WO2008151808A1 - Diagnostic method - Google Patents

Diagnostic method Download PDF

Info

Publication number
WO2008151808A1
WO2008151808A1 PCT/EP2008/004743 EP2008004743W WO2008151808A1 WO 2008151808 A1 WO2008151808 A1 WO 2008151808A1 EP 2008004743 W EP2008004743 W EP 2008004743W WO 2008151808 A1 WO2008151808 A1 WO 2008151808A1
Authority
WO
WIPO (PCT)
Prior art keywords
hbp
individual
severe sepsis
risk
wbc
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2008/004743
Other languages
French (fr)
Inventor
Lars Bjorck
Bertil Christensson
Heiko Herwald
Adam Linder
Per Akesson
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Hansa Biopharma AB
Original Assignee
Hansa Medical AB
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=38331957&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2008151808(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to JP2010511540A priority Critical patent/JP5166522B2/en
Priority to AT08759218T priority patent/ATE548050T1/en
Priority to EP08759218A priority patent/EP2129391B1/en
Priority to DK08759218.4T priority patent/DK2129391T3/en
Priority to US12/161,330 priority patent/US8518648B2/en
Priority to AU2008261252A priority patent/AU2008261252B2/en
Priority to PL08759218T priority patent/PL2129391T3/en
Application filed by Hansa Medical AB filed Critical Hansa Medical AB
Priority to CN200880019915.XA priority patent/CN101687023B/en
Priority to ES08759218T priority patent/ES2380875T3/en
Priority to CA2690067A priority patent/CA2690067C/en
Priority to BRPI0812875A priority patent/BRPI0812875B8/en
Priority to SI200830645T priority patent/SI2129391T1/en
Publication of WO2008151808A1 publication Critical patent/WO2008151808A1/en
Anticipated expiration legal-status Critical
Priority to US13/797,749 priority patent/US20130252347A1/en
Priority to US14/094,679 priority patent/US9784741B2/en
Ceased legal-status Critical Current

Links

Classifications

    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61B—DIAGNOSIS; SURGERY; IDENTIFICATION
    • A61B5/00—Measuring for diagnostic purposes; Identification of persons
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04—Antibacterial agents
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00—Detection or diagnosis of diseases
    • G01N2800/26—Infectious diseases, e.g. generalised sepsis

Definitions

  • the invention relates to the diagnosis of susceptibility to and the prevention of the development of severe sepsis.
  • Sepsis is a systemic inflammatory response to infection, which causes organ failure and death in severe cases. It is an increasingly common cause of morbidity and mortality, particularly in elderly, immuno-compromised, and critically ill individuals. Sepsis has been reported to be the most common cause of death in the non-coronary intensive care unit (Bone RC et al; Chest. 1992 Jun;101(6): 1644-55).
  • fever temperature >38°C
  • hypothermia temperature ⁇ 36°C
  • heart rate >90 beats per minute
  • SIRS severe Inflammatory Response Syndrome
  • Sepsis-induced hypotension is defined as a systolic blood pressure of ⁇ 90 mm Hg or a reduction of ⁇ 40 mm Hg from baseline in the absence of other causes of hypotension.
  • Perfusion abnormalities may include, but are not limited to hypoperfusion, lactic acidosis, oliguria, or an acute alteration in mental status.
  • Severe sepsis includes as a sub-category the condition of septic shock. This condition is specifically defined by the presence of sepsis-induced hypotension despite adequate fluid resuscitation along with the presence of perfusion abnormalities. Individuals who are receiving inotropic or vasopressor agents may not be hypotensive at the time that perfusion abnormalities are measured.
  • Heparin-binding protein (HBP, CAP37, Azurocidin) is a glycosylated, single chain, negatively charged 37 kDa inactive serine protease homologue exhibiting 44% sequence identity with human neutrophil elastase.
  • HBP Heparin-binding protein
  • CAP37 CAP37, Azurocidin
  • HBP has been published (Iversen et al Nat Struct Biol. 1997 Apr;4(4):265-8). It is contained in the azurofilic granulae of human neutrophils (Lindmark et al, J Leukoc
  • HBP HBP
  • HBP levels in individuals exhibiting one or more of the SIRS criteria have not previously been investigated.
  • the inventors have shown for the first time that levels of HBP are increased in individuals who subsequently develop severe sepsis. HBP levels are raised up to 12 hours before sepsis-induced hypotension is recorded, but rapidly decrease if therapy is instituted.
  • the inventors have also shown for the first time that the HBP/White Blood Cell count (WBC) ratio is elevated in individuals who subsequently develop severe sepsis.
  • WBC White Blood Cell count
  • the method of the invention may further comprise measuring the WBC or neutrophil count (NC) in an individual, calculating the HBP/WBC ratio or HBP / NC ratio respectively, and thereby determining whether or not the individual is at risk of developing severe sepsis.
  • the method of the invention may thus comprise measuring the HBP in an individual and calculating the HBP/WBC level or HBP/NC ratio in an individual, and thereby determining whether or not the individual is at risk of developing severe sepsis.
  • the invention further provides: - an agent for the detection of HBP for use in determining whether or not an individual is at risk of developing severe sepsis; - a test kit for use in a method for determining whether or not an individual is at risk of developing severe sepsis, which test kit comprises an agent for the detection of HBP in an individual; - a method of reducing the risk of an individual developing severe sepsis comprising:
  • Line within box median; edges of box: quartiles (Ql, Q3); whiskers: range of values; x and o: outlier values identified by patient number.
  • Figure 2 shows an ROC curve for HBP level and/or HBP/WBC ratio, HBP level, HBP/WBC ratio, lactate, White blood cell count, CRP, and IL-6.
  • the straight line from 0,0 to 1,1 is a reference line. Diagonal segments are produced by ties.
  • Open circles in Figure 3 a represent patients who fell below the HBP/WBC ratio cut off level but scored above the HBP concentration cut off level.
