatest frequency of highly conserved residues, consists of subdomains VI through IX. As referred to herein, protein kinases include a kinase catalytic domain of about 20-400 amino acid residues in length, about 50-300 amino acid residues in length, about 100-300 amino acid residues in length, about 200-300 amino acid residues in length or about 250-300 amino acid residues in length. Specificity of a protein kinase for phosphorylation of either tyrosine or serine/threonine can be predicted by the sequence of two of the subdomains (VIb and VIII) in which different residues are conserved in each class (as described in, for example, Hanks et al. (1988) Science 241, 42-52, the contents of which are incorporated herein by reference). Protein kinases that have closely related catalytic domains define families and represent products of genes that have undergone relatively recent evolutionary divergence. Clustering appears to be of predictive value in the determination of the properties and function of novel protein kinases. Accordingly, members of a given family tend also to share related functions. This is manifested by similarities in overall structural topology, mode of regulation, and substrate specificity (see, generally, Hardie, D. G., et al. (1995) The Protein Kinase Factsbook, Academic Press, London).
The complete repertoire of human kinases can be subdivided into "families", according to a dendrogram-based organization of human kinases, e.g. as shown in Manning et al. (2002) Science 298: 1912-1919, which are distinguished from each other according to sequence comparison of kinase catalytic domains, comparison of sequence and protein structures outside of the catalytic domains, known biological functions, and classification of kinases in other species. The following are exemplary kinase families: A6, ABCl, AbI, Ack, AKT, AIk, Alpha, AUR, AxI, BCR, BRD, BUB, Bud32, CAMKl, CAMK2, CAMKK, CAMKL, CAMK-Unique, CASK, CCK4, CDC7, CDK, CDKL, CKl, CK2, CLK, Csk, DAPK, DCAMKL, DDR, DMPK, DYRK, EGFR, Eph, Fak, FAST, Fer, FGFR, Gl 1, GRK, GSK, Hl 1, Haspin, IKK, InsR, IRAK, IRE, JakA, JakB, LISK, Lmr, LRRK, MAPK, MAPKAPK, MAST, Met, MLCK, MLK, MOS, Musk, NAK, NDR, NEK, NKFl, NKF2, NKF3, NKF4, NKF5, NRBP, Other-Unique, PDFGR, PDHK, PEK, PHK, PIKK, PM, PKA, PKB, PKC, PKD, PKG, PKN, PLK, PSK, RAD53, RAF, RCK, Ret, RGC, RIO, RIPK, Ror, RSK, RSKb, RSKL, Ryk, SCYl, Sev, SGK, Slob, Src, SRPK, STEI l, STE20, STE7, STE- Unique, STKR, Syk, TAFl, TBCK, Tec, Tie, TBFl, TKL-Unique, TK-Unique, TLK, TOPK, Trbl, Trio, Trk, TSSK, TTBK, TTK, ULK, VEGFR, VPS 15, VRK, WEE, Wnk, YANK, sphingosine kinases (SKs), diacylglycerol kinases (DGKs), ceramide kinases (CKs), 1-acyl- glycerol kinases, phosphatidylinositol-phosphate kinases, carbohydrate kinases, lipid kinases, nucleotide kinases, and urokinases.
In one embodiment, a regulatable protein comprises, consists essentially of, or consists of a kinase or kinase related protein in Table 1. A regulatable protein may also be a kinase or kinase related protein that is not listed in Table 1. A regulatable protein may also be an orthologue of a protein in Table 1 or other kinase or kinase related protein, e.g., a non- human orthologue, such as a mammalian, vertebrate, ovine, bovine, equine, feline, canine, mouse, or other orthologue. Regulatable proteins may be components of the same biological pathway or of different biological pathways.
In certain embodiments, a composition comprises one or more regulatable proteins or nucleic acids encoding such, wherein at least some of the regulatable proteins are kinases or kinase related proteins with the proviso that the proteins are not specific proteins, e.g., proteins known in the art to have been linked to a regulatory signal, hi certain embodiments, one or more nucleic acids encode one or more regulatable proteins, e.g., kinases or kinase related proteins, with the proviso that the protein is not of a specific family of kinases, e.g., one of the families further described herein.
A regulatable protein may also be a fragment of a naturally occurring regulatable protein, e.g., a kinase or kinase related protein. A fragment may be a biologically active fragment, such as a fragment that retains the catalytic activity of the protein, e.g., the ability to phosphorylate a target protein. For example, a regulatable protein may be a protein that comprises, consists essentially of, or consists of a catalytic kinase domain, such as those further described herein. A fragment may comprise more than one conserved domain, e.g., a catalytic domain and a protein-protein interaction domain, an extracellular ligand binding domain, and/or a transmembrane domain of a receptor kinases. A fragment may also comprise a catalytic kinase domain and about 1, 2, 3, 4, 5, 10, 15, 20, or 50 or more consecutive amino acids on the N- or C-terminus. A fragment may also comprise a full length naturally occurring regulatable protein lacking 1, 2, 3, 4, S, 10, 15, 20, or 50 or more amino acids at the N- or C-terminus. The term "regulatable protein" includes full length regulatable protein, such as they occur in nature, or biologically active fragments thereof or homologs thereof, such as a protein that can be used in or more of the complementation assays described herein.
In one embodiment, a regulatable protein comprises, consists essentially of, or consists of an amino acid sequence that is at least about 70%, 80%, 90%, 95%, 98% or 99% identical to the amino acid sequence of a naturally-occurring kinase or kinase related protein, e.g., shown in Table 1 , or a portion thereof. A r-egulatable protein may comprise an amino acid sequence that is at least about 70%, 80%, 90%, 95%, 98% or 99% identical to a kinase catalytic domain, e.g., present in one of the proteins of Table 1.
A regulatable protein may also be a protein that is encoded by a nucleic acid that is at least about 70%, 80%, 90%, 95%, 98% or 99% identical to a nucleotide sequence encoding a protein of Table 1 or other kinase or kinase related protein or fragment thereof, such as the nucleotide sequence that encodes the catalytic domain.
The term "percent identical" refers to sequence identity between two amino acid sequences or between two nucleotide sequences. Identity can be determined by comparing a position in each sequence, which may be aligned for purposes of comparison. When an equivalent position in the compared sequences is occupied by the same base or amino acid, then the molecules are identical at that position; when the equivalent site occupied by the same or a similar amino acid residue (e.g., similar in steric and/or electronic nature), then the molecules can be referred to as homologous (similar) at that position. Expression as a percentage of homology, similarity, or identity refers to a function of the number of identical or similar amino acids at positions shared by the compared sequences. Expression as a percentage of homology, similarity, or identity refers to a function of the number of identical or similar amino acids at positions shared by the compared sequences. Various alignment algorithms and/or programs may be used, including FASTA, BLAST, or ENTREZ. FASTA and BLAST are available as a part of the GCG sequence analysis package (University of Wisconsin, Madison, Wis.), and can be used with, e.g., default settings. ENTREZ is available through the National Center for Biotechnology Information, National Library of Medicine, National Institutes of Health, Bethesda, Md. In one embodiment, the percent identity of two sequences can be determined by the GCG program with a gap weight of 1, e.g., each amino acid gap is weighted as if it were a single amino acid or nucleotide mismatch between the two sequences.
Other techniques for alignment are described in Methods in Enzymology, vol. 266: Computer Methods for Macromolecular Sequence Analysis (1996), ed. Doolittle, Academic Press, Inc., a division of Harcourt Brace & Co., San Diego, California, USA. Preferably, an alignment program that permits gaps in the sequence is utilized to align the sequences. The Smith-Waterman is one type of algorithm that permits gaps in sequence alignments. See Meth. MoI. Biol. 70: 173-187 (1997). Also, the GAP program using the Needleman and Wunsch alignment method can be utilized to align sequences. An alternative search strategy uses MPSRCH software, which runs on a MASPAR computer. MPSRCH uses a Smith- Waterman algorithm to score sequences on a massively parallel computer. This approach improves ability to pick up distantly related matches, and is especially tolerant of small gaps and nucleotide sequence errors. Nucleic acid-encoded amino acid sequences can be used to search both protein and DNA databases. Regulatory proteins may also be encoded by nucleic acids that hybridize, e.g., under stringent hybridization conditions, to a nucleic acid encoding a protein in Table 1 or other kinase or kinase related protein or biologically active fragment thereof. Hybridization may be under high stringency conditions of 0.2 to 1 x SSC at 65 °C followed by a wash at 0.2 x SSC at 65 °C. Regulatory proteins may also be encoded by nucleic acids that hybridize under low stringency conditions of 6 x SSC at room temperature followed by a wash at 2 x SSC at room temperature to a nucleic acid encoding a protein in Table 1 or other kinase or kinase related protein or biologically active fragment thereof. Other hybridization conditions include 3 x SSC at 40 or 50 °C, followed by a wash in 1 or 2 x SSC at 20, 30, 40, 50, 60, or 65 °C. Hybridizations can be conducted in the presence of formaldehyde, e.g., 10%, 20%, 30% 40% or 50%, which further increases the stringency of hybridization. Theory and practice of nucleic acid hybridization is described, e.g., in S. Agrawal (ed.) Methods in Molecular Biology, volume 20; and Tijssen (1993) Laboratory Techniques in biochemistry and molecular biology-hybridization with nucleic acid probes, e.g., part I chapter 2 "Overview of principles of hybridization and the strategy of nucleic acid probe assays," Elsevier, New York provide a basic guide to nucleic acid hybridization.
The present invention also provides for analogs of naturally occurring regulatable proteins, such as those in Table 1. Analogs can differ from naturally occurring proteins by conservative amino acid sequence differences or by modifications which do not affect sequence, or by both. Any number of procedures may be used for the generation of mutant, derivative or variant forms of regulatable proteins using recombinant DNA methodology well known in the art such as, for example, that described in Sambrook et al. (1989, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York) and Ausubel et al. (1997, Current Protocols in Molecular Biology, Green & Wiley, New York). For example, conservative amino acid changes may be made, which although they alter the primary sequence of a protein or peptide, do not normally alter its function. Conservative amino acid substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid; asparagine, glutamine; serine, threonine; lysine, arginine (in positions other than proteolytic enzyme recognition sites); phenylalanine, tyrosine.
Other variants of naturally occurring regulatable proteins are those that differ from the naturally-occurring protein in 1, 2, 3, 4, 5, 10, 20, 50 or more amino acid substitutions, deletions or additions. The substitutions may be conservative substitutions or non- conservative substitutions. Guidance in determining which amino acid residues may be substituted, inserted, or deleted without abolishing biological activity may be found using computer programs well known in the art, for example, LASERGENE software (DNASTAR).
A regulatable protein may also differ from a naturally occurring regulatable protein, e.g., a protein in Table 1, by the addition of 1, 2, 3, 4, 5, 10, 20, 50 or more consecutive amino acids having a sequence that is unrelated to, or not part of (e.g., heterologous to), the sequence of the naturally occurring regulatable protein. In one embodiment, a regulatable protein is a biologically active fragment of a naturally occurring regulatable protein to which 1, 2, 3, 4, 5, 10, 20, 50 or more consecutive amino acids are added to the N- and/or C- terminus of the protein, which consecutive amino acids form an amino acid sequence that is not present at the same place in the naturally occurring regulatable protein.
The terms "polypeptide", "peptide" and "protein" (if single chain) are used interchangeably herein to refer to polymers of amino acids. The polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified by, for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component. As used herein the term "amino acid" refers to either natural and/or unnatural or synthetic amino acids, including glycine and both the D or L optical isomers, and amino acid analogs and peptidomimetics. Peptides and proteins may also comprise one or more non-naturally occurring amino acids. For example, nonclassical amino acids or chemical amino acid analogs can be introduced as a substitution or addition into peptides. Non-classical amino acids include, but are not limited to, the D-isomers of the common amino acids, 2,4-diaminobutyric acid, alpha- amino isobutyric acid, 4-aminobutyric acid, Abu, 2-amino butyric acid, gamma-Abu, epsilon- Ahx, 6-amino hexanoic acid, Aib, 2-amino isobutyric acid, 3 -amino propionic acid, ornithine, norleucine, norvaline, hydroxyproline, sarcosine, citrulline, homocitrulline, cysteic acid, t- butylglycine, t-butylalanine, phenylglycine, cyclohexylalanine, beta-alanine, fluoro-amino acids, designer amino acids such as beta-methyl amino acids, Calpha-methyl amino acids, Nalpha-methyl amino acids, and amino acid analogs in general.
Also provided are derivatives of regulatable proteins, such as chemically modified peptides and peptidomimetics. Peptidomimetics are compounds based on, or derived from, peptides and proteins. Peptidomimetics can be obtained by structural modification of known peptide sequences using unnatural amino acids, conformational restraints, isosteric replacement, and the like. The subject peptidomimetics constitute the continuum of structural space between peptides and non-peptide synthetic structures; peptidomimetics may be useful, therefore, in delineating pharmacophores and in helping to translate peptides into nonpeptide compounds with the activity of the parent peptides.
Moreover, mimetopes of the subject peptides and proteins can be provided. Peptidomimetics can have such attributes as being non-hydrolyzable (e.g., increased stability against proteases or other physiological conditions which degrade the corresponding peptide). For illustrative purposes, peptide analogs can be generated using, for example, benzodiazepines (e.g., see Freidinger et al. in Peptides: Chemistry and Biology, G.R. Marshall ed., ESCOM Publisher: Leiden, Netherlands, 1988), substituted gamma lactam rings (Garvey et al. in Peptides: Chemistry and Biology, G.R. Marshall ed., ESCOM Publisher: Leiden, Netherlands, 1988, pl23), C-7 mimics (Huffman et al. in Peptides: Chemistry and Biologyy, G.R. Marshall ed., ESCOM Publisher: Leiden, Netherlands, 1988, p. 105), keto-methylene pseudopeptides (Ewenson et al. (1986) J Med Chem 29:295; and Ewenson et al. in Peptides: Structure and Function (Proceedings of the 9th American Peptide Symposium) Pierce Chemical Co. Rockland, IL, 1985), β-turn dipeptide cores (Nagai et al.
(1985) Tetrahedron Lett 26:647; and Sato et al. (l9S6) JChem Soc Perkin Trans 1:1231), β- aminoalcohols (Gordon et al. (1985) Biochem Biophys Res Commun 126:419; and Dann et al.
(1986) Biochem Biophys Res Commun 134:71), diaminoketones (Natarajan et al. (1984) Biochem Biophys Res Commun 124:141), and methyleneamino-modifϊed (Roark et al. in Peptides: Chemistry and Biology, G.R. Marshall ed., ESCOM Publisher: Leiden, Netherlands, 1988, pi 34). Also, see generally, Session III: Analytic and synthetic methods, in Peptides: Chemistry and Biology, G.R. Marshall ed., ESCOM Publisher: Leiden, Netherlands, 1988). Additionally, peptidomimetics based on more substantial modifications of the backbone of a peptide can be used. Peptidomimetics which fall in this category include (i) retro-inverso analogs, and (ii) N-alkyl glycine analogs (so-called peptoids).
In addition to a variety of side chain replacements which can be carried out to generate peptidomimetics, the description specifically contemplates the use of conformationally restrained mimics of peptide secondary structure. Numerous surrogates have been developed for the amide bond of peptides. Frequently exploited surrogates for the amide bond include the following groups (i) trans-olefins, (ii) fluoroalkene, (iii) methyleneamino, (iv) phosphonamides, and (v) sulfonamides.
Peptides may comprise at least one amino acid or every amino acid that is a D stereoisomer. Other peptides may comprise at least one amino acid that is reversed. The amino acid that is reversed may be a D stereoisomer. Every amino acid of a peptide may be reversed and/or every amino acid may be a D stereoisomer.
In another illustrative embodiment, a peptidomimetic can be derived as a retro- enantio analog of a peptide. Retro-enantio analogs such as this can be synthesized with commercially available D-amino acids (or analogs thereof) and standard solid- or solution- phase peptide-synthesis techniques, as described, e.g., in WO 00/01720. The final product may be purified by HPLC to yield the pure retro-enantio analog.
Also included are peptide derivatives which are differentially modified during or after synthesis, e.g., by benzylation, glycosylation, acetylation, phosphorylation, amidation, pegylation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to an antibody molecule or other cellular ligand, etc. In specific embodiments, the peptides are acetylated at the N-terminus and/or amidated at the C-terminus.
Modifications that do not normally alter primary sequence include in vivo or in vitro chemical derivatization of polypeptides, e.g., acetylation, or carboxylation. Also included are modifications of glycosylation, e.g., those made by modifying the glycosylation patterns of a polypeptide during its synthesis and processing or in further processing steps; e.g., by exposing the polypeptide to enzymes which affect glycosylation, e.g., mammalian glycosylating or deglycosylating enzymes. Also embraced are proteins which have phosphorylated amino acid residues, e.g., phosphotyrosine, phosphoserine, or phosphothreonine.
A skilled artisan will readily understand that the nucleotide sequences encoding proteins with specific cellular activities or the proteins themselves may be modified in a number of ways as to make the proteins regulatable such that said cellular activities can be activated or inactivated independent of natural cellular regulatory mechanisms.
In one embodiment, a regulatable protein is linked to a regulatory signal. A "regulatory signal" is a protein domain, which when linked to a regulatory protein, causes the regulatory protein to exhibit at least some of the biological activity of the corresponding wild type or naturally occurring protein in the absence of regulation by its natural factors. A regulatory signal can be an activation signal or a repression signal. An activation signal is a protein domain, which when linked to a regulatory protein, causes the regulatory protein to exhibit at least some of the biological activity of the corresponding wild type or naturally occurring protein in the absence of activation by its natural factors. A regulatory domain may be linked to the N-terminus or C-terminus of a regulatable protein or it can be located internally to the regulatable protein. It can be linked directly or indirectly, e.g., through 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more consecutive amino acids, which maybe unrelated in sequence to the regulatable protein or the regulatory signal.
In one embodiment, a regulatory protein is a protein that is active as a result of a modification, such as a modification that allows the protein to oligomerize or to be targeted to a particular compartment in a cell, e.g., the cell membrane. Linking the regulatory protein to a regulatory signal will regulate, i.e., activate or repress, the protein, either, constitutively or inducibly. Its activity may be similar to, higher or lower relative to the naturally occurring corresponding regulatable protein. For example, a regulatable protein may be a kinase that is activated by being targeted to the cell membrane and/or by dimerization, events that will happen naturally in a cell under certain circumstances. Linking a kinase to a domain that will target it to the cell membrane or allow it to dimerize will allow the kinase to be active independently of whether the specific circumstances that usually activate kinase are present.
In one embodiment, a regulatable protein, e.g., a kinase, is constitutively regulated, e.g., activated, by linking it to one or more of the following domains/signals: an oligomerization domain, a cellular membrane localizing signal, or a signal for covalent binding of lipid groups.
In one embodiment, a regulatable protein is linked to an activation signal that allows its trafficking and insertion into cellular membranes. Additionally, the signal may be a novel sequence created, for example, from all or part of two or more different signals. In one embodiment, a regulatable protein is linked to an activation signal allowing it to be covalently modified by lipid groups. Such lipid groups that can be covalently attached include, but are not limited to, fatty acids, isoprenoids and glycosylphosphatidylinositol (GPI) anchors, either alone or in combinations thereof. Various proteins involved in signal transduction have been shown to be fatty-acylated (Johnson et al. (1994) Ann. Rev. Biochem. 63, 869-914) and this modification has been demonstrated to be sufficient for the constitutive activation of many kinases, including PDK pi 10a subunit and AKT (Klippel et al. (1996) MoI. Cell. Biol. 16, 4117-4127; Kohn et al. (1996) J. Biol. Chem. 271, 21920-21926). In one embodiment, fatty acids will contain from between about 1 to 100 carbons or between about 12 to 24 carbons. In another embodiment, fatty acylation involves the covalent attachment of the 14-carbon saturated fatty acid myristate (myristoylation) by either N-myristoyltransferase 1 (NMT-I) or NMT-2 or the 16-carbon fatty acid palmitate (palmitoylation) to a regulatable protein. These regulatable proteins may be modified by myristate or palmitate, either alone or in combinations thereof. Myristoylated proteins include the α subunit of some heterotrimeric G proteins, cAMP-dependent protein kinase, Src, myristoylated protein kinase C substrate (MARCKS) protein and numerous retroviral coat proteins. Through analysis of amino acid sequence variability of known myristoylated substrate proteins, binding site analyses in X-ray structures or 3D homology models for NMTs from various taxa, and on kinetic data, a refinement of the motif for N-terminal
(glycine) myristoylation has been accomplished (Maurer-Stroh et al. (2002J J. MoI. Biol. 317, 541-557). In one embodiment, myristoylated regulatable proteins contain a canonical myristoylation motif (MGXXXS/T, where X is an intervening amino acid residue). Additional information regarding myristoylation motifs can be found in, e.g., Towler et al. (1988) Ann. Rev. Biochem. 57: 69-99. Exemplary myristoylation motifs that may be used includes MET GLY SER SER LYS SER LYS PRO LYS ASP PRO SER GLN ARG ARG ARG ARG ILE ARG GLY from c-src.
It is understood that there are at least three motif regions present within the approximately 17 N-terminal residues of N-myristoylated proteins: region 1 (approximately positions 1 -6) that fits the binding pocket of NMTs, region 2 (approximately positions 7- 10) that interact with the NMTs surface at the mouth of the catalytic cavity and region 3 (approximately positions 11-17) comprising a hydrophilic linker. In another embodiment, these residues, or the nucleotides that encode them, can be modified according to known structure- function relationships to generate signals that will result in myristoylation of a given protein (e.g., Maurer-Stroh et al. (2002) J MoI. Biol. 317, 541-557). Proteins can also be fatty acylated with palmitoyl moieties linked through thioester bonds to one or more cysteine residues. Because other medium- and long-chain fatty acids can also be attached to 'palmitoylated' proteins, the term S-acylation is often used. There is no consensus sequence for protein palmitoylation, although some modified sites can be predicted, hi addition, all of these motifs or their variants may also be found at the C-terminus or at any other position within the protein to signal myristoylation. Examples of C-terminal and internal myristoylation signals are well known in the art. Various DNA sources known in the art can be used to clone and encode such sequences. - Proteins can also be lipidated by prenylation, a process involving protein modification of lipid anchors comprising isoprene units (C5). In one embodiment, prenylation may involve protein modification of lipid anchors composed of between 1 and 20 isoprene units. In general, prenylation can be conveniently subdivided into three types: (1) Farnesylation generally involves the linkage of a faraesyl (15-carbon) group(s) to cysteine residues at or near the C terminus of proteins. One consensus target sequence for farnesylation is CAAX (where C is cysteine, A is an amino acid with a hydrophobic side chain and X is another amino acid). This sequence is recognized by farnesyltransferase (FT). Additionally, palmitoylation of cysteines close to the farnesylated cysteine occurs in some proteins. The farnesyl group is donated by farnesyl pyrophosphate, an intermediate in the sterol biosynthetic pathway. The enzymology of farnesylation and its associated modifications appears to have been conserved in eukaryotes. These processes occur in both mammalian cells and in the budding yeast, S. cerevisiae. Farnesylated proteins include G subunits of some heterotrimeric G proteins, ras proteins and the nuclear lamins. For example, it is well known in the art that it is possible to fuse the last eleven amino acids of a ras protein to a given protein and confer membrane association upon that protein. (2) Geranylgeranylation generally involves the addition of a geranylgeranyl (20-carbon) group(s) to the cysteine residues at or near the C terminus of proteins. One consensus target sequence for geranylgeranylation is CAAX, where A is preferably an aliphatic amino acid and X is preferably L, F, I, V or M. The enzyme which performs this type of geranylgeranylation is geranylgeranyl transferase I (GGTl), which contains a subunit that is common to farnesyl transferase. Proteins that undergo this modification include several ras-related G proteins, such as racl, rac2 and ralA and the G subunits of some heterotrimeric G proteins. (3) Geranylgeranylation can also be effected by geranylgeranyl transferase II (GGT2), which recognizes a variety of C terminal motifs. Examples of known C-terminal motifs include, but are not limited to, -CC, -CXC, - CCX, -CCXX, -CCXXX, and -CXXX (where C is cysteine and X is another amino acid). GGT2 appears to be especially important for geranylgeranylation of Rab proteins, a large subgroup of Ras-related GTPases involved in vesicular trafficking. Through analysis of amino acid sequence variability of known substrates for FT, GGTl and GGT2 and evolutionary motif conservation, a refinement of the motif for recognition by these enzymes has been accomplished (Maurer-Stroh and Eisenhaber (2005) Genome Biol. 6, R55) and it has been determined that the motifs recognized by these enzymes is more flexible than recognition of the canonical 'CAAX' box. In one embodiment, these flexible amino acid motifs, or the nucleotides that encode them, can be modified according to known structure- function relationships to generate signals that will result in either farnesylation or geranylgeranylation of a given protein (e.g., Maurer-Stroh and Eisenhaber (2005) Genome Biol. 6, R55). In addition, all of these motifs or their variants may also be found at the N- terminus or at any other position within the protein to signal prenylation. Examples of N- terminal and internal prenylation signals are well known in the art. Various DNA sources known in the art can be used to clone and encode such sequences.
Proteins can also be lipidated by post-translational addition of glycosylphosphatidylinositol (GPI) anchors and this process generally involves a transamidation reaction in which a GPI moiety is attached at or near the C-terminus of a polypeptide in the endoplasmic reticulum. In general, the GPI signal sequence consists of a triplet of small amino acids (termed ω, ω+1, and ω+2 in the art), a hydrophilic spacer sequence of 7-10 amino acids, and a C-terminal hydrophobic stretch. The ω amino acid constitutes the site of GPI attachment and this attachment is catalyzed by GPI transamidase (GPIT). Through analysis of amino acid sequence variability of known GPI-modified proteins and site-directed mutant information, a refinement of the motif signal required for GPI-modification has been accomplished (Eisenhaber et al. (2001) Protein Eng. 14, 17-25 and references therein). In one embodiment, the amino acid motif signals, or the nucleotides that encode them, can be modified according to known structure- function relationships to generate signals that will result in GPI-modification of a given protein (e.g., Eisenhaber et al. (2001) Protein Eng. 14, 17-25 and references therein). In addition, all of these motifs or their variants may also be found at the N-terminus or at any other position within the protein to signal GPI modification. Examples of N-terminal and internal GPI signals are well known in the art. Various DNA sources known in the art can be used to clone and encode such sequences. In a specific embodiment, a regulatable protein is targeted to a membrane in an inducible fashion. Several inducible membrane targeting strategies for proteins are known. In one embodiment, a regulatable protein is linked to a FRAP rapamycin binding (FRB) domain or a variant thereof. This FRB-regulatable protein fusion protein can then be induced to heterodimerize in the presence of a small molecule, e.g., rapamycin or a rapamycin analog, with an FKBP domain or a variant of FKBP 12 or its homo log. The FKBP domain(s) can be expressed at the membrane, for example, through linkage to a membrane targeting signal (e.g. myristoylation moiety) and will thus effect inducible membrane targeting of regulatable proteins upon exposure to said small molecule (e.g., Li et al (2002) Gene Therapy 9, 233- 244). The basic FRB-rapamycin-FKBP strategy, especially as applied in mammalian cells, has been extensively described in the art (e.g. Rivera (1998) Methods 14: 421-429 and Pollock and Rivera (1999) Methods Enzymol. 306: 263-281). Alternatively, a regulatable protein can be fused to an FKBP domain or a variant thereof that can be induced to heterodimerize in the presence of a small molecule, e.g., rapamycin or a rapamycin analog, with an FRB domain or a variant thereof from FKBP 12 or its homo log such that expression of a membrane bound FRB domain, effected through linkage to a membrane targeting signal (e.g. myristoylation moiety), will effect membrane targeting of the regulatable protein. Membrane targeting of regulatable proteins can be controlled by the availability of the small molecule, rapamycin, or its derivatives. A skilled artisan will appreciate that stable membrane binding of proteins post- translationally modified for membrane localization may be enhanced by the addition of one or more membrane targeting modifications. For example, membrane binding of the Src kinase is mediated by an N-terminal myristoylation in addition to a polybasic residue domain (Sigal et al. (1994) Proc. Natl. Acad. ScL USA 91, 12253-12257). An activation signal may also comprise, consist essentially of or consist of a dimerization or oligomerization domain that allows homo- and hetero-dimerization or oligomerization of a regulatable protein with itself or with additional regulatable proteins. Homodimerization and homo-oligomerization refer to the association of like components to form dimers or oligomers. Heterodimerization and hetero-oligomerization refer to the association of dissimilar components to form dimers or oligomers. Homo-oligomers thus comprise an association of multiple copies of a particular components, while hetero- oligomers comprise an association of copies of different components. "Oligomerization", "oligomerize" and "oligomer", with or without prefixes, are intended to encompass "dimerization", "dimerize" and "dimer". Oligomerization brings the action domains of the encompassed components into close proximity with one another thus triggering cellular processes normally associated with the respective action domain, such as kinase-mediated signal transduction. Numerous examples in the literature indicate that naturally occurring mutations resulting in oligomerization of both receptor and non-receptor protein kinases can cause cellular transformation (e.g., Monaco et al. (2001) Oncogene 20, 599-608 and Fan et al. (2003) Cancer Res. 63, 873-877). An oligomerization domain can be linked to the N- terminus, C-terminus or internally to the regulatable protein. Oligomerization may be enhanced by the addition of two or more oligomerization domains. Regarding kinases, such oligomerization domains may replace or be used in conjunction with membrane localizing domains in order to activate or enhance the activity of kinases whose activities are influenced by dimerization and which are minimally or completely nonresponsive to membrane localization.
In general, dimerization and oligomerization domains can be conveniently subdivided into two types: (1) domains whose associations are constitutive and (2) domains whose associations are regulated. In general, domains whose associations are constitutive can be fused to regulatable proteins to allow heterologous homo- and hetero-dimerization or oligomerization in a constitutive manner upon expression. A skilled artisan will recognize that many heterologous domains whose associations are constitutive are well known in the art. Examples described in the art include, but are not limited to, heterodimerization of PDZ domains from the mammalian proteins neuronal nitric oxide synthase (nNOS) and syntrophin (Ung et al. (2001) EMBOJ. 20: 3728-3737), heterodimerization of the Xenopus XLMl and LDBl proteins (Ung et al. (2001) EMBO J. 20: 3728-3737), oligomerization of RFG (also named ELEl or ARA70) through its coiled-coil domain (Monaco et al. (2001) Oncogene 20: 599-608), oligomerization of the leucine zipper domain of yeast GCN4 (Harbury et al. (1993) Science 262: 1401-1407), and oligomerization of the TEL helix-loop-helix (HLH) domain (Golub et al. (1996) MoI. Cell. Biol. 16, 4107-4116) and their variants. In one embodiment, the activation domain consists of the TEL protein or an oligomerization domain thereof, which is a member of the Ets family of transcription factors, or the helix-loop-helix (HLH) domain of TEL. An exemplary TEL sequence comprises the amino acid sequence MSETPAQCSDCQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRL
PAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKE DFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQPEVILHQ NHEE. TEL-kinase fusion proteins form HLH-dependent homo-oligomers in vitro, a process critical for constitutive tyrosine kinase phosphorylation, and hence, constitutive activation (Golub et al. (1996) MoI. Cell. Biol. 16, 4107-4116).
In general, oligomerization domains can be fused to regulatable proteins to allow heterologous homo- and hetero-dimerization or oligomerization in a regulated manner. A skilled artisan will recognize that many heterologous domains whose associations are regulated, rather than constitutive, are well known in the art. Examples include, but are not limited to, the Gyrase B-coumermycin system, the FKBP-rapamycin-FRAP system, and their variants. In general, these heterologous domains are domains from naturally occurring proteins or truncated active portions thereof. The binding domain can be small (<25 kDa to allow efficient transfection in viral vectors), nonimmunogenic and accessible to cell permeable, nontoxic ligands. In one embodiment, a regulatable protein is fused to bacterial Gyrase B polypeptide or a fragment or derivatives thereof (e.g. amino acids 1-220 of E. coli GyrB) that can be induced to dimerize in the presence of coumermycin or a coumermycin analog (Farrar et al. (1996) Nature 383, 178-181 and Farrar et al., US Patent 6,916,846). In another embodiment, a regulatable protein is fused to the FRB (FRAP rapamycin binding) domain(s) or its variants of FRAP/mTOR or to an FKBP domain(s) or its variants of FKBP 12 or its homologs, such that expression of a chimeric protein comprising the regulatable protein fused to the FRB domain and identical regulatory proteins or other regulatory proteins fused to FKBP, or vice versa, can dimerize in the presence of rapamycin or a rapamycin analog, hi another embodiment, the linking ligand can have different receptor binding molecules with different epitopes to mediate oligomerization of chimeric proteins having the same or different binding domains. For example, the ligand may comprise rapamycin or a rapamycin- type moiety and a cyclosporinA or cyclosporin type moiety. Both moieties may be covalently attached to a common linker moiety. Such a ligand would be useful for mediating the oligomerization of a first and second chimeric protein where the first chimeric protein contains a receptor domain, such as an FKBP domain from FKBP 12 or its homo log that is capable of binding to the rapamycin or rapamycin-type moiety, and the second chimeric protein contains a receptor domain, such as cyclophilin, that is capable of binding to the cyclosporin A or cyclosporin type moiety. A variety of pairs of synthetic ligands and ligand binding proteins or domains known in the art can be employed.
Detection and confirmation of protein-protein interactions resulting from dimerization or oligomerization can be accomplished in a number of manners well known in the art. These approaches generally employ the affinities between interacting proteins to isolate and analyze proteins in a bound state or the distance between interacting proteins. Examples of such methods include, but are not limited to, non-reducing SDS-PAGE, chromatography, density gradient densitometry, microscopy including transmission electron microscopy, mass spectrometry, immunoprecipitation employing dimerization- or oligomerization-specific antibodies, bioluminescence resonance energy transfer (BRET), fluorescence resonance energy transfer (FRET) and the like.