  • Open circles in Figure 3b represent patients who fell below the HBP concentration cut off level but scored above the HBP/WBC ratio cut off level.
  • Figure 4 shows the change in HBP/WBC ratio in consecutive plasma samples taken from 16 patients with severe sepsis over 96 hours ( Figure 4a) and 7 patients with sepsis, infection without SIRS or no infection over 72 hours (Figure 4b). Each line represents an individual patient.
  • the present invention relates to a method of identifying whether or not a subject is at risk of developing severe sepsis.
  • the invention therefore relates to the diagnosis of susceptibility of an individual to severe sepsis.
  • the individual under test is typically suspected of being at risk of developing severe sepsis.
  • the individual is typically a mammal.
  • the mammal is typically a human or a domestic mammal such as a horse, a cow, a sheep, a dog or a cat.
  • the individual is preferably a human.
  • the individual may be suspected of being at risk of developing severe sepsis because they have a confirmed or suspected infection, and/or display one or more, or two or more, of the SIRS criteria.
  • the SIRS criteria are:
  • fever temperature >38°C
  • hypothermia temperature ⁇ 36°C
  • the confirmed or suspected infection is typically one or more of a bacterial, a parasitic or a fungal infection.
  • a bacterial infection may be caused by one or more Gram negative or Gram positive bacteria.
  • the one or more Gram negative bacteria may be selected from Escherichia coli, Klebsiella spp. (typically K.pneumoniae or K.oxytocd), Enterobacter spp (typically E. cloacae or E.aerogenes), Bordetella spp. (typically B. bronchiseptica, B. pertussis or B. parapertussis), Chlamydia spp.
  • the one or more Gram positive bacteria may be selected from Staphylococcus spp. (typically S.
  • a fungal infection may be caused by one or more fungi selected from Candida albicans, Candida tropicalis, Candida parapsilosis, Candida krusei, Candida glabrata and Aperigillus fumigatus. The confirmed or suspected infection may affect any part of the body.
  • Typical examples include an infection which affects the lungs; the respiratory tract; the liver; the kidneys; the urinary tract; the skin (cutaneous and subcutaneous); the heart; the stomach; the intestines; the blood; the bones; the joints or any combination thereof.
  • the confirmed or suspected infection may be meningitis.
  • the infection may be confirmed by diagnostic practices known in the art, for example microbial culture of samples taken from the individual, antigen testing of urine or other fluid samples taken from the individual (especially for S. pneumoniae and Legionella sp. infections) or PCR analysis (especially for atypical pneumonia caused by bacterial infection e.g. Mycoplasma, Legionella, Chlamydia, and B. pertussis). More recently multiplex PCR techniques have been developed which enable simultaneous testing for multiple bacterial and fungal infections.
  • the infection may be suspected because of the presence of one or more of the following general symptoms: fever higher than 38 0 C; chills; pain; an ache or tenderness; general feeling of tiredness; night sweats; and a wound or incision with associated redness, heat, swelling or pain, or that exudes a fluid that is white, yellowish or greenish.
  • the present invention may be used to confirm susceptibility in an individual with one or more additional risk factors and/or one or more predispositions toward the development of severe sepsis.
  • Risk factors that increase susceptibility to developing severe sepsis typically include any factor which increases susceptibility to infection. These factors can include a weakened immune system (i.e. the individual is immunocompromised), or the presence in a hospitalised patient of an intravenous line, surgical wound, surgical drain, or a site of skin breakdown known as decubitus ulcers or bedsores. A diabetic individual is more prone to developing severe sepsis.
  • the diagnostic method of the invention may be carried out in conjunction with another assay or genetic test to refine risk prediction.
  • the individual does not have a chronic inflammatory-associated disease and/or displays no symptoms which are specifically associated with such diseases.
  • diseases include atherosclerosis, Alzheimer's disease, asthma, rheumatoid arthritis, osteoarthritis, and inflammatory diseases of the bowel such as Crohn's disease, Ulcerative colitis, Irritable bowel syndrome and
  • Inflammatory bowel disease If the individual does have a chronic inflammatory- associated disease, they additionally have a confirmed or suspected infection as defined above and/or display one or more, or two or more, of the SIRS criteria. Typically, the individual does not have severe sepsis or displays no symptoms which would lead to a diagnosis of severe sepsis. Typically such symptoms include sepsis-induced hypotension, organ dysfunction or perfusion abnormalities. Sepsis-induced hypotension is defined as a systolic blood pressure of ⁇ 90 mm Hg or a reduction of ⁇ 40 mm Hg from baseline in the absence of other causes of hypotension. Perfusion abnormalities may include, but are not limited to hypoperfusion, lactic acidosis, oliguria, or an acute alteration in mental status.
  • Severe sepsis includes as a sub-category the condition of septic shock. This condition is specifically defined by the presence of sepsis-induced hypotension despite adequate fluid resuscitation along with the presence of perfusion abnormalities. Individuals who are receiving inotropic or vasopressor agents may not be hypotensive at the time that perfusion abnormalities are measured.
  • the present invention involves measuring the level of HBP in an individual.
  • the level of HBP is measured by determining the concentration of HBP in a fluid sample taken from the individual.
  • an increased level of HBP compared with the baseline level or concentration indicates that the individual is susceptible to or at risk of developing severe sepsis.
  • the baseline level is typically the level of HBP in an individual who is suspected of being at risk of developing severe sepsis but does not subsequently develop severe sepsis.
  • the inventors have shown that, when the level of HBP is measured by determining the concentration of HBP in a plasma sample taken from an individual, individuals who develop non-severe sepsis have a median HBP concentration of about 8.5 ng/ml, individuals who have a confirmed or suspected infection but display one or fewer SIRS criteria have a median HBP concentration of about 6.5 ng/ml, and individuals who display of two or more SIRS criteria in the absence of infection have a median HBP concentration of about 9 ng/ml.
  • the median HBP concentration for all categories of individual who are suspected of being at risk of developing severe sepsis but do not subsequently develop severe sepsis is about 8 ng/ml.
  • an increased concentration of HBP associated with increased susceptibility to or risk of developing severe sepsis is typically greater than about 15 ng/ml, or greater than about 16, 17, 18, 19, 20, 21 , 22, 23 or 24 ng/ml.
  • the increased concentration of HBP associated with increased susceptibility to or risk of developing severe sepsis is preferably greater than about 20 ng/ml.
  • the increase in HBP level or concentration associated with increased susceptibility to or risk of developing severe sepsis is at least 2 fold, 2.5 fold or 3 fold relative to the baseline level or concentration.
  • the increase in HBP level or concentration associated with increased susceptibility to or risk of developing severe sepsis is preferably at least 2.5 fold relative to the baseline level or concentration.
  • the present invention may therefore also involve assessment of the ratio of HBP/white blood cell count (WBC) to determine the risk of developing severe sepsis.
  • WBC white blood cell count
  • an increased HBP/WBC ratio compared with the baseline ratio indicates that the individual is susceptible to or at risk of developing severe sepsis.
  • the baseline ratio is typically the HBP/WBC ratio in an individual who is suspected of being at risk of developing severe sepsis but does not subsequently develop severe sepsis.
  • the inventors When the concentration of HBP in a fluid sample is measured in ng/ml and the WBC in a blood sample is measured in number of cells xlO /1, the inventors have shown that, for example, individuals who develop non-severe sepsis have a median HBP/WBC ratio of about 0.7: 1 , individuals who have a confirmed or suspected infection but display one or fewer SIRS criteria have a median HBP/WBC ratio of about 0.85: 1, and individuals who display of two or more SIRS criteria in the absence of infection have a median HBP/WBC ratio of about 0.9: 1.
  • the median HBP/WBC ratio for all categories of individual who are suspected of being at risk of developing severe sepsis but do not subsequently develop severe sepsis is about 0.75: 1.
  • an increased HBP/WBC ratio associated with increased susceptibility to or risk of developing severe sepsis is typically greater than about 1.4:1, or greater than about 1.5:1, 1.6:1, 1.7: 1, 1.8:1, 1.9:1, 2.0:1, 2.1 : 1, 2.2:1, 2.3: 1 or 2.4:1.
  • the increased HBP/WBC ratio associated with increased susceptibility to or risk of developing severe sepsis is preferably greater than about 2.0:1.
  • the increase in HBP/WBC ratio associated with increased susceptibility to or risk of developing severe sepsis is at least 1.5 fold, 2 fold, 2.5 fold or 3 fold relative to the baseline ratio.
  • the increase in HBP/WBC ratio associated with increased susceptibility to or risk of developing severe sepsis is preferably at least 2.5 fold relative to the baseline ratio.
  • the present inventors have determined the mean neutrophil count (NC) in individuals suspected of being at risk of developing severe sepsis is about 80% of the white blood cell count (WBC).
  • the present invention may also assess the ratio of HBP/NC to determine the risk of developing severe sepsis.
  • an increased HBP/NC ratio compared with the baseline ratio indicates that an individual is susceptible to or at risk of developing severe sepsis.
  • the baseline ratio is typically the HBP/NC ratio in an individual who does not have an infection and/or does not display any of the SIRS criteria.
  • the inventors When the concentration of HBP in a fluid sample is measured in ng/ml and the NC count in a blood sample is measured in number of cells xlO 9 /l, the inventors have shown that, for example, individuals who develop non-severe sepsis have a median HBP/NC ratio of about 0.55:1, individuals who have a confirmed or suspected infection but display one or fewer SIRS criteria have a median HBP/NC ratio of about 0.65:1, and individuals who display of two or more SIRS criteria in the absence of infection have a median HBP/NC ratio of about 0.7:1.
  • the median HBP/NC ratio for all categories of individual who are suspected of being at risk of developing severe sepsis but do not subsequently develop severe sepsis is about 0.6: 1.
  • an increased HBP/NC ratio associated with increased susceptibility to or risk of developing severe sepsis is typically greater than about 1.1 :1, or greater than about 1.2:1, 1.3:1, 1.4:1, 1.5: 1, 1.6: 1, 1.7:1, 1.8:1 or 1.9:1.
  • the increased HBP/NC ratio associated with increased susceptibility to or risk of developing severe sepsis is preferably greater than about 1.6: 1.
  • the increase in HBP/NC ratio associated with increased susceptibility to or risk of developing severe sepsis is at least 1.5 fold, 2 fold, 2.5 fold or 3 fold relative to the baseline ratio.
  • the increase in HBP/NC ratio associated with increased susceptibility to or risk of developing severe sepsis is preferably at least 2.5 fold relative to the baseline ratio.
  • the invention is typically carried out in vitro on a sample obtained from the individual.
  • the sample typically comprises a body fluid of the individual.
  • the sample is preferably a blood, plasma, serum, urine, cerebrospinal fluid or joint fluid sample.
  • the sample is most preferably a blood sample.
  • the sample is typically processed prior to being assayed, for example by centrifugation.
  • the sample may also be typically stored prior to assay, preferably below -70°C.
  • Standard methods known in the art may be used to assay the level of HBP. These methods typically involve using an agent for the detection of HBP.
  • the agent typically binds specifically to HBP.
  • the agent may be an antibody specific for HBP.
  • the agent or antibody binds to HBP with no significant cross-reactivity to any other molecule, particularly any other protein.
  • an agent or antibody specific for HBP will show no significant cross- reactivity with human neutrophil elastase. Cross-reactivity may be assessed by any suitable method.
  • An antibody used in the method of the invention may either be a whole antibody or a fragment thereof which is capable of binding to HBP.
  • the antibody may be monoclonal.
  • Such a whole antibody is typically an antibody which is produced by any suitable method known in the art.
  • polyclonal antibodies may be obtained by immunising a mammal, typically a rabbit or a mouse, with HBP under suitable conditions and isolating antibody molecules from, for example, the serum of said mammal.