Also provided herein are compositions comprising one or more nucleic acids encoding at least 1, 2, 3, 4, 5, 10, 20, 50, 100, 500 or more inhibitory mutants of proteins, wherein expression of the inhibitory mutants in a cell downregulates one or more biological activities associated with the corresponding wild-type or naturally occurring proteins. In one embodiment, a composition may comprise a library of nucleic acids encoding inhibitory mutant proteins, or pools of nucleic acids thereof (a "dead library"). A pool of nucleic acids may encode about 5-10, 10-20, 10-30 or more inhibitory mutants.
In one embodiment, each inhibitory mutant is encoded by a separate nucleic acid. For example, a composition may comprise at least about 1, 2, 3, 4, 5, 10, 20, 50, 100, 200, 300, or 500 nucleic acids, wherein each nucleic acid encodes one inhibitory mutant. As further discussed below, the nucleic acids do not need to be in one composition, hi particular, each member of a library of nucleic acids may be physically separated from the other members, e.g., by being present in a well of a multiwell plate. In one embodiment, each member of a library of nucleic acids encoding inhibitory mutants is present in a separate well from the other nucleic acids of the library.
Also provided herein are compositions comprising one or more inhibitory mutants. A composition can comprise at least about 1, 2, 3, 4, 5, 10, 20, 50, 100 or more proteins. A composition may comprise a library of inhibitory mutants or pools of proteins thereof. A pool of proteins may comprise about 5-10, 10-20, 10-30 or more proteins. The members of the library do not need to be in a composition. Each member of the library may be in a separate vial or well of a multiwell dish.
An inhibitory mutant may be a mutant of a protein involved in signal transduction, e.g., a kinase or a phosphatase. An inhibitory mutant may be a dominant negative mutant, a deletion mutant, a mutant comprising one or more substitution or addition of amino acids.
In one embodiment, a protein, e.g., a kinase, in a cell is inactivated by introducing into the cell an inhibitory mutant of the protein, such that the inhibitory mutant downregulates one or more biological activities associated with the corresponding wild-type protein. Such mutants can be generated by the following, but are not limited to, mutation, deletion, modification or rearrangement of nucleotide sequences that encode domains used to define the protein family with which the protein is associated (e.g. the kinase domain of kinase proteins), regulatory elements, protein-protein interaction domains, residues that are targets of cell signaling (e.g. phosphorylation), protein degradation signal domains and cellular localization domains. In one embodiment, these inhibitory mutants are dominant negative mutants. As used herein, a dominant negative mutant is a mutant polypeptide which, when expressed, disrupts the activity of the wild type protein. It may act by binding to the active protein and rendering it inactive or inhibited, or where it is an enzyme, by binding the target protein without enzymatically activating the protein, thus blocking and preventing, the active enzymes from binding and activating the target protein. A dominant negative-protein is encoded by a dominant negative gene, which is itself derived from a change with regard to at least one position in its sequence relative to the corresponding wild type version of the gene. A dominant negative gene encodes a product that disrupts an endogenous genetic process of a host cell which expresses the gene and that is effective in a single copy or may produce an effect due to overexpression of the gene either by increased production of the gene product, or by coexpression of multiple copies of the gene. In one embodiment, a change can occur due to alternative splicing of gene products, which have lost an important site or domain, and thus become enzymatically inactive or inhibited. In another embodiment a change can occur at a position that encodes a changed amino acid residue position at an active site required for biological and/or pharmacological activity in the native peptide, as can happen, for example, due to amino acid alterations in residues critical for catalytic function of kinase domains. Such critical regions are described in the art, as in Hanks et al. (1988) Science 241, 42-52. In yet another embodiment, the dominant negative mutants are the result of substitutions in one or more amino acids that causes a change in posttranslational modification of the protein (e.g. a change in acetylation, glycosylation, phosphorylation, ubiquitination, alkylation, glutamylation, acylation, isoprenylation, lipoylation, phosphopantetheinylation, sulfation, selenation, or C-terminal amidation). These inhibitory proteins are said to be "constitutively regulated" because they do not exhibit specific activity despite potential stimulation by natural factors and do not produce any of the cellular responses normally induced by said natural factors even with potential stimulation by these natural factors.
Also provided herein are compositions comprising one or more nucleic acids comprising or capable of expressing at least 1, 2, 3, 4, 5, 10, 20, 50, 100, 500 or more small nucleic acids or antisense oligonucleotides or derivatives thereof, wherein said small nucleic acids or antisense oligonucleotides or derivatives thereof in a cell specifically hybridize (e.g., bind) under cellular conditions, with small nucleic acids (e.g., small RNAs and microRNAs), with cellular mRNA and/or genomic DNA encoding one or more cellular proteins, hi one embodiment, expression of the small nucleic acids or antisense oligonucleotides or derivatives thereof in a cell can enhance or upregulate one or more biological activities associated with the corresponding wild-type, naturally occurring, or synthetic small nucleic acids. In another embodiment, expression of the small nucleic acids or antisense oligonucleotides or derivatives thereof in a cell can inhibit expression or biological activity of cellular nucleic acids and/or proteins, e.g., by inhibiting transcription, translation and/or small nucleic acid processing. In one embodiment, the small nucleic acids or antisense oligonucleotides or derivatives thereof are small RNAs (e.g., microRNAs) or complements of small RNAs. In another embodiment, the small nucleic acids or antisense oligonucleotides or derivatives thereof can be single or double stranded and are at least six nucleotides in length and are less than about 1000, 900, 800, 700, 600, 500, 400, 300, 200, 100, 50, 40, 30, 25, 24, 23, 22, 21,20, 19, 18, 17, 16, 15, or 10 nucleotides in length. In another embodiment, a composition may comprise a library of nucleic acids comprising or capable of expressing small nucleic acids or antisense oligonucleotides or derivatives thereof, or pools of said small nucleic acids or antisense oligonucleotides or derivatives thereof. A pool of nucleic acids may comprise about 5-10, 10-20-, 10-30 or more nucleic acids comprising or capable of expressing small nucleic acids or antisense oligonucleotides or derivatives thereof. In one embodiment, each small nucleic acid or antisense oligonucleotide or derivative thereof is generated by a separate nucleic acid. For example, a composition may comprise at least about 1, 2, 3, 4, 5, 10, 20, 50, 100, 200, 300, or 500 nucleic acids, wherein each nucleic acid generates a small nucleic acid or antisense oligonucleotide or derivative thereof. As further discussed below, the nucleic acids do not need to be in one composition. In particular, each member of a library of nucleic acids may be physically separated from the other members, e.g., by being present in a well of a multiwell plate. In one embodiment, each member of a library of nucleic acids that generate a small nucleic acid or antisense oligonucleotide or derivative thereof is present in a separate well from the other nucleic acids of the library. Such nucleic acids may be used alone or in combinations with regulatable proteins and/or inactive mutants described herein.
In one embodiment, binding may be by conventional base pair complementarity, or, for example, in the case of binding to DNA duplexes, through specific interactions in the major groove of the double helix. In general, "antisense" refers to the range of techniques generally employed in the art, and includes any process that relies on specific binding to oligonucleotide sequences.
Small nucleic acids and/or antisense constructs of the methods and compositions presented herein can be delivered, for example, as an expression plasmid which, when transcribed in the cell, produces RNA which is complementary to at least a unique portion of cellular nucleic acids (e.g., small RNAs, mRNA, and/or genomic DNA). Alternatively, Small nucleic acids and/or antisense constructs are oligonucleotide probes that are generated ex vivo and which, when introduced into the cell, results in hybridization with cellular nucleic acids (e.g., small RNAs, mRNA, and/or genomic DNA). Such oligonucleotide probes are preferably modified oligonucleotides that are resistant to endogenous nucleases, e.g., exonucleases and/or endonucleases, and are therefore stable in vivo. Exemplary nucleic acid molecules for use as small nucleic acids and/or antisense oligonucleotides are phosphoramidate, phosphothioate and methylphosphonate analogs of DNA (see also U.S. Patents 5,176,996; 5,264,564; and 5,256,775). Additionally, general approaches to constructing oligomers useful in antisense therapy have been reviewed, for example, by Van der Krol et al. (1988) BioTechniques 6:958-976; and Stein et al. (1988) Cancer Res 48:2659-2668.
Antisense approaches may involve the design of oligonucleotides (either DNA or RNA) that are complementary to cellular nucleic acids (e.g., small RNAs, mRNA, and/or genomic DNA). Absolute complementarity is not required. In the case of double-stranded antisense nucleic acids, a single strand of the duplex DNA may thus be tested, or triplex formation may be assayed. The ability to hybridize will depend on both the degree of complementarity and the length of the antisense nucleic acid. Generally, the longer the hybridizing nucleic acid, the more base mismatches with a nucleic acid (e.g., RNA) it may contain and still form a stable duplex (or triplex, as the case may be). One skilled in the art can ascertain a tolerable degree of mismatch by use of standard procedures to determine the melting point of the hybridized complex.
Oligonucleotides that are complementary to the 5' end of the mRNA, e.g., the 5' untranslated sequence up to and including the AUG initiation codon, should work most efficiently at inhibiting translation. However, sequences complementary to the 3' untranslated sequences of mRNAs have recently been shown to be effective at inhibiting translation of mRNAs as well. (Wagner, R. (1994) Nature 372:333). Therefore, oligonucleotides complementary to either the 5 ' or 3' untranslated, non-coding regions of genes could be used in an antisense approach to inhibit translation of endogenous mRNAs. Oligonucleotides complementary to the 5' untranslated region of the mRNA may include the complement of the AUG start codon. Antisense oligonucleotides complementary to mRNA coding regions are less efficient inhibitors of translation but could also be used in accordance with the methods and compositions presented herein. Whether designed to hybridize to the 5', 3' or coding region of cellular mRNAs, small nucleic acids and/or antisense nucleic acids should be at least six nucleotides in length, and can be less than about 1000, 900, 800, 700, 600, 500, 400, 300, 200, 100, 50, 40, 30, 25, 24, 23, 22, 21,20, 19, 18, 17, 16, 15, or 10 nucleotides in length.
Regardless of the choice of target sequence, it is preferred that in vitro studies are first performed to quantitate the ability of the antisense oligonucleotide to inhibit gene expression. In one embodiment these studies utilize controls that distinguish between antisense gene inhibition and nonspecific biological effects of oligonucleotides. In another embodiment these studies compare levels of the target nucleic acid or protein with that of an internal control nucleic acid or protein. Additionally, it is envisioned that results obtained using the antisense oligonucleotide are compared with those obtained using a control oligonucleotide. It is preferred that the control oligonucleotide is of approximately the same length as the test oligonucleotide and that the nucleotide sequence of the oligonucleotide differs from the antisense sequence no more than is necessary to prevent specific hybridization to the target sequence. Small nucleic acids and/or antisense oligonucleotides can be DNA or RNA or chimeric mixtures or derivatives or modified versions thereof, single-stranded or double- stranded. Small nucleic acids and/or antisense oligonucleotides can be modified at the base moiety, sugar moiety, or phosphate backbone, for example, to improve stability of the molecule, hybridization, etc., and may include other appended groups such as peptides (e.g., for targeting host cell receptors), or agents facilitating transport across the cell membrane (see, e.g., Letsinger et al. (1989) Proc. Natl. Acad. Sci. U.S.A. 86:6553-6556; Lemaitre et al. (1987) Proc. Natl. Acad. Sci. 84:648-652; PCT Publication No. W088/09810, published December 15, 1988) or the blood-brain barrier (see, e.g., PCT Publication No. W089/10134, published April 25, 1988), hybridization-triggered cleavage agents. (See, e.g., Krol et al. (1988) BioTechniques 6:958-976) or intercalating agents. (See, e.g., Zon (1988), Pharm. Res. 5:539-549). To this end, small nucleic acids and/or antisense oligonucleotides may be conjugated to another molecule, e.g., a peptide, hybridization triggered cross-linking agent, transport agent, hybridization-triggered cleavage agent, etc. small nucleic acids and/or antisense oligonucleotides may comprise at least one modified base moiety which is selected from the group including but not limited to 5- fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xantine, 4- acetylcytosine, 5-(carboxyhydroxytiethyl) uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6- isopentenyiadenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D- mannosylqueosine, 5'-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N6- isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5- oxyacetic acid methylester, uracil-5-oxyacetic acid (v), 5-methyl-2-thiouracil, 3-(3-amino-3- N-2-carboxypropyl) uracil, (acp3)w, and 2,6-diaminopurine. Small nucleic acids and/or antisense oligonucleotides may also comprise at least one modified sugar moiety selected from the group including but not limited to arabinose, 2-fluoroarabinose, xylulose, and hexose.
Small nucleic acids and/or antisense oligonucleotides can also contain a neutral peptide-like backbone. Such molecules are termed peptide nucleic acid (PNA)-oligomers and are described, e.g., in Perry-O'Keefe et al. (1996) Proc. Natl. Acad. Sci. U.S.A. 93:14670 and in Eglom et al. (1993) Nature 365:566. One advantage of PNA oligomers is their capability to bind to complementary DNA essentially independently from the ionic strength of the medium due to the neutral backbone of the DNA. In yet another embodiment, small nucleic acids and/or antisense oligonucleotides comprises at least one modified phosphate backbone selected from the group consisting of a phosphorothioate, a phosphorodithioate, a phosphoramidothioate, a phosphoramidate, a phosphordiamidate, a methylphosphonate, an alkyl phosphotriester, and a formacetal or analog thereof.
In a further embodiment, small nucleic acids and/or antisense oligonucleotides are α- anomeric oligonucleotides. An α-anomeric oligonucleotide forms specific double-stranded hybrids with complementary RNA in which, contrary to the usual b-units, the strands run parallel to each other (Gautier et al. ( 1987) Nucl. Acids Res. 15.6625-6641 ). The oligonucleotide is a 2'-0-methylribonucleotide (Inoue et al. (1987) Nucl. Acids Res. 15:6131- 6148), or a chimeric RNA-DNA analogue (Inoue et al. (1987) FEBS Lett. 215:327-330).
Small nucleic acids and/or antisense oligonucleotides of the methods and compositions presented herein may be synthesized by standard methods known in the art, e.g., by use of an automated DNA synthesizer (such as are commercially available from Biosearch, Applied Biosystems, etc.). As examples, phosphorothioate oligonucleotides may be synthesized by the method of Stein et al. (1988) Nucl. Acids Res. 16:3209, methylphosphonate olgonucleotides can be prepared by use of controlled pore glass polymer supports. (Sarin et al. (1988) Proc. Natl. Acad. Sci. U.S.A. 85:7448-7451), etc.
Small nucleic acids and/or antisense oligonucleotides can be delivered to cells in vivo. A number of methods have been developed for delivering small nucleic acids and/or antisense oligonucleotides DNA or RNA to cells; e.g., antisense molecules can be injected directly into the tissue site, or modified antisense molecules, designed to target the desired cells (e.g., antisense linked to peptides or antibodies that specifically bind receptors or antigens expressed on the target cell surface) can be administered systematically.
In one embodiment, small nucleic acids and/or antisense oligonucleotides may comprise or be generated from double stranded small interfering RNAs (siRNAs), in which sequences fully complementary to cellular nucleic acids (e.g. mRNAs) sequences mediate degradation or in which sequences incompletely complementary to cellular nucleic acids (e.g., mRNAs) mediate translational repression when expressed within cells. In another embodiment, double stranded siRNAs can be processed into single stranded antisense RNAs that bind single stranded cellular RNAs (e.g., microRNAs) and inhibit their expression. RNA interference (RNAi) is the process of sequence-specific, post-transcriptional gene silencing in animals and plants, initiated by double-stranded RNA (dsRNA) that is homologous in sequence to the silenced gene. In vivo, long dsRNA is cleaved by ribonuclease III to generate 21- and 22-nucleotide siRNAs. It has been shown that 21 -nucleotide siRNA duplexes specifically suppress expression of endogenous and heterologous genes in different mammalian cell lines, including human embryonic kidney (293) and HeLa cells (Elbashir et al. Nature 2001 ;411(6836):494-8). Accordingly, translation of a gene in a cell can be inhibited by contacting the cell with short doublestranded RNAs having a length of about 15 to 30 nucleotides or of about 18 to 21 nucleotides or of about 19 to 21 nucleotides. Alternatively, a vector encoding for such siRNAs or hairpin RNAs that are metabolized into siRNAs can be introduced into a target cell (see, e.g., McManus et al. (2002) RNA 8:842; Xia et al. (2002) Nature Biotechnology 20: 1006; and Brummelkamp et al. (2002) Science
296:550. Vectors that can be used are commercially available, e.g., from OligoEngine under the name pSuper RNAi System™.
Ribozyme molecules designed to catalytically cleave cellular mRNA transcripts can also be used to prevent translation of cellular mRNAs and expression of cellular polypeptides, or both (See, e.g., PCT International Publication WO90/11364, published October 4, 1990; Sarver et al. (1990) Science 247:1222-1225 and U.S. Patent No. 5,093,246). While ribozymes that cleave mRNA at site specific recognition sequences can be used to destroy cellular mRNAs, the use of hammerhead ribozymes is preferred. Hammerhead ribozymes cleave mRNAs at locations dictated by flanking regions that form complementary base pairs with the target mRNA. The sole requirement is that the target mRNA have the following sequence of two bases: 5'-UG-3'. The construction and production of hammerhead ribozymes is well known in the art and is described more fully in Haseloff and Gerlach (1988) Nature 334:585-591. The ribozyme may be engineered so that the cleavage recognition site is located near the 5' end of cellular mRNAs; i.e., to increase efficiency and minimize the intracellular accumulation of non- functional mRNA transcripts.
The ribozymes of the the methods and compositions presented herein also include RNA endoribonucleases (hereinafter "Cech-type ribozymes") such as the one which occurs naturally in Tetrahymena thermophila (known as the IVS, or L-19 IVS RNA) and which has been extensively described by Thomas Cech and collaborators (Zaug, et al. (1984) Science 224:574-578; Zaug, et al. (1986) Science 231. "470-475; Zaug, et al. (1986) Nature 324:429- 433; published International patent application No. WO88/04300 by University Patents Inc.; Been, et al. (1986) Cell 47:207-216). The Cech-type ribozymes have an eight base pair active site which hybridizes to a target RNA sequence whereafter cleavage of the target RNA takes place. The methods and compositions presented herein encompasses those Cech-type ribozymes which target eight base-pair active site sequences that are present in cellular genes.
As in the antisense approach, the ribozymes can be composed of modified oligonucleotides (e.g., for improved stability, targeting, etc.) and should be delivered to cells which express Foxo genes in vivo. A preferred method of delivery involves using a DNA construct "encoding" the ribozyme under the control of a strong constitutive pol III or pol II promoter, so that transfected cells will produce sufficient quantities of the ribozyme to destroy endogenous cellular messages and inhibit translation. Because ribozymes unlike antisense molecules, are catalytic, a lower intracellular concentration is required for efficiency. Nucleic acid molecules to be used in triple helix formation for the inhibition of transcription of cellular genes are preferably single stranded and composed of deoxyribonucleotides. The base composition of these oligonucleotides should promote triple helix formation via Hoogsteen base pairing rules, which generally require sizable stretches of either purines or pyrimidines to be present on one strand of a duplex. Nucleotide sequences may be pyrimidine-based, which will result in TAT and CGC triplets across the three associated strands of the resulting triple helix. The pyrimidine-rich molecules provide base complementarity to a purine-rich region of a single strand of the duplex in a parallel orientation to that strand. In addition, nucleic acid molecules may be chosen that are purine- rich, for example, containing a stretch of G residues. These molecules will form a triple helix with a DNA duplex that is rich in GC pairs, in which the majority of the purine residues are located on a single strand of the targeted duplex, resulting in CGC triplets across the three strands in the triplex.
Alternatively, the potential sequences that can be targeted for triple helix formation may be increased by creating a so called "switchback" nucleic acid molecule. Switchback molecules are synthesized in an alternating 5 '-3', 3 '-5' manner, such that they base pair with first one strand of a duplex and then the other, eliminating the necessity for a sizable stretch of either purines or pyrimidines to be present on one strand of a duplex.
Small nucleic acids, antisense oligonucleotides, ribozymes, and triple helix molecules of the methods and compositions presented herein may be prepared by any method known in the art for the synthesis of DNA and RNA molecules. These include techniques for chemically synthesizing oligodeoxyribonucleotides and oligoribonucleotides well known in the art such as for example solid phase phosphoramidite chemical synthesis. Alternatively, RNA molecules may be generated by in vitro and in vivo transcription of DNA sequences encoding the antisense RNA molecule. Such DNA sequences may be incorporated into a wide variety of vectors which incorporate suitable RNA polymerase promoters such as the T7 or SP6 polymerase promoters. Alternatively, antisense cDNA constructs that synthesize antisense RNA constitutively or inducibly, depending on the promoter used, can be introduced stably into cell lines. Moreover, various well-known modifications to nucleic acid molecules may be introduced as a means of increasing intracellular stability and half-life. Possible modifications include but are not limited to the addition of flanking sequences of ribonucleotides or deoxyribonucleotides to the 5' and/or 3' ends of the molecule or the use of phosphorothioate or 2' O-methyl rather than phosphodiesterase linkages within the oligodeoxyribonucleotide backbone. One of skill in the art will readily understand that regulatable proteins, inhibitory mutants, small nucleic acids, and antisense oligonucleotides can be further linked to another peptide or polypeptide (e.g., a heterologous peptide), e.g., that serves as a means of protein detection. Non-limiting examples of label peptide or polypeptide moieties useful for detection in the invention include, without limitation, suitable enzymes such as horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; epitope tags, such as FLAG, MYC, HA, or HIS tags; fluorophores such as green fluorescent protein; dyes; radioisotopes; digoxygenin; biotin; antibodies; polymers; as well as others known in the art, for example, in Principles of Fluorescence Spectroscopy, Joseph R. Lakowicz (Editor), Plenum Pub Corp, 2nd edition (July 1999).
Regulatable proteins and inhibitory mutants, e.g., as described herein, may be encoded by one or more nucleic acids or variants thereof. Small nucleic acids and antisense oligonucleotides can comprise or be expressed by one or more nucleic acids or variants thereof. The terms "polynucleotide" and "nucleic acid" are used interchangeably. They refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. The following are non-limiting examples of polynucleotides: coding or non-coding regions of a gene or gene fragment, loci (locus) defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers. A polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer. The sequence of nucleotides may be interrupted by non-nucleotide components. A polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component. The term "recombinant" polynucleotide means a polynucleotide of genomic, cDNA, semisynthetic, or synthetic origin which either does not occur in nature or is linked to another polynucleotide in a nonnatural arrangement. The term "oligonucleotide" may be used to refer to a single stranded polynucleotide having less than about 100 nucleotides, less than about, e.g, 75, 50, 25, or 10 nucleotides.
Nucleic acids described herein may also be variants, e.g., variants of those in Table 1. The term "variant," when used in the context of a polynucleotide sequence, may encompass a polynucleotide sequence related to that of a particular gene or the coding sequence thereof. This definition may also include, for example, "allelic," "splice," "species," or "polymorphic" variants. A splice variant may have significant identity to a reference molecule, but will generally have a greater or lesser number of polynucleotides due to alternate splicing of exons during mRNA processing. The corresponding polypeptide may possess additional functional domains or an absence of domains. Species variants are polynucleotide sequences that vary from one species to another. The resulting polypeptides generally will have significant amino acid identity relative to each other. A polymorphic variation is a variation in the polynucleotide sequence of a particular gene between individuals of a given species. Polymorphic variants also may encompass "single nucleotide polymorphisms" (SNPs) in which the polynucleotide sequence varies by one base. The presence of SNPs may be indicative of, for example, a certain population, a disease state, or a propensity for a disease state.
A nucleic acid that encodes a protein described herein may be linked to a regulatory element, e.g., a promoter, enhancer, silencer, and termination signal, as further described herein. One of skill in the art will readily understand that the proteins described herein can be expressed by expression vectors harboring nucleic acids that encode these proteins and that these expression vectors may be modified in a number of ways. The term "vector" refers to a nucleic acid capable of transporting another nucleic acid to which it has been linked. One type of vector which may be used in accord with the invention is an episome, i.e., a nucleic acid capable of extra-chromosomal replication. Other vectors include those capable of autonomous replication and expression of nucleic acids to which they are linked. Vectors capable of directing the expression of genes to which they are operatively linked are referred to herein as "expression vectors". As used herein, the term "operably linked" refers to a linkage of polynucleotide elements in a functional relationship. For instance, a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the coding sequence. More precisely, two DNA molecules (such as a polynucleotide containing a promoter region and a polynucleotide encoding a desired polypeptide or polynucleotide) are said to be "operably linked" if the nature of the linkage between the two polynucleotides does not (1) result in the introduction of a frame-shift mutation or (2) interfere with the ability of the polynucleotide containing the promoter to direct the transcription of the coding polynucleotide, hi general, expression vectors of utility in recombinant DNA techniques are often in the form of "plasmids" which refer to circular double stranded DNA molecules which, in their vector form are not bound to the chromosome, hi the present specification, "plasmid" and "vector" are used interchangeably as the plasmid is the most commonly used form of vector. However, the invention is intended to include such other forms of expression vectors which serve equivalent functions and which become known in the art subsequently hereto. Appropriate vectors may be introduced into host cells using well known techniques, such as infection, transduction, transfection, transvection, electroporation and transformation and accompanying reagents typically used to introduce the compositions into a cell. Generally, a plasmid vector is introduced in a precipitate, such as a calcium phosphate precipitate, or in a complex with a charged lipid. If the vector is a virus, it may be packaged in vitro using an appropriate packaging cell line and then transduced into cells. In one embodiment, the vector may be, for example, a phage, plasmid, viral or retroviral. Exemplary viral and retroviral vectors include adenovirus vectors, adeno-associated virus vectors, lentivirus vectors, herpes simplex virus (HSV) vectors, human immunodeficiency virus (HIV) vectors, bovine immunodeficiency virus (BIV), murine leukemia virus (MLV), and the like. Retroviral vectors may be replication competent or replication defective, hi the latter case, viral propagation generally will occur only in complementing host cells, hi a preferred - embodiment, the vector is a recombinant retroviral vector. A gene delivery vehicle can optionally comprise viral sequences such as a viral origin of replication or packaging signal. These viral sequences can be selected from viruses such as astrovirus, coronavirus, orthomyxovirus, papovavirus, paramyxovirus, parvovirus, picornavirus, poxvirus, retrovirus, togavirus or adenovirus. Recombinant retroviruses and various uses thereof have been described in numerous references including, for example, Mann et al., Cell 33: 153, 1983, Cane and Mulligan, Proc. Nat'l. Acad. Sci. USA 81 :6349, 1984, Miller et al., Human Gene Therapy 1:5-14, 1990, U.S. Patent Nos. 4,405,712, 4,861,719, and 4,980,289, and PCT Application Nos. WO 89/02,468, WO 89/05,349, and WO 90/02,806. Numerous retroviral gene delivery vehicles can be utilized in the present invention, including for example those described in EP 0,415,731; WO 90/07936; WO 94/03622; WO 93/25698; WO 93/25234;
U.S. Patent No. 5,219,740; WO 9311230; WO 9310218; Vile and Hart, Cancer Res. 53:3860- 3864, 1993; Vile and Hart, Cancer Res. 53:962-967, 1993; Ram et al., Cancer Res. 53:83-88, 1993; Takamiya et al., J. Neurosci. Res. 33:493-503, 1992; Baba et al., J. Neurosurg. 79:729- 735, 1993 (U.S. Patent No. 4,777,127, GB 2,200,651, EP 0,345,242 and WO91/02805). Other viral vector systems that can be used to deliver a polynucleotide of the invention have been derived from Moloney murine leukemia virus, e.g., Morgenstern and Land, Nucleic Acids Res. 18:3587-3596, 1990, herpes virus, e.g., Herpes Simplex Virus (U.S. Patent No. 5,631,236 by Woo et al., issued May 20, 1997 and WO 00/08191 by Neurovex), vaccinia virus (Ridgeway (1988) Ridgeway, "Mammalian expression vectors," hi: Rodriguez R L, Denhardt D T, ed. Vectors: A survey of molecular cloning vectors and their uses. Stoneham: Butterworth,; Baichwal and Sugden (1986) "Vectors for gene transfer derived from animal DNA viruses: Transient and stable expression of transferred genes," hi: Kucherlapati R, ed. Gene transfer. New York: Plenum Press; Coupar et al. (1988) Gene, 68:1-10), and several RNA viruses. Modifications may include individual nucleotide substitutions to a constitutively regulated vector or insertions or deletions of one or more nucleotides in the vector sequences. Modifications or operable linkages to a constitutively regulated vector that alter (i.e., increase or decrease) expression of a sequence interval (e.g., alternative promoters), provide greater cloning flexibility (e.g. alternative multiple cloning sites), provide greater experimental efficiency (e.g. alternative reporter genes), and/or increase vector stability are contemplated herein. hi one embodiment, an expression vector of the invention may be modified to replace a Gateway® cloning cassette with a multi-cloning sequence, containing restriction enzyme sites for insertion of potential enhancers through standard ligation.
A "promoter" herein refers to a DNA sequence recognized by the synthetic machinery of the cell required to initiate the specific transcription of a gene, hi another embodiment, an expression vector of the invention may be modified to eliminate the strong CMV promoter sequence, to allow testing of an enhancer-promoter combination, including the endogenous gene promoter, inducible promoter, cell type-specific promoter, minimal promoter or other alternative enhancer-promoter sequences known to the skilled artisan. It is also known that many proteins, e.g., kinases, can be activated simply by being overexpressed in a given cell. In one embodiment, the strong CMV promoter sequence can be replaced with an even stronger promoter or coupled with an improved enhancer or the like in order to cause increased expression of wild type or regulatable proteins, hi another embodiment, increased expression of wild type or regulatable proteins can be effected through coexpression of multiple copies of the gene with standard promoters. hi one embodiment, an expression vector will further contain sites for transcription initiation, termination and, in the transcribed region, a ribosome binding site for translation. The coding portion of the mature transcripts expressed by the constructs will preferably include a translation initiating site at the beginning and a termination codon (UAA, UGA or UAG) appropriately positioned at the end of the polypeptide to be translated.
In one embodiment, a vector of the invention may be modified to include reporter genes, including genes encoding fluorescent proteins or enzymes, such as β-galactosidase and alkaline phosphatase. In certain embodiments, fluorescent reporters may be replaced with alternate fluorescent reporters with shorter or longer protein half-life allowing more precise evaluation of the timing of regulatory control. A reporter may also be replaced by cassettes encoding protein substrates that allow observation (direct or indirect) of response based on cell/biochemical activity, e.g., in screens of chemical libraries to identify potential therapeutic chemical targets/leads.
In one embodiment, an expression vector can include at least one selectable marker. Such markers include dihydrofolate reductase, neomycin or puromycin resistance for eukaryotic cell culture and tetracycline, kanamycin, or ampicillin resistance genes for culturing in E. coli and other bacteria. Representative examples of appropriate hosts include, but are not limited to, bacterial cells, such as E. coli, Streptomyces and Salmonella typhimurium cells; fungal cells, such as yeast cells; insect cells such as Drosophila S2 and Sf9 cells; animal cells such as CHO, COS and Bowes melanoma cells; and plant cells. Appropriate culture mediums and conditions for the above-described host cells are known in the art.
Nucleic acids or proteins described herein may be present in one or more compositions. For example, nucleic acids or proteins may be present in wells of a multiwell plate or in individual tubes or devices. They may also be present, e.g., linked, to a solid surface. Accordingly, also provided herein are devices comprising a location, wherein the location comprises one or more nucleic acids described herein, e.g., a nucleic acid encoding a regulatable protein linked to one or more regulatory signals, wherein expression of the regulatable proteins in a cell results in the regulatable protein or biologically active portion thereof being constitutively regulated. Also provided herein are cells comprising one or more proteins, e.g., regulatable proteins linked to one or more regulatory signals or inhibitory mutants, or nucleic acid encoding these. A cell may be an isolated cell or it may be a cell that is part of a tissue or an organism. A cell may be a eukaryotic or a prokaryotic cell. A eukaryotic cell may be a human or a non-human mammalian or vertebrate cell, e.g., a simian, ovine, bovine, equine, porcine, canine, feline, rat or mouse cell. A prokaryotic cell may be a bacterial cell. Cells may comprise one or more nucleic acids or proteins. Exemplary cells are further described herein.
Further provided are methods comprising contacting a cell with a nucleic acid or a protein described herein. Contacting may be under conditions in which the nucleic acid or protein is taken up by the cell. For example, a cell may be contacted with a nucleic acid, or a pool of nucleic acids, under conditions resulting in transient transfection, in which the nucleic acids are essentially not integrated into the genome of the cell. Nucleic acids may also be contacted with a cell under conditions for stable transfection, resulting in one or more nucleic acids being integrated into the genome of the cell or in the form of an episome. The presence of an introduced nucleic acid or a protein in a cell can be determined according to methods known in the art.
II. Kits