  • Monoclonal antibodies may be obtained by hybridoma or recombinant methods.
  • Hybridoma methods involve immunising a mammal, typically a rabbit or a mouse, with HBP under suitable conditions, then harvesting the spleen cells of said mammal and fusing them with myeloma cells. The mixture of fused cells is then diluted and clones are grown from single parent cells. The antibodies secreted by the different clones are then tested for their ability to bind to HBP, and the most productive and stable clone is then grown in culture medium to a high volume. The secreted antibody is collected and purified. Recombinant methods involve the cloning into phage or yeast of different immunoglobulin gene segments to create libraries of antibodies with slightly different amino acid sequences.
  • the antibody is a mammalian antibody, such as a primate, human, rodent (e.g. mouse or rat), rabbit, ovine, porcine, equine or camel antibody.
  • the antibody may be a camelid antibody or shark antibody.
  • the antibody may be a nanobody.
  • the antibody can be any class or isotype of antibody, for example IgM, but is preferably IgG.
  • the fragment of whole antibody that can be used in the method comprises an antigen binding site, e.g. Fab or F(ab)2 fragments.
  • the whole antibody or fragment may be associated with other moieties, such as linkers which may be used to join together 2 or more fragments or antibodies.
  • linkers may be chemical linkers or can be present in the form of a fusion protein with the fragment or whole antibody.
  • the linkers may thus be used to join together whole antibodies or fragments which have the same or different binding specificities, e.g. that can bind the same or different polymorphisms.
  • the antibody may be a bispecif ⁇ c antibody which is able to bind to two different antigens, typically any two of the polymorphisms mentioned herein.
  • the antibody may be a 'diabody' formed by joining two variable domains back to back.
  • the antibodies used in the method are present in any of the above forms which have different antigen binding sites of different specificities then these different specificities are typically to polymorphisms at different positions or on different proteins.
  • the antibody is a chimeric antibody comprising sequence from different natural antibodies, for example a humanised antibody.
  • Methods to assess HBP level typically involve contacting a sample with an agent or antibody capable of binding specifically to HBP.
  • Such methods may include dipstick assays and Enzyme-linked Immunosorbant Assay (ELISA).
  • dipsticks comprise one or more antibodies or proteins that specifically bind HBP. If more than one antibody is present, the antibodies preferably have different non-overlapping determinants such that they may bind to HBP simultaneously.
  • ELISA is a heterogeneous, solid phase assay that requires the separation of reagents.
  • ELISA is typically carried out using the sandwich technique or the competitive technique. The sandwich technique requires two antibodies. The first specifically binds HBP and is bound to a solid support. The second antibody is bound to a marker, typically an enzyme conjugate.
  • a substrate for the enzyme is used to quantify the HBP-antibody complex and hence the amount of HBP in a sample.
  • the antigen competitive inhibition assay also typically requires an HBP-specific antibody bound to a support.
  • An HBP-enzyme conjugate is added to the sample (containing HBP) to be assayed.
  • Competitive inhibition between the HBP-enzyme conjugate and unlabeled HBP allows quantification of the amount of HBP in a sample.
  • the solid supports for ELISA reactions preferably contain wells.
  • the present invention may also employ methods of measuring HBP that do not comprise antibodies.
  • High Performance Liquid Chromatography (HPLC) separation and fluorescence detection is preferably used as a method of determining the HBP level.
  • HPLC apparatus and methods as described previously may be used (Tsikas D et al. J Chromatogr B Biomed Sci Appl 1998; 705: 174-6) Separation during HPLC is typically carried out on the basis of size or charge.
  • endogenous amino acids and an internal standard L-homoarginine Prior to HPLC, endogenous amino acids and an internal standard L-homoarginine are typically added to assay samples and these are phase extracted on CBA cartridges (Varian, Harbor City, CA).
  • Amino acids within the samples are preferably derivatized with o- phthalaldehyde (OPA).
  • OPA o- phthalaldehyde
  • the accuracy and precision of the assay is preferably determined within quality control samples for all amino acids. Standard methods known in the art may
  • the invention further provides a diagnostic kit that comprises means for measuring the HBP level in an individual and thereby determining whether or not the individual is at risk of developing severe sepsis.
  • the kit typically contains one or more antibodies that specifically bind HBP.
  • the kit may comprise a monoclonal antibody, a polyclonal antibody, a single chain antibody, a chimeric antibody, a CDR-grafted antibody or a humanized antibody.
  • the antibody may be an intact immunoglobulin molecule or a fragment thereof such as a Fab, F(ab') 2 or Fv fragment. If more than one antibody is present, the antibodies preferably have different non-overlapping determinants such that they may bind to HBP simultaneously.
  • the kit may additionally comprise means for the measurement of the WBC count in an individual.
  • the kit may additionally comprise one or more other reagents or instruments which enable any of the embodiments of the method mentioned above to be carried out.
  • reagents or instruments include one or more of the following: suitable buffer(s) (aqueous solutions), means to isolate HBP from sample, means to obtain a sample from the individual (such as a vessel or an instrument comprising a needle) or a support comprising wells on which quantitative reactions can be done.
  • suitable buffer(s) aqueous solutions
  • means to isolate HBP from sample means to obtain a sample from the individual (such as a vessel or an instrument comprising a needle) or a support comprising wells on which quantitative reactions can be done.
  • the kit may, optionally, comprise instructions to enable the kit to be used in the method of the invention or details regarding which individuals the method may be carried out upon.
  • the present invention also relates to the treatment of an individual identified by a method of the invention as at risk of developing severe sepsis.
  • a substance for use in reducing the risk of developing severe sepsis may be used in the manufacture of a medicament for use in the treatment of an individual identified by a method of the invention as at risk of developing severe sepsis.
  • the condition of an individual identified by a method of the invention as at risk of developing severe sepsis can therefore be improved by administration of such a substance. Severe sepsis can thus be prevented.