Also provided herein are kits comprising one or more nucleic acids described herein, e.g., encoding a regulatable protein linked to one or more regulatory signals, wherein expression of the regulatable proteins in a cell results in the regulatable protein or biologically active portion thereof being constitutively regulated and packaging for said kit. Said kit may comprise one or more reagents necessary to express the regulatable proteins. In certain embodiments, the kit may further comprise a reference standard, e.g., a nucleic acid encoding a protein that does not affect or regulate signaling pathways controlling cell growth, division, migration, survival or apoptosis. One skilled in the art can envision many such control proteins, including, but not limited to, common molecular tags (e.g. green fluorescent protein and beta-galactosidase), proteins not classified in any pathway encompassing cell growth, division, migration, survival or apoptosis by GeneOntology reference, or ubiquitous housekeeping proteins. Reagents in the kit may be provided in individual containers or as mixtures of two or more reagents in a single container. In addition, instructional materials which describe the use of the compositions within the kit can be included.
IU. Exemplary assays
Provided herein are cell-based assays for identifying genes that are involved in causing cellular transformation or protecting against cellular transformation. A method may comprise contacting one or more cells with a nucleic acid or protein described herein. The method may further comprise determining whether a characteristic of the cells has changed. In one embodiment, a method comprises providing a cell that is not transformed and introducing into the cell one or more regulatable proteins linked to one or more regulatory signals or one or more nucleic acids encoding such. The method may further comprise determining whether the cell is transformed. In an illustrative embodiment, a pool of nucleic acids encoding about 10-100 regulatable proteins each linked to one or more regulatory signals is introduced into cells that are not transformed. The cells are cultured under conditions that allow the nucleic acids to express the encoded proteins and then the method comprises determining whether the cells have been transformed as a result of the presence and expression of the nucleic acids. If the cells have been transformed, the nucleic acids are divided into subpools, e.g., of about 10-20 nucleic acids, and these are introduced into the same or other non-transformed cells such that the encoded proteins are expressed. The method then comprises determining again whether the cells have been transformed. If the cells have been transformed, it indicates that one or more nucleic acids encodes a protein that has transforming capacity. The nucleic acids can then progressively combined into smaller pools and introduced into cell and the above-described steps are reiterated until the nucleic acid that causes the cell to become transformed has been identified. The regulatable protein encoded by the nucleic acid can be identified using well known techniques. In one embodiment, members of the regulatable protein library are administered in pools to determine whether any individual species within the set of pooled species is capable of altering characteristics of cellular transformation and/or tumorigenesis. In order to determine the identity of the effective species from each pool capable of altering characteristics of cellular transformation and/or tumorigenesis, transient expression or stable cell lines expressing individual species from each pool can be generated and analyzed for the ability to alter characteristics of cellular transformation and/or tumorigenesis. In a another embodiment, pools consisting of about 1-2, 1-5, 1-10, 1-20, 1-30, 1-40, 1-50, 1-100, 1-150, 1- 300, 1-600 or 1-1200 unique regulatable proteins are contacted simultaneously with cells. In another embodiment, pools may be divided according to a dendrogram-based organization of human kinases as described, for example, by Manning et al. (2002) Science 298: 1912-1919. One of skill in the art may expect to identify some regulatable proteins that will induce alterations in characteristics of cellular transformation in any cell type and others that display cell type-specificity with regard to such alterations.
The methods may also employ any of a variety of non-transformed cells. A cell may be immortalized or not immortalized. In one embodiment, a cell is an immortalized cell that contains one or more genetic modifications that leads the cell to the path of being transformed, without, however, transforming it. For example, a cell may comprise 1 , 2, 3 or more oncogenes but be only partially transformed, such that upon the addition of one more oncogene, the cell becomes transformed. Cells that are transformed but for the presence of one or more other genes or oncogenes are referred to herein as "quasi-transformed." In one example, a cell comprises one or more of the following genes and oncogenes or proteins: the catalytic subunit of telomerase (hTERT), telomerase, human papilloma virus E6, Human papilloma virus E7, cyclin Dl, an R24C form of CDK4 (CDK4R24C), p53DD, MYC, phosphatidylinositol-3-kinase, adenovirus early region IA (ElA), E6, E7, MDM2, SV40 large T antigen, SV40 small T antigen, RAC/RHO, PBK, AKT, RAF, MEK, MEKDD, MAPK, RAL-GEFs, RAL, PLDl, H-RAS, an activated allele of H-RAS (H-RASV12), ALT, CycDl/CDK4, or variants or fragments thereof that may be oncogenic or other such genes known in the art (see, e.g., Zhao et al., Trends MoI Med., 10:344-350, 2004; Hunter, Cell, 64:249-270, 1991; and references incorporated therein). As shown in the Examples, a quasi- transformed cell may comprise hTERT, SV40 large T antigen and SV40 small T antigen. Other cells are those in which one or more tumor suppressor genes are inhibited or inactivated. A cell may have, for example, an inhibited or inactivated copy of p53, retinoblastoma (Rb), PP2A, pi 9ARF, pl61NK4A or PTEN tumor suppressor genes or proteins or variants or fragments thereof that may be tumor resppressors or other such genes known in the art (see, e.g., Zhao et al., Trends MoI Med., 10:344-350, 2004; Hunter, Cell, 64:249-270, 1991; and references incorporated therein). Quasi-transformed cells may also comprise a combination of one or more oncogenes and one or more inactivated tumor suppressor genes. Thus, in some embodiments, cells express, although not limited to, c-myc, H-RAS, hTERT individually or together with loss of function of the p53, retinoblastoma (RB) or PTEN tumor suppressor genes individually or in various combinations to cause transformation and/or tumorigenicity. Quasi-transformed cells can also be created by inactivating an oncogene or by activating inactivated tumor suppressor genes.
The quasi-transformed cell may be of human or non-human origin. Exemplary cells include human kidney epithelial (HEK) cells, human mammary epithelial cells (HMEC) and human prostate epithelial cells (HPEC). In one embodiment a quasi-transformed cell is an HEK cell comprising SV40 large and small T antigen and hTERT (HAlE cell). Other quasi- transformed cells are described in the Examples.
The principle of quasi-transformed cells is based at least on the following. Recent work indicates that a limited set of genetic changes can suffice to transform human cells
(Hahn et al. (1999) Nature 436, 117-122). In one embodiment, the constitutive expression of the catalytic subunit of telomerase {hTERT) and the Large T (LT) and Small T (ST) oncoprotein of the SV40 Early Region (SV40ER) is sufficient to render a wide range of human cells transformed and/or tumorigenic, if supplied with an activated allele of H-RAS (H-RASV12, H-RAS) (Zhao et al. (2004) Trends MoI Med. 10, 344-350). It is known that LT contributes to cell transformation by binding to and inactivating the retinoblastoma (RB) and p53 tumor suppressor pathways. It is also known that ST contributes to cell transformation through its effects on the serine-threonine phosphatase family PP2A. In one embodiment, this set of proteins is expressed in human kidney epithelial (HEK), human mammary epithelial (HMEC) and human prostate epithelial cells (HPEC) (Berger et al. (2004) Cancer Res. 64, 8867-8875; Elenbaas and Weinberg (2001) Exp. Cell Res. 264, 169-184; Lundberg et al. (2002) Oncogene 21, 4577-4586; MacKenzie et al. (2002) Oncogene 21, 4200-4211; Rich et al. (2001) Cancer Res. 61, 3556-3560; Yu et al. (2001) Virology 290, 192-198). Other embodiments include experimental models containing defined combinations of cancer-associated mutations that are able to transform human cells without viral oncoproteins (Boehm et al. (2005) MoI. Cell. Biol. 25, 6464-6474; Kendall et al. (2005) Cancer Res. 65, 9824-9828; Zhao et al. (2005) Proc. Natl. Acad. ScL USA 102, 18443-18448) or experimental models that recapitulate particular tumor stages and types (Berger et al. (2004) Cancer Res. 64, 8867-8875; Chudnovsky et al. (2005) Nat. Genet. 37, 745-749; Zhao et al., (2003) Cancer Cell 3, 483-495). In yet another embodiment, the methods involve identifying genes and proteins affect cellular characteristics of transformation and/or tumorigenicity through the use of transformed and/or tumorigenic cells that are caused by undefined mutations or through the use of untransformed cells. Methods described herein may be referred to as complementing methods. As used herein, the term "complement" refers to the ability of a gene or gene product to substitute for the expression of another gene or gene product to affect cellular characteristics of transformation and/or tumorigenicity. hi one embodiment, non-transformed and/or non-tumorigenic cells are contacted with and made to take up and express compositions capable of expressing regulatable or inhibitory protein(s), either alone or in combinations thereof, to alter characteristics of cellular transformation and/or tumorigenicity and thereby identify proteins that can complement existing genetic changes that together cause transformation and/or tumorigenesis. In another embodiment, transformed and/or tumorigenic cells with undefined mutations can be contacted with and made to take up and express compositions capable of expressing either a regulatable or inhibitory protein(s), either alone or in combinations thereof, to identify proteins that can complement undefined mutations in altering transformation characteristics of the cell. For example, the activation or inactivation of an expressed kinase in a transformed cell may cause a transformed cell whose growth is no longer regulated by dependence on IL3 to become IL3-dependent. In yet another embodiment, non-transformed cells can be contacted with and made to take up compositions capable of expressing a regulatable protein or inhibitory protein(s), either alone or in combinations thereof, to identify proteins that can complement wild type proteins in altering transformation characteristics of the cell. For example, the activation or inactivation of an expressed kinase may cause a non- transformed cell whose growth is IL3-dependent to no longer be regulated by IL3 for growth. A skilled artisan will appreciate that many cytokines or growth factors can be similarly used, including, but not limited to, members of the platelet-derived growth factor (PDGF), epidermal growth factor (EGF), fibroblast growth factor (FGF), bone morphogenetic proteins (BMPs), nerve growth factor (NGF), erythropoietin, insulin-like growth factor (IGF), tumor necrosis factor (TNF), colony stimulating factor (CSF), neurotrophin, transforming growth factor beta (TGFβ), IL-2, interferon (IFN), IL-10, IL-I, and IL- 17 families.
In one embodiment a transformed cell is contacted with one or more nucleic acids encoding one or more inhibitory mutants of proteins. Expression of one or more inhibitory mutants of proteins may downregulate one or more biological activities associated with the corresponding wild-type proteins. For example, cells can be contacted with pools of nucleic acids, such that the nucleic acids enter the cells and are expressed therein. The cell is then tested for loss of transforming capacity. Subpools of nucleic acids are then introduced into the same or different cells and the cells are tested for modulation, e.g. loss, of transforming capacity. These steps are reiterated until a nucleic acid encoding a protein that modulates, e.g. reverses, transformation is identified.
Several in vitro and in vivo assays for assessing characteristics of cellular transformation and/or tumorigenicity are envisioned. These assays rely on well described changes in cellular characteristics related to cellular transformation including, but not limited to, formation of foci, anchorage independence, loss of growth factor or serum requirements (e.g. IL-3 -independent growth), change in cell morphology, ability to form tumors when injected into suitable animal hosts, and/or immortalization of the cell. In one embodiment, the well described anchorage-independent growth and colony formation in soft agar constitutes an in vitro transformation assay. When anchorage independence is the transformation characteristic being used in a particular assay, the cells used in the assay are cells which, when not transformed, are anchorage dependent. That is, when such cells are not transformed, they grow only when attached to a solid surface. Upon becoming transformed, such cells will grow in a medium (e.g. semi-solid agar) without being attached to a solid surface. In another embodiment, the well described tumor formation assay in immunocompromised ("nude") animals constitutes an in vivo transformation assay. Clones from colonies that grow in soft agar or as tumors in animals can be re-isolated by PCR on genomic DNA using vector-specific primers. Re-introduction of re-isolated regulatable proteins into the parental cells can serve to confirm that they reproducibly confer a transformed phenotype. The methods envision subsequent assays to determine if the regulatable proteins that suffice to transform human cells are physiologically related to processes involved in driving spontaneously arising human cancers. An assay may rely on changes in expression characteristics of the gene identified in the above assay in human cancer specimens or cell lines derived from human cancer specimens relative to normal counterparts including, but not limited to, copy number gain, increased transcript levels, increased protein levels and oncogene addiction (Weinstein and Joe (2006) Nat. Clin. Pr act. Oncol. 3, 448-457). Increased gene copy number can be detected by standard techniques currently known in the art and include for example, high-density SNP array (Zhao et al. (2004) Cancer Res. 64, 3060-3071 ), comparative genome hybridization (aCGH) (Pinkel et al. (1998) Nat Genet. 20, 207-211) and/or fluorescence in situ hybridization (FISH) analyses. Increased transcript levels can be detected by standard techniques currently known in the art and include, for example, serial analysis of gene expression (SAGE), transcript expression microarray, publicly or privately available transcript expression databases, quantitative reverse transcription-coupled polymerase chain reaction (qRT-PCR), Northern blot, and/or RNase protection analyses. The degree of differences in expression levels need only be large enough to be visualized or measured via standard characterization techniques. Increased protein levels can be detected by standard techniques currently known in the art and include, for example, quantitative Western blot analyses using antibodies that detect either the protein itself or a peptide tag associated with the protein. Oncogene addiction is a phenomenon in which the expression of many oncogenes renders cancer cells unusually dependent upon the expression of the oncogene for cell proliferation or viability (Weinstein and Joe (2006) Nat. Clin. Pract. Oncol. 3, 448-457). The degree of oncogene addiction maybe assessed by determining the extent to which cell proliferation or viability is affected when the cell is deprived of the functional oncoprotein. This may be achieved, for example, using RNA interference (RNAi), immunodepletion, dominant negative mutations, or loss-of function mutations directed against the oncoprotein itself or the messenger RNA transcript or DNA gene encoding the oncoprotein.
IV. Exemplary uses for transforming and anti-tumor genes
Regulatable proteins that alter characteristics of cellular transformation and/or tumorigenesis and were, e.g., identified by the methods described herein, can be used as a marker for the detection of disorders or diseases, e.g., cancer, that are associated with abnormal expression of the regulatable protein or generally for predicting whether a subject has or is likely to develop such as disorder or disease
In one embodiment, a regulatable protein causing cellular transformation identified as described herein is expressed in a cell and the phosphorylation profile (i.e., the phosphorylation status of proteins within the cell) of the cell is determined. Comparison of the phosphorylation profile to that of a cell that was not transformed with the transforming regulatable protein will indicate a specific set of proteins that are phosphorylated only in the transformed cell. This phosphorylation profile can then be used as a point of comparison to determine whether a cell is transformed, e.g., by this particular transforming regulatable protein.
In another embodiment, an inhibitory protein, e.g. a dominant negative protein, causing cellular transformation identified as described herein is expressed in a cell and the phosphorylation profile (i.e., the phosphorylation status of proteins within the cell) of the cell is determined. Comparison of the phosphorylation profile to that of a cell that was not transformed with the inhibitory protein will indicate a specific set of proteins that are phosphorylated only in the transformed cell. This phosphorylation profile can then be used as a point of comparison to determine whether a cell is transformed, e.g., by this particular inhibitory protein.
In another embodiment, gene expression products of a cell in which a transforming regulatable protein is expressed are determined. By comparison with a cell that does not express the transforming regulatable protein, a specific set of gene expression products that are up- or down-regulated by the regulatable protein can be identified. This expression profile can then be used as a point of comparison to determine whether a cell is transformed , e.g., by this particular transforming regulatable protein. In another embodiment, gene expression products of a cell in which a transforming inhibitory protein is expressed are determined. By comparison with a cell that does not express the transforming inhibitory protein, a specific set of gene expression products that are up- or down-regulated by the inhibitory protein can be identified. This expression profile can then be used as a point of comparison to determine whether a cell is transformed, e.g., by this particular inhibitory protein.
Determination of gene expression products from cells can be performed using common methods in the art (see, e.g., U.S. Patent Application Nos: 20030013208A1; 20020155493A1, 20030017515 and U.S. Pat. Nos: 6,329,209; 6,365,418, 6,618,6796; 6,379,897; 6,664,377; 6,451,536; 548,257; U.S. 20030157485 and Schena et al. (1995) Science 20, 467-470; Gerhold et al. (1999) Trends In Biochem. Sci. 24, 168-173; and Lennon et al. (2000) Drug Discovery Today 5, 59-65, which are herein incorporated by reference in their entirety). The genes and proteins identified may be used for treating or preventing cancer, e.g., by down-regulating or up-regulating the levels of said identified genes and proteins. The genes and proteins identified can also be used to determine if the expression of such genes and proteins (e.g. a particular gene splice variant or a protein with a particular phosphorylation state) is associated with: 1) the identity of a sample (i.e. tumor or normal); 2) the state of differentiation; or 3) the predicted clinical outcome (e.g., either non-recurrence of tumor after surgery or recurrence). In one embodiment, a biological sample can be classified with respect to a phenotypic effect, e.g. presence or absence cellular transformation characteristics, comprising the steps of isolating a gene expression product from a sample, for example from a cell or cells in the sample, and determining a gene expression profile of at least one informative gene, wherein the gene expression profile is correlated with a phenotypic effect, thereby classifying the sample with respect to a phenotypic effect. According to the methods of the invention, samples can be classified as belonging to (i.e. derived from) an individual who has or is likely to develop cancer. In a preferred embodiment, this cancer is breast cancer.
As used herein, "gene expression products" include proteins, peptides and nucleic acid molecules (e.g., mRNA, tRNA, rRNA, or cRNA). The nucleic acid molecule levels measured can be derived directly from the gene or, alternatively, from a corresponding regulatory gene. All forms of gene expression products can be measured, including, for example, splice variants or states of protein modificationm (e.g., phosphorylated versus unphosphorylated states of a given protein). Similarly, gene expression can be measured by assessing the level of protein or derivative thereof translated from mRNA. The sample to be assessed can be any sample that contains a gene expression product. Suitable sources of gene expression products, i.e., samples, can include cells, lysed cells, cellular material for determining gene expression, or material containing gene expression products. Examples of such samples are blood, plasma, lymph, urine, tissue, mucus, sputum, saliva or other cell samples. Methods of obtaining such samples are known in the art. In a preferred embodiment, the sample is derived from an individual who has been clinically diagnosed as having cancer or at risk of developing cancer.
As used herein, "obtaining" means acquiring a sample, either by directly procuring a sample from a patient or a sample (tissue biopsy, primary cell, cultured cells), or by receiving the sample from one or more people who procured the sample from the patient or sample and determining the gene expression levels therein.
Once the samples are obtained, the profile of gene expression levels of the sample are determined. As used herein, "gene expression profiles" are defined as the level of gene expression of a particular gene, protein or modified protein and groups thereof as assessed by methods described herein, hi one embodiment, the gene expression product is a nucleic acid. The skilled artisan will readily know many methods to determine gene expression levels of individual or groups of gene transcripts expressed in a given sample. For example, gene transcript levels can be determined using serial analysis of gene expression (S AGE), transcript expression microarray, publicly or privately available transcript expression databases, quantitative reverse transcription-coupled polymerase chain reaction (qRT-PCR), Northern blot, and/or RNase protection analyses, hi another embodiment, the gene expression product is a protein or polypeptide. Protein levels can be detected by standard techniques currently known in the art and include, for example, quantitative Western blot analyses using antibodies that detect either the protein itself or a peptide tag associated with the protein. Such antibodies, if directed against modified proteins (e.g. phosphorylated protein forms), are useful for detecting modified protein species that may be differentially present in cancer cells relative to appropriate controls. A skilled artisan will understand that transcript and protein levels of a given gene may be altered due to alterations in the copy of number of that gene in the genome. A skilled artisan will also understand that expression of numerous genes can be measured simultaneously, using genome-wide methods known in the art and that the assessment of numerous genes provides for a more accurate evaluation of the sample because there are more genes that can assist in classifying the sample.
Once the gene expression levels of the sample are obtained, the levels are compared or evaluated against appropriate controls, and the sample is classified. The evaluation of the sample determines whether or not the sample should be assigned to the particular phenotypic class being studied. The gene expression value measured or assessed can be interpreted using a number of methods familiar to the skilled artisan. For example, numeric expression values can be quantified and analyzed with software (e.g., Microsoft Excel® spreadsheet and Affymetrix GENECHIP® software). Phenotype classification (e.g. presence or absence of cancer, diagnostic risk assessment for developing cancer or state of therapeutic outcome) can be made by comparing the gene expression profile of the sample with respect to one or more informative genes, proteins and modified proteins with one or more appropriate control gene expression profiles (e.g., in a database). For example, a level of a regulatable protein, e.g., IKKε, that is higher or lower in a sample of a subject relative to a control sample indicates that the subject may have or is likely to develop cancer.
As used herein, "informative genes" can be cancer identification genes, for example, all or a subset of the genes having increased or decreased expression in immediately transformed cells relative to appropriate controls; cancer differentiation genes, for example, all or a subset of the genes having increased or decreased expression in established transformed cells relative to appropriate controls; and tumor recurrence genes, for example, all or a subset of genes having increased or decreased expression in recurrent tumors relative to appropriate controls. A skilled artisan will readily understand that not all informative genes for a particular class distinction must be assessed in order to classify a sample. For example, it may be sufficient to determine that a level of a regulatable protein, e.g., IKKε, that is higher or lower in a sample of a subject relative to a control sample indicates that the subject may have or is likely to develop cancer. Similarly, the set of informative genes for one phenotypic effect may or may not be the same as the set of informative genes for a different phenotypic effect. For example, a subset of the informative genes which demonstrate a high correlation with a class distinction can be used. This subset can be, for example, 1 or more genes, 2 or more genes, 3 or more genes, 4 or more genes, 5 or more genes, 10 or more genes, 25 or more genes, or 50 or more genes. It will be understood that the methods of the present invention classify a sample by evaluating a sample for a gene or combination of genes, proteins or modification states of proteins whose expression is increased and/or decreased in transformed cells relative to appropriate controls.
The correlation between gene expression criteria used to classify a sample and class distinction can be used to evaluate the effectiveness of the given gene expression criteria as a diagnostic marker for a given class distinction. This correlation can be determined using a variety of methods. For example, methods of defining classes and classifying samples are known in the art, as exemplified in U.S. patent application Ser. No. 09/544,627, filed Apr. 6, 2000 by Golub et al.
Also provided are methods for monitoring the effect of a regulatable protein on characteristics of cellular transformation or for monitoring the effect of a treatment regimen in an individual by monitoring the gene expression profile for one or more informative genes relative to appropriate controls. For example, a baseline gene expression profile for an immortal, non-transformed cell (e.g. HMEL) can be determined, and repeated gene expression profiles can be determined at time points after which a regulatable protein(s) is added that is able to complement a known protein in altering characteristics of cellular transformation (e.g. HMELs expressing MEKDD and IKBKE). Analysis of gene expression differences at different time points can identify informative genes useful in the diagnosis of cancer types and stages and useful in identifying therapeutic targets. Similarly, a baseline gene expression profile from an individual at risk for cancer or having cancer can be determined, and repeated gene expression profiles can be determined at various time points during cancer treatment. For example, a shift in gene expression profile from a profile correlated with poor treatment outcome to a profile correlated with improved treatment outcome is evidence of an effective therapeutic regimen, while a repeated profile correlated with poor treatment outcome is evidence of an ineffective therapeutic regimen.
V. Compositions and methods for diagnosing a disease or disorder based on regulatable proteins identified herein
The term "cancer" is meant to be interpreted in the broadest sense, and to include solid and nonsolid malignancies, premalignancies, and tumors which are malignant by virtue of their location such as, for example, within the brain. The term "cancers of epithelial origin" refers to cancers that arise from epithelial cells which include, but are not limited to, breast cancer, basal cell carcinoma, adenocarcinoma, gastrointestinal cancer, lip cancer, mouth cancer, esophageal cancer, small bowel cancer and stomach cancer, colon cancer, liver cancer, bladder cancer, pancreas cancer, ovary cancer, cervical cancer, lung cancer, breast cancer and skin cancer, such as squamus cell and basal cell cancers, prostate cancer, renal cell carcinoma, and other known cancers that effect epithelial cells throughout the body.
The term "aggressive" or "invasive" with respect to cancer refers to the proclivity of a tumor for expanding beyond its boundaries into adjacent tissue (Darnell, J. (1990), Molecular Cell Biology, Third Ed., W. H. Freeman, N. Y.). Invasive cancer can be contrasted with organ-confined cancer wherein the tumor is confined to a particular organ. The invasive property of a tumor is often accompanied by the elaboration of proteolytic enzymes, such as collagenases, that degrade matrix material and basement membrane material to enable the tumor to expand beyond the confines of the capsule, and beyond confines of the particular tissue in which that tumor is located. The term "metastasis", as used herein, refers to the condition of spread of cancer from the organ of origin to additional distal sites in the patient. The process of tumor metastasis is a multistage event involving local invasion and destruction of intercellular matrix, intravasation into blood vessels, lymphatics or other channels of transport, survival in the circulation, extravasation out of the vessels in the secondary site and growth in the new location (Fidler, et al, Adv. Cancer Res. 28, 149-250 (1978), Liotta, et al., Cancer Treatment Res. 40, 223-238 (1988), Nicolson, Biochim. Biophy. Acta 948, 175-224 (1988) and Zetter, N. Eng. J. Med. 322, 605-612 (1990)). Increased malignant cell motility has been associated with enhanced metastatic potential in animal as well as human tumors (Hosaka, et al., Gann 69, 273-276 (1978) and Haemmerlin, et al., Int. J. Cancer 27, 603-610 (1981)).
A "biological sample" refers to a sample of biological material obtained from a subject, preferably a human subject, including a tissue, a tissue sample, a cell sample, a tumor sample, and a biological fluid, e.g., blood, urine and a nipple aspirate. A biological sample may be obtained in the form of , e.g., a tissue biopsy, such as, an aspiration biopsy, a brush biopsy, a surface biopsy, a needle biopsy, a punch biopsy, an excision biopsy, an open biopsy, an incision biopsy, and an endoscopic biopsy.
An "isolate" of a biological sample (e.g., an isolate of a tissue or tumor sample) refers to a material or composition (e.g., a biological material or composition) which has been separated, derived, extracted, purified or isolated from the sample and additionally may be substantially free of undesirable compositions and/or impurities or contaminants associated with the biological sample.
A "tissue sample" includes a portion, piece, part, segment, or fraction of a tissue which is obtained or removed from an intact tissue of a subject, preferably a human subject.
A "tumor sample" includes to a portion, piece, part, segment, or fraction of a tumor, for example, a tumor which is obtained or removed from a subject (e.g., removed or extracted from a tissue of a subject), preferably a human subject.
A "primary tumor" is a tumor appearing at a first site within the subject and can be distinguished from a "metastatic tumor" which appears in the body of the subject at a remote site from the primary tumor. The term "level" refers to the qualitative and/or quantitative amount and/or activity of, for example, a regulatable protein in a given specimen, cell, tissue, organ, subject, etc.
Provided herein are methods for determining whether a subject has or is likely to develop a disease or disorder, e.g. cancer, associated with a regulatable protein identified herein. A method may comprise measuring the level of expression of a regulatable protein, e.g., IKKε, in a subject, e.g., in a biological sample obtained from a patient. The method may further comprise comparing the observed level of the regulatable protein in said sample against one or a range of levels of the regulatable protein normally found in biological samples (of the same type) of healthy individuals. Determining the level of a regulatable protein in a cell or a biological sample includes qualitatively or quantitatively determining the level and/or the activity of the protein of the regulatable protein or degradation product thereof, the level of mRNA or pre-mRNA encoding said regulatable protein, the number of genomic loci encoding said regulatable protein, or the level and/or activity of any biological molecule or product that is indicative of expression of said regulatable protein, or degradation product thereof.
It may be sufficient to detect the presence of the regulatable protein rather than determining its level and comparing it to a standard or control level, as the levels of the regulatable protein may be relatively low in normal cells and tissues and may not be detectable by standard methods of detection, e.g., immunohistochemistry.
In one embodiment, a control may constitute the level of a regulatable protein, e.g., IKKε, in a normal or healthy tissue of the same type as that from which a sample was obtained. A control may also be an average or mean value of at least 2, 5, 10 or more values of levels of the regulatable protein in normal or healthy tissues. A control may also be a normal control sample, i.e., a sample obtained from a normal or healthy individual, or an individual who does not have cancer, or at least not the type of cancer that is being investigated.
For purposes of comparison, a test sample and a normal control sample may be of the same type, that is, obtained from the same biological source. A normal control sample can also be a standard sample that contains the same concentration of a regulatable protein that is normally found in a biological sample of the same type and that is obtained from a healthy individual, e.g., an individual who does not have cancer, e.g., breast cancer. For example, there can be a standard normal control sample for the amounts of a regulatable protein normally found in a cell or tissue. When comparing the level of a regulatable protein to a control value, an increased likelihood for developing cancer or having cancer may be concluded from the presence of at least about 1.5 fold, 2 fold, 5 fold, 10 fold, 30 fold, 50 fold, 100 fold higher or lower levels of the regulatable protein in the sample of the subject compared to the control value. The term "higher or lower level" in the context of levels of a regulatable protein in a sample from a patient relative to a control value of the level in a tissue from a healthy subject refers to a level that is statistically significant or significantly above or below levels found in the control value or tissue from the healthy subject. The term "statistically significant" or "significantly" refers to statistical significance and generally means a two standard deviation (2SD) or larger difference in regulatable protein levels of the marker in the experimental sample relative to the control. The levels of the regulatable protein can be represented by arbitrary units, for example, as units obtained from a densitometer, luminometer, or an ELISA plate reader.
Levels of a regulatable protein, e.g., IKKε, may also be determined in cells or tissue adjacent to or in the vicinity of a tumor, e.g., lymph node cells. A control value or sample may then be obtained from the same type of cells.
Based at least on the fact that tests based on a regulatable protein described herein may be more sensitive than known tests in predicting the presence or development of cancer, one can also determine levels of the regulatable protein in tissue that does not appear to contain a growth or tumor. The presence of higher or lower levels of the regulatable protein in such a tissue would indicate the presence or the likelihood of development of cancer in said tissue or potentially another tissue.
The methods described herein may be useful for determining whether a subject has or is likely to develop any one of a variety of cancers. Examples of such cancers include, but are not limited to, epithelial cancers, urogenital cancer, e.g., urinary bladder cancer, transitional cell carcinoma (TCC), prostate cancer, lung carcinoma, breast carcinoma, thyroid carcinoma, brain cancers (cerebellum, medulloblastoma, astrocytoma, ependymoma, glioblastoma), pancreatic carcinoma, ovarian carcinoma, uterine cancer, eye cancer (retinoblastoma), muscle (rhabdosarcoma), lymphoma, stomach cancer, liver cancer, and colon cancer. Generally, cancers may be cancers of the prostate, lung, breast, thyroid, brain (e.g., cerebellum, medulloblastoma, astrocytoma, ependymoma, glioblastoma), pancreas, ovary, eye (e.g., retinoblastoma), muscle (e.g., rhabdosarcoma), lymph, stomach, liver, colon, bladder, uterus, and kidney.
Determining the levels of a regulatable protein, e.g., IKKε, in a subject or a biological sample may also be used to determine whether a subject has or is likely to develop cancer. In one embodiment, a method for determining whether a subject has or is likely to develop cancer comprises determining the level of a regulatable protein in the subject, such as in cells or tissues of the subject. The method allows the detection or likelihood of development of any cancer that is associated with high or low expression of the regulatable protein relative to an appropriate control, as further described herein. A method may involve measuring levels of the regulatable protein in a test sample obtained from a patient having or suspected of having cancer. A method may further comprise comparing the observed levels of the regulatable protein to a control or to levels of the regulatable protein found in a normal control sample, for example, a sample obtained from a subject that does not have cancer. The presence of regulatable protein at levels that are higher or lower than those observed in an appropriate control indicate the presence of cancer or the likelihood of developing cancer.
Additionally, disease progression can be assessed by following the levels of a regulatable protein, e.g. DCKε levels, in individual patients over time. Accordingly, methods provided herein also include methods for monitoring the progression of cancer in a subject, comprising, e.g., monitoring the presence or level of the regulatable protein in a cell, e.g., in a cancerous cell or tumor, of the subject over time. A change in the regulatable protein over time indicates that the cancer is progressing or retreating. In another embodiment, a reference reading is taken after an operation involving the cancer and others taken at regular intervals subsequent to the operation. Any change in the level of the regulatable protein over time indicates that the cancer is progressing or retreating.
The information provided by the methods described herein may be used by the physician in determining the most effective course of treatment. A course of treatment refers to the therapeutic measures taken for a patient after diagnosis or after treatment for cancer. For example, a determination of the likelihood for cancer recurrence, spread, or patient survival, can assist in determining whether a more conservative or more radical approach to therapy should be taken, or whether treatment modalities should be combined. For example, when cancer recurrence is likely, it can be advantageous to precede or follow surgical treatment with chemotherapy, radiation, immunotherapy, biological modifier therapy, gene therapy, vaccines, and the like, or adjust the span of time during which the patient is treated.
Also provided herein are methods for diagnosing followed by treating a subject having cancer. A method may comprise (i) determining the level of a regulatable protein, e.g., IKKε, in a cancerous tumor of a subject; and (ii) if the level of the regulatable protein is higher or lower in the cancerous tumor of the subject relative to a control, treating the subject aggressively, whereas if the level of the regulatable protein in the cancerous tumor of a subject is statistically within the range of an appropriate control, treating the subject less aggressively. An aggressive therapy may comprise surgical removal of cancer cells or a tissue comprising the cancer cells, e.g., mastectomy in the case of breast cancer, chemotherapy, radiation, or a combination thereof. Surgical removal may be followed by early systematic therapy. The treatment may then be followed by continued monitoring of the levels of the regulatable protein.
The levels of the regulatable protein in cancer patients can be easily added in the pathology report with other pathological predictors including tumor size, grade, subtype, and stage for the patient's outcome information and clinical treatment. Determining the level of a regulatable protein, e.g., IKKε, may also be combined with the detection of one or more other biomarkers for which increased or decreased expression correlates with cancer. The selected biomarker can be a general diagnostic or prognostic marker useful for multiple types of cancer, such as CA 125, CEA or LDH, or can be a cancer- specific diagnostic or prognostic marker, such as a breast cancer marker (for example, CA 15- 2. Her-2/neu and CA 27.29), colon cancer marker (for example, sialosyl-TnCEA, CAl 9-9, or LASA), ovarian cancer marker (for example, CA72-4), lung cancer (for example, neuron- specific enolase (NSE) and tissue polypeptide antigen (TPA)), prostate cancer (for example, PSA, prostate-specific membrane antigen and prostatic acid phosphatase), melanoma (for example, S-100 and TA-90), as well as other biomarkers specific for other types of cancer. Those skilled in the art will be able to select useful diagnostic or prognostic markers for detection in combination with a regulatable protein. Similarly, three or more, four or more or five or more or a multitude of biomarkers can be used together for determining a diagnosis or prognosis of a patient. Also provided herein are kits, e.g., kits for determining the level of a regulatable protein, e.g. IKKε, in a subject or in a biological sample of a subject. A kit may comprise any agent useful for qualitatively or quantitatively detecting the regulatable protein, RNA (including pre-mRNA and mRNA) encoding the regulatable protein, or changes in copy number of genomic loci encoding the regulatable protein, such as agents further described herein. A kit may further comprise a control, such as a control value or control sample or control tissue. A control may be protein or nucleic acid attached to a solid support. A kit may also comprise additional components or reagents necessary for the detection of the regulatable protein, such as secondary antibodies for use in immunohistochemistry.
In one embodiment, the protein level of a regulatable protein, e.g., IKKε, is measured. It is generally preferred to use antibodies, or antibody equivalents, to detect the regulatable protein. Methods for the detection of protein are well known to those skilled in the art, and include ELISA (enzyme linked immunosorbent assay), RIA (radioimmunoassay), Western blotting, and immunohistochemistry. Immunoassays, such as ELISA or RIA, which can be extremely rapid, are more generally preferred. Antibody arrays or protein chips can also be employed, see for example U.S. Patent Application Nos: 20030013208A1; 20020155493 Al, 20030017515 and U.S. Pat. Nos: 6,329,209; 6,365,418, herein incorporated by reference in their entirety.
ELISA and RIA procedures may be conducted such that a protein standard for the regulatable protein is labeled (with a radioisotope such as 125I or 35S, or an assayable enzyme, such as horseradish peroxidase or alkaline phosphatase), and, together with the unlabelled sample, brought into contact with the corresponding antibody, whereon a second antibody is used to bind the first, and radioactivity or the immobilized enzyme assayed (competitive assay). Alternatively, the regulatable protein in the sample is allowed to react with the corresponding immobilized antibody, radioisotope- or enzyme-labeled antibody that specifically recognizes the regulatable protein is allowed to react with the system, and radioactivity or the enzyme assayed (ELIS A-sandwich assay). Other conventional methods may also be employed as suitable.
The above techniques may be conducted essentially as a "one-step" or "two-step" assay. A "one-step" assay involves contacting antigen with immobilized antibody and, without washing, contacting the mixture with labeled antibody. A "two-step" assay involves washing before contacting, the mixture with labeled antibody. Other conventional methods may also be employed as suitable.
In one embodiment, a method for measuring the levels of a regulatable protein comprises the steps of: contacting a biological specimen with an antibody or variant (e.g., fragment) thereof which selectively binds the regulatable protein, and detecting whether said antibody or variant thereof is bound to said sample and thereby measuring the levels of the regulatable protein.
Enzymatic and radiolabeling of the regulatable protein and/or the antibodies may be effected by conventional means. Such means will generally include covalent linking of the enzyme to the antigen or the antibody in question, such as by glutaraldehyde, specifically so as not to adversely affect the activity of the enzyme, by which is meant that the enzyme must still be capable of interacting with its substrate, although it is not necessary for all of the enzyme to be active, provided that enough remains active to permit the assay to be effected. Indeed, some techniques for binding enzyme are non-specific (such as using formaldehyde), and will only yield a proportion of active enzyme.
It is usually desirable to immobilize one component of the assay system on a support, thereby allowing other components of the system to be brought into contact with the component and readily removed without laborious and time-consuming labor. It is possible for a second phase to be immobilized away from the first, but one phase is usually sufficient.
It is possible to immobilize the enzyme itself on a support, but if solid-phase enzyme is required, then this is generally best achieved by binding to antibody and affixing the antibody to a support, models and systems for which are well-known in the art. Simple polyethylene may provide a suitable support. Enzymes employable for labeling are not particularly limited, but may be selected from the members of the oxidase group, for example. These catalyze production of hydrogen peroxide by reaction with their substrates, and glucose oxidase is often used for its good stability, ease of availability and cheapness, as well as the ready availability of its substrate (glucose). Activity of the oxidase may be assayed by measuring the concentration of hydrogen peroxide formed after reaction of the enzyme-labeled antibody with the substrate under controlled conditions well-known in the art.
Other techniques may be used to detect a regulatable protein according to a practitioner's preference based upon the present disclosure. One such technique is Western blotting (Towbin et at., Proc. Nat. Acad. Sci. 76:4350 (1979)), wherein a suitably treated sample is run on an SDS-PAGE gel before being transferred to a solid support, such as a nitrocellulose filter. Antibodies that bind the regulatable protein (unlabeled) are then brought into contact with the support and assayed by a secondary immunological reagent, such as labeled protein A or antiimmunoglobulin (suitable labels including 125I, horseradish peroxidase and alkaline phosphatase). Chromatographic detection may also be used.
Immunohistochemistry may be used to detect expression of the regulatable protein, e.g., in a biopsy sample. A suitable antibody is brought into contact with, for example, a thin layer of cells, washed, and then contacted with a second, labeled antibody. Labeling may be by fluorescent markers, enzymes, such as peroxidase, avidin, or radiolabelling. The assay is scored visually, using microscopy.
Antibodies that bind the regulatable protein may also be used for imaging purposes, for example, to detect the presence of the regulatable protein in cells and tissues of a subject. Suitable labels include radioisotopes, iodine (1251, 121I), carbon (14C), sulphur (35S), tritium (3H), indium ( 12In), and technetium ("mTc), fluorescent labels, such as fluorescein and rhodamine, and biotin.
For in vivo imaging purposes, antibodies are not detectable, as such, from outside the body, and so must be labeled, or otherwise modified, to permit detection. Markers for this purpose may be any that do not substantially interfere with the antibody binding, but which allow external detection. Suitable markers may include those that may be detected by X- radiography, NMR or MRI. For X-radiographic techniques, suitable markers include any radioisotope that emits detectable radiation but that is not overtly harmful to the patient, such as barium or cesium, for example. Suitable markers for NMR and MRI generally include those with a detectable characteristic spin, such as deuterium, which may be incorporated into the antibody by suitable labeling of nutrients for the relevant hybridoma, for example. The size of the subject, and the imaging system used, will determine the quantity of imaging moiety needed to produce diagnostic images, hi the case of a radioisotope moiety, for a human subject, the quantity of radioactivity injected will normally range from about 5 to 20 millicuries of technetium-99 m. The labeled antibody or antibody fragment will then preferentially accumulate at the location of cells which contain the regulatable protein. The labeled antibody or antibody fragment can then be detected using known techniques.
Antibodies that may be used to detect a regulatable protein include any antibody, whether natural or synthetic, full length or a fragment thereof, monoclonal or polyclonal, that binds sufficiently strongly and specifically to the regulatable protein to be detected. An antibody may have a Kd of at most about 10-6M, 10-7M, 10-8M, 10-9M, 10-10M, 10-11M, 10- 12M. The phrase "specifically binds" refers to binding of, for example, an antibody to an epitope or antigen or antigenic determinant in such a manner that binding can be displaced or competed with a second preparation of identical or similar epitope, antigen or antigenic determinant. An antibody may bind preferentially to the regulatable protein relative to other proteins, such as related proteins, including homologs of the regulatable protein.
Such antibodies may be commercially available or may be prepared according to methods known in the art.
Antibodies and derivatives thereof that may be used encompass polyclonal or monoclonal antibodies, chimeric, human, humanized, primatized (CDR-grafted), veneered or single-chain antibodies as well as functional fragments, i.e., binding fragments a regulatable protein, of antibodies. For example, antibody fragments capable of binding to the regulatable protein or portions thereof, including, but not limited to, Fv, Fab, Fab' and F (ab1) 2 fragments can be used. Such fragments can be produced by enzymatic cleavage or by recombinant techniques. For example, papain or pepsin cleavage can generate Fab or F (ab1) 2 fragments, respectively. Other proteases with the requisite substrate specificity can also be used to generate Fab or F (ab1) 2 fragments. Antibodies can also be produced in a variety of truncated forms using antibody genes in which one or more stop codons have been introduced upstream of the natural stop site. For example, a chimeric gene encoding a F (ab') 2 heavy chain portion can be designed to include DNA sequences encoding the CH, domain and hinge region of the heavy chain.
Synthetic and engineered antibodies are described in, e.g., Cabilly et al., U.S. Pat. No. 4,816,567 Cabilly et al., European Patent No. 0,125,023 Bl; Boss et al., U.S. Pat. No. 4,816,397; Boss et al., European Patent No. 0,120,694 Bl; Neuberger, M. S. et al., WO 86/01533; Neuberger, M. S. et al., European Patent No. 0,194,276 Bl; Winter, U.S. Pat. No. 5,225,539; Winter, European Patent No. 0,239,400 Bl; Queen et al., European Patent No. 0451216 Bl; and Padlan, E. A. et al., EP 0519596 Al. See also, Newman, R. et al., BioTechnology, 10: 1455-1460 (1992), regarding primatized antibody, and Ladner et al., U.S. Pat. No. 4,946,778 and Bird, R. E. et al., Science, 242: 423-426 (1988)) regarding single- chain antibodies. Antibodies produced from a library, e.g., phage display library, may also be used.
In some embodiments, agents that specifically bind to a regulatable protein, e.g., IKKε, other than antibodies are used, such as peptides. Peptides that specifically bind to the regulatable protein can be identified by any means known in the art. For example, specific peptide binders of the regulatable protein can be screened for using peptide phage display libraries.
Generally, agents that are capable of detecting protein of the regulatable protein, such that the presence of the regulatable protein is detected and/or quantitated, may be used. As defined herein, an "agent" refers to a substance which is capable of identifying or detecting the regulatable protein in a biological sample (e.g., identifies or detects protein of or nucleic acid encoding the regulatable protein), m one embodiment, the agent is a labeled or labelable antibody that specifically binds to the regulatable protein. As used herein, the phrase "labeled or labelable" refers to the attaching or including of a label (e.g., a marker or indicator) or ability to attach or include a label (e.g., a marker or indicator). Markers or indicators include, but are not limited to, for example, radioactive molecules, colorimetric molecules, and enzymatic molecules which produce detectable changes in a substrate. hi addition, the regulatable protein may be detected using Mass Spectrometry such as MALDI/TOF (time-of-flight), SELDI/TOF, liquid chromatography-mass spectrometry (LC- MS), gas chromatography-mass spectrometry (GC-MS), high performance liquid chromatography-mass spectrometry (HPLC-MS), capillary electrophoresis-mass spectrometry, nuclear magnetic resonance spectrometry, or tandem mass spectrometry (e.g., MS/MS, MS/MS/MS, ESI-MS/MS, etc.). See for example, U.S. Patent Application Nos: 20030199001, 20030134304, 20030077616, which are herein incorporated by reference.
Mass spectrometry methods are well known in the art and have been used to quantify and/or identify biomolecules, such as proteins (see, e.g., Li et al. (2000) Tibtech 18, 151-160; Rowley et al. (2000) Methods 20, 383-397; Kuster and Mann (1998) Curr. Opin. Structural Biol. 8, 393-400). Further, mass spectrometric techniques have been developed that permit at least partial de novo sequencing of isolated proteins (see, e.g., Chait et al. (1993) Science 262, 89-92; Keough et al. (1999) Proc. Natl. Acad. Sd. USA. 96, 7131-7136; reviewed in Bergman (2000) EXS 88, 133-44).
In certain embodiments, a gas phase ion spectrophotometer is used. In other embodiments, laser-desorption/ionization mass spectrometry is used to analyze the sample. Modem laser desorption/ionization mass spectrometry ("LDI-MS") can be practiced in two main variations: matrix assisted laser desorption/ionization ("MALDI") mass spectrometry and surface-enhanced laser desorption/ionization ("SELDI"). In MALDI, the analyte is mixed with a solution containing a matrix, and a drop of the liquid is placed on the surface of a substrate. The matrix solution then co-crystallizes with the biological molecules. The substrate is inserted into the mass spectrometer. Laser energy is directed to the substrate surface where it desorbs and ionizes the biological molecules without significantly fragmenting them. However, MALDI has limitations as an analytical tool. It does not provide means for fractionating the sample, and the matrix material can interfere with detection, especially for low molecular weight analytes (see, e.g., Hellenkamp et al., U.S. Pat. No. 5,118,937 and Beavis and Chait, U.S. Pat. No. 5,045,694). In SELDI, the substrate surface is modified so that it is an active participant in the desorption process. In one variant, the surface is derivatized with adsorbent and/or capture reagents that selectively bind the protein of interest. In another variant, the surface is derivatized with energy absorbing molecules that are not desorbed when struck with the laser. In another variant, the surface is derivatized with molecules that bind the protein of interest and that contain a photo lytic bond that is broken upon application of the laser, hi each of these methods, the derivatizing agent generally is localized to a specific location on the substrate surface where the sample is applied (see, e.g., Hutchens and Yip, U.S. Pat. No. 5,719,060 and Hutchens and Yip, WO 98/59361). The two methods can be combined by, for example, using a SELDI affinity surface to capture an analyte and adding matrix-containing liquid to the captured analyte to provide the energy absorbing material.
For additional information regarding mass spectrometers, see, e.g., Principles of Instrumental Analysis, 3rd edition., Skoog, Saunders College Publishing, Philadelphia, 1985; and Kirk-Othmer Encyclopedia of Chemical Technology, 4.sup.th ed. Vol. 15 (John Wiley & Sons, New York 1995), pp. 1071-1094. Detection of the presence of a marker or other substances will typically involve detection of signal intensity. This, in turn, can reflect the quantity and character of a polypeptide bound to the substrate. For example, in certain embodiments, the signal strength of peak values from spectra of a first sample and a second sample can be compared (e.g., visually or by computer analysis) to determine the relative amounts of particular biomolecules. Software programs such as the Biomarker Wizard program (Ciphergen Biosystems, Inc., Fremont, Calif.) can be used to aid in analyzing mass spectra. The mass spectrometers and their techniques are well known to those of skill in the art.
Any person skilled in the art understands that any of the components of a mass spectrometer (e.g., desorption source, mass analyzer, detect, etc.) and varied sample preparations can be combined with other suitable components or preparations described herein, or to those known in the art. For example, in some embodiments a control sample may contain heavy atoms (e.g. 13C) thereby permitting the test sample to be mixed with the known control sample in the same mass spectrometry run. In one embodiment, a laser desorption time-of-flight (TOF) mass spectrometer is used. In laser desorption mass spectrometry, a substrate with a bound marker is introduced into an inlet system. The marker is desorbed and ionized into the gas phase by laser from the ionization source. The ions generated are collected by an ion optic assembly, and then in a time-of-flight mass analyzer, ions are accelerated through a short high voltage field and let drift into a high vacuum chamber. At the far end of the high vacuum chamber, the accelerated ions strike a sensitive detector surface at a different time. Since the time-of-flight is a function of the mass of the ions, the elapsed time between ion formation and ion detector impact can be used to identify the presence or absence of molecules of specific mass to charge ratio. In some embodiments the relative amounts of one or more biomolecules present in a first or second sample is determined, in part, by executing an algorithm with a programmable digital computer. The algorithm identifies at least one peak value in the first mass spectrum and the second mass spectrum. The algorithm then compares the signal strength of the peak value of the first mass spectrum to the signal strength of the peak value of the second mass spectrum of the mass spectrum. The relative signal strengths are an indication of the amount of the biomolecule that is present in the first and second samples. A standard containing a known amount of a biomolecule can be analyzed as the second sample to provide better quantification of the amount of the biomolecule present in the first sample. In certain embodiments, the identity of the biomolecules in the first and second sample can also be determined.
In one embodiment, detecting or determining levels of a regulatable protein comprises detecting or determining the levels of RNA encoding the regulatable protein. In one embodiment, one or more cells from the subject to be tested are obtained and RNA is isolated from the cells. When obtaining the cells, it is preferable to obtain a sample containing predominantly cells of the desired type, e.g., a sample of cells in which at least about 50%, preferably at least about 60%, even more preferably at least about 70%, 80% and even more preferably, at least about 90% of the cells are of the desired type. Tissue samples can be obtained according to methods known in the art. It is also possible to obtain a cell sample from a subject, and then to enrich it in the desired cell type. For example, cells can be isolated from other cells using a variety of techniques, such as isolation with an antibody binding to an epitope on the cell surface of the desired cell type. Where the desired cells are in a solid tissue, particular cells can be dissected out, e.g., by microdissection. In one embodiment, RNA is obtained from a single cell. For example, a cell can be isolated from a tissue sample by laser capture microdissection (LCM). Using this technique, a cell can be isolated from a tissue section, including a stained tissue section, thereby assuring that the desired cell is isolated {see, e.g., Bonner et al. (1997) Science 278: 1481; Emmert- Buck et al. (1996) Science 274:998; Fend et al. (1999) Am. J. Path. 154: 61 and Murakami et al. (2000) Kidney hit. 58:1346). For example, Murakami et al., supra, describe isolation of a cell from a previously immunostained tissue section.
It is also be possible to obtain cells from a subject and culture the cells in vitro, such as to obtain a larger population of cells from which RNA can be extracted. Methods for establishing cultures of non-transformed cells, i.e., primary cell cultures, are known in the art. When isolating RNA from tissue samples or cells from individuals, it may be important to prevent any further changes in gene expression after the tissue or cells has been removed from the subject. Changes in expression levels are known to change rapidly following perturbations, e.g., heat shock or activation with lipopolysaccharide (LPS) or other reagents. In addition, the RNA in the tissue and cells may quickly become degraded. Accordingly, in a preferred embodiment, the tissue or cells obtained from a subject is snap frozen as soon as possible.
RNA can be extracted from the tissue sample by a variety of methods, e.g., the guanidium thiocyanate lysis followed by CsCl centrifugation (Chirgwin et al., 1979, Biochemistry 18:5294-5299). RNA from single cells can be obtained as described in methods for preparing cDNA libraries from single cells, such as those described in Dulac, C. (1998) Curr. Top. Dev. Biol. 36, 245 and Jena et al. (1996) J. Immunol. Methods 190:199. Care to avoid RNA degradation must be taken, e.g., by inclusion of RNAsin.
The RNA sample can then be enriched in particular species, hi one embodiment, poly(A)+ RNA is isolated from the RNA sample. In general, such purification takes advantage of the poly- A tails on mRNA. In particular and as noted above, poly-T oligonucleotides may be immobilized within on a solid support to serve as affinity ligands for mRNA. Kits for this purpose are commercially available, e.g., the MessageMaker® kit (Life Technologies, Grand Island, NY). In another embodiment, the RNA population is enriched in sequences encoding a regulatable protein, e.g., DCKε. Enrichment can be undertaken, e.g., by primer-specific cDNA synthesis, or multiple rounds of linear amplification based on cDNA synthesis and template- directed in vitro transcription (see, e.g., Wang et al. (1989) PNAS 86, 9717; Dulac et al., supra, and Jena et al., supra). The population of RNA, enriched or not in particular species or sequences, can further be amplified. As defined herein, an "amplification process" is designed to strengthen, increase, or augment a molecule within the RNA. For example, where RNA is mRNA, an amplification process such as RT-PCR can be utilized to amplify the mRNA, such that a signal is detectable or detection is enhanced. Such an amplification process is beneficial particularly when the biological, tissue, or tumor sample is of a small size or volume.
Various amplification and detection methods can be used. For example, it is within the scope of the present invention to reverse transcribe mRNA into cDNA followed by polymerase chain reaction (RT-PCR); or, to use a single enzyme for both steps as described in U.S. Pat. No. 5,322,770, or reverse transcribe mRNA into cDNA followed by symmetric gap ligase chain reaction (RT-AGLCR) as described by R. L. Marshall, et al., PCR Methods and Applications 4: 80-84 (1994). Real time PCR may also be used (see Examples).
Other known amplification methods which can be utilized herein include but are not limited to the so-called "NASBA" or "3SR" technique described in PNAS USA 87: 1874- 1878 (1990) and also described in Nature 350 (No. 6313): 91-92 (1991); Q-beta amplification as described in published European Patent Application (EPA) No. 4544610; strand displacement amplification (as described in G. T. Walker et al., Clin. Chem. 42: 9-13 (1996) and European Patent Application No. 684315; target mediated amplification, as described by PCT Publication WO9322461; PCR; ligase chain reaction (LCR) {see, e.g., Wu and Wallace, Genomics 4, 560 (1989), Landegren et al., Science 241, 1077 (1988)); self-sustained sequence replication (SSR) {see, e.g., Guatelli et al., Proc. Nat. Acad. Sci. USA, 87, 1874 (1990)); and transcription amplification {see, e.g., Kwoh et al., Proc. Natl. Acad. Sci. USA 86, 1173 (1989)).
Detection of RNA transcripts may be achieved by Northern blotting, for example, wherein a preparation of RNA is run on a denaturing agarose gel, and transferred to a suitable support, such as activated cellulose, nitrocellulose or glass or nylon membranes. Radiolabeled cDNA or RNA is then hybridized to the preparation, washed and analyzed by autoradiography.
In situ hybridization visualization may also be employed, wherein a radioactively labeled antisense RNA probe is hybridized with a thin section of a biopsy sample, washed, cleaved with RNase and exposed to a sensitive emulsion for autoradiography. The samples may be stained with haematoxylin to demonstrate the histological composition of the sample, and dark field imaging with a suitable light filter shows the developed emulsion. Nonradioactive labels such as digoxigenin may also be used. Alternatively, mRNA expression can be detected on a DNA array, chip or a microarray. Labeled nucleic acids of a test sample obtained from a patient may be hybridized to a solid surface comprising DNA encoding a regulatable protein. Positive hybridization signal is obtained with the sample containing RNA transcripts, DNA or cDNA encoding the regulatable protein. Methods of preparing DNA arrays and their use are well known in the art (see, e.g., U.S. Pat. Nos: 6,618,6796; 6,379,897; 6,664,377; 6,451,536; 548,257; U.S.
20030157485 and Schena et al. (1995) Science 20, 467-470; Gerhold et al. (1999) Trends In Biochem. Sd. 24, 168-173; and Lennon et al. (2000) Drug Discovery Today 5, 59-65, which are herein incorporated by reference in their entirety). Serial Analysis of Gene Expression (SAGE) can also be performed (See for example U.S. Patent Application 20030215858). To monitor mRNA levels, for example, mRNA is extracted from the biological sample to be tested, reverse transcribed, and fluorescently-labeled cDNA probes are generated. The microarrays capable of hybridizing to cDNA generated from transcripts encoding a regulatable protein are then probed with the labeled cDNA probes, the slides scanned and fluorescence intensity measured. This intensity correlates with the hybridization intensity and expression levels.
Types of probes that can be used in the methods described herein include cDNA, riboprobes, synthetic oligonucleotides and genomic probes. The type of probe used will generally be dictated by the particular situation, such as riboprobes for in situ hybridization, and cDNA for Northern blotting, for example. In one embodiment, the probe is directed to nucleotide regions unique to the RNA. The probes may be as short as is required to differentially recognize mRNA transcripts of a regulatable protein, and may be as short as, for example, 15 bases; however, probes of at least 17, 18, 19 or 20 or more bases can be used. In one embodiment, the primers and probes hybridize specifically under stringent conditions to a DNA fragment having the nucleotide sequence corresponding to the gene encoding the regulatable protein. As herein used, the term "stringent conditions" means hybridization will occur only if there is at least 95% identity in nucleotide sequences. In another embodiment, hybridization under "stringent conditions" occurs when there is at least 97% identity between the sequences. The form of labeling of the probes may be any that is appropriate, such as the use of radioisotopes, for example, 32P and 35S. Labeling with radioisotopes may be achieved, whether the probe is synthesized chemically or biologically, by the use of suitably labeled bases.
In one embodiment, a change in copy number of genomic loci encoding a regulatable protein, e.g., IKKε, is detected. In one embodiment, the biological sample is tested for the presence of copy number changes in genomic loci encoding the regulatable protein. A copy number of at least 3, 4, 5, 6, 7, 8, 9, or 10 is indicative of the presence of cancer or the likelihood of developing cancer.
Methods of evaluating the copy number of a particular biomarker or chromosomal region associated with a regulatable protein (e.g., IKBKE or chromosome Iq32) include, but are not limited to, hybridization-based assays. Hybridization-based assays include, but are not limited to, traditional "direct probe" methods, such as Southern blots, in situ hybridization {e.g., FISH and FISH plus SKY) methods, and "comparative probe" methods, such as comparative genomic hybridization (CGH), e.g., cDNA-based or oligonucleotide-based CGH. The methods can be used in a wide variety of formats including, but not limited to, substrate (e.g. membrane or glass) bound methods or array-based approaches.
In one embodiment, evaluating the copy number of a gene encoding a regulatable protein in a sample involves a Southern Blot. In a Southern Blot, the genomic DNA (typically fragmented and separated on an electrophoretic gel) is hybridized to a probe specific for the target region (e.g., IKBKE or chromosome Iq32). Comparison of the intensity of the hybridization signal from the probe for the target region with control probe signal from analysis of normal genomic DNA {e.g., a non-amplified portion of the same or related cell, tissue, organ, etc.) provides an estimate of the relative copy number of the target nucleic acid. Alternatively, a Northern blot may be utilized for evaluating the copy number of encoding nucleic acid in a sample. In a Northern blot, mRNA is hybridized to a probe specific for the target region. Comparison of the intensity of the hybridization signal from the probe for the target region with control probe signal from analysis of normal RNA (e.g., a non- amplified portion of the same or related cell, tissue, organ, etc.) provides an estimate of the relative copy number of the target nucleic acid. Alternatively, other methods well known in the art to detect RNA encoding the regulatable protein can be used, such that higher or lower expression relative to an appropriate control (e.g., a non-amplified portion of the same or related cell tissue, organ, etc.) provides an estimate of the relative copy number of the target nucleic acid. An alternative means for determining genomic copy number is in situ hybridization
(e.g., Angerer (1987) Meth. Enzymol 152: 649). Generally, in situ hybridization comprises the following steps: (1) fixation of tissue or biological structure to be analyzed; (2) prehybridization treatment of the biological structure to increase accessibility of target DNA, and to reduce nonspecific binding; (3) hybridization of the mixture of nucleic acids to the nucleic acid in the biological structure or tissue; (4) post-hybridization washes to remove nucleic acid fragments not bound in the hybridization and (5) detection of the hybridized nucleic acid fragments. The reagent used in each of these steps and the conditions for use vary depending on the particular application. In a typical in situ hybridization assay, cells are fixed to a solid support, typically a glass slide. If a nucleic acid is to be probed, the cells are typically denatured with heat or alkali. The cells are then contacted with a hybridization solution at a moderate temperature to permit annealing of labeled probes specific to the nucleic acid sequence encoding the protein. The targets, e.g., cells, are then typically washed at a predetermined stringency or at an increasing stringency until an appropriate signal to noise ratio is obtained. The probes are typically labeled, e.g., with radioisotopes or fluorescent reporters. In one embodiment, probes are sufficiently long so as to specifically hybridize with the target nucleic acid(s) under stringent conditions. Probes generally range in length from about 200 bases to about 1000 bases, hi some applications it is necessary to block the hybridization capacity of repetitive sequences. Thus, in some embodiments, tRNA, human genomic DNA, or Cot-I DNA is used to block non-specific hybridization. An alternative means for determining genomic copy number is comparative genomic hybridization, hi general, genomic DNA is isolated from normal reference cells, as well as from test cells (e.g., tumor cells) and amplified, if necessary. The two nucleic acids are differentially labeled and then hybridized in situ to metaphase chromosomes of a reference cell. The repetitive sequences in both the reference and test DNAs are either removed or their hybridization capacity is reduced by some means, for example by prehybridization with appropriate blocking nucleic acids and/or including such blocking nucleic acid sequences for said repetitive sequences during said hybridization. The bound, labeled DNA sequences are then rendered in a form that is visualizable, if necessary. Chromosomal regions in the test cells, which are at increased or decreased copy number, can be identified by detecting regions where the ratio of signal from the two DNAs is altered. For example, those regions that have decreased in copy number in the test cells will show relatively lower signal from the test DNA than the reference compared to other regions of the genome. Regions that have been increased in copy number in the test cells will show relatively higher signal from the test DNA. Where there are chromosomal deletions or multiplications, differences in the ratio of the signals from the two labels will be detected and the ratio will provide a measure of the copy number. In another embodiment of CGH, array CGH (aCGH), the immobilized chromosome element is replaced with a collection of solid support bound target nucleic acids on an array, allowing for a large or complete percentage of the genome to be represented in the collection of solid support bound targets. Target nucleic acids may comprise cDNAs, genomic DNAs, oligonucleotides (e.g., to detect single nucleotide polymorphisms) and the like. Array-based CGH may also be performed with single-color labeling (as opposed to labeling the control and the possible tumor sample with two different dyes and mixing them prior to hybridization, which will yield a ratio due to competitive hybridization of probes on the arrays). In single color CGH, the control is labeled and hybridized to one array and absolute signals are read, and the possible tumor sample is labeled and hybridized to a second array (with identical content) and absolute signals are read. Copy number difference is calculated based on absolute signals from the two arrays. Methods of preparing immobilized chromosomes or arrays and performing comparative genomic hybridization are well known in the art (see, e.g., U.S. Pat. Nos: 6,335,167; 6,197,501; 5,830,645; and 5,665,549 and
Albertson (19S4) EMBO J. 3: 1227-1234; Pinkel (1988) Proc. Natl. Acad. Sd. USA 85: 9138- 9142; EPO Pub. No. 430,402; Methods in Molecular Biology, Vol. 33: In situ Hybridization Protocols, Choo, ed., Humana Press, Totowa, NJ. (1994), etc.). In another embodiment, the hybridization protocol of Pinkel, et al. (1998) Nature Genetics 20: 207-211, or of Kallioniemi (1992) Proc. Natl Acad Sd USA 89:5321-5325 (1992) is used.
In still another embodiment, amplification-based assays can be used to measure copy number. In such amplification-based assays, the nucleic acid sequences act as a template in an amplification reaction (e.g., Polymerase Chain Reaction (PCR). In a quantitative amplification, the amount of amplification product will be proportional to the amount of template in the original sample. Comparison to appropriate controls, e.g. healthy tissue, provides a measure of the copy number.