  • a therapeutically effective amount of a substance useful for reducing the risk of developing severe sepsis may be given to an individual identified by a method of the invention as in need thereof.
  • Substances suitable for reducing the risk of developing severe sepsis typically include one or more antibiotics and/or one or more intravenous fluids.
  • the one or more antibiotics are typically broad spectrum antibiotics.
  • the broad spectrum antibiotics are typically selected from one or more aminoglycosides, cephalosporins, fluoroquinolones, lincosamides, macrolides, penicillins, sulfonamides, or tetracyclins.
  • antibiotics include, but are not limited to, Gentamicin, Kanamycin, Neomycin, Streptomycin, Tobramycin, Cefazolin, Cephalexin, Cephapirin, Cephradine, Cefuroxime, Cefixime, Cefotaxime, Ceftazidime, Ceftizoxime, Ceftriaxone, Ciprofloxacin, Levofloxacin, Ofloxacin, Clindamycin, Azithromycin, Clarithromycin, Erythromycin, Amoxicillin, Ampicillin, Ampicillin-Sulbactam, Cloxacillin, Dicloxacillin, Mezlocillin, Nafcillin, Oxacillin, Penicillin G Benzathine, Penicillin G Potassium, Penicillin G Procaine, Penicillin V Potassium, Piperacillin, Ticarcillin, Ticarcillin-Clavulanate potassium, Pyrimethamine-Sulfadoxine, Sulfadizin
  • a substance useful for reducing the risk of developing severe sepsis according to the invention is typically formulated for administration in the present invention with a pharmaceutically acceptable carrier or diluent.
  • the pharmaceutical carrier or diluent may be, for example, an isotonic solution.
  • solid oral forms may contain, together with the active substance, diluents, e.g. lactose, dextrose, saccharose, cellulose, corn starch or potato starch; lubricants, e.g. silica, talc, stearic acid, magnesium or calcium stearate, and/or polyethylene glycols; binding agents; e.g.
  • starches gum arabic, gelatin, methylcellulose, carboxymethylcellulose or polyvinyl pyrrolidone; disaggregating agents, e.g. starch, alginic acid, alginates or sodium starch glycolate; effervescing mixtures; dyestuffs; sweeteners; wetting agents, such as lecithin, polysorbates, laurylsulphates; and, in general, non-toxic and pharmacologically inactive substances used in pharmaceutical formulations.
  • Such pharmaceutical preparations may be manufactured in known manner, for example, by means of mixing, granulating, tabletting, sugar-coating, or film-coating processes.
  • Liquid dispersions for oral administration may be syrups, emulsions or suspensions.
  • the syrups may contain as carriers, for example, saccharose or saccharose with glycerine and/or mannitol and/or sorbitol.
  • Suspensions and emulsions may contain as carrier, for example a natural gum, agar, sodium alginate, pectin, methylcellulose, carboxymethylcellulose, or polyvinyl alcohol.
  • the suspensions or solutions for intramuscular injections may contain, together with the active substance, a pharmaceutically acceptable carrier, e.g. sterile water, olive oil, ethyl oleate, glycols, e.g. propylene glycol, and if desired, a suitable amount of lidocaine hydrochloride.
  • Solutions for intravenous administration or infusion may contain as carrier, for example, sterile water or preferably they may be in the form of sterile, aqueous, isotonic saline solutions.
  • a therapeutically effective amount of a substance used in the prevention of severe sepsis is administered to a patient identified according to a method of the invention.
  • the dose for example of an antibiotic, may be determined according to various parameters, especially according to the substance used; the age, weight and condition of the patient to be treated; the route of administration; and the required regimen. Again, a physician will be able to determine the required route of administration and dosage for any particular patient.
  • a typical daily dose is from about 0.1 to 50 mg per kg of body weight, according to the activity of the specific antibiotic, the age, weight and conditions of the subject to be treated and the frequency and route of administration.
  • daily dosage levels are from 5 mg to 2 g. That dose may be provided as a single dose or may be provided as multiple doses, for example taken at regular intervals, for example 2, 3 or 4 doses administered daily.
  • Example 1 illustrates the invention.
  • Inclusion criteria were fever > 38° C and antibiotic treatment for less than 24 hours. Duration of antibiotic treatment, demographics, SIRS criteria and systolic blood pressure (SBP) were recorded at admittance. C-reactive protein (CRP), lactate and WBC count were analysed, and plasma samples for later analysis of HBP, IL-6 levels were obtained within 12 hours from admission. In 20 patients serial plasma samples were obtained for up to 96 hours in parallel with recording SIRS criteria and SBP. After discharge, the final diagnosis and 28 d mortality was recorded and the patients were classified according to the SIRS criteria (Bone et al, Chest 1992; 101(6): 1644-55).
  • Severe sepsis (group 1) was defined as the presence of sepsis and SBP ⁇ 90 mmHg or a > 40 mmHg SBP fall from baseline within 24 h of collection of the blood samples, sepsis (group 2) was defined as display of two or more SIRS criteria together with an infection, non-sepsis (group 3) was defined as display of one SIRS criterion together with an infection, and non-infection (group 4) was defined as display of two or more SIRS criteria together with a non-infectious final diagnosis.
  • HBP concentration of HBP (ng/ml) was determined by a sandwich ELISA as described in (Tapper et al ⁇ Blood 2002; 99(5): 1785-93). Plasma samples were diluted 1/40 in PBS and run in duplicates. Recombinant human HBP was produced and purified as described in (Rasmussen et al ⁇ FEBS Lett 1996; 390(1): 109-12). Mouse monoclonal antibodies (2F23A) and rabbit antiserum (409A) to recombinant HBP were prepared and purified as described in (Lindmark et al ⁇ J. Leukoc. Biol 1999; 66(4):634-43) and used at 1/3000 and 1/7000 respectively.
  • HBP/WBC ratio was calculated by dividing the HBP concentration (ng/ml) with the WBC (xlO 9 cells/L).