Methods of "quantitative" amplification are well known to those of skill in the art. For example, quantitative PCR involves simultaneously co-amplifying a known quantity of a control sequence using the same primers. This provides an internal standard that may be used to calibrate the PCR reaction. Detailed protocols for quantitative PCR are provided in Innis, et al. (1990) PCR Protocols, A Guide to Methods and Applications, Academic Press, Inc. N. Y.). Measurement of DNA copy number at microsatellite loci using quantitative PCR analysis is described in Ginzonger, et al. (2000) Cancer Research 60:5405-5409. The known nucleic acid sequence for the genes is sufficient to enable one of skill in the art to routinely select primers to amplify any portion of the gene. Fluorogenic quantitative PCR may also be used in the methods of the invention. In fluorogenic quantitative PCR, quantitation is based on amount of fluorescence signals, e.g., TaqMan and SYBR green.
Other suitable amplification methods include, but are not limited to, ligase chain reaction (LCR) (see Wu and Wallace (1989) Genomics 4: 560, Landegren, et al. (1988) Science 241:1077, and Barringer et al. (1990) Gene 89: 117), transcription amplification (Kwoh, et al. (1989) Proc. Natl. Acad. ScL USA 86: 1173), self-sustained sequence replication (Guatelli, et al. (1990) Proc. Nat. Acad. Sci. USA 87: 1874), dot PCR, and linker adapter PCR, etc. Loss of heterozygosity (LOH) mapping (Wang, Z.C., et al. (2004) Cancer Res
64(1):64-71; Seymour, A. B., et al. (1994) Cancer Res 54, 2761-4; Hahn, S. A., et al. (1995) Cancer Res 55, 4670-5; Kimura, M., et al. (1996) Genes Chromosomes Cancer 17, 88-93) may also be used to identify regions of amplification or deletion.
VI. Therapeutics for treating a disease or disorder based on regulatable proteins identified herein
Based at least on the observation that altered levels of regulatable proteins, e.g., KKε, identified herein lead to altered characteristics of cellular transformation and/or tumorigenicity, it may be possible to diminish the likelihood of developing cancer, halt the progression of cancer, or prevent cancer altogether by controlling the level of a regulatable protein in a tumor or tissue of the subject. In one embodiment, a method for treating or preventing cancer comprises reducing the level of expression of a regulatable protein. A method may include reducing the level of nucleic acid encoding the regulatable protein, reducing the amount of the regulatable protein , or inhibiting the activity of the regulatable protein. In a method for treatment, one may decrease levels and/or activity of the regulatable protein or the nucleic acid encoding it in a tumor, e.g., a primary tumor. In a method for preventing cancer, one may decrease levels and/or activity of the regulatable protein or the nucleic acid encoding it in tissue likely to develop cancer. Prophylaxis may be appropriate even at very early stages of the disease, to prevent tumorigenesis or metastasis. Thus, administration of an agent that decreases levels and/or activity of a regulatable protein or the nucleic acid encoding it may be effected as soon as cancer is diagnosed, and treatment continued for as long as is necessary, generally until the threat of the disease has been removed. Such treatment may also be used prophylactically in individuals at high risk for development of certain cancers, e.g., breast cancer.
RNAi Technology
In one embodiment, levels of nucleic acid encoding a regulatable protein are decreased by administration of or expression in a subject, e.g., in cells or a tissue of the subject, of one or more siRNAs.
Isolated RNA molecules specific to mRNA encoding the regulatable protein, which mediate RNAi, are antagonists useful in the method of the present invention (see, e.g., U.S. Patent Application Nos: 20030153519A1; 20030167490A1; and U.S. Pat. Nos: 6,506,559; 6,573,099, which are herein incorporated by reference in their entirety).
In one embodiment, the RNA is comprised of, or capable of being cleaved to, short interfering or small interfering RNAs (siRNAs). The term "short interfering RNAs (siRNA)" as used herein is intended to refer to any nucleic acid molecule capable of mediating RNAi or gene silencing. The term siRNA is intended to encompass various naturally generated or synthetic compounds, with RNAi function. Such compounds include, without limitation, duplex synthetic oligonucleotides, of about 21 to 23 base pairs with terminal overlaps of 2 or 3 base pairs; hairpin structures of one oligonucleotide chain with sense and complementary, hybridizing, segments of 21-23 base pairs joined by a loop of 3-5 base pairs; and various genetic constructs leading to the expression of the preceding structures or functional equivalents. Such genetic constructs are usually prepared in vitro and introduced in the test system, but can also include siRNA from naturally occurring siRNA precursors encoded by the genome of the host cell or animal.
It is not a requirement that the siRNA be comprised solely of RNA. In one embodiment, the siRNA comprises one or more chemical modifications and/or nucleotide analogues. The modification and/or analogue may be any modification and/or analogue, respectively, that does not negatively affect the ability of the siRNA to inhibit expression of nucleic acid encoding a regulatable protein. The inclusion of one or more chemical modifications and/or nucleotide analogues in an siRNA may be used to prevent or slow nuclease digestion, and in turn, create a more stable siRNA for practical use. Chemical modifications and/or nucleotide analogues which stabilize RNA are known in the art. Phosphorothioate derivatives, which include the replacement of non-bridging phosphoryl oxygen atoms with sulfur atoms, are one example of analogues showing increased resistance to nuclease digestion. Sites of the siRNA which may be targeted for chemical modification include the loop region of a hairpin structure, the 5' and 3' ends of a hairpin structure (e.g. cap structures), the 3' overhang regions of a double-stranded linear siRNA, the 5' or 3' ends of the sense strand and/or antisense strand of a linear siRNA, and one or more nucleotides of the sense and/or antisense strand.
As used herein, the term siRNA is intended to be equivalent to any term in the art defined as a molecule capable of mediating sequence-specific RNAi. Such equivalents include, for example, double-stranded RNA (dsRNA), microRNA (miRNA), short hairpin RNA (shRNA), short interfering oligonucleotide, endoribonuclease-prepared siRNA (esiRNA), and post-transcriptional gene silencing RNA (ptgsRNA). siRNAs may be introduced into cells to suppress gene expression for therapeutic or prophylactic purposes as described in International Publication Number WO 0175164. Such molecules may be introduced into cells to suppress gene expression for therapeutic or prophylactic purposes as described in various patents, patent applications and papers. Publications herein incorporated by reference, describing RNAi technology include, but are not limited to, the following: U.S. Pat. No. 6,686,463, U.S. Pat. No. 6,673,611, U.S. Pat. No. 6,623,962, U.S. Pat. No. 6,506,559, U.S. Pat. No. 6,573,099, and U.S. Pat. No. 6,531,644; International Publication Numbers WO04061081; WO04052093; WO04048596; WO04048594; WO04048581; WO04048566; WO04046320; WO04044537; WO04043406; WO04033620; WO04030660; WO04028471; WO 0175164. Papers which describe the methods and concepts for the optimal use of these compounds include, but are not limited to, the following: Brummelkamp Science 296: 550-553 (2002); Caplen Expert Opin. Biol. Ther. 3:575-86 (2003); Brummelkamp, Science Express 21 Mar. 3 1-6 (2003); Yu Proc Natl Acad Sci USA 99:6047-52 (2002); Paul, Nature Biotechnology 29:505-8 (2002); Paddison, Proc Natl Acad Sci USA 99:1443-8 (2002); Brummelkamp, Nature 424: 797-801 (2003); Brummelkamp, Science 296: -550-3 (2003); Sui, Proc Natl Acad Sci USA 99: 5515-20 (2002); Paddison, Genes and Development 16:948-58 (2002).
A composition comprising an siRNA effective to inhibit expression of nucleic acid encoding a regulatable protein, e.g., IKBKE, may include an RNA duplex comprising a sense sequence encoding the regulatable protein. In this embodiment, the RNA duplex comprises a first strand comprising a sense sequence encoding the regulatable protein and a second strand comprising a reverse complement of the sense sequence encoding the regulatable protein. In one embodiment the sense sequence encoding the regulatable protein comprises of from 10 to 25 nucleotides in length. In another embodiment, the sense sequence encoding the regulatable protein comprises of from 19 to 25 nucleotides in length. In yet another embodiment, the sense sequence encoding the regulatable protein comprises of from 21 to 23 nucleotides in length. The sense sequence encoding the regulatable protein can comprises a sequence of the regulatable protein containing a translational start site or a portion of the regulatable protein sequence within the first 400 nucleotides of the nucleic acid encoding the regulatable protein. In another embodiment, a composition comprising an siRNA effective to inhibit the nucleic acid encoding the regulatable protein expression may comprise in a single molecule a sense sequence encoding the regulatable protein, the reverse complement of the sense sequence encoding the regulatable protein, and an intervening sequence enabling duplex formation between the sense and reverse complement sequences. The sense sequence encoding the regulatable protein may comprise 10 to 25 nucleotides in length, 19 to 25 nucleotides in length, or 21 to 23 nucleotides in length.
It will be readily apparent to one of skill in the art that an siRNA of the present invention may comprise a sense sequence encoding the regulatable protein or the reverse complement of the sense sequence encoding the regulatable protein which is less than perfectly complementary to each other or to the targeted region encoding the regulatable protein. In other words, the siRNA may comprise mismatches or bulges within the sense or reverse complement sequence. In one aspect, the sense sequence or its reverse complement may not be entirely contiguous. The sequence or sequences may comprise one or more substitutions, deletions, and/or insertions. The only requirement of the present invention is that the siRNA sense sequence possess enough complementarity to its reverse complement and to the targeted region of the regulatable protein to allow for RNAi activity. It is an object of the present invention, therefore, to provide for sequence modifications of an siRNA of the present invention that retain sufficient complementarity to allow for RNAi activity. One of skill in the art may predict that a modified siRNA composition of the present invention will work based on the calculated binding free energy of the modified sequence for the complement sequence and targeted region encoding the regulatable protein. Methods for calculating binding free energies for nucleic acids and the effect of such values on strand hybridization are known in the art. A wide variety of delivery systems are available for use in delivering an siRNA of the present invention to a target cell in vitro and in vivo. An siRNA of the present invention may be introduced directly or indirectly into a cell in which inhibition of the nucleic acid encoding the regulatable protein is desired. An siRNA may be directly introduced into a cell by, for example, injection. As such, it is an object of the invention to provide for a composition comprising an siRNA effective to inhibit the nucleic acid encoding the regulatable protein in injectable, dosage unit form. An siRNA of the present invention may be injected intravenously or subcutaneously, as an example, for therapeutic use in conjunction with the methods and compositions of the present invention. Such treatment may include intermittent or continuous administration until therapeutically effective levels are achieved to inhibit expression of the nucleic acid encoding the regulatable protein in the desired tissue.
Indirectly, an expressible DNA sequence or sequences that encode the siRNA may be introduced into a cell and the siRNA, thereafter, transcribed from the DNA sequence or sequences. It is an object of the present invention, therefore, to provide for compositions comprising a DNA sequence or sequences which encode an siRNA effective to inhibit the regulatable protein expression.
A DNA composition of the present invention comprises a first DNA sequence which encodes a first RNA sequence comprising a sense sequence of a regulatable protein, e.g., IKBKE, and a second DNA sequence which encodes a second RNA sequence comprising the reverse complement of the sense sequence encoding the regulatable protein. The first and second RNA sequences, when hybridized, form an siRNA duplex capable of forming an RNA-induced silencing complex, the RNA-induced silencing complex being capable of inhibiting expression of the nucleic acid encoding the regulatable protein. The first and second DNA sequences may be chemically synthesized or synthesized by PCR using appropriate primers to the regulatable protein. Alternatively, the DNA sequences may be obtained by recombinant manipulation using cloning technology, which is well known in the art. Once obtained, the DNA sequences may be purified, combined, and then introduced into a cell in which inhibition of the regulatable protein is desired. Alternatively, the sequences may be contained in a single vector or separate vectors and the vector or vectors introduced into the cell in which inhibition of the regulatable protein is desired.
Delivery systems available for use in delivering a DNA composition of the present invention to a target cell include, for example, viral and non-viral systems. Examples of suitable viral systems include, for example, adenoviral vectors, adeno-associated virus, lentivirus, poxvirus, retroviral vectors, vaccinia, herpes simplex virus, HIV, the minute virus of mice, hepatitis B virus and influenza virus. Non- viral delivery systems may also be used, for example using, uncomplexed DNA, DNA-liposome complexes, DNA-protein complexes and DNA-coated gold particles, bacterial vectors such as salmonella, and other technologies such as those involving VP22 transport protein, Co-X-gene, and replicon vectors. A viral or non- viral vector in the context of the present invention may express the antigen of interest.
Antisense Technology
In another embodiment, the level of nucleic acid encoding a regulatable protein, e.g., IKBKE, is decreased by administration or the expression of antisense molecules in a subject or tissue or cell thereof.
Gene expression can be controlled through triple-helix formation or antisense DNA or RNA, both of which methods are based on binding of a polynucleotide to DNA or RNA. An antisense nucleic acid molecule which is complementary to a nucleic acid molecule encoding the regulatable protein can be designed based upon the isolated nucleic acid molecules encoding the regulatable protein. An antisense nucleic acid molecule can comprise a nucleotide sequence which is complementary to a coding strand of a nucleic acid, e.g. complementary to an mRNA sequence, constructed according to the rules of Watson and Crick base pairing, and can hydrogen bond to the coding strand of the nucleic acid. The antisense sequence complementary to a sequence of an mRNA can be complementary to a sequence in the coding region of the mRNA or can be complementary to a 5 ' or 3' untranslated region of the mRNA. Furthermore, an antisense nucleic acid can be complementary in sequence to a regulatory region of the gene encoding the mRNA, for instance, a transcription initiation sequence or regulatory element. In one embodiment, an antisense nucleic acid complementary to a region preceding or spanning the initiation codon or in the 3' untranslated region of an mRNA is used. An antisense nucleic acid can be designed based upon the nucleotide sequence encoding the regulatable protein. A nucleic acid is designed which has a sequence complementary to a sequence of the coding or untranslated region of the regulatable protein. Alternatively, an antisense nucleic acid can be designed based upon sequences of gene(s) encoding the regulatable protein, which can be identified by screening a genomic DNA library with an isolated nucleic acid of the invention. For example, the sequence of an important regulatory element can be determined by standard techniques and a sequence which is antisense to the regulatory element can be designed.
The antisense nucleic acids and oligonucleotides of the invention can be constructed using chemical synthesis and enzymatic ligation reactions using procedures known in the art. The antisense nucleic acid or oligonucleotide can be chemically synthesized using naturally occurring nucleotides or variously modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed between the antisense and sense nucleic acids. For example, phosphorothioate derivatives and acridine substituted nucleotides can be used. Alternatively, the antisense nucleic acids and oligonucleotides can be produced biologically using an expression vector into which a nucleic acid has been subcloned in an antisense orientation (i.e. nucleic acid transcribed from the inserted nucleic acid will be of an antisense orientation to a target nucleic acid of interest). The antisense expression vector is introduced into cells in the form of a recombinant plasmid, phagemid or attenuated virus in which antisense nucleic acids are produced under the control of a high efficiency regulatory region, the activity of which can be determined by the cell type into which the vector is introduced. For a discussion of the regulation of gene expression using antisense genes, see Weintraub, H. et al., Antisense RNA as a molecular tool for genetic analysis, Reviews-Trends in Genetics, Vol. 1 (1)1986.
In addition, ribozymes can be used to inhibit in vitro expression of nucleic acids encoding a regulatable protein, e.g., IKBKE. For example, the nucleic acids of the invention can further be used to design ribozymes which are capable of cleaving a single-stranded nucleic acid encoding the regulatable protein, such as an mRNA transcript encoding the regulatable protein. A catalytic RNA (ribozyme) having ribonuclease activity can be designed which has specificity for an mRNA encoding the regulatable protein based upon the sequence of a nucleic acid of the invention. For example, a derivative of a Tetrahymena L- 19 IVS RNA can be constructed in which the base sequence of the active site is complementary to the base sequence to be cleaved in an mRNA encoding the regulatable protein (see, e.g., Cech et al., U.S. Pat. No. 4,987,071; Cech, et al., U.S. Pat. No. 5,116,742). Alternatively, a nucleic acid of the invention could be used to select a catalytic RNA having a specific ribonuclease activity from a pool of RNA molecules (see, e.g., Bartel and Szostak (1993) Science 261, 1411-1418).
Blocking Antibodies and Aptamer Technology
In yet another embodiment, levels and/or activity of a regulatable protein, e.g., IKKε, are reduced by administration to or expression in a subject or a cell or tissue thereof, of blocking antibodies or aptamers against the regulatable protein. Antibodies, or their equivalents and derivatives, e.g., intrabodies, or other antagonists of the regulatable protein, may be used in accordance with the present invention for the treatment or prophylaxis of cancers. Administration of a suitable dose of the antibody or the antagonist may serve to block the activity of the protein and this may provide a crucial time window in which to treat malignant growth.
A method of treatment involves attachment of a suitable toxin to the antibodies which then target the area of the tumor. Such toxins are well known in the art, and may comprise toxic radioisotopes, heavy metals, enzymes and complement activators, as well as such natural toxins as ricin which are capable of acting at the level of only one or two molecules per cell. It may also be possible to use such a technique to deliver localized doses of suitable physiologically active compounds, which may be used, for example, to treat cancers.
In addition to using antibodies to inhibit the levels and/or activity of the regulatable protein, it may also be possible to use other forms of inhibitors. For example, it may be possible to identify antagonists that functionally inhibit the regulatable protein, hi addition, it may also be possible to interfere with the binding of the regulatable protein to target proteins. Other suitable inhibitors will be apparent to the skilled person.
The antibody (or other inhibitors or intrabody) can be administered by a number of methods. One method is set forth by Marasco and Haseltine in PCT WO94/02610, which is incorporated herein by reference. This method discloses the intracellular delivery of a gene encoding the antibody. In one embodiment, a gene encoding a single chain antibody is used. In another embodiment, the antibody would contain a nuclear localization sequence (e.g. an SV40 nuclear localization signal). By this method, one can intracellular Iy express an antibody, which can block activity of the regulatable protein in desired cells.
Where the present invention provides for the administration of, for example, antibodies to a patient, then this may be by any suitable route. If the tumor is still thought to be, or diagnosed as, localized, then an appropriate method of administration may be by injection direct to the site. Administration may also be by injection, including subcutaneous, intramuscular, intravenous and intradermal injections.
Aptamers can be produced using the methodology disclosed in a U.S. Pat. No. 5,270,163 and WO 91/19813.
Other inhibitors of regulatable protein
Compounds that inhibit the activity of a regulatable protein may also be used. Such compounds include small molecules, e.g., molecules that interact with the active site or a binding site of the protein, e.g., an ATP binding site or substrate binding site. Small molecules can also act as allosteric inhibitors of the protein. Such compounds may be identified according to methods known in the art.
Pharmaceutical formulations
Formulations may be any that are appropriate to the route of administration, and will be apparent to those skilled in the art. The formulations may contain a suitable carrier, such as saline, and may also comprise bulking agents, other medicinal preparations, adjuvants and any other suitable pharmaceutical ingredients. Catheters constitute another mode of administration.
The term "pharmaceutically acceptable" refers to compounds and compositions which may be administered to mammals without undue toxicity. Exemplary pharmaceutically acceptable salts include mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like.
The antibodies, nucleic acids or antagonists of the invention may be administered orally, topically, or by parenteral means, including subcutaneous and intramuscular injection, implantation of sustained release depots, intravenous injection, intranasal administration, and the like. Accordingly, antibodies or nucleic acids of the invention may be administered as a pharmaceutical composition comprising the antibody or nucleic acid of the invention in combination with a pharmaceutically acceptable carrier. Such compositions may be aqueous solutions, emulsions, creams, ointments, suspensions, gels, liposomal suspensions, and the like. Suitable carriers (excipients) include water, saline, Ringer's solution, dextrose solution, and solutions of ethanol, glucose, sucrose, dextran, mannose, mannitol, sorbitol, polyethylene glycol (PEG), phosphate, acetate, gelatin, collagen, Carbopol Registered TM, vegetable oils, and the like. One may additionally include suitable preservatives, stabilizers, antioxidants, antimicrobials, and buffering agents, for example, BHA, BHT, citric acid, ascorbic acid, tetracycline, and the like. Cream or ointment bases useful in formulation include lanolin, Silvadene Registered TM (Marion), Aquaphor Registered TM (Duke Laboratories), and the like. Other topical formulations include aerosols, bandages, and other wound dressings. Alternatively, one may incorporate or encapsulate the compounds in a suitable polymer matrix or membrane, thus providing a sustained-release delivery device suitable for implantation near the site to be treated locally. Other devices include indwelling catheters and devices such as the Alzet Registered TM minipump. Ophthalmic preparations may be formulated using commercially available vehicles such as Sorbi-care Registered TM (Allergan), Neodecadron Registered TM (Merck, Sharp & Dohme), Lacrilube Registered TM, and the like, or may employ topical preparations such as that described in U.S. Pat. No. 5,124,155, incorporated herein by reference. Further, one may provide an antagonist in solid form, especially as a lyophilized powder. Lyophilized formulations typically contain stabilizing and bulking agents, for example human serum albumin, sucrose, mannitol, and the like. A thorough discussion of pharmaceutically acceptable excipients is available in Remington's Pharmaceutical Sciences (Mack Pub. Co.).
The amount of antibody, nucleic acid or inhibitor required to treat any particular disorder will of course vary depending upon the nature and severity of the disorder, the age and condition of the subject, and other factors readily determined by one of ordinary skill in the art.
Immunotherapy In further aspects, the present invention provides methods for using a regulatable protein, e.g., IKKε, or an immunoreactive polypeptide thereof (or DNA encoding the protein or polypeptides) for immunotherapy of cancer in a patient. As used herein, a "patient" refers to any warm-blooded animal, preferably a human. A patient may be afflicted with a disease, or may be free of detectable disease. Accordingly, the regulatable protein or an immunoreactive polypeptide thereof, may be used to treat cancer or to inhibit the development of cancer.
In accordance with this method, the protein, polypeptide or DNA is generally present within a pharmaceutical composition and/or a vaccine. Pharmaceutical compositions may comprise the full length protein or one or more immunogenic polypeptides, and a physiologically acceptable carrier. The vaccines may comprise the full length protein or one or more immunogenic polypeptides and a non-specific immune response enhancer, such as an adjuvant, biodegradable microsphere (PLG) or a liposome (into which the polypeptide is incorporated).
Alternatively, a pharmaceutical composition or vaccine may contain DNA encoding the regulatable protein or an immunogenic polypeptide thereof, such that the full length protein or polypeptide is generated in situ. In such pharmaceutical compositions and vaccines, the DNA may be present within any of a variety of delivery systems known to those of ordinary skill in the art, including nucleic acid expression systems, bacteria and viral expression systems. Appropriate nucleic acid expression systems contain the necessary DNA sequences for expression in the patient (such as a suitable promoter). Bacterial delivery systems involve the administration of a bacterium (such as Bacillus-Calmette-Guerrin) that expresses an epitope of a breast cell antigen on its cell surface. In one embodiment, the DNA may be introduced using a viral expression system (e.g., vaccinia or other pox virus, retrovirus, or adenovirus), which may involve the use of a non-pathogenic (defective), replication competent virus. Suitable systems are disclosed, for example, in Fisher-Hoch et al., PNAS 86:317-321, 1989; Flexner et al., Ann. N.Y Acad. Sci. 569:86-103, 1989; Flexner et al., Vaccine 8:17-21, 1990; U.S. Pat. Nos. 4,603,112, 4,769,330, and 5,017,487; WO 89/01973; U.S. Pat. No. 4,777,127; GB 2,200,651; EP 0,345,242; WO 91/02805; Berkner, Biotechniques 6:616-627,1988; Rosenfeld et al., Science 252:431-434, 1991; Kolls et al., PNAS 91:215-219, 1994; Kass-Eisler et al., PNAS 90:11498-11502, 1993; Guzman et al., Circulation 88:2838-2848, 1993; and Guzman et al., Cir. Res. 73:1202-1207, 1993. Techniques for incorporating DNA into such expression systems are well known to those of ordinary skill in the art. The DNA may also be "naked," as described, for example, in published PCT application WO 90/11092, and Ulmer et al., Science 259:1745-1749 (1993), reviewed by Cohen, Science 259:1691-1692 (1993).
Routes and frequency of administration, as well as dosage, will vary from individual to individual and may parallel those currently being used in immunotherapy of other diseases. In general, the pharmaceutical compositions and vaccines may be administered by injection (e.g., intracutaneous, intramuscular, intravenous or subcutaneous), intranasally (e.g., by aspiration) or orally. Between 1 and 10 doses may be administered over a 3-24 week period. In one embodiment, 4 doses are administered, at an interval of 3 months, and booster administrations may be given periodically thereafter. Alternative protocols may be appropriate for individual patients. A suitable dose is an amount of polypeptide or DNA that is effective to raise an immune response (cellular and/or humoral) against tumor cells, e.g., kidney tumor cells, in a treated patient. A suitable immune response is at least 10-50% above the basal (i.e. untreated) level. In general, the amount of polypeptide present in a dose (or produced in situ by the DNA in a dose) ranges from about 1 pg to about 100 mg per kg of host, from about 10 pg to about 1 mg, or from about 100 pg to about 1 μg. Suitable dose sizes will vary with the size of the patient, but will typically range from about 0.01 mL to about 5 ml.
The regulatable protein or an immunogenic polypeptide thereof can be used in cell based immunotherapies, i.e. stimulation of dendritic cells with the regulatable protein or fusion with cells expressing the regulatable protein. The modified dendritic cells, once injected into the patient, are a cellular vaccine, where the dendritic cells activate an immune response against the cancer expressing the regulatable protein.
While any suitable carrier known to those of ordinary skill in the art may be employed in the pharmaceutical compositions of this invention, the type of carrier will vary depending on the mode of administration. For parenteral administration, such as subcutaneous injection, the carrier can comprise water, saline, alcohol, a fat, a wax and/or a buffer. For oral administration, any of the above carriers or a solid carrier, such as mannitol, lactose, starch, magnesium stearate, sodium saccharine, talcum, cellulose, glucose, sucrose, and/or magnesium carbonate, may be employed. Biodegradable microspheres (e.g., polyleptic galactide) may also be employed as carriers for the pharmaceutical compositions of this invention. Suitable biodegradable microspheres are disclosed, for example, in U.S. Pat. Nos. 4,897,268 and 5,075,109.
Any of a variety of non-specific immune response enhancers may be employed in the vaccines of this invention. For example, an adjuvant may be included. Most adjuvants contain a substance designed to protect the antigen from rapid catabolism, such as aluminum hydroxide or mineral oil, and a nonspecific stimulator of immune response, such as lipid A, Bordella pertussis or Mycobacterium tuberculosis. Such adjuvants are commercially available as, for example. Freund's Incomplete Adjuvant and Complete Adjuvant® (Difco Laboratories. Detroit, Mich.) and Merck Adjuvant 65® (Merck and Company, Inc., Rahway, N.J.).
The present description is further illustrated by the following examples, which should not be construed as limiting in any way. The contents of all cited references (including literature references, issued patents, published patent applications and GenBank Accession numbers as cited throughout this application) are hereby expressly incorporated by reference. The practice of the present methods will employ, unless otherwise indicated, conventional techniques of cell biology, cell culture, molecular biology, transgenic biology, microbiology, recombinant DNA, and immunology, which are within the skill of the art. Such techniques are explained fully in the literature. See, for example, Molecular Cloning A Laboratory Manual, 2nd Ed., ed. by Sambrook, Fritsch and Maniatis (Cold Spring Harbor Laboratory Press: 1989); DNA Cloning, Volumes I and II (D. N. Glover ed., 1985);
Oligonucleotide Synthesis (M. J. Gait ed., 1984); Mullis et al. U.S. Patent No: 4,683,195; Nucleic Acid Hybridization (B. D. Hames & S. J. Higgins eds. 1984); Transcription And Translation (B. D. Hames & S. J. Higgins eds. 1984); Culture Of Animal Cells (R. I. Freshney, Alan R. Liss, Inc., 1987); Immobilized Cells And Enzymes (IRL Press, 1986); B. Perbal, A Practical Guide To Molecular Cloning (1984); the treatise, Methods In Enzymology (Academic Press, Inc., N.Y.); Gene Transfer Vectors For Mammalian Cells (J. H. Miller and M. P. Calos eds., 1987, Cold Spring Harbor Laboratory); Methods In Enzymology, VoIs. 154 and 155 (Wu et al. eds.), Immunochemical Methods In Cell And Molecular Biology (Mayer and Walker, eds., Academic Press, London, 1987); Handbook Of Experimental Immunology, Volumes I-IV (D. M. Weir and C. C. Blackwell, eds., 1986); Manipulating the Mouse Embryo, (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1986).
EXAMPLES
Example 1- Contributions of Ras effector pathways to human cell transformation
It was previously shown that immortalized human embryonic kidney (HEK) epithelial cells expressing hTERT, LT and ST (HAlE), are rendered tumorigenic by the introduction of H-RASV12 (Hahn et al. (1999) Nature 436, 117-122). Activation of Ras stimulates many effector pathways including, but not limited to, the MAPK, PBK and RALGDS pathways (Downward (2003) Nat. Rev. Cancer 3, 11-22). However, it was likely that only a subset of these pathways participate directly in H-RAS vl2-induced transformation. Since activating mutations are found in several members of the MAPK and PI3K pathways in many human cancers, it was reasoned that the co-activation of these two pathways might be sufficient to replace H-RAS V12 in transformation. To test this hypothesis, the MAPK and PI3K pathways were manipulated in a combinatorial manner in HAlE cells.
To activate the PI3K pathway, one of three mutant alleles was expressed: myristoylated (myr), and therefore constitutively active, alleles of PIK3CA pi 10a (Klippel et al. (1996) MoI. Cell. Biol. 16, 4117-4127) (myr-110a) or AKTl (myr-AKT) (Kohn et al. (1996) J. Biol. Chem. 271 , 21920-21926); or a short hairpin RNA (shRNA) targeting PTEN (Boehm et al. (2005) MoI. Cell. Biol. 25, 6464-6474). To activate the MAPK pathway, one of three mutant alleles was expressed: an activated allele of CRAF (C-Raf 22W) (Stanton et al. (1989) MoI. Cell. Biol. 9, 639-647); the BRAFE600 allele (Davies et al. (2002) Nature 417, 949-954); or a constitutively active MEK1D218>D222 allele (MEKDD) (Brunet et al. (1994) Oncogene 9, 3379-3387). Using these reagents, sixteen cell lines expressing all possible combinations of these mutant alleles were created. All of these cell lines were confirmed to stably express each of the activated alleles, either singly or in pairwise combinations, and the ability of these cells to grow in an anchorage independent (AI) manner or to form tumors in immunodeficient animals was analyzed (TABLE 2). When introduced singly, none of the mutant alleles promoted AI colony formation (TABLE 2). However, certain combinations of activated alleles were found to substitute for H-RAS V12 to render these immortalized HEK cells tumorigenic (TABLE 2). Specifically, activation of the MAPK pathway by either BRAFE600 or MEKDD expression together with activation of the PDK pathway by myr-AKT expression induced AI growth indistinguishable from that induced by H-RAS V12 (TABLE 2, upper panel and FIG 1). Surprisingly, while either BRAFE60° or MEKDD cooperated with myr-AKT to induce AI growth, only cells expressing the MEKDD+myr-AKT combination induced tumor growth comparable to that observed in cells expressing H-RAS v12 (TABLE 2, lower panel and FIG 1). These - observations indicate that co-activation of specific members of the MAPK and PDK pathways suffices to replace H-RAS V12 in human cell transformation. In these HEK cells, co-expression of MEKDD and myr-AKT most closely recapitulated the AI growth and tumorigenicity phenotypes induced by H-RAS v12 (FIGl).
Example 2- Identification of transforming kinases
This approach not only identified specific combinations of activated members of the MEK and PDK pathways that replace H-RASV12 in HEK cell transformation, but also established an experimental platform to discover other transforming genes. This work was therefore extended by screening a large collection of genes to identify those that can substitute for myr-AKT. Because phosphorylation plays a key role in Ras signaling, it was hypothesized that other kinases might participate in PDK-induced transformation.
To identify such kinases, a library of 354 human kinases and kinase-related open reading frames (ORFs), including 256 kinases, was cloned into Gateway®-compatible entry vectors (Rual et al., (2004) Genome Res. 14, 2128-2135). Because membrane recruitment via the addition of a myr sequence activates both the PDK pi 10a subunit and AKT (Klippel et al. (1996) MoI. Cell. Biol. 16, 4117-4127; Kohn et al. (1996) J. Biol. Chem. 271, 21920-21926), a Gateway®-compatible retroviral destination vector, pWN-MF-DEST, was created which adds a myr sequence and a FLAG-epitope tag (MF) to each introduced ORF. It was confirmed that this destination vector and myr tag were functional (FIG7). Each ORF was subsequently transferred individually into p WN-MF-DEST (FIG2A).
Using the library of 354 myristoylated ORFs, a screen for genes that could replace myr-AKT and induce cell transformation was performed. Pools consisting of 10-12 unique ORFs were introduced into immortal but non-tumorigenic HEK cells expressing MEKDD (HAlE-M). Several pools reproducibly induced colony formation more than two standard deviations greater than the median number of colonies observed in the controls (FIG2B). To determine the identity of the specific kinases in these pools responsible for AI growth, cell lines were created that express individual kinases from each of such pools (FIG2C). Of the four pools analyzed in this manner, three contained one transforming kinase gene, and one pool, contained two transforming kinase genes. Each of these kinase genes (AKTl, IKBKE, DAK, TSSK6 and CSNKlE) also induced tumor formation (FIG2D). Since it was previously shown that myr-AKT cooperates with MEKDD to transform these immortalized cells, the identification of AKTl in this screen validated this screening approach. Thus, using a library of myristoylated kinases in retroviral vectors, four novel kinases were identified that cooperate with activated MEKl to replace H-RAS V12 in human cell transformation.