  • IL-6 was measured with a commercial human IL-6 kit (Quantikine, R&D Systems, UK), detection limit 3pg/mL. Plasma samples were diluted 1/40. CRP and lactate analyses were performed on a Roche Hitachi Modular-P with reagents from Roche Diagnostics (Mannheim, Germany) according to the manufacturer's description with the exception that the samples for the lactate analysis were taken from plasma citrate tubes instead of oxalate-flouride tubes.
  • WBC White blood cell count
  • HBP levels were significantly higher in the severe sepsis group (pO.OOOl) (Fig. Ia), with 42/51 patients exceeding a cut-off level of 20 ng/ml, as compared to 1/95, 0/44 and 0/12 patients in group 2, group 3 and group 4, respectively.
  • patients in the severe sepsis group showed significantly (p ⁇ 0.0001) higher HBP/WBC ratios as compared to the other groups (Fig. Ib).
  • a HBP/WBC ratio above 2.0 was found in 44/51 patients in the severe sepsis group, 2/95 patients in the sepsis group, 0/44 patients in the non-sepsis group and 0/12 patients in the non-infection group.
  • HBP level and HBP/WBC ratio predict severe sepsis before onset of clinical symptoms
  • HBP value was elevated up to 12h before the lowest SBP was reached (figures 3a and 3b).
  • the HBP levels rapidly decreased within 24h in the 11 patients who were treated with adequate antibiotics and intravenous fluids and who recovered without complications.
  • the HBP levels In 5 cases where the patients continued to be circulatory unstable the HBP levels, however, remained elevated, 1 of these patient died within 28 days of the inclusion date (Fig 4a).
  • HBP/WBC >2 92.2 98.7 95.9 97.4 71 0.08 ratio or or

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Chemical & Material Sciences (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pathology (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Food Science & Technology (AREA)
  • Biotechnology (AREA)
  • Biochemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Oncology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Communicable Diseases (AREA)
  • Virology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Epidemiology (AREA)
  • Medical Informatics (AREA)
  • Surgery (AREA)
  • Mycology (AREA)
  • Biophysics (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Investigating Or Analysing Biological Materials (AREA)

Abstract

It has been demonstrated that the level of HBP increases in individuals that subsequently develop severe sepsis. Accordingly, the level of HBP, HBP/WBC ratio or HBP/NC ratio in an individual can be used to determine whether or not an individual is at risk of developing severe sepsis.

Description

DIAGNOSTIC METHOD
Field of the invention
The invention relates to the diagnosis of susceptibility to and the prevention of the development of severe sepsis.
Background of the invention
Sepsis is a systemic inflammatory response to infection, which causes organ failure and death in severe cases. It is an increasingly common cause of morbidity and mortality, particularly in elderly, immuno-compromised, and critically ill individuals. Sepsis has been reported to be the most common cause of death in the non-coronary intensive care unit (Bone RC et al; Chest. 1992 Jun;101(6): 1644-55).
It occurs in 1-2% of all hospitalizations and mortality rates range from 20% for sepsis to 40% for severe sepsis to >60% for septic shock (a sub-category of severe sepsis) (Leibovici; Ann Intern Med 1991 ; 1 14(8):703, Martin et al; N Engl J Med.
2003 Apr 17;348(16): 1546-54).
The clinical definition of sepsis is the presence of two or more of the following conditions:
(1) fever (temperature >38°C) or hypothermia (temperature <36°C); (2) heart rate >90 beats per minute;
(3) respiratory rate >20 breaths per minute or PaCO2 <32 mm Hg; and
(4) white blood cell count >12 (xl09 cells/L) or <4 (xl O9 cells/1), at the same time as a confirmed or suspected infection.
Conditions (1) to (4) are known as the SIRS (Severe Inflammatory Response Syndrome) criteria (Bone RC et al; Chest. 1992 Jun; 101 (6): 1644-55) and are a recognised international standard for diagnosis of severe inflammation. An individual exhibiting two or more of the SIRS criteria without a confirmed or suspected infection is classified as having non-infection associated SIRS.
The clinical definition of severe sepsis is sepsis as defined above, associated with sepsis-induced hypotension, organ dysfunction or perfusion abnormalities.
Sepsis-induced hypotension is defined as a systolic blood pressure of <90 mm Hg or a reduction of <40 mm Hg from baseline in the absence of other causes of hypotension. Perfusion abnormalities may include, but are not limited to hypoperfusion, lactic acidosis, oliguria, or an acute alteration in mental status. Severe sepsis includes as a sub-category the condition of septic shock. This condition is specifically defined by the presence of sepsis-induced hypotension despite adequate fluid resuscitation along with the presence of perfusion abnormalities. Individuals who are receiving inotropic or vasopressor agents may not be hypotensive at the time that perfusion abnormalities are measured.
For the treatment of severe sepsis, diagnosis prior to the onset of the more severe symptoms (hypotension, organ dysfunction or hypoperfusion) with the institution of adequate treatment is of the utmost importance for a successful outcome (Rivers E et al. N Engl J Med 2001; 345(19): 1368-77). For example, Kumar et al showed that mortality was correlated to the number of hours passed after the onset of sepsis-induced hypotension before the first treatment was given (Kumar et al. Crit Care Med 2006;34(6): 1589-96). A reliable biological or clinical marker to determine as early as possible whether an individual is at risk of developing severe sepsis is needed to minimise the delay before the institution of treatment,
Summary of the invention
Heparin-binding protein (HBP, CAP37, Azurocidin) is a glycosylated, single chain, negatively charged 37 kDa inactive serine protease homologue exhibiting 44% sequence identity with human neutrophil elastase. The three dimensional structure of
HBP has been published (Iversen et al Nat Struct Biol. 1997 Apr;4(4):265-8). It is contained in the azurofilic granulae of human neutrophils (Lindmark et al, J Leukoc
Biol 1999; 66(4):634-43). It is a multifunctional protein that has been shown to induce vascular leakage by altering the Ca2+ balance of the blood vessel cytoskeleton
(Gautam et al, Nature Medicine 2001; 7(10): 1123-7). The M-protein of group A streptococci (GAS) in complex with fibrinogen has been shown to induce HBP release by stimulation of the B2-integrin receptor of neutrophils (Herwald et al, Cell
2004; 1 16(3):367-79). LPS can also induce HBP release by an unknown mechanism (Rasmussen et al, FEBS Lett 1996; 390(l):109 12). The sequence of HBP is publically available (for example as NCBI accession no. NP_001691 REGION:
27..248) and is reproduced below as SEQ ID NO.l SEQ ID NO: 1
IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTWLGAYDLRRRE
RQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGW
GSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFS
LGPCGRGPDFFTRVALFRDWIDGVLNNPGP
The HBP levels in individuals exhibiting one or more of the SIRS criteria have not previously been investigated. The inventors have shown for the first time that levels of HBP are increased in individuals who subsequently develop severe sepsis. HBP levels are raised up to 12 hours before sepsis-induced hypotension is recorded, but rapidly decrease if therapy is instituted. The inventors have also shown for the first time that the HBP/White Blood Cell count (WBC) ratio is elevated in individuals who subsequently develop severe sepsis. According to the invention there is thus provided a method of identifying whether or not an individual is at risk of developing severe sepsis, which method comprises measuring HBP in the individual and thereby determining whether or not the individual is at risk of developing severe sepsis.
The method of the invention may further comprise measuring the WBC or neutrophil count (NC) in an individual, calculating the HBP/WBC ratio or HBP / NC ratio respectively, and thereby determining whether or not the individual is at risk of developing severe sepsis.
The method of the invention may thus comprise measuring the HBP in an individual and calculating the HBP/WBC level or HBP/NC ratio in an individual, and thereby determining whether or not the individual is at risk of developing severe sepsis.
The invention further provides: - an agent for the detection of HBP for use in determining whether or not an individual is at risk of developing severe sepsis; - a test kit for use in a method for determining whether or not an individual is at risk of developing severe sepsis, which test kit comprises an agent for the detection of HBP in an individual; - a method of reducing the risk of an individual developing severe sepsis comprising:
(i) determining whether or not an individual is at risk of developing severe sepsis using a method of the invention; and (ii) administering to an individual identified in (i) as at risk, a therapeutically effective amount of an agent suitable for the treatment of infection and/or intravenous fluids.
Description of the Figures
Figure 1 shows HBP concentration (Figure Ia), HBP/WBC ratios (Figure Ib), CRP levels (Figure Ic), IL-6 levels (Figure Id) and lactate levels (Figure Ie) in the severe sepsis group (n=51), sepsis group (n=95), infection without SIRS group (n=44) and SIRS without infection group (n=12). Line within box: median; edges of box: quartiles (Ql, Q3); whiskers: range of values; x and o: outlier values identified by patient number. Lines representing cut-off values for HBP level of 20 ng/ml and HBP/WBC ratio of 2 for Figures Ia and Ib respectively
Figure 2 shows an ROC curve for HBP level and/or HBP/WBC ratio, HBP level, HBP/WBC ratio, lactate, White blood cell count, CRP, and IL-6. The straight line from 0,0 to 1,1 is a reference line. Diagonal segments are produced by ties.
Figure 3 shows the HBP/WBC ratio (Figure 3a) or the HBP concentration (Figure 3b) for each individual (n=51) in the severe sepsis group, plotted against the time from collection of the first plasma sample relative to the time of the lowest measured blood pressure (indicated by the arrow at 0 hrs). Open circles in Figure 3 a represent patients who fell below the HBP/WBC ratio cut off level but scored above the HBP concentration cut off level. Open circles in Figure 3b represent patients who fell below the HBP concentration cut off level but scored above the HBP/WBC ratio cut off level.
Figure 4 shows the change in HBP/WBC ratio in consecutive plasma samples taken from 16 patients with severe sepsis over 96 hours (Figure 4a) and 7 patients with sepsis, infection without SIRS or no infection over 72 hours (Figure 4b). Each line represents an individual patient.
Detailed description of the invention
Diagnosis
The present invention relates to a method of identifying whether or not a subject is at risk of developing severe sepsis. The invention therefore relates to the diagnosis of susceptibility of an individual to severe sepsis. The individual under test is typically suspected of being at risk of developing severe sepsis. The individual is typically a mammal. The mammal is typically a human or a domestic mammal such as a horse, a cow, a sheep, a dog or a cat. The individual is preferably a human.
The individual may be suspected of being at risk of developing severe sepsis because they have a confirmed or suspected infection, and/or display one or more, or two or more, of the SIRS criteria. The SIRS criteria are:
(1) fever (temperature >38°C) or hypothermia (temperature <36°C);
(2) heart rate >90 beats per minute;
(3) respiratory rate >20 breaths per minute or PaCO2 <32 mm Hg; and
(4) white blood cell count >12 (xl09 cells/L) or <4 (xl09 cells/L). The confirmed or suspected infection is typically one or more of a bacterial, a parasitic or a fungal infection. A bacterial infection may be caused by one or more Gram negative or Gram positive bacteria. The one or more Gram negative bacteria may be selected from Escherichia coli, Klebsiella spp. (typically K.pneumoniae or K.oxytocd), Enterobacter spp (typically E. cloacae or E.aerogenes), Bordetella spp. (typically B. bronchiseptica, B. pertussis or B. parapertussis), Chlamydia spp. (typically C. trachomatis), Legionella spp. (typically L. pneumophilia), Pseudemonas spp. (typically P. aeruginosa), Mycoplasma spp. (typically M. pneumoniae), Haemophilus influenza, Serratia marcescens, Proteus mirabilis, , Acinetobacter baumannii, Stenotrophomonas maltophilia and Neisseria meningitidis (typically of serogroup A, B, C, H, I, K, L, X, Y, Z, 29E or W 135). The one or more Gram positive bacteria may be selected from Staphylococcus spp. (typically S. aureus or Coagulase negative Staphylococci), Streptococcus spp. (typically S. pneumoniae or S.pyogenes) and Enterococcus spp. (typically E.faecium or E.faecalis). A fungal infection may be caused by one or more fungi selected from Candida albicans, Candida tropicalis, Candida parapsilosis, Candida krusei, Candida glabrata and Aperigillus fumigatus. The confirmed or suspected infection may affect any part of the body.
Typical examples include an infection which affects the lungs; the respiratory tract; the liver; the kidneys; the urinary tract; the skin (cutaneous and subcutaneous); the heart; the stomach; the intestines; the blood; the bones; the joints or any combination thereof. The confirmed or suspected infection may be meningitis. The infection may be confirmed by diagnostic practices known in the art, for example microbial culture of samples taken from the individual, antigen testing of urine or other fluid samples taken from the individual (especially for S. pneumoniae and Legionella sp. infections) or PCR analysis (especially for atypical pneumonia caused by bacterial infection e.g. Mycoplasma, Legionella, Chlamydia, and B. pertussis). More recently multiplex PCR techniques have been developed which enable simultaneous testing for multiple bacterial and fungal infections.
The infection may be suspected because of the presence of one or more of the following general symptoms: fever higher than 380C; chills; pain; an ache or tenderness; general feeling of tiredness; night sweats; and a wound or incision with associated redness, heat, swelling or pain, or that exudes a fluid that is white, yellowish or greenish.
The present invention may be used to confirm susceptibility in an individual with one or more additional risk factors and/or one or more predispositions toward the development of severe sepsis. Risk factors that increase susceptibility to developing severe sepsis typically include any factor which increases susceptibility to infection. These factors can include a weakened immune system (i.e. the individual is immunocompromised), or the presence in a hospitalised patient of an intravenous line, surgical wound, surgical drain, or a site of skin breakdown known as decubitus ulcers or bedsores. A diabetic individual is more prone to developing severe sepsis. The diagnostic method of the invention may be carried out in conjunction with another assay or genetic test to refine risk prediction. Typically, the individual does not have a chronic inflammatory-associated disease and/or displays no symptoms which are specifically associated with such diseases. Examples of such diseases include atherosclerosis, Alzheimer's disease, asthma, rheumatoid arthritis, osteoarthritis, and inflammatory diseases of the bowel such as Crohn's disease, Ulcerative colitis, Irritable bowel syndrome and
Inflammatory bowel disease. If the individual does have a chronic inflammatory- associated disease, they additionally have a confirmed or suspected infection as defined above and/or display one or more, or two or more, of the SIRS criteria. Typically, the individual does not have severe sepsis or displays no symptoms which would lead to a diagnosis of severe sepsis. Typically such symptoms include sepsis-induced hypotension, organ dysfunction or perfusion abnormalities. Sepsis-induced hypotension is defined as a systolic blood pressure of <90 mm Hg or a reduction of <40 mm Hg from baseline in the absence of other causes of hypotension. Perfusion abnormalities may include, but are not limited to hypoperfusion, lactic acidosis, oliguria, or an acute alteration in mental status.
Severe sepsis includes as a sub-category the condition of septic shock. This condition is specifically defined by the presence of sepsis-induced hypotension despite adequate fluid resuscitation along with the presence of perfusion abnormalities. Individuals who are receiving inotropic or vasopressor agents may not be hypotensive at the time that perfusion abnormalities are measured.
The present invention involves measuring the level of HBP in an individual. Typically the level of HBP is measured by determining the concentration of HBP in a fluid sample taken from the individual. According to the present invention, an increased level of HBP compared with the baseline level or concentration indicates that the individual is susceptible to or at risk of developing severe sepsis. The baseline level is typically the level of HBP in an individual who is suspected of being at risk of developing severe sepsis but does not subsequently develop severe sepsis. For example the inventors have shown that, when the level of HBP is measured by determining the concentration of HBP in a plasma sample taken from an individual, individuals who develop non-severe sepsis have a median HBP concentration of about 8.5 ng/ml, individuals who have a confirmed or suspected infection but display one or fewer SIRS criteria have a median HBP concentration of about 6.5 ng/ml, and individuals who display of two or more SIRS criteria in the absence of infection have a median HBP concentration of about 9 ng/ml. The median HBP concentration for all categories of individual who are suspected of being at risk of developing severe sepsis but do not subsequently develop severe sepsis is about 8 ng/ml. In the present invention, in a fluid sample taken from an individual an increased concentration of HBP associated with increased susceptibility to or risk of developing severe sepsis is typically greater than about 15 ng/ml, or greater than about 16, 17, 18, 19, 20, 21 , 22, 23 or 24 ng/ml. The increased concentration of HBP associated with increased susceptibility to or risk of developing severe sepsis is preferably greater than about 20 ng/ml.
According to the present invention, the increase in HBP level or concentration associated with increased susceptibility to or risk of developing severe sepsis is at least 2 fold, 2.5 fold or 3 fold relative to the baseline level or concentration. The increase in HBP level or concentration associated with increased susceptibility to or risk of developing severe sepsis is preferably at least 2.5 fold relative to the baseline level or concentration.
The present invention may therefore also involve assessment of the ratio of HBP/white blood cell count (WBC) to determine the risk of developing severe sepsis. According to the present invention, an increased HBP/WBC ratio compared with the baseline ratio indicates that the individual is susceptible to or at risk of developing severe sepsis. The baseline ratio is typically the HBP/WBC ratio in an individual who is suspected of being at risk of developing severe sepsis but does not subsequently develop severe sepsis. When the concentration of HBP in a fluid sample is measured in ng/ml and the WBC in a blood sample is measured in number of cells xlO /1, the inventors have shown that, for example, individuals who develop non-severe sepsis have a median HBP/WBC ratio of about 0.7: 1 , individuals who have a confirmed or suspected infection