Example 3- Amplification of IKBKE in breast cancer cell lines and patient-derived tumor samples
It was next explored whether any of these kinases are altered in human cancers. First, high density SNP arrays were used to identify areas of copy number gain or loss in 179 cell lines representing a wide spectrum of cancer types (Garraway et al. (2005) Nature 436, 117- 122). Clear evidence of amplifications of the loci encoding DAK, TSSK6 or CSNKlE in any of the cell lines was not found. In contrast, copy number gain or amplification of Iq32 involving the IKBKE locus was found in 8 of 49 (16.3%) breast cancer cell lines (FIG3A). Indeed, copy number gain of Iq is the most common and earliest genetic alteration in breast cancers (Rennstam et al. (2003) Cancer Res. 63, 8861-8868).
It was next investigated whether IKBKE was similarly amplified in primary human breast cancer specimens by performing array comparative genome hybridization (aCGH) analyses on 30 breast tumors representing different clinicopathological stages (Yao et al., (2006) Cancer Res. 66, 4065-4078). These studies also revealed a region of recurrent copy number gain involving the IKBKE locus on chromosome Iq in 10 of 30 breast tumors (FIG3B). Four of the 10 ductal carcinoma in situ (DCIS) cases analyzed showed copy number gain of IKBKE, suggesting that amplification of this locus is an early event in the development of some breast cancers. An association of IKBKE copy number gain with estrogen receptor or Her2/neu status, or with the presence of lymph node involvement at diagnosis was not found. In addition, the IKBKE gene in 28 breast tumors and 19 breast cancer cell lines was sequenced and no evidence of somatic mutations was found, corroborating recent sequence efforts from other groups (Bamford et al. (2004) Br. J. Cancer 91, 355-358). To confirm that the region of copy number gain at Iq32 involves IKBKE, fluorescence in situ hybridization (FISH) was performed on several breast cancer cell lines and a primary breast tumor containing an amplification of Iq32 (FIG3C). Up to 10 copies of IKBKE in the UACC-812 and ZR-75-1 breast cancer cell lines and 5 copies of IKBKE in MCF-7 cells were found. One of the DCIS breast tumors, BWH-Tl 8, harbored 5 copies of the IKBKE locus in the majority of nuclei (FIG3C).
It was also investigated whether these DNA copy number changes corresponded to increases in IKBKE transcript and protein levels. Indeed, Serial Analysis of Gene Expression (SAGE), quantitative RT-PCR, and immunoblotting analyses confirmed that IKBKE (IKKε) is overexpressed in cell lines and breast tumors that exhibited Iq32 gain,- suggesting that IKBKE is one target of this amplicon (FIG3D and FIG3E). In addition, it was found that an additional 13/17 cell lines (76.5%) and 10/21 breast cancers (47.6%) showed increased expression (>2 fold) of IKBKE transcripts in the absence of Iq32 copy number changes. Utilizing two different IKKε antibodies, the observed protein levels correlated with the transcript levels (FIG3D and FIG3E), and UACC-812 and ZR-75-1 cells, which harbor Iq32 amplifications (FIG3A and FIG3C), showed the highest levels of IKKε of any cell line analyzed (FIG3E).
Although initial experiments were performed in immortalized HEK cells, it was also found that the introduction of IKBKE transforms human mammary epithelial cells (HMEC) expressing hTERT, the SV40ER and MEKK (HMEC-M) (Fig3F). In addition, since Iq32 amplifications result in increased levels of wild- type (WT) IKBKE, it was examined whether forced expression of the WT, non-myr IKBKE allele also rendered cells tumorigenic. It was found that cells expressing WT IKBKE at levels found in human cancer cells exhibited a similar capacity for tumorigenicity (FIG2D and FIG3G), confirming that the allele amplified in breast cancer specimens is transforming. Together, these observations identified IKBKE as a transforming kinase that is amplified and overexpressed in a substantial fraction of breast cancer cell lines and primary breast tumors.
Example 4- Consequences of suppressing IKBKE in breast cancer cells Because the findings described above implicate IKBKE as a breast cancer oncogene, the question of whether breast cancer cells are functionally dependent on IKKε expression was asked. The upregulated expression of many oncogenes renders cancer cells unusually dependent upon the continued function of the oncogene for cell proliferation or viability. This property of oncogenes, termed oncogene addiction, provides a rationale for targeting oncogenes therapeutically. To determine whether the presence of IKBKE amplifications and overexpression induces oncogene addiction, the effects of RNA interference (RNAi) targeting IKBKE and other genes were examined.
As part of a separate project to systematically discover genes essential for cancer cell viability, the shRNA library developed by The RNAi Consortium (TRC) (Moffat et al. (2006) Cell 124, 1283-1298) was used to screen a large collection of genes required for the proliferation and/or viability of cancer cell lines. As part of this effort, the MCF-7 breast cancer cell line was screened, as well as several additional human cancer cell lines, with 6,144 shRNAs targeting 1200 genes, including 93% of known human kinase genes. The results from the screening of MCF-7 cells were of particular relevance to the present study, because this breast cancer cell line harbors a Iq32 copy number gain (FIG3A and FIG3C) that results in a modest 2.5 fold increase in IKBKE transcript levels compared to immortalized MCFlOA cells (FIG3D). Examining the data from this screen, it was found that three of five shRNA targeting IKBKE compromised cell proliferation and viability (FIG4A, FIG4C, and FIG4D). It was found that the level of IKKε suppression by these 5 shRNA correlated with the observed decrease in cell proliferation and viability in MCF-7 cells (FIG4A, FIG4C, and FIG4D). These observations indicate that IKBKE is required for cell proliferation and survival of MCF-7 breast cancer cells.
This RNAi screen also included constructs targeting three of the other four genes that emerged from the gain-of-function screen (AKTl, CSNKlE and TSSK6). Similar to the results from shRNA targeting IKBKE, shRNA targeting AKTl or CSNKlE also resulted in inhibition of MCF-7 cell proliferation.
The data generated in the high throughput RNAi was next examined in order screen was examined in order to determine whether any other kinase encoded within the Iq32 amplicon was similarly required for MCF-7 viability. A minimally amplified region (5.6 Mb) containing IKBKE in the UACC-812 breast cancer cell line (FIG3A). This minimally amplified region contains 9 additional kinase genes. However, RNAi-mediated suppression of these other kinase genes failed to induce a statistically significant decrease in viability of MCF-7 cells (FIG4B). Three of four shRNA targeting NUAK2 partially inhibited the proliferation of MCF-7 cells but failed to satisfy the criteria employed in the high throughput RNAi screen. Although these observations do not eliminate the possibility that other genes within this Iq32 amplicon may cooperate with IKBKE to induce transformation, these findings suggest that IKBKE is a key target of the Iq32 amplification in breast cancer cell lines and tumors. To confirm that these observations in MCF-7 cells applied to other breast cancer cell lines that show IKBKE amplifications, the ZR-75-1 breast cancer cell line, which exhibits high-level amplification of IKBKE (FIG3A and FIG3C), was examined. It was found that inhibition of IKBKE expression in this cell line also compromised viability (FIG4C). In contrast, shRNA-mediated suppression of IKBKE failed to affect viability in PC3 prostate cancer cells, hTERT-expressing HMECs or the MCF10A.DCIS.com breast cancer cell line, all of which do not harbor amplifications of IKBKE (FIG4C). Corroborating these qualitative observations, it was found that suppression of IKBKE in MCF10A.DCIS.com or PC3 cancer cells inducted only a small increase in doubling time (9.1%-28.0%) over 11 days (FIG4D) while suppression of IKBKE in MCF-7 and ZR-75-1 cells increased doubling time by 80.6%- 114.5% (FIG4D). These observations suggested that IKBKE is essential for proliferation in breast cancer cell lines that show increased IKBKE copy number.
IKKε is a member of a family of five distinct but closely related proteins, the IKB kinase (IKK) family, consisting of IKKα, IKKβ, IKKγ, IKKε, and TBKl . Since IKKε function partly overlaps with other IKKs (Fitzgerald et al. (2003) Nat. Immunol. 4, 491-496; Peters et al. (2000) MoI. Cell 5, 513-522; Sharma et al. (2003) Science 300, 1148-1151), it was next determined whether the proliferation of ZR-75-1, MCF-7, or PC3 cells depended upon expression of any of the other IKK family members. Specifically, five distinct shRNA targeting each of these IKK family members were introduced into MCF-7, ZR-75 and PC3 cells. It was required that more than one shRNA construct targeting the gene to decrease viability and it was found that IKKε was the only IKK family member required for proliferation of ZR-75-1 cells, while both IKKε and TBKl were required for the proliferation of MCF-7 cells (FIG8). Suppression of TBKl, but not IKKε, inhibited the proliferation of PC3 cells. Taken together, these observations implicate IKBKE as an essential oncogene in breast cancer cell lines harboring amplifications of 1 q32 and are reminiscent of similar findings made in cell lines harboring other oncogenes such as BCR-ABL and EGFR, which also appear to render oncogene-expressing cells particularly dependent upon their expression (Weinstein and Joe (2006) Nat. Clin. Pract. Oncol. 3, 448-457).
Example 5- Consequences of DCBKE amplification and overexpression
Recent work implicates IKKε in the innate immune response to viral infections, as it activates the interferon pathway in part by stimulating the activity of the transcription factor IRF3 (Fitzgerald et al. (2003) Nat. Immunol. 4, 491-496; Sharma et al. (2003) Science 300, 1148-1151). It was tested whether cells expressing IKBKE displayed evidence of increased IRF3 transcriptional activity and a 3-5-fold activation of the IRF3-responsibe interferon- regulated promoter element (ISRE) of the IFIT2 gene in HAlE-M cells expressing either the myr or WT allele of IKBKE (FIG9A) was found. HAlE-M and HMEC-M cells expressing these IKBKE alleles also showed increased transcription of two known interferon responsive genes, IFNB 1 and CCL5 (encoding RANTES) (FIG9B and FIG9C).
To determine whether this activation of interferon-responsive promoters was required for transformation induced by IKBKE, IRF3-specific shRNA constructs were introduced into transformed HAlE-M cells expressing myr-IKBKE (FIG9D). Suppression of IRF3 failed to suppress AI growth (FIG9E). These observation suggested that, although the physiologic function of IKBKE involves activation of interferon responses, this activity of IKBKE may not be essential for transformation. IKBKE has also been reported to activate the NF-κB pathway (Peters et al. (2000) MoI. Cell 5, 513-522). It was therefore next determined whether the transforming activity of IKBKE is mediated by NF-κB. It was determined whether the expression of IKBKE destabilized the cytoplasmic pool of IκBα. HAlE-M cells expressing myr-IKBKE displayed a 43% reduction in cytoplasmic IκBα compared to levels observed in cells expressing a control vector (FIG5A and FIG5B). Moreover, even when IκBα was overexpressed in these IKBKE-expressing cells, increased IκBα protein expressed was not observed (FIG5C), indicating that IKKε effectively drives IκBα degradation. One consequence of IκBα degradation is the translocation of NF-κB transcription factors from the cytoplasm to the nucleus. Consistent with this expectation, it was found that HAlE-M cells expressing myr- IKBKE displayed a 32% reduction in cytoplasmic NF-κB p50 (FIG5A and FIG5B), and 71% of these cells displayed nuclear NF-κB p50 compared to 8% in cells harboring a control vector (FIG5D and FIG5E). It was also tested whether overexpression of IKBKE induced NF-κB transcriptional activity. HAlE-M cells expressing myr-IKBKE exhibited a 5-fold higher level of NF-κB transcriptional activity compared to cells expressing a control vector, as assessed by measuring the activity of a synthetic NF-κB reporter gene (FIG5F). To confirm that IKBKE activated the expression of endogenous NF-κB target genes, the expression levels of 9 NF-κB target genes was measured in HAlE-M or HMEC-M cells expressing myr- or WT IKBKE, respectively. IKBKE induced increased expression of all of these transcripts compared to cells expressing a control vector (FIG6G and FIG6H). Since cyclin Dl is overexpressed in over 50% of breast cancers (Bartkova et al. (1994) Int. J. Cancer 57, 353-361), it was examined whether the observed increases in CCNDl mRNA levels corresponded to increased cyclin Dl protein levels. Indeed, both HAlE-M or HMEC-M cells expressing myr-IKBKE showed substantially elevated levels of cyclin Dl (FIG5I). These data demosntrated that IKBKE activates the NF-κB pathway in two epithelial cell types.
To determine whether activation of the NF-κB pathway is necessary for transformation induced by IKBKE, NF-κB activity was inhibited in IKBKE-transformed HEK cells by expressing a mutant (MUT) "super-repressor" allele of IκBα harboring two amino acid substitutions (S32A/S36A), which renders this MUT IκBα resistant to phosphorylation and degradation (Brown et al. (1995) Science 267, 1485-1488). Expression of MUT IκBα in IKBKE-transformed HEK cells increased doubling times (FIG5J) and suppressed AI colony formation by 90.7% compared to cells infected with a control vector (FIG5K). In summary, these results implicate the activation of the NF-κB pathway in IKBKE-mediated cell transformation.
IKBKE was initially identified as a kinase that replaced AKTl in cellular transformation (FIG2A). Since AKT has also been reported to activate the NF-κB pathway (Ozes et al. (1999) Nature 401, 82-85; Romashkova and Makarov (1999) Nature 401, 86-90), it was next determined if the NF-κB pathway is similarly required for AKT-dependent transformation. Introduction of the MUT IκBα allele increased the doubling time of HEK cells transformed by AKT (FIG5J) and suppressed AI growth by 73.9% (FIG5K). It was next examined whether IKBKE contributed to cell transformation induced by AKT. Indeed, it was found that suppression of IKBKE by two different shRNA constructs increased doubling times by 20.0-59.0% and inhibited the capacity of AKT-transformed HEK to proliferate and grow in an AI manner (FIG5L). In aggregate, these observations implicate aberrant activation of the NF-κB pathway by IKBKE as a critical step in cell transofmration induced by AKT. Finally, it was determined whether DCBKE regulates the NF-κB pathway in breast cancer cell lines and patient-derived breast cancer tissue samples. Changes in NF-κB gene expression after IKBKE suppression in ZR-75-1 and MCF-7 breast cancer cells were examined and it was found that the expression of two DCBKE-induced NF-κB regulated genes, MMP9 and BCL2 (FIG5G and FIG5H), decreased upon suppression of IKBKE (FIG6A). Breast cancer cell lines harboring the Iq32 amplification showed increased expression of these genes compared to a breast cancer cell line that lacks IKKε expression (SUM52, FIG3E, right panel) (FIG6B and FIG6C). It was confirmed that these observations in cell lines also extended to primary breast cancer specimens. Since IKKε has recently been shown to induce nuclear accumulation of the NF-κB family member c-REL (Harris et al. (2006) J. Immunol., 177, 2527-2535), immunohistochemistry (1HC) was performed to detect IKKε and c-REL in an independent set of 20 breast cancer tissue samples. It was found that 7/20 (35%) of these breast cancer specimens showed increased expression of IKKε (FIG6D and FIG6E), confirming observations in the initial breast cancer specimens (FIG3B and FIG3D). In addition, it was found that 7 of 7 (100%) breast tumors that exhibited increased IKKε expression also displayed nuclear c-REL. hi contrast, c-REL was expressed at very low levels or was predominantly located in the cytoplasm in 12 of 13 (92%) of breast tumors that do not exhibit increased IKKε expression (FIG6D and FIG6E). This correlation between IKKε expression and nuclear localization of c-REL was statistically significant (p<0.0084). Taken together, these observations demonstrated that IKKε activates the NF-κB pathway in braest cancer. Moreover, while the clinical evidence for IKBKE gain-of-function in cancer comes from the amplification or overexpression of this gene, IKBKE and other candidates were only scored in the oncogenic transformation assay using the myr-kinase library. Overexpression of the cDNA for IKBKE failed in the primary screen. No candidate gene was scored when either a cDNA or ORF library was tested in the primary screen, suggesting that activated kinase library provides more robust signals.
Example 6- Materials and Methods for Examples 1-5
A. Cells culture and retroviral infection
HEK cells (Hahn et al. (1999) Nature 436, 117-122) and HMECs expressing hTERT (Elenbaas and Weinberg (2001) Exp. Cell Res. 264, 169-184) have been described. To introduce or suppress specific genes, retroviral (pBabe, pWzl, pMKO) (Boehm et al., (2005) MoI. Cell. Biol. 25, 6464-6474; Morgenstern and Land (1990) Nucleic Acids Res. 18, 3587- 3596) or lentiviral (pLKO) (Moffat et al., (2006) Cell 124, 1283-1298) vectors were used. Retroviruses and lentiviruses were generated as described (Boehm et al., (2005) MoI. Cell. Biol. 25, 6464-6474; Moffat et al., (2006) Cell 124, 1283-1298). Growth conditions for HEK cells have been described (Hahn et al., (2002) MoI Cell. Biol, 22, 2111-2123). HMEC cells were maintained in 1:1 DMEM:F12 (Invitrogen Corp., Carlsbad, CA) supplemented with 10 ng/mL epidermal growth factor (Sigma-Aldrich, St. Louis, MO), 0.5 μg/mL hydrocortisone (Sigma- Aldrich, St. Louis, MO), and 10 μg/mL insulin (Sigma-Aldrich, St. Louis, MO). Tumor specimens and breast cancer cell lines were obtained as described (Yao et al., (2006) Cancer Res. 66, 4065-4078)
B. Myristoylated kinase library
ORFs were cloned into Gateway® compatible pEntry vectors by performing site- specific BP recombination reactions as described (Rual et al., (2004) Genome Res. 14, 2128- 2135). pWzl-Neo-Myr-Flag DEST (p WN-MF-DEST) was created by inserting an N-terminal myristoylation-FLAG tag and the Gateway® selectable cassette into the pWzl-Neo retroviral vector (Morgenstern and Land (1990) Nucleic Acids Res. 18, 3587-3596). To create specific pWN-MF-ORF vectors, site-specific LR recombination reactions were performed individually, as described (Rual et al., (2004) Genome Res. 14, 2128-2135).
C. Other vectors used in this study pBabe-Puro-cRAFw22, pBabe-Puro-BRAFE600, pBabe-Puro-MEKDD, and pBabe- HcRed-MEKDD were created by introducing the cRAFw22 allele (Stanton et al. (1989) MoI. Cell. Biol. 9, 639-647), the BRAFE60° allele (Davies et al. (2002) Nature 417, 949-954) and the MEK1D218'D222 allele (MEKDD) (Brunet et al. (1994) Oncogene 9, 3379-3387) (gifts from H. Widlund, Dana-Farber Cancer Insitute) into pBabe-Puro or pBabe-HcRed (Boehm et al. (2005) MoI. Cell. Biol. 25, 6464-6474). pMKO-GFP-PTEN has been described (Boehm et al. (2005) MoI. Cell. Biol. 25, 6464-6474). pBabe-GFP-Myr-Flag-PI3K 110a allele and pBabe- GFP-Myr-Flag-AKTl were created by introducing the Myr-Flag-PI3K 110a (Zhao et al., (2003) Cancer Cell 3, 483-495) or the Myr-Flag-AKTl allele (Ramaswamy et al. (1999) Proc. Natl. Acad. ScL USA 96, 2110-2115) into pBabe-GFP. pBabe-Puro-RASV12 has been described (Serrano et al. (1997) Cell 88, 593-602). pBabe-Puro-Myr-FLAG-IKBKE, pBabe- Puro-Flag-IKBKE, pBabe-Neo-Myr-Flag-QCBKE and pBabe-Neo-Flag-IKBKE were generated by PCR cloning Myr-Flag-IKBKE or Flag-DCBKE from pWN-DEST-MF-IKBKE into pBabe-Puro or pBabe-Neo, and were fully sequenced. For experiments subsequent to the primary screen, MEKX)D, Myr-Flag-IKBKE, Flag-IKBKE, and Myr-Flag-AKT were introduced into HAlE cells using pBabe-HcRed-MEKDD (FIG5) or pBabe-Puro-MEKDD (FIG2D), pBabe-Puro-Myr-Flag-IKBKE, pBabe-Puro-Flag-IKBKE and pBabe-GFP-Myr- Flag-AKTl and HMECs using pBabe-Puro-MEKDD, pBabe-Neo-Myr-Flag-IKBKE and pBabe-Neo-Flag-IKBKE. To introduce MUT IκBα or wt IκBα, pBabe-GFP-MUT IκBα
(FIG5C), pBabe-Puro-MUT IκBα (FIG5J and FIG5K), or pBabe-GFP-wt IκBα (FIG5C) was used, which were created by cloning MUT IκBα or wt IκBα (gift from K. Steigmeier, Dana- Farber Cancer Institute) into pBabe-GFP or pBabe-Puro.
D. Retroviral infection Infections were performed serially by using drug selection or fluorescence-activated cell sorting to purify cell populations 48 hours after injection. For puromycin selection, 2 μg/mL (HEK cells) or 0.5 μg/mL (HMEL cells) was used. For neomycin selection, 150 ng/mL (HMEL cells) was used.
E. Anchorage-independent growth and tumorigenicity assays Growth of cells in soft agar was determined by plating 5x104 cells in triplicate in 0.4% (HEK) or 0.3% (HMEC) Noble agar. Colonies greater than 100 μm in diameter were counted microscopically 8 weeks after plating. Colonies greater than 200 nm in diameter were counted macroscopically 8 weeks after plating. Tumor xenograft experiments were performed as described (Boehm et al., (2005) MoI. Cell. Biol. 25, 6464-6474). Tumor injection sites were monitored for 80 days for tumor formation. F. Immunoblotting
Immunoblotting was performed as described (Boehm et al., (2005) MoI. Cell. Biol. 25, 6464-6474). The following antibodies were used: anti-IKKε C-14 (Santa Cruz Biotech, Inc., Santa Cruz, CA) or anti-IKKε c-terminal (Sigma-Aldrich, St. Louis, MO), anti-IκBα C- 15 (Santa Cruz Biotech, Inc., Santa Cruz, CA), anti-NKκB H-119 (Santa Cruz Biotech, Inc., Santa Cruz, CA), anti-MEKl/2 (Cell Signaling Technology, Inc., Danvers, MA), anti-Cyclin Dl (Neomarkers, Lab Vision Corp., Fremont, CA), or anti-IRF3 (Santa Cruz Biotech, Inc., Santa Cruz, CA). G. Immuno fluorescence
For immunofluorescence, cells were seeded on Teflon-coated slides and incubated for 24 hours. Cells were washed with PBS, fixed in 4% paraformaldehyde, and permeabilized with 0.5% Triton. After washing, slides were blocked with Dakocytomation Protein Block (Dakocytomation), incubated for 2 hours with anti-NKκB H-119, and then incubated with a FITC-conjugated anti-Rabbit IgG (Molecular Probes, Invitrogen Corp., Carlsbad, CA). After washing, slides were counterstained with Hoechst 33342 (10 uM) (Invitrogen Corp., Carlsbad, CA). H. PCR
A list of gene-specific primers used is as follows: Figure 3D:
IKBKE (forward; 5'-TGCGTGCAGAAGTATCAAGC-3, reverse; 5'-
TACAGGCAGCCACAGAACAG-3') Figure 5C:
NFKBIA (forward; 5 '-GCCTGGACTCCATGAAAGAC-3' , reverse; 5'- GACACGTGTGGCCATTGTAG-3')
Figure 5G,H, Figure 6A,B,C:
CChJDl (forward; 5t-AACTACCTGGACCGCTTCCT-3, reverse; 5'-
CCACTTGAGCTTGTTCACCA-S1)
MYC (forward; 5'-TTCGGGTAGTGGAAAACCAG-3', reverse; 5'- CAGCAGCTCGAATTTCTTCC-3') PTGS2 (forward; 5'-TGAGCATCTACGGTTTGCTG-3', reverse; 5'-
TGCTTGTCTGGAACAACTGC-3')
ILIA (forward; 5'-AATGACGCCCTCAATCAAAG-3', reverse; 5'-
TGGGTATCTCAGGCATCTCC-3') MMP9 (forward; 5'-TTGACAGCGACAAGAAGTGG-3', reverse; 5'-
GCCATTCACGTCGTCCTTAT-3')
VEGF (forward; S'-CCCACTGAGGAGTCCAACAT-3', reverse; 5'-
TTTCTTGCGCTTTCGTTTTT-3')
BIRC2 (forward; 5'-CCAGGTCCCTCGTATCAAAA-3', reverse; 5'- AAACCAGCACGAGCAAGACT-3')
BIRC3 (forward; 5'-CTTTGCCTGTGGTGGAAAAT-3', reverse; 5'-
ACTTGCAAGCTGCTCAGGAT-3')
BCL2 (forward; 5'-GAGGATTGTGGCCTTCTTTG-3' , reverse; 5'-
ACAGTTCCACAAAGGCATCC-3 ') Figure 9B,C:
IFNBl (forward; 5'-ACTGCCTCAAGGACAGGATG-3', reverse; 5'-
AGCCAGGAGGTTCTCAACAA-3')
CCL5 (forward; 5'-CCATATTCCTCGGACACCAC-3', reverse; 5'-
TGTACTCCCGAACCCATTTC-3') For quantitative RT-PCR, SYBR-Green (Applied Biosystems) was used. For RT-
PCR, total RNA was isolated using TRIzol (Invitrogen Corp., Carlsbad, CA). For quantitative RT-PCR, we used SYBR-Green (Applied Biosystems, Foster City, CA). I. Immunohistochemistry
Breast cancer Tissue Microarray slides (Biomax BR8O3) were immunostained with anti-IKKε-c-terminal (1:250; Sigma) and anti-c-Rel c-terminus (1 :200; Chemicon) antibodies using microwave-citrate antigen retrieval followed by standard IHC staining procedures. Arrays were scored in a blinded manner by a pathologist on a scale of 0-3. J. Genome structure analyses
SNP array, aCGH and SAGE data was collected and analyzed as described (Garraway et al. (2005) Nature 436, 117-122).
K. Fluorescence in situ hybridization (FISH)
Bacterial artificial chromosome (BAC) clone CTD 2229G19 containing IKBKE (Invitrogen Corp., Carlsbad, CA) was labeled with digoxigenin (Roche Diagnostics Corp., Indianapolis, IN) using the enzyme mix from the BioNick labeling kit (Invitrogen Corp., Carlsbad, CA) as described (Zhao et al. (1995) MoI. Cell. Biol. 15, 4353-4363). The probe was detected according to the manufacturer's recommendations (Cytocell Technologies Ltd.,
Cambridge, United Kingdom). The Spectrum Orange labeled chromosome 1 specific centromeric probe (D1Z5) and whole chromosome paint probe (WCPl) were obtained from Vysis, Inc. (Downers Grove, IL). Tissue and cell line preparations were performed as described (Yao et al., (2006) Cancer Res. 66, 4065-4078) and hybridization of metaphase chromosomes was performed as described (Ney et al. (1993) MoI. Cell. Biol. 13, 5604-5612). L. RNA interference
To stably suppress IKBKE and other members of the DCK family, pLKO.l lentiviral shRNA constructs generated by TRC (Moffat et al. (2006) Cell 124, 1283-1298) were used. Lentiviral infections were performed as described (Moffat et al. (2006) Cell 124, 1283-1298). Cell Titer GIo (Promega Corp., Madison, WI) was used to measure viability 5 days after lentiviral infection. Z-scores were calculated by normalizing the viability score of each well to the plate mean viability score and standard deviation (SD) of plate viability scores: Z = (X- μ)/σ, where X= assay value (relative luminescence); μ = mean plate viability score; and σ = SD of plate viability scores. Suppression of viability was defined as the capacity for at least one shRNA to decrease viability more than 1.5 SD below the mean Z-score and at least one additional shRNA targeting the same kinase to decrease viability more than 1 SD below the mean Z-score. M. shRNA experiments
To suppress IRF3 in FIG9D, shRNA specific for the following IRF3 seuqences using pLKO.l lentiviral vectors (Moffat et al. (2006) Cell 124, 1283-1298) were introduced: shIRF3 #l: CCCTTCATTGTAGATCTGATT shIRF3 #2: GCCAACCTGGAAGAGGAATTT
To suppress IKBKEin FIGS4-6, shRNA specific for the following IKBKE sequences using pLKO.l lentiviral vectors were introducted (Moffat et al. (2006) Cell 124, 1283-1298): shIKBKE #3: TGGGCAGGAGCTAATGTTTCG shIKBKE #4: GTCCTTAGTCACACACGGCAA shIKBKE #5: GAGCATTGGAGTGACCTTGTA N. Reporter Assays
For NF-κB or interferon reporter assays, 3x104 cells were seeded in triplicate in 24- well plates. 12 hours after seeding, 100 ng of pNF-κB-luciferase (BD Biosciences) or pISRE- luciferase (Stratagene) plus 500 ng renilla-encoding plasmid (pRL-TK, gift from L. Poling, Dana-Farber Cancer Institute) was transfected in triplicate using Fugene (Roche), Media was replaced after 6 hours, and luciferase and renilla signals were measured 24 hours after transfection using the Dual Luciferase Reporter Assay Kit (Promega). Example 7- Identification of kinases and signaling pathways involved in resistance to PDK inactivation
Another contemplated embodiment of the invention involves the use of kinase libraries described herein to identify kinases and signaling pathways that establish resistance to PDK inactivation. In one example, the screens using the kinase libraries employ cells that harbor a specific knockout of PIK3CA, which is the PD Kinase catalytic subunit which uses ATP to phosphorylate phosphatydinositol molecules. As PDK inhibitors are entering clinical trials, drug resistance is likely to be the next frontier. Information arising from screens as described herein will provide a better understanding of the mechanisms by which tumor cells might survive and even grow in the presence of a PDK inhibitor and for identifying kinases or pathways, which might optimally be targeted in concert with PDK inhibition. Preliminary screening using the myr-kinase library described in Example 6 have resulted in the identification of a number of kinases, e.g. Akt, Raf, MATK and MAP3K8, that could drive oncogenic transformation of these cells even when PIK3CA is inactivated, providing a potential resistance mechanism for PDK inhibitors in cancer treatment. For example, PIK3CA is frequently mutated in many types of human cancer and these mutations are oncogenic. PDK inhibitors are being developed to target cancers carrying PIK3CA mutations. However, if these cancer cells also harbor activated Akt, Raf, MATK or MAP3K8, they may not respond to PDK inhibitors and combination therapy may be proposed.
Example 8- Identification of kinases and signaling pathways involved in resistance to PDK inactivation
To complement the library of kinases activated by myristoylation, the helix-loop-helix domain (HL) of the Tel transcription factor (TeI-HLH) was used to activate tyrosine kinases (TKs). The human genome contains roughly 90 tyrosine kinases (TKs). Since most TKs are not efficiently activated by myrsitoylation, but can usually be activated by dimerization, a ligand-independent dimerization system was employed to make chimeric proteins that contain TKs fused at their C-termini to the TeI-HLH domain (FIGlO). TeI-HLH was isolated as an element fused to PDGR in patients with chronic myelomonocytic leukemia. The HLH domain of the transcription factor Tel mediates the dimerzation of the Tel/PDGFR fusion protein and leads to the constitutive activation of PDGFR, resulting in cellular transformation (Carroll et al, (1996) Proc. Natl. Acad. Sci. U.S.A. 93:14845-14850). Similar to the construction of myristoylated kinase library as described in Example 6, a retroviral-based, Gateway-compatible DEST-vector containing elements encoding HLH domain of Tel fused in frame with a Flag-epitope, pWN-TelF-DEST was constructed. Full-length ORFs of TKs lacking stop codons were moved into the Gateway entry vector and subsequently into pWN- TeIF-DEST. TKs expressed from pWN-TelF-DEST vector feature a full-length protein kinase fused in frame with the TeI-HLH domain and a Flag epitope. To test for expression and activation of the resulting fusion proteins, these TeI-TK clones were introduced into 293T cells, which were then starved for growth factors and lysed. The resulting lysates were then analyzed by western blotting. The blots were developed with Flag antibodies to check for protein expression and with the 4G10 antibody to assess for tyrosine phosphorylation of these TeI-TKs (FIGIl).
Equivalents
While specific embodiments of the subject invention have been discussed, the above specification is illustrative and not restrictive. Many variations of the invention will become apparent to those skilled in the art upon review of this specification and the claims below. The full scope of the invention should be determined by reference to the claims, along with their full scope of equivalents, and the specification, along with such variations.
Table 1
NCBI Official
Gene IO Symbol Description
25 ABL1 v-abl Abelson murine leukemia viral oncogene homolog 1
27 ABL2 v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene)
90 ACVR1 activin A receptor, type I
91 ACVR1 B activin A receptor, type IB
92 ACVR2 activin A receptor, type Il
93 ACVR2B activin A receptor, type HB
94 ACVRL1 activin A receptor type ll-tike 1 132 ADK adenosine kinase 156 ADRBK1 adrenergic, beta, receptor kinase 1 157 ADRBK2 adrenergic, beta, receptor kinase 2
203 AK1 adenylate kinase 1
204 AK2 adenylate kinase 2
205 AK3 adenylate kinase 3
207 AKT1 v-akt murine thymoma viral oncogene homolog 1
208 AKT2 v-akt murine thymoma viral oncogene homolog 2 238 ALK anaplastic lymphoma kinase (Ki-1 ) 269 AMHR2 anti-Mullerian hormone receptor, type Il 369 ARAF 1 v-raf murine sarcoma 3611 viral oncogene homolog 1 472 ATM ataxia telangiectasia mutated (includes complementation groups A, C and D) 545 ATR ataxia telangiectasia and Rad3 related 558 AXL AXL receptor tyrosine kinase 613 BCR breakpoint cluster region 640 BLK B lymphoid tyrosine kinase
657 BMPR1A bone morphogenetic protein receptor, type IA
658 BMPR 1 B bone morphogenetic protein receptor, type IB
659 BMPR2 bone morphogenetic protein receptor, type Il (serine/threonine kinase)
660 BMX BMX non-receptor tyrosine kinase 673 BRAF v-raf murine sarcoma viral oncogene homolog B1 676 BRDT bromodomain, testis-specific 695 BTK Bruton agammaglobulinemia tyrosine kinase 699 BUB1 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) 701 BUB1B BUB1 budding uninhibited by benzimidazoles 1 homolog beta (yeast) 780 DDR 1 discoidin domain receptor family, member 1 801 CALM1 calmodulin 1 (phosphorylase kinase, delta) 805 CALM2 calmodulin 2 (phosphorylase kinase, delta) 808 CALM3 calmodulin 3 (phosphorylase kinase, delta) 814 CAMK4 calcium/calmodulin-dependent protein kinase IV 815 CAMK2A calcium/calmodulin-dependent protein kinase (CaM kinase) Il alpha 816 CAMK2B calcium/calmodulin-dependent protein kinase (CaM kinase) Il beta 817 CAWIK2D calcium/calmodulin-dependent protein kinase (CaM kinase) Il delta 818 CAMK2G calcium/calmodulin-dependent protein kinase (CaM kinase) Il gamma 914 CD2 CD2 antigen (p50), sheep red blood cell receptor;CD2
983 CDC2 cell division cycle 2, G 1 to S and G2 to M
984 CDC2L1 cell division cycle 2-like 1 (PITSLRE proteins)
985 CDC2L2 cell division cycle 2-like 2 (PITSLRE proteins)
1017 CDK2 cyclin-dependent kinase 2
1018 CDK3 cyclin-dependent kinase 3
1019 CDK4 cyclin-dependent kinase 4
1020 CDK5 cyclin-dependent kinase 5
1021 CDK6 cyclin-dependent kinase 6
1022 CDK7 cyclin-dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk-activating kinase)
1024 CDK8 cyclin-dependent kinase 8
1025 CDK9 cyclin-dependent kinase 9 (CDC2-related kinase) 1111 CHEK1 CHK1 checkpoint homolog (S. pombe) 1119 CHKA choline kinase alpha 1120 CHKB choline kinase beta 1147 CHUK conserved helix-loop-helix ubiquitous kinase 1152 CKB creatine kinase, brain 1158 CKM creatine kinase, muscle 1159 CKMT1 creatine kinase, mitochondrial 1 (ubiquitous) 1160 CKMT2 creatine kinase, mitochondrial 2 (sarcomeric) 1163 CKS1B CDC28 protein kinase regulatory subunit 1B 1164 CKS2 CDC28 protein kinase regulatory subunit 2 1195 CLK1 CDC-like kinase 1 1196 CLK2 CDC-hke kinase 2
1198 CLK3 CDC-like kinase 3
1263 PLK3 polo-like kinase 3 (Drosophila)
1326 MAP3K8 mitogen-activated protein kinase kinase kinase 8
1399 CRKL v-crk sarcoma virus CT10 oncogene homolog (avιan)-lιke.CRKL
1432 MAPK 14 mitogen-activated protein kinase 14 colony stimulating factor 1 receptor, formerly McDonough feline sarcoma viral (v-fms)
1436 CSF1R oncogene homolog
1445 CSK c-src tyrosine kinase
1452 CSNK1A1 casein kinase 1 , alpha 1
1453 CSNK1 D casein kinase 1 , delta
1454 CSNK1 E casein kinase 1 , epsilon
1455 CSNK1 G2 casein kinase 1 , gamma 2
1456 CSNK1G3 casein kinase 1, gamma 3
1457 CSNK2A1 casein kinase 2, alpha 1 polypeptide
1459 CSNK2A2 casein kinase 2, alpha prime polypeptide
1460 CSNK2B casein kinase 2, beta polypeptide
1606 DGKA diacylglycerol kinase, alpha 8OkDa
1607 DGKB diacylglycerol kinase, beta 9OkDa
1608 DGKG diacylglycerol kinase, gamma 9OkDa
1609 DGKQ diacylglycerol kinase, theta 110kDa
1612 DAPK1 death-associated protein kinase 1
1613 DAPK3 death-associated protein kinase 3 1633 DCK deoxycytidine kinase
1716 DGUOK deoxyguanosine kinase
1739 DLG1 discs, large homolog 1 (Drosophιla),DLG1
1740 DLG2 discs, large homolog 2, chapsyn-110 (Drosophιla),DLG2
1741 DLG3 discs, large homolog 3 (neuroendocπne-dlg, Drosophιla),DLG3 1760 DMPK dystrophia myotonica-protein kinase
1841 DTYMK deoxythymidylate kinase (thymidylate kinase)
1859 DYRK1A dual-specificity tyrosιne-(Y)-phosphorylatιon regulated kinase 1A epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene
1956 EGFR homolog, avian)
1969 EPHA2 EPH receptor A2
2011 MARK2 MAP/microtubule affinity-regulating kinase 2
2041 EPHA1 EPH receptor A1
2042 EPHA3 EPH receptor A3
2043 EPHA4 EPH receptor A4
2044 EPHA5 EPH receptor A5
2045 EPHA7 EPH receptor A7 2046 EPHA8 EPH receptor A8
2047 EPHB1 EPH receptor B1
2048 EPHB2 EPH receptor B2
2049 EPHB3 EPH receptor B3
2050 EPHB4 EPH receptor B4
2051 EPHB6 EPH receptor B6 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived
2064 ERBB2 oncogene homolog (avian)
2065 ERBB3 v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)
2066 ERBB4 v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian) 2081 ERN1 endoplasmic reticulum to nucleus signalling 1
2185 PTK2B PTK2B protein tyrosine kinase 2 beta
2241 FER fer (fps/fes related) tyrosine kinase (phosphoprotein NCP94)
2242 FES feline sarcoma oncogene
2260 FGFR1 fibroblast growth factor receptor 1 (fms-related tyrosine kinase 2, Pfeiffer syndrome)
2261 FGFR3 fibroblast growth factor receptor 3 (achondroplasia, thanatophoric dwarfism) fibroblast growth factor receptor 2 (bacteria-expressed kinase, keratmocyte growth factor receptor, craniofacial dysostosis 1 , Crouzoπ syndrome, Pfeiffer syndrome, Jackson-
2263 FGFR2 Weiss syndrome)
2264 FGFR4 fibroblast growth factor receptor 4
2268 FGR Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability
2321 FLT1 factor receptor)
2322 FLT3 fms-related tyrosine kinase 3 2324 FLT4 fms-related tyrosine kinase 4 2395 FXN frataxiπ.FXN
2444 FRK fyn-related kinase
2475 FRAP1 FK506 binding protein 12-rapamycιn associated protein 1
2534 FYN FYN oncogene related to SRC, FGR, YES 2580 GAK cyclin G associated kinase
2584 GALK1 galactokinase 1
2585 GALK2 galactokinase 2
2645 GCK glucokinase (hexokinase 4, maturity onset diabetes of the young 2)
2710 GK glycerol kinase
2712 GK2 glycerol kinase 2
2868 GRK4 G protein-coupled receptor kinase 4
2869 GRK5 G protein-coupled receptor kinase 5
2870 GRK6 G protein-coupled receptor kinase 6
2872 MKNK2 MAP kinase interacting serine/threonine kinase 2
2931 GSK3A glycogen synthase kinase 3 alpha
2932 GSK3B glycogen synthase kinase 3 beta
2965 GTF2H1 general transcription factor HH, polypeptide 1 , 62kDa;GTF2H1
2984 GUCY2C guanylate cyclase 2C (heat stable eπterotoxin receptor)
2986 GUCY2F guanylate cyclase 2F, retinal
2987 GUK1 guanylate kinase 1
3000 GUCY2D guanylate cyclase 2D, membrane (retina-specific)
3055 HCK hemopoietic cell kinase
3098 HK1 hexokinase 1
3099 HK2 hexokinase 2
3101 HK3 hexokinase 3 (white cell)
3480 IGF 1 R insulin-like growth factor 1 receptor
3551 IKBKB inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta
3611 ILK integrin-linked kinase
3643 INSR insulin receptor
3645 INSRR insulin receptor-related receptor
3654 IRAKI interleukin-1 receptor-associated kinase 1
3656 IRAK2 interleukin-1 receptor-associated kinase 2
3702 ITK IL2-inducible T-cell kinase
3705 ITPK1 inositol 1,3,4-triphosphate 5/6 kinase
3706 ITPKA inositol 1 ,4,5-trisphosphate 3-kinase A
3707 ITPKB inositol 1 ,4,5-trisphosphate 3-kinase B
3716 JAK 1 Janus kinase 1 (a protein tyrosine kinase)
3717 JAK2 Janus kinase 2 (a protein tyrosine kinase)
3718 JAK3 Janus kinase 3 (a protein tyrosine kinase, leukocyte)
3791 KDR kinase insert domain receptor (a type III receptor tyrosine kinase)
3795 KHK ketohexokinase (fructokinase)
3815 KIT v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
3932 LCK lymphocyte-specific protein tyrosine kinase
3984 LIMK1 LIM domain kinase 1
3985 LIMK2 LIM domain kinase 2 4058 LTK leukocyte tyrosine kinase
4067 LYN v-yes-1 Yamaguchi sarcoma viral related oncogene homolog
4117 MAK male germ cell-associated kinase
4139 MARK1 MAP/microtubule affinity-regulating kinase 1
4140 MARK3 MAP/microtubule affinity-regulating kinase 3 4145 MATK megakaryocyte-associated tyrosine kinase
4214 MAP3K1 mitogen-activated protein kinase kinase kinase 1
4215 MAP3K3 mitogen-activated protein kinase kinase kinase 3
4216 MAP3K4 mitogen-activated protein kinase kinase kinase 4
4217 MAP3K5 mitogen-activated protein kinase kinase kinase 5 4233 MET met proto-oncogene (hepatocyte growth factor receptor)
4293 MAP3K9 mitogen-activated protein kinase kinase kinase 9
4294 MAP3K10 mitogen-activated protein kinase kinase kinase 10 4296 MAP3K11 mitogen-activated protein kinase kinase kinase 11 4342 MOS v-mos Moloney murine sarcoma viral oncogene homolog
4354 MPP1 membrane protein, palmitoylated 1, 55kDa;MPP1
4355 MPP2 membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2);MPP2
4356 MPP3 membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3);MPP3 4486 MST1R macrophage stimulating 1 receptor (c-met-related tyrosine kinase)
4593 MUSK muscle, skeletal, receptor tyrosine kinase
4598 MVK mevalonate kinase (mevalonic aciduria)
4638 MYLK myosin, light polypeptide kinase
4750 NEK1 NIMA (never in mitosis gene a)-related kinase 1
4751 NEK2 NIMA (never in mitosis gene a)-related kinase 2
4752 NEK3 NIMA (never in mitosis gene a)-related kinase 3
4830 NME1 nucleoside-diphosphate kinase 1
4831 NME2 nucleoside-diphosphate kinase 2
4832 NME3 nucleoside-diphosphate kinase 3 4833 NME4 nucleoside-diphosphate kinase 4
4881 NPR1 natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A)
4882 NPR2 natriuretic peptide receptor B/guanylate cyclase B (atπonatπuretic peptide receptor B)
4914 NTRK1 neurotrophic tyrosine kinase, receptor, type 1
4915 NTRK2 neurotrophic tyrosine kinase, receptor, type 2
4916 NTRK3 neurotrophic tyrosine kinase, receptor, type 3
4919 ROR1 receptor tyrosine kinase-like orphan receptor 1
4920 ROR2 receptor tyrosine kinase-like orphan receptor 2
4921 DDR2 discoidin domain receptor family, member 2
5058 PAK1 p21/Cdc42/Rad -activated kinase 1 (STE20 homolog, yeast)
5062 PAK2 p21 (CDKN 1A)-actιvated kinase 2
5063 PAK3 p21 (CDKN 1A)-actιvated kinase 3
5105 PCK1 phosphoenolpyruvate carboxykinase 1 (soluble)
5106 PCK2 phosphoenolpyruvate carboxykinase 2 (mitochondrial)
5127 PCTK1 PCTAIRE protein kinase 1
5128 PCTK2 PCTAIRE protein kinase 2
5129 PCTK3 PCTAIRE protein kinase 3
5156 PDGFRA platelet-derived growth factor receptor, alpha polypeptide
5157 PDGFRL platelet-derived growth factor receptor-like.PDGFRL 5159 PDGFRB platelet-derived growth factor receptor, beta polypeptide
5163 PDK1 pyruvate dehydrogenase kinase, isoenzyme 1
5164 PDK2 pyruvate dehydrogenase kinase, isoenzyme 2
5165 PDK3 pyruvate dehydrogenase kinase, isoenzyme 3
5166 PDK4 pyruvate dehydrogenase kinase, isoenzyme 4 5170 PDPK1 3-phosphoιnosιtιde dependent protein kιnase-1
5207 PFKFB1 6-phosphofructo-2-kιnase/fructose-2,6-bιphosphatase 1
5208 PFKFB2 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
5209 PFKFB3 6-phosphofructo-2-kιπase/fructose-2,6-bιphosphatase 3
5210 PFKFB4 6-phosphofructo-2-kιnase/fructose-2,6-bιphosphatase 4
5211 PFKL phosphofructokinase, liver
5213 PFKM phosphofructokinase, muscle
5214 PFKP phosphofructokinase, platelet 5218 PFTK1 PFTAIRE protein kinase 1 5230 PGK1 phosphoglycerate kinase 1 5232 PGK2 phosphoglycerate kinase 2
5255 PHKA1 phαsphorylase kinase, alpha 1 (muscle)
5256 PHKA2 phosphorylase kinase, alpha 2 (liver)
5257 PHKB phosphorylase kinase, beta
5260 PHKG1 phosphorylase kinase, gamma 1 (muscle)
5261 PHKG2 phosphorylase kinase, gamma 2 (testis)
5286 PIK3C2A phosphoιnosιtιde-3-kιnase, class 2, alpha polypeptide
5287 PIK3C2B phosphoinosιtιde-3-kιnase, class 2, beta polypeptide
5288 PIK3C2G phosphoιnosιtιde-3-kιnase, class 2, gamma polypeptide
5289 PIK3C3 phosphoιnosιtιde-3-kιnase, class 3
5290 PIK3CA phosphoιnosιtιde-3-kinase, catalytic, alpha polypeptide
5291 PIK3CB phosphoιnosιtιde-3-kιnase, catalytic, beta polypeptide
5292 Pl M 1 pιm-1 oncogene
5293 PIK3CD phosphoιnosιtιde-3-kιnase, catalytic, delta polypeptide
5294 PIK3CG phosphoinosιtιde-3-kιnase, catalytic, gamma polypeptide
5295 PIK3R1 phosphoιnosιtιde-3-kιnase, regulatory subunit 1 (p85 alpha)
5296 PIK3R2 phosphoιnosιtιde-3-kιnase, regulatory subunit 2 (p85 beta)
5297 PIK4CA phosphatidylinositol 4-kιnase, catalytic, alpha polypeptide
5298 PIK4CB phosphatidylinositol 4-kιnase, catalytic, beta polypeptide 5305 PIP5K2A phosphatιdylιnosιtol-4-phosphate 5-kιnase, type II, alpha 5313 PKLR pyruvate kinase, liver and RBC
5315 PKM2 pyruvate kinase, muscle
5328 PLAU plasminogen activator, urokinase
5347 PLK1 polo-like kinase 1 (Drosophila)
5361 PLXNA1 plexin A1 ,PLXNA1
5362 PLXNA2 plexin A2.PLXNA2
5364 PLXNB1 plexin B1 ,PLXNB1
5365 PLXNB3 plexin B3.PLXNB3
5394 EXOSC10 exosome component 10.EXOSC10
5562 PRKAA1 protein kinase, AMP-activated, alpha 1 catalytic subunit
5563 PRKAA2 protein kinase, AMP-activated, alpha 2 catalytic subunit
5564 PRKAB1 protein kinase, AMP-activated, beta 1 non-catalytic subunit
5565 PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit 5566 PRKACA protein kinase, cAMP-dependent, catalytic, alpha
5567 PRKACB protein kinase, cAMP-dependent, catalytic, beta
5568 PRKACG protein kinase, cAMP-dependent, catalytic, gamma
5571 PRKAG1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit
5573 PRKAR1A protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1)
5575 PRKAR1 B protein kinase, cAMP-dependent, regulatory, type I, beta
5576 PRKAR2A protein kinase, cAMP-dependent, regulatory, type II, alpha
5577 PRKAR2B protein kinase, cAMP-dependent, regulatory, type II, beta
5578 PRKCA protein kinase C, alpha
5579 PRKCB1 protein kinase C, beta 1
5580 PRKCD protein kinase C, delta
5581 PRKCE protein kinase C, epsilon
5582 PRKCG protein kinase C, gamma
5583 PRKCH protein kinase C, eta
5584 PRKCI protein kinase C, iota
5585 PKN1 protein kinase N1
5586 PKN2 protein kinase N2
5587 PRKD 1 protein kinase D1
5588 PRKCQ protein kinase C, theta
5590 PRKCZ protein kinase C, zeta
5591 PRKDC protein kinase, DNA-activated, catalytic polypeptide
5592 PRKG1 protein kinase, cGMP-dependent, type I
5593 PRKG2 protein kinase, cGMP-dependent, type Il
5594 MAPK1 mitogen-activated protein kinase 1
5595 MAPK3 mitogen-activated protein kinase 3
5596 MAPK4 mitogen-activated protein kinase 4
5597 MAPK6 mitogen-activated protein kinase 6
5598 MAPK7 mitogen-activated protein kinase 7
5599 MAPK8 mitogen-activated protein kinase 8
5600 MAPK11 mitogen-activated protein kinase 11
5601 MAPK9 mitogen-activated protein kinase 9
5602 MAPK10 mitogen-activated protein kinase 10
5603 MAPK13 mitogen-activated protein kinase 13
5604 MAP2K1 mitogen-activated protein kinase kinase 1
5605 MAP2K2 mitogen-activated protein kinase kinase 2
5606 MAP2K3 mitogen-activated protein kinase kinase 3
5607 MAP2K5 mitogen-activated protein kinase kinase 5
5608 MAP2K6 mitogen-activated protein kinase kinase 6
5609 MAP2K7 mitogen-activated protein kinase kinase 7
5610 PRKR protein kinase, interferon-inducible double stranded RNA dependent 5613 PRKX protein kinase, X-linked
5616 PRKY protein kinase, Y-lιnked
5631 PRPS1 phosphoribosyl pyrophosphate synthetase 1 ,PRPS1
5634 PRPS2 phosphoribosyl pyrophosphate synthetase 2.PRPS2
5681 PSKH1 protein serine kinase H1
5747 PTK2 PTK2 protein tyrosine kinase 2
5753 PTK6 PTK6 protein tyrosine kinase 6
5754 PTK7 PTK7 protein tyrosine kinase 7 5756 PTK9 PTK9 protein tyrosine kinase 9
5832 ALDH18A1 aldehyde dehydrogenase 18 family, member A1 ,ALDM 8A1
5871 MAP4K2 mitogen-activated protein kinase kinase kinase kinase 2
5891 RAGE renal tumor antigen
5894 RAF1 v-raf-1 murine leukemia viral oncogene homolog 1 ret proto-oncogene {multiple endocrine neoplasia and medullary thyroid carcinoma 1 ,
5979 RET Hirschsprung disease)
5987 TRIM27 tripartite motif-containing 27,TRIM27
6011 GRK1 G protein-coupled receptor kinase 1
6041 RNASEL ribonuclease L (2',5'-olιgoιsoadenylate synthetase-dependent)
6046 BRD2 bromodomain containing 2
6093 ROCK1 Rho-associated, coiled-coil containing protein kinase 1
6098 ROS 1 v-ros UR2 sarcoma virus oncogene homolog 1 (avian)
6102 RP2 retinitis pigmentosa 2 (X-linked recessιve),RP2
6195 RPS6KA1 ribosomal protein S6 kinase, 9OkDa, polypeptide 1
6196 RPS6KA2 ribosomal protein S6 kinase, 9OkDa, polypeptide 2
6197 RPS6KA3 ribosomal protein S6 kinase, 9OkDa, polypeptide 3
6198 RPS6KB1 ribosomal protein S6 kinase, 7OkDa, polypeptide 1
6199 RPS6KB2 ribosomal protein S6 kinase, 7OkDa, polypeptide 2 6259 RYK RYK receptor-like tyrosine kinase 6300 MAPK12 mitogen-activated protein kinase 12
6347 CCL2 chemokine (C-C motif) ligand 2;CCL2
6351 CCL4 chemokine (C-C motif) ligand 4;CCL4
6416 MAP2K4 mitogen-activated protein kinase kinase 4
6446 SGK serum/glucocorticoid regulated kinase
6714 SRC v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation
6725 SRMS sites
6732 SRPK1 SFRS protein kinase 1
6733 SRPK2 SFRS protein kinase 2
6787 NEK4 NIMA (never in mitosis gene a)-related kinase 4
6788 STK3 serine/threonine kinase 3 (STE20 homolog, yeast)
6789 STK4 serine/threonine kinase 4
6790 STK6 serine/threonine kinase 6
6792 CDKL5 cyclin-dependent kinase-like 5
6793 STK10 serine/threonine kinase 10
6794 STK11 serine/threonine kinase 11 (Peutz-Jeghers syndrome)
6795 AURKC aurora kinase C 6850 SYK spleen tyrosine kinase
6872 TAF1 TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 25OkDa
6885 MAP3K7 mitogen-activated protein kinase kinase kinase 7
7006 TEC tec protein tyrosine kinase
TEK tyrosine kinase, endothelial (venous malformations, multiple cutaneous and
7010 TEK mucosal)
7016 TESK1 testis-specific kinase 1
7046 TGFBR1 transforming growth factor, beta receptor I (activin A receptor type ll-like kinase, 53kDa)
7048 TGFBR2 transforming growth factor, beta receptor Il (70/8OkDa)
7049 TGFBR3 transforming growth factor, beta receptor III (betaglycan, 300kDa);TGFBR3 7075 TIE1 tyrosine kinase with immunoglobulin-like and EGF-like domains 1
7083 TK1 thymidine kinase 1 , soluble
7084 TK2 thymidine kinase 2, mitochondrial
7175 TPR translocated promoter region (to activated MET oncogene);TPR
7204 TRIO triple functional domain (PTPRF interacting)
7272 TTK TTK protein kinase
7273 TTN titin
7294 TXK TXK tyrosine kinase
7297 TYK2 tyrosine kinase 2
7301 TYRO3 TYRO3 protein tyrosine kinase
7371 UCK2 uridine-cytidine kinase 2
7443 VRK1 vaccinia related kinase 1
7444 VRK2 vaccinia related kinase 2 7465 WEE1 WEE1 homolog (S. pombe)
7525 YES1 v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1
7535 2AP70 zeta-chain (TCR) associated protein kinase 7OkDa
7786 MAP3K12 mitogen-activated protein kinase kinase kinase 12
7867 MAPKAPK3 mitogen-activated protein kinase-activated protein kinase 3
8019 BRD3 bromodomain containing 3
8295 TRRAP transformation/transcription domain-associated protein
8317 CDC7 CDC7 cell division cycle 7 (S. cerevisiae)
8382 NME5 non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase)
8394 PIP5K1A phosphatidylinositol-4-phosphate 5-kinase, type I, alpha
8395 PIP5K1B phosphatidylinositol-4-phosphate 5-kinase, type I, beta
8396 PIP5K2B phosphatidylinositol-4-phosphate 5-kinase, type II, beta 8408 ULK1 unc-51-like kinase 1 (C. elegans)
8428 STK24 serine/threonine kinase 24 (STE20 homolog, yeast)
8444 DYRK3 dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
8445 DYRK2 dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 8476 CDC42BPA CDC42 binding protein kinase alpha (DMPK-like)
8491 MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3
8503 PIK3R3 phosphoinositide-3-kinase, regulatory subunit 3 (p55, gamma)
8525 DGKZ diacylglycerol kinase, zeta 104kDa
8526 DGKE diacylglycerol kinase, epsilon 64kDa
8527 DGKD diacylglycerol kinase, delta 13OkDa
8536 CAMK1 calcium/calmodulin-dependent protein kinase I
8550 MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5
8558 CDK10 cyclin-dependent kinase (CDC2-like) 10
8566 PDXK pyridoxal (pyridoxine, vitamin B6) kinase 8569 MKNK1 MAP kinase interacting serine/threonine kinase 1
8573 CASK calcium/calmoduhn-dependent serine protein kinase (MAGUK family)
8576 STK 16 serine/threonine kinase 16
8621 CDC2L5 cell division cycle 2-lιke 5 (cholinesterase-related cell division controller)
8649 MAP2K1IP1 mttogen-activated protein kinase kinase 1 interacting protein 1
8711 TNK1 tyrosine kinase, non-receptor, 1
8737 R1PK1 receptor (TNFRSF)-ιnteractιng serine-threonine kinase 1
8767 RIPK2 receptor-interacting serine-threonine kinase 2
8780 RIOK3 RIO kinase 3 (yeast)
8798 DYRK4 dual-specificity tyrosιne-(Y)-phosphorylatιon regulated kinase 4
8814 CDKL1 cyclm-dependent kinase-like 1 (CDC2-related kinase)
8844 KSR kinase suppressor of ras
8851 CDK5R1 cyclm-dependent kinase 5, regulatory subunit 1 (p35)
8859 STK19 serine/threonine kinase 19
8877 SPHK1 sphingosine kinase 1
8895 CPNE3 copine III.CPNE3
8899 PRPF4B PRP4 pre-mRNA processing factor 4 homolog B (yeast)
8941 CDK5R2 cyclm-dependent kinase 5, regulatory subunit 2 (p39)
8986 RPS6KA4 ribosomal protein S6 kinase, 9OkDa, polypeptide 4
8997 KALRN kalirin, RhoGEF kinase isoform 1
8999 CDKL2 cyclm-dependent kinase-like 2 (CDC2-related kinase)
9020 MAP3K14 mitogen-activated protein kinase kinase kinase 14
9024 STK29 serine/threonine kinase 29
9060 PAPSS2 3'-phosphoadenosιne 5'-phosphosulfate synthase 2.PAPSS2
9061 PAPSS1 3'-phosphoadeπσsιne 5'-phosphosulfate synthase 1.PAPSS1 9064 MAP3K6 mitogen-activated protein kinase kinase kinase 6
9088 PKMYT1 membrane-associated tyrosine- and threonine-specific cdc2-ιnhιbιtory kinase
9113 LATS1 LATS, large tumor suppressor homolog 1 (Drosophila)
9149 DYRK1B dual-specificity tyrosιne-(Y)-phosphorylatιon regulated kinase 1B
9162 DGKI diacylglycerol kinase, iota
9175 MAP3K13 mitogen-activated protein kinase kinase kinase 13
9201 DCAMKL1 doublecortin and CaM kinase-like 1
9212 AURKB aurora kinase B
9223 MAGH membrane associated guanylate kinase, WW and PDZ domain containing 1 ,MAGH
9252 RPS6KA5 ribosomal protein S6 kinase, 9OkDa, polypeptide 5
9261 MAPKAPK2 mitogen-activated protein kinase-activated protein kinase 2
9262 STK17B serine/threonine kinase 17b (apoptosis-inducing)
9263 STK17A serine/threonine kinase 17a (apoptosis-inducing) 9344 TAOK2 TAO kinase 2
9414 ZO2 tight junction protein 2 (zona occludens 2),TJP2
9448 MAP4K4 mitogen-activated protein kinase kinase kinase kinase 4
9451 EIF2AK3 eukaryotic translation initiation factor 2-alpha kinase 3
9467 SH3BP5 SH3-domaιn binding protein 5 (BTK-associated),SH3BP5
9475 ROCK2 Rho-associated, coiled-coil containing protein kinase 2
9578 CDC42BPB CDC42 binding protein kinase beta (DMPK-like)
9625 AATK apoptosis-associated tyrosine kinase
9641 IKBKE inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon
9706 ULK2 uπc-51-lιke kinase 2 (C elegans)
9748 SLK STE20-like kinase (yeast)
9807 1HPK1 inositol hexaphosphate kinase 1
9829 DNAJC6 DnaJ (Hsp40) homolog, subfamily C, member 6.DNAJC6
9833 MELK maternal embryonic leucine zipper kinase
9863 MAGI2 membrane associated guanylate kinase, WW and PDZ domain containing 2.MAGI2
9874 TLK1 tousled-like kinase 1
9891 ARK5 AMP-activated protein kinase family member 5
9942 XYLB xylulokinase homolog (H influenzae)
9943 OXSR 1 oxidative-stress responsive 1
9950 GOLGA5 golgi autoantigen, golgin subfamily a, 5.GOLGA5
10000 AKT3 v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)
10020 GNE glucosamine (UDP-N-acetyl)-2-epιmerase/N-acetylmannosamine kinase
10087 COL4A3BP collagen, type IV, alpha 3 (Goodpasture antigen) binding proteιn,COL4A3BP
10110 SGK2 serum/glucocorticoid regulated kinase 2
10114 HIPK3 homeodomain interacting protein kinase 3
10128 LRPPRC leucine-rich PPR-motif containing.LRPPRC
10154 PLXNC1 plexin C1.PLXNC1
10188 ACK1 activated Cdc42-assocιated kinase 1
10201 NME6 non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase)
10221 TRIB1 tπbbles homolog 1 (Drosophila) 10290 APEG 1 aortic preferentially expressed protein 1 10295 BCKDK branched chain alpha-ketoacid dehydrogenase kinase 10298 PAK4 p21 (CDKN 1A)-actιvated kinase 4 10420 TESK2 testis-specific kinase 2 10461 MERTK c-mer proto-oncogene tyrosine kinase 10494 STK25 serine/threonine kinase 25 (STE20 homolog, yeast) 10519 CIB1 calcium and integrin binding 1 (calmyrιn),CIB1 10595 ERN2 endoplasmic reticulum to nucleus signalling 2 10645 CAMKK2 calcium/calmodulin-dependent protein kinase kinase 2, beta 10654 PMVK phosphomevalonate kinase 10733 PLK4 polo-like kinase 4 (Drosophila) 10746 MAP3K2 mitogen-activated protein kinase kinase kinase 2 10769 PLK2 polo-like kinase 2 (Drosophila) 10783 NEK6 NIMA (never in mitosis gene a)-related kinase 6 10922 FASTK FAST kinase 11011 TLK2 tousled-like kinase 2 11035 RIPK3 receptor-interacting serine-threonine kinase 3 11040 PIM2 pιm-2 oncogene 11113 ClT citron (rho-interacting, serine/threonine kinase 21)
11183 MAP4K5 mitogen-activated protein kinase kinase kinase kinase 5
11184 MAP4K1 mitogen-activated protein kinase kinase kinase kinase 1 11200 CHEK2 CHK2 checkpoint homolog (S pombe) 11213 IRAK3 ιnterleukιn-1 receptor-associated kinase 3 11284 PNKP polynucleotide kinase 3'-phosphatase 11329 STK38 seπne/threonine kinase 38 11344 PTK9L PTK9L protein tyrosine kinase 9-lιke (A6-related protein) 22848 AAK1 AP2 associated kinase 1 22853 LMTK2 lemur tyrosine kinase 2 22858 ICK intestinal cell (MAK-like) kinase 22868 FASTKD2 FAST kinase domains 2.FASTKD2 22901 ARSG arylsulfatase G, ARSG 22928 SPS2 selenophosphate synthetase 2.SEPHS2 22983 MAST1 microtubule associated serine/threonine kinase 1 23012 STK38L serine/threonine kinase 38 like 23031 MAST3 microtubule associated serine/threonine kinase 3 23043 TNIK TRAF2 and NCK interacting kinase 23049 SMG 1 PI-3-kιnase-related kinase SMG-1 23097 CDC2L6 cell division cycle 2-lιke 6 (CDK8-lιke) 23129 PLXND1 plexin D1.PLXND1 23139 MAST2 microtubule associated serine/threonine kinase 2 23178 PASK PAS domain containing serine/threonine kinase 23227 MAST4 microtubule associated serine/threonine kinase family member 4 23235 SIK2 salt-inducible serine/threonine kinase 2 23300 ASCIZ ATM/ATR-Substrate Chk2-lnteractιng Zn2+-finger proteιn,ASCIZ 23387 K1AA0999 K1AA0999 protein 23396 PIP5K1C phosphatιdylιnosιtol-4-phosphate 5-kιnase, type I, gamma 23476 BRD4 bromodomain containing 4 23533 PIK3R5 phosphoιnosιtιde-3-kιnase, regulatory subunit 5, p101 23552 CCRK cell cycle related kinase 23604 DAPK2 death-associated protein kinase 2 23617 STK22B serine/threonine kinase 22B (spermiogenesis associated) 23636 NUP62 nucleoporin 62kDa,NUP62 23654 PLXNB2 plexin B2.PLXNB2
23677 SH3BP4 SH3-domaιn binding protein 4.SH3BP4
23678 SGKL serum/glucocorticoid regulated kinase-like 23683 PRKD3 protein kinase D3 23729 CARKL carbohydrate kinase-like 25778 RIPK5 receptor interacting protein kinase 5 25865 PRKD2 protein kinase D2
DKF2P434C 25989 131 DKFZP434C131 protein 26007 DAK dihydroxyacetone kinase 2 homolog (S cerevιsιae),DAK 26289 AK5 adenylate kinase 5 26353 HSPB8 heat shock 22kDa protein 8 26524 LATS2 LATS, large tumor suppressor, homolog 2 (Drosophila) 26576 STK23 serine/threonine kinase 23 26750 RPS6KC1 ribosomal protein S6 kinase, 52kDa, polypeptide 1 27010 TPK1 thiamin pyrophosphokiπase 1 27102 HRI heme-regulated initiation factor 2-alpha kinase 27148 STK36 serine/threonine kinase 36 (fused homolog, Drosophila)
27231 ITGB1BP3 integrin beta 1 binding protein 3;ITGB1BP3
27330 RPS6KA6 ribosomal protein S6 kinase, 9OkDa, polypeptide 6
27347 STK39 serine threonine kinase 39 (STE20/SPS1 homolog, yeast)
28951 TRIB2 tribbles homolog 2 (Drosophila)
28996 HIPK2 homeodomain interacting protein kinase 2
29110 TBK1 TANK-binding kinase 1
29904 EEF2K eukaryotic elongation factor-2 kinase
29922 NME7 non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase)
29941 PKN3 protein kinase N3
29959 NRBP nuclear receptor binding protein
30811 HUNK hormonalty upregulated Neu-associated kinase
30849 PIK3R4 phosphoinositide-3-kinase, regulatory subunit 4, p150
50488 MINK misshapen/NIK-related kinase
50808 AK3L1 adenylate kinase 3 like 1
51086 TNNI3K TNNI3 interacting kinase
51135 IRAK4 interleukin-1 receptor-associated kinase 4
51231 VRK3 vaccinia related kinase 3
51265 CDKL3 cyclin-dependent kinase-like 3
51314 TXNDC3 thioredoxin domain containing 3 (spermatozoa);TXNDC3
51347 TAOK3 TAO kinase 3
51422 PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit
51447 IHPK2 inositol hexaphosphate kinase 2
51678 MPP6 membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6);MPP6
51701 NLK nemo like kinase
51727 UMP-CMPK UMP-CMP kinase
51755 CRK7 CDC2-related protein kinase 7
51765 MST4 Mst3 and SOK1 -related kinase
51776 2!AK sterile alpha motif and leucine zipper containing kinase AZK
53354 PANK1 pantothenate kinase 1
53632 PRKAG3 protein kinase, AMP-activated, gamma 3 non-catalytic subunit
53834 FGFRL1 fibroblast growth factor receptor-like 1 ;FGFRL1
53904 MYO3A myosin HIA
53944 CSNK1G1 casein kinase 1 , gamma 1
54101 RIPK4 receptor-interacting serine-threonine kinase 4
54103 LOC54103 hypothetical protein LOC54103;LOC54103
54822 TRPM7 transient receptor potential cation channel, subfamily M, member 7
54861 SNRK SNF-1 related kinase
54899 PXK PX domain containing serine/threonine kinase
54963 UCKL1 uridine-cytidine kinase 1-like 1
54981 C9orf95 chromosome 9 open reading frame 95;C9orf95
54986 FLJ20574 hypothetical protein FLJ20574
55224 ETNK2 ethanolamine kinase 2
55229 PANK4 pantothenate kinase 4
55277 FLJ10986 hypothetical protein FU10986;FLJ10986
55300 PI4K2B phosphatidylinositol 4-kinase type-ll beta
55312 RFK riboflavin kinase
55351 STK32B serine/threonine kinase 32B
55359 STYK1 protein kinase STYK1
55361 PI4KII phosphatidylinositol 4-kinase type Il
55437 ALS2CR2 amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 2
55500 ETNK1 ethanolamine kinase 1
55558 PLXNA3 plexin A3;PLXNA3
55561 CDC42BPG CDC42 binding protein kinase gamma (DMPK-like)
55577 NAGK N-acetylglucosamiπe kinase
55589 BMP2K BMP2 inducible kinase
55681 FLJ10074 hypothetical protein FLJ10074
55728 N4BP2 Nedd4 binding protein 2
55750 MULK multiple substrate lipid kinase;MULK
55781 RIOK2 RIO kinase 2 (yeast)
55872 TOPK T-LAK cell-originated protein kinase
56155 TEX14 testis expressed sequence 14
56164 STK31 serine/threonine kinase 31
56848 SPHK2 sphingosine kinase 2
56911 C21orf7 chromosome 21 open reading frame 7;C21orf7
56924 PAK6 p21 (CDKN1 A)-activated kinase 6
56997 CABC1 chaperone, ABC1 activity of bd complex like (S. pombe)
57118 CAMK1D calcium/calmodulin-dependent protein kinase ID
57143 ADCK1 aarF domain containing kinase 1 57144 PAK7 p21(CDKN1A)-actιvated kinase 7
57147 PACE-1 ezrin-binding partner PACE-1
57172 CAMK1G calαum/calmoduliπ-dependent protein kinase IG
57396 CLK4 CDC-like kinase 4
5741 Q SCYL1 SCY1-lιke 1 (S cerevisiae)
57538 ALPK3 alpha-kinase 3
57551 TAOK1 TAO kinase 1
57729 KIAA1639 KIAA1639 protein
57761 TRIB3 tribbles homolog 3 (Drosophila)
57787 MARK4 MAP/microtubule affinity-regulating kinase 4
58538 MPP4 membrane protein, palmitoylated 4 (MAGUK p55 subfamily member 4),MPP4
60493 FASTKD5 FAST kinase domains 5.FASTKD5
64080 RBKS πbokinase
64089 SNX16 sorting nexin 16.SNX16
64122 FN3K fructosamine 3 kinase
64149 NJMU-R1 protein kinase Njmu-R1
64398 MPP5 membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5),MPP5
64768 IPPK inositol 1,3,4,5,6-pentakιsphosphate 2-kιnase,IPPK
64781 CERK ceramide kinase
65018 PINK1 PTEN induced putative kinase 1
65061 ALS2CR7 amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 7
65125 PRKWNK1 protein kinase, lysine deficient 1
65220 FLJ 13052 NAD kinase
65266 PRKWNK4 protein kinase, lysine deficient 4
65267 PRKWNK3 protein kinase, lysine deficient 3
65268 PRKWNK2 protein kinase, lysine deficient 2 65975 STK33 serine/threonine kinase 33 79012 MGC8407 hypothetical protein MGC8407 79072 FASTKD3 FAST kinase domains 3.FASTKD3 79646 PANK3 pantothenate kinase 3
79672 FN3KRP fructosamιne-3-kιnase-related protein
79675 FASTKD1 FAST kinase domains 1.FASTKD1
79705 LRRK1 leucine-nch repeat kinase 1
79834 KIAA2002 KIAA2002 protein
79837 PIP5K2C phosphatιdylιnosιtol-4-phosphate 5-kιnase, type Il gamma
79858 NEK11 NIMA (never in mitosis gene a)- related kinase 11
79877 DCAKD dephospho-CoA kinase domain containing, DCAKD
79906 MORN1 MORN repeat containing 1 ,MORN1
79934 ADCK4 aarF domain containing kinase 4
80025 PANK2 pantothenate kinase 2 (Hallervorden-Spatz syndrome)
80122 FLJ23074 hypothetical protein FLJ23074
80201 HKDC1 hexokmase domain containing 1.HKDC1
80216 ALPK1 alpha-kinase 1
80271 ITPKC inositol 1,4,5-trιsphosphate 3-kιnase C
80347 COASY Coenzyme A synthase.COASY
80851 SH3BP5L SH3-bιndιng domain protein 5-lιke,SH3BP5L
80852 GRIP2 glutamate receptor interacting protein 2.GRIP2
81629 STK22C serine/threonine kinase 22C (spermiogenesis associated)
81788 SNARK likely ortholog of rat SNF1/AMP-actιvated protein kinase
83440 ADPGK ADP-dependent glucokinase
83549 UCK1 uπdine-cytidme kinase 1
83694 RPS6KL1 πbosomal protein S6 kinase-like 1
83732 RIOK1 RIO kinase 1 (yeast)
83903 GSG2 haspin
83931 MGC4796 Ser/Thr-like kinase
83942 STK22D serine/threonine kinase 22D (spermiogenesis associated)
83983 SSTK serine/threonine protein kinase SSTK
84033 OBSCN obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF
84197 FU23356 hypothetical protein FLJ23356
84206 RKHD3 ring finger and KH domain containing 3.RKHD3
84254 CAMKK1 calcium/calmodulin-dependent protein kinase kinase 1 , alpha
84284 C1orf57 chromosome 1 open reading frame 57,C1orf57
84433 CARD11 caspase recruitment domain family, member 11 ,CARD11
84446 KIAA1811 KIAA1811 protein
84451 KIAA1804 mixed lineage kinase 4
84630 TTBK1 tau tubulin kinase 1
84930 MASTL microtubule associated serine/threonine kinase-like
85366 MYLK2 myosin light chain kinase 2, skeletal muscle
85443 KIAA1765 KIAA1765 protein 85481 PSKH2 protein serine kinase H2 89882 NYD-SP25 protein kinase NYD-SP25 90381 MGC45866 leucine-πch repeat kinase 1 90956 ADCK2 aarF domain containing kinase 2
DKF2p434B1 91156 231 eEF1A2 binding proteιn,DKFZρ434B1231 91419 XRCC6BP1 XRCC6 binding protein 1.XRCC6BP1 91461 LOC91461 hypothetical protein BC007901 91584 PLXNA4B plexin A4, B.PLXNA4B 91754 NEK9 NIMA (never in mitosis gene a)- related kinase 9 91807 LOC91807 myosin light chain kinase (MLCK) 92335 LYK5 protein kinase LYK5 93627 MGC16169 hypothetical protein MGC16169
112858 TP53RK TP53 regulating kinase
114783 IMTK3 lemur tyrosine kinase 3
114836 SLAMF6 SLAM family member 6.SLAMF6
115701 ALPK2 alpha-kmase 2
117283 1HPK3 inositol hexaphosphate kinase 3
120892 LRRK2 leucine-rich repeat kinase 2
122011 CSNK1A1L casein kinase 1, alpha 1-lιke
122481 AK7 adenylate kinase 7
124923 FLJ25006 hypothetical protein FLJ25006
127933 UHMK1 U2AF homology motif (UHM) kinase 1
130106 CIB4 calcium and integπn binding family member 4.CIB4
130399 ACVR 1C activiπ A receptor, type IC
131890 GRK7 G protein-coupled receptor kinase 7
132158 GLYCTK glycerate kinase
136332 LRGUK leucine-πch repeats and guanylate kinase domain containing.LRGUK
138429 PIP5KL1 phosphatιdylιnosιtol-4-phosphate 5-kιnase-lιke 1
TAF1-lιke RNA polymerase II, TATA box binding protein (TBP)-assocιated factor,
138474 TAF 1 L 21OkDa 139189 DGKK diacylglycerol kinase, kappa, DGKK 139728 PNCK pregnancy upregulated non-ubιquιtously expressed CaM kinase 140469 MYO3B myosin HIB 140609 NEK7 NIMA (never in mitosis gene a)-related kinase 7 140803 TRPM6 transient receptor potential cation channel, subfamily M, member 6 140901 STK35 serine/threonine kinase 35 143098 MPP7 membrane protein, palmitoylated 7 (WIAGUK p55 subfamily member 7),MPP7 146057 TTBK2 tau tubulin kinase 2 147746 HIPK4 homeodomain interacting protein kinase 4 149420 PDIK1 L PDLIM1 interacting kinase 1 like 150094 SNF1LK SNF1-lιke kinase 152110 NEK10 NIMA (never in mitosis gene a)- related kinase 10
DKFZp761P0 157285 423 hypothetical protein DKFZp761P0423 158067 C9orf98 chromosome 9 open reading frame 98,C9orf98 160851 DGKH diacylglycerol kinase, eta 166614 MGC45428 hypothetical protein MGC45428 167359 MGC42105 hypothetical protein MGC42105 169436 C9orf96 chromosome 9 open reading frame 96
197258 FUK fucokinase
197259 FL J34389 hypothetical protein FLJ34389 200576 PIP5K3 phosphatιdylιnosιtol-3-phosphate/phosphatιdylιnosιtol 5-kιnase, type III 202374 STK32A serine/threonine kinase 32A 203054 ADCK5 aarF domain containing kinase 5 203447 NRK Nik related kinase 204851 HIPK1 homeodomain interacting protein kinase 1
220686 LOC220686 hypothetical protein LOC220686,LOC220686 221823 PRPS1 L1 phosphoribosyl pyrophosphate synthetase 1-lιke 1.PRPS1 L1 225689 ERK8 extracellular signal-regulated kinase 8 253430 IPMK inositol polyphosphate multikinase 255239 ANKK1 ankyrin repeat and kinase domain containing 1 256356 MGC40579 hypothetical protein MGC40579.MGC40579 260425 MAGI-3 membrane-associated guanylate kinase-related (MAGI-3) 282974 STK32C serine/threonine kinase 32C 283284 IGSF22 immunoglobulin superfamily, member 22.IGSF22 283455 KSR2 kinase suppressor of Ras-2 283629 C14orf20 chromosome 14 open reading frame 20 284086 NEK8 NIMA (never in mitosis gene a)- related kinase 8 284656 EPHA10 EphAIOs protein 285220 EPHA6 EPH receptor A6 285962 FU40852 hypothetical protein FLJ40852 340156 LOC340156 hypothetical protein LOC340156
340371 LOC340371 hypothetical protein LOC340371 341676 NEK5 NIMA (never in mitosis gene a)-related kinase 5 344387 CDKL4 cychn-dependent kinase-like 4 347359 BMP2KL BMP2 inducible kinase-like 347736 TXNDC6 thioredoxin domain containing 6.TXNDC6 374872 C 19orf35 chromosome 19 open reading frame 35,C19orf35 375133 LOC375133 similar to phosphatidylinositol 4-kιnase alpha 375298 CERKL ceramide kinase-like 375449 LOC375449 similar to microtubule associated testis specific serine/threonine protein kinase 378464 MORN2 MORN repeat containing 2.MORN2 387851 AK3L2 adenylate kinase 3-lιke 2 388228 LOC388228 similar to SH3-bιndιng kinase similar to protein kinase related to Raf protein kinases Method conceptual translation
388259 LOC388259 supplied by author 388957 LOC388957 similar to BMP2 inducible kinase similar to amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 2, ILP-
389599 LOC389599 interacting protein ILPIPA 389840 FLJ 16518 FLJ16518 protein 389906 LOC389906 similar to Seπne/threonine-protein kinase PRKX (Protein kinase PKX1 ) 390877 LOC390877 similar to adenylate kinase (EC 2 74 3), cytosolic - common carp similar to spermiogenesis associated serine/threonine kinase 22D, serine/threonine
391295 LOC391295 kinase FKSG81 , spermiogenesis associated 4 similar to Vascular endothelial growth factor receptor 1 precursor (VEGFR-1) (Vascular permeability factor receptor) (Tyrosine-protein kinase receptor FLT) (Flt-1 ) (Tyrosine-
391533 LOC391533 protem kinase FRT) (Fms-like tyrosine kinase 1 ) similar to Serine/threonine-protein kinase PLK 1 (Polo-like kinase 1) (PLK-1) (Seπne- 392226 LOC392226 threonine protein kinase 13) (STPK13) similar to Cell division protein kinase 5 (Tau protein kinase Il catalytic subunit) (TPKII
392265 LOC392265 catalytic subunit) (Serine/threonine-protein kinase PSSALRE) 392347 LOC392347 similar to adenylate kinase 3 alpha like, adenylate kinase 6 similar to protein kinase CHK2 isoform b, checkpoint-like protein CHK2, seπne/threonine-
400301 LOC400301 protein kinase CHK2, CHK2 (checkpoint, S pombe) nomolσg 402289 LOC402289 similar to Ser/Thr protein kinase PAR-1Balpha 402679 LOC402679 similar to Ser/Thr protein kinase PAR-1 Balpha 415116 PIM3 serine/threonine-protein kinase pιm-3 440275 LOC440275 similar to GCN2 elF2alpha kinase similar to PI-3-kιnase-related kinase SMG-1 isoform 1 , lambda/iota protein kinase C-
440345 LOC440345 interacting protein, phosphatidylinositol 3-kιnase-related protein kinase 441047 LOC441047 similar to Adenylate kinase isoenzyme 4, mitochondrial (ATP-AMP transphosphorylase) 441655 LOC441655 similar to chromosome 9 open reading frame 12, 1 ,3,4,5,6-pentakιsphosphate 2-kιnase similar to CDC42-bιπdιng protein kinase alpha isoform A ser-thr protein kinase related to the myotonic dystrophy protein kinase, ser-thr protein kinase PK428, myotonic dystrophy
441708 LOC441708 kinase-related CDC42-bιndιng protein kinase alpha, CDC42 binidng prot 441733 LOC441733 similar to Serine/threonine-protein kinase PRKX (Protein kinase PKX1) similar to Serine/threonine-protein kinase PLK1 (Polo-like kinase 1 ) (PLK-1) (Serine-
441777 LOC441777 threonine protein kinase 13) (STPK13) 441971 LOC441971 similar to phosphoinositide 3-hydroxykιnase p110-alpha subunit similar to serine/threonine kinase, establishes embryonic polarity, asymmetrically distributed , abnormal embryonic PARtitioning of cytoplasm PAR-1 , ZYGote defective
442075 LOC442075 embryonic lethal ZYG-14 (126 3 kD) (par-1 ) similar to Phosphorylase B kinase gamma catalytic chain, skeletal muscle isoform 442313 LOC442313 (Phosphorylase kinase gamma subunit 1) similar to Phosphorylase B kinase gamma catalytic chain, skeletal muscle isoform
442558 LOC442558 (Phosphorylase kinase gamma subunit 1 ) 548596 CKMT1 A creatine kinase, mitochondrial 1A.CKMT1A similar to Nucleoside diphosphate kinase, mitochondrial precursor (NDP kinase, mitochondrial) (NDK) (nm23-H4) (Nucleoside diphosphate kinase D)
641857 LOC641857 (NDPKD).unassigned similar to Nucleoside diphosphate kinase, mitochondrial precursor (NDP kinase, mitochondrial) (NDK) (nm23-H4) (Nucleoside diphosphate kinase D)
642355 LOC642355 (NDPKD),unassιgned 642483 LOC642483 similar to fibroblast growth factor receptor 2 isoform lllb.unassigned similar to amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate
644462 LOC644462 2,unassιgned 644644 LOC644644 similar to Serine/threonine-protein kinase PRKX (Protein kinase PKX1 ),unassιgned 645118 LOC645118 similar to microtubule associated serine/threonine kinase 2,unassιgned 645146 LOC645146 similar to Kinase suppressor of ras-1 (Kinase suppressor of ras),unassιgned similar to Adenylate kinase isoenzyme 4, mitochondrial (ATP-AMP
645619 LOC645619 transphosphorylase),unassιgned 645739408E54 similar to CDC42-bιndιng protein kinase beta.unassigned 646096 LOC646096 similar to protein kinase CHK2 isoform b.unassigned 646505 LOC646505 similar to Dual specificity protein kinase CLK3 (CDC-like kinase 3),unassιgned 646643 LOC646643 similar to protein kinase Bsk146,unassιgned similar to Phosphorylase b kinase alpha regulatory chain, skeletal muscle isoform
646780 LOC646780 (Phosphorylase kinase alpha M subunιt),uπassιgned 646836 LOC646836 similar to CDC42-bιndιng protein kinase beta.unassigned 647138 LOC647138 similar to Kinase suppressor of ras-1 (Kinase suppressor of ras),unassιgned 647176 LOC647176 similar to Kinase suppressor of ras-1 (Kinase suppressor of ras),unassιgned 647279 LOC647279 similar to MAP/microtubule affinity-regulating kinase 3,unassιgned 647935 LOC647935 similar to fibroblast growth factor receptor 2 isoform lllb.unassigned 648152 LOC648152 similar to ataxia telangiectasia and Rad3 related protein, unassigned 648482 LOC648482 similar to MAP/microtubule affinity-regulating kinase 3,unassιgned similar to Adenylate kinase isoenzyme 4, mitochondrial (Adenylate kinase 3-lιke 1 ) (ATP-
649288 LOC649288 AMP transphosphory!ase),unassιgned 649407 LOC649407 similar to Dual specificity protein kinase CLK3 (CDC-like kinase 3),unassιgned 649970 LOC649970 similar to creatine kinase, mitochondrial 1B precursor.unassigned 650122 LOC650122 similar to choline kinase alpha isoform a, unassigned similar to amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate
650168 BRDG1 2,unassιgned 650459 LOC650459 similar to CDC42-bιndιng protein kinase beta.unassigned similar to Phosphorylase b kinase gamma catalytic chain, testis/hver isoform (PHK-
650556 LOC650556 gamma-T) (Phosphorylase kinase gamma subunit 2) (PSK-C3),unassιgned 650832 LOC650832 similar to mitogen-activated protein kinase kinase 3 isoform A.unassigned 651008 LOC651008 similar to mitogen-activated protein kinase kinase 3 isoform A.unassigned 651423 LOC651423 similar to mitogen-activated protein kinase kinase 3 isoform A.unassigned similar to Seπne-protein kinase ATM (Ataxia telangiectasia mutated) (A-T,
651610 LOC651610 mutated),unassιgπed 651771 LOC651771 similar to apoptosis-associated tyrosine kinase.unassigned 651921 LOC651921 similar to ataxia telangiectasia and Rad3 related protein.unassigned 652041 LOC652041 similar to 3-phosphoιnosιtιde dependent protein kinase 1 (hPDK1 ),unassιgned 652662 LOC652662 similar to Janus kinase 3,unassigned 652722 LOC652722 similar to PTK2 protein tyrosine kinase 2 isoform a.unassigned similar to Mast/stem cell growth factor receptor precursor (SCFR) (Proto-oncogene
652799 LOC652799 tyrosine-protein kinase Kit) (c-kit) (CD117 antιgen),unassιgned 653052 LOC653052 similar to Homeodomain-interacting protein kinase 2 (hHIPk2),unassιgned 653155 LOC653155 similar to PRP4 pre-mRNA processing factor 4 homolog B.unassigned similar to Mast/stem cell growth factor receptor precursor (SCFR) (Proto-oncogene
653882 LOC653882 tyrosine-protein kinase Kit) (c-kit) (CD117 antιgen),unassιgned
654364 NME1-NME2 NME1-NME2 proteιn,NME1-NME2 similar to Rho-associated protein kinase 1 (Rho-associated, coiled-coil-containing protein 727758 LOC727758 kinase 1) (p160 ROCK-1 ) (p160ROCK) (NY-REN-35 antιgen),unassιgned 727761 LOC727761 similar to deoxythymidylate kinase (thymidylate kιnase),unassιgned 728642 LOC728642 similar to cell division cycle 2-lιke 1 (PITSLRE proteins) isoform 1 ,unassιgned 728687 LOC728687 similar to Serine/threonine-protein kinase PRKX (Protein kinase PKX1 ),unassιgned 729116 LOC729116 similar to protein kinase, X-lιnked,unassιgned 729871 LOC729871 similar to aortic preferentially expressed gene 1.unassigned 729937 LOC729937 similar to microtubule associated serine/threonine kinase 2,unassιgned 729985 LOC729985 similar to CDC42-bιndιng protein kinase beta, unassigned 73000Q LOC730000 similar to testis-specific serine kinase 6, unassigned 730418 LOC730418 similar to protein kinase, cAMP-dependent, catalytic, gamma.unassigned similar to Adenylate kinase isoenzyme 4, mitochondrial (Adenylate kinase 3-lιke 1 ) (ATP-
731007 LOC731007 AMP transphosphorylase),unassιgned 731055 LOC731055 similar to testis-specific serine kinase 6, unassigned similar to Serine/threonine-protein kinase tousled-like 2 (Tousled-like kinase
731082 LOC731082 2),unassιgned 731295 LOC731295 similar to microtubule associated serine/threonine kinase 2,unassιgned 731320 LOC731320 similar to obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF, unassigned 731391 LOC731391 similar to creatine kinase, mitochondrial 1B precursor.unassigned 731751 LOC731751 similar to protein kinase, DNA-activated, catalytic polypeptide, unassigned 732306 LOC732306 similar to vaccinia related kinase 2,unassιgned 732371 LOC732371 similar to mixed lineage kinase domain-like, unassigned 732396 LOC732396 similar to serine/threonine kinase 36 (fused homolog, Drosophιla),unassιgned similar to Rho-associated protein kinase 1 (Rho-associated coiled-coil-containing protein 732432 LOC732432 kinase 1) (p160 ROCK-1) (p160ROCK) (NY-REN-35 antιgen),unassιgned
Figure imgf000110_0001

Claims

Claims:
1. A composition comprising one or more nucleic acids encoding at least two regulatable proteins linked to one or more regulatory signals, wherein expression of the regulatable proteins in a cell results in the regulatable protein being regulated.
2. The composition of claim 1, wherein the one or more nucleic acids encode at least three regulatable proteins.
3. The composition of claim 2, wherein the one or more nucleic acids encode at least five regulatable proteins.
4. The composition of claim 3, wherein the one or more nucleic acids encode at least ten regulatable proteins.
5. The composition of claim 1, wherein the regulatable proteins are kinases or biologically active fragments thereof.
6. The composition of claim 1, wherein the kinases are selected from the group of kinases set forth in Table 1.
7. The composition of claim 5, wherein the kinases or biologically active portions thereof are linked to an activation signal.
8. The composition of claim 7, wherein the activation signal is a myristoylation signal.
9. The composition of claim 8, wherein the myristoylation signal is linked to the N- terminus of the kinases or biologically active portions thereof.
10. The composition of claim 7, wherein the activation signal is a ligand independent oligomerization domain.
11. The composition of claim 10, wherein the oligomerization domain is a dimerization domain.
12. The composition of claim 11, wherein the dimerization domain is an inducible dimerization domain.
13. The composition of claim 12, wherein the inducible dimerization domain is induced to dimerize in the presence of a small molecule.
14. The composition of claim 11, wherein the oligomerization domain is linked to the C- terminus of the kinases or biologically active portions thereof.
15. The composition of claim 8, wherein one or more kinases or biologically active portions thereof are further linked to a dimerization domain.
16. The composition of claim 15, wherein one or more kinases or biologically active portions thereof is an intracellular kinase domain of a receptor tyrosine kinase.
17. The composition of claim 1, wherein at least one regulatable protein is further linked to a detectable peptide.
18. The composition of claim 17, wherein the detectable peptide is a FLAG tag.
19. The composition of claim 1, wherein at least one regulatable protein is linked directly to one or more regulatory signals.
20. The composition of claim 1, wherein at least one regulatable protein is linked to one or more regulatory signals through a linker.
21. The composition of claim 1, wherein the one or more nucleic acids comprises one or more strong transcriptional regulatory sequence controlling the expression of the regulatable proteins.
22. The composition of claim 21, wherein the nucleic acids are in an expression vector.
23. The composition of claim 22, wherein the expression vector is a viral expression vector.
24. The composition of claim 1 , further comprising a reagent for introducing the composition into a cell.
25. The composition of claim 1, which is in contact with a cell.
26. The cell of claim 25, which is an immortalized, non-tumorigenic cell.
27. The cell of claim 26, which is a human cell.
28. The cell of claim 26, which is a nurine cell.
29. A cell comprising a composition of claim 1.
30. The composition of claim 1, comprising at least two nucleic acids, wherein each nucleic acid encodes a regulatable protein linked to one or more regulatory signals.
31. The composition of claim 29, comprising at least five nucleic acids, wherein each nucleic acid encodes a regulatable protein linked to one or more regulatory signals.
32. A kit comprising a nucleic acid encoding a regulatable protein linked to one or more regulatory signals, wherein expression of the regulatable proteins in a cell results in the regulatable protein being constitutively regulated and packaging for said kit.
33. A device comprising a location, wherein the location comprises a nucleic acid encoding a regulatable protein linked to one or more regulatory signals, wherein expression of the regulatable protein in a cell results in the regulatable protein or biologically active portion thereof being constitutively regulated.
34. The device of claim 32, which is a multiwell device and the location is a well.
35. A composition comprising one or more nucleic acids encoding at least two inhibitory mutants of proteins, wherein expression of the inhibitory mutants in a cell downregulates one or more biological activities associated with the corresponding wild-type proteins.
36. The composition of claim 34, wherein at least one protein is a kinase, a phosphatase, an acetylase, a deacetylase, a transcription factor, a ubiquitin ligase, a methylase, or a demethylase.
37. The composition of claim 34, wherein at least one inhibitory mutant of a protein is a dominant negative mutant of the protein.
38. The composition of claim 36, wherein at least one inhibitory mutant of a protein is a deletion mutant of the protein.
39. The composition of claim 36, wherein at least one inhibitory mutant of a protein comprises a substitution of one or more amino acids.
40. The composition of claim 38, wherein one or more substitutions of amino acids results in a change in posttranslational modification of the protein.
41. The composition of claim 39, wherein one or more substitutions of amino acids results in a change in acetylation, glycosylation or phosphorylation of the protein.
42. A method comprising contacting one or more cells with a composition of claim 1.
43. The method of claim 41, wherein the cells are contacted with the composition under conditions in which at least some of the nucleic acids of the composition are taken up by the cells.
44. The method of claim 42, wherein the cells are immortal but not tumorigenic cells.
45. The method of claim 43, wherein the cells constitutively express the catalytic subunit of human telomerase (hTERT), the Large T (LT) of the SV40 Early Region and c-myc.
46. The method of claim 44, further comprising determining whether the cells contacted with the composition are tumorigenic.
47. The method of claim 45, comprising determining whether the cells contacted with the nucleic acids grow in an anchorage-independent manner and/or promote tumor formation in animal hosts.
48. The method of claim 43, wherein the cells require a growth factor for growth and the method further comprises determining whether the cells contacted with the composition grow independently of the growth factor.
49. The method of claim 46, wherein the growth factor is IL-3.
PCT/US2008/062230 2007-05-01 2008-05-01 Compositions and methods for identifying transforming and tumor suppressor genes Ceased WO2009002607A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US92706607P 2007-05-01 2007-05-01
US60/927,066 2007-05-01

Publications (1)

Publication Number Publication Date
WO2009002607A1 true WO2009002607A1 (en) 2008-12-31

Family

ID=39773028

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2008/062230 Ceased WO2009002607A1 (en) 2007-05-01 2008-05-01 Compositions and methods for identifying transforming and tumor suppressor genes

Country Status (2)

Country Link
US (1) US8178317B2 (en)
WO (1) WO2009002607A1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN102482719A (en) * 2009-09-10 2012-05-30 富士胶片株式会社 Method for analyzing nucleic acid mutations using array comparative genomic hybridization techniques
WO2013090732A3 (en) * 2011-12-14 2013-09-26 The Board Of Regents Of The University Of Texas System Collateral gene inactivation biomarkers and targets for cancer therapy

Families Citing this family (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8348856B1 (en) 2008-12-16 2013-01-08 Zanetta Malanowska-Stega Simultaneous multiple method out-patient uterus biopsy device and method
US8993347B2 (en) 2009-12-17 2015-03-31 Cornell University Methods for detecting antibodies in mucosal samples and device for sampling mucosal material
US9597346B2 (en) 2010-01-15 2017-03-21 Cornell University Methods for reducing protein levels in a cell
EP2545187B1 (en) * 2010-03-09 2018-09-05 Dana-Farber Cancer Institute, Inc. Methods of diagnosing and treating cancer in patients having or developing resistance to a first cancer therapy
WO2012068073A2 (en) 2010-11-15 2012-05-24 University Of Florida Research Foundation, Inc. Therapeutic and diagnostic applications targeting tnk-1
US8900845B2 (en) 2011-02-08 2014-12-02 Washington University Methods and uses of KSR kinase, and mutations thereof
DK2885010T3 (en) 2012-08-16 2020-02-03 Ipierian Inc METHODS OF TREATING TAUOPATHY
US8980270B2 (en) 2013-01-18 2015-03-17 Ipierian, Inc. Methods of treating a tauopathy
WO2014179476A1 (en) * 2013-05-01 2014-11-06 St. Jude Children's Research Hospital Truncated constructs of ripk3 and related uses
JP2017512751A (en) * 2014-02-14 2017-05-25 アイピエリアン,インコーポレイティド Tau peptides, anti-tau antibodies, and methods for their use
MX2019006793A (en) 2016-12-09 2019-11-18 Zanetta Malanowska Stega DEVICE, KIT AND BRUSH METHODS FOR BIOPSY.
EP3600451B1 (en) 2017-03-29 2025-12-24 Minerva Biotechnologies Corporation Agents for differentiating stem cells and treating cancer
WO2019005763A1 (en) * 2017-06-26 2019-01-03 Phase Genomics Inc. A method for the clustering of dna sequences
CN110320362A (en) * 2019-04-16 2019-10-11 福建师范大学 Application of the death-associated protein kinase 1 in preparation cutaneum carcinoma Postoperative determination assessment kit
WO2021202780A2 (en) * 2020-04-01 2021-10-07 Engine Biosciences Pte. Ltd. Methods and compositions for treating cancer

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2001083808A2 (en) * 2000-05-01 2001-11-08 Rappaport Family Institute For Research In The Medical Sciences Nucleic acid construct system and method utilizing same useful for identifying protein-protein interactions

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5837544A (en) * 1995-02-02 1998-11-17 Cell Genesys, Inc. Method of inducing a cell to proliferate using a chimeric receptor comprising janus kinase
US6916846B2 (en) * 2000-05-12 2005-07-12 Merck & Co. Inc. Coumermycin analogs as chemical dimerizers of chimeric proteins
AU2003262937B2 (en) * 2002-08-27 2009-05-07 Bristol-Myers Squibb Company Adzymes and uses thereof

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2001083808A2 (en) * 2000-05-01 2001-11-08 Rappaport Family Institute For Research In The Medical Sciences Nucleic acid construct system and method utilizing same useful for identifying protein-protein interactions

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
AOKI M ET AL: "The akt kinase: molecular determinants of oncogenicity", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF USA, NATIONAL ACADEMY OF SCIENCE, WASHINGTON, DC.; US, vol. 95, 1 December 1998 (1998-12-01), pages 14950 - 14955, XP002996032, ISSN: 0027-8424 *
BOEHM JESSE S ET AL: "Integrative genomic approaches identify IKBKE as a breast cancer oncogene", CELL, vol. 129, no. 6, June 2007 (2007-06-01), pages 1065 - 1079, XP002498282, ISSN: 0092-8674 *
JAARO HANNA ET AL: "A genome wide screening approach for membrane-targeted proteins", MOLECULAR & CELLULAR PROTEOMICS, vol. 4, no. 3, March 2005 (2005-03-01), pages 328 - 333, XP002498281, ISSN: 1535-9476 *
MENDE INES ET AL: "Oncogenic transformation induced by membrane-targeted Akt2 and Akt3", ONCOGENE, NATURE PUBLISHING GROUP, GB BASINGSTOKE, HANTS, vol. 20, no. 32, 19 July 2001 (2001-07-19), pages 4419 - 4423, XP002299908, ISSN: 0950-9232 *

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN102482719A (en) * 2009-09-10 2012-05-30 富士胶片株式会社 Method for analyzing nucleic acid mutations using array comparative genomic hybridization techniques
EP2476760A4 (en) * 2009-09-10 2013-08-14 Fujifilm Corp Method for analyzing nucleic acid mutation using array comparative genomic hybridization technique
CN102482719B (en) * 2009-09-10 2014-08-27 富士胶片株式会社 Method for analyzing nucleic acid mutations using array comparative genomic hybridization
WO2013090732A3 (en) * 2011-12-14 2013-09-26 The Board Of Regents Of The University Of Texas System Collateral gene inactivation biomarkers and targets for cancer therapy
US9452182B2 (en) 2011-12-14 2016-09-27 Board Of Regents, The University Of Texas System Collateral gene inactivation biomarkers and targets for cancer therapy

Also Published As

Publication number Publication date
US20090047675A1 (en) 2009-02-19
US8178317B2 (en) 2012-05-15

Similar Documents

Publication Publication Date Title
US8178317B2 (en) Compositions and methods for identifying transforming and tumor suppressor genes
Shinh et al. Expression of axl in lung adenocarcinoma and correlation with tumor progression
Long et al. ERK3 signals through SRC-3 coactivator to promote human lung cancer cell invasion
Chen et al. DSG3 is overexpressed in head neck cancer and is a potential molecular target for inhibition of oncogenesis
Laudanski et al. MicroRNAs expression profiling of eutopic proliferative endometrium in women with ovarian endometriosis
US20130137748A1 (en) Whsc1 and whsc1l1 for target genes of cancer therapy and diagnosis
EP2468887A1 (en) TTK as tumor marker and therapeutic target for lung cancer
JP2004159640A5 (en) Methods and compositions for predicting, diagnosing, prognosing, preventing and treating malignant tumors
JP2004159640A (en) Method and composition for prognosticating, diagnosing, prognostically determining, preventing and treating malignant tumor
WO2008073290A1 (en) Tp53 gene expression and uses thereof
JP2014525586A (en) Methods and compositions for the treatment and diagnosis of colorectal cancer
EP1904645B1 (en) Method for predicting and monitoring direct response to cancer therapy
CN101835893A (en) Cancer-related genes, CDCA5, EPHA7, STK31 and WDHD1
Begum et al. Identification of PAK4 as a putative target gene for amplification within 19q13. 12‐q13. 2 in oral squamous‐cell carcinoma
US20160160217A1 (en) Compositions and methods for characterizing and treating muscular dystrophy
JP2007512807A (en) Methods and compositions for predicting response to treatment of malignant tumors
US20150018235A1 (en) Methods and Compositions for the Treatment and Diagnosis of Pancreatic Cancer
KR20220031069A (en) Methods for diagnosing the effectiveness of anti-tumor treatment
Persson et al. Comprehensive molecular characterization of adenoid cystic carcinoma reveals tumor suppressors as novel drivers and prognostic biomarkers
Rashed et al. Relation of BAALC and ERG gene expression with overall survival in acute myeloid leukemia cases
CN101528768A (en) Genes and polypeptides relating to breast cancers
EP4063507A1 (en) Method for predicting sensitivity of cancer cells to helicase inhibitor
US20100166731A1 (en) Methods and Compositions for Treating Cancer
KR102897614B1 (en) Novel MFSD7-ATP5l fusion gene and uses thereof
US7504212B2 (en) Cancer monitoring and therapeutics

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 08747354

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 08747354

Country of ref document: EP

Kind code of ref document: A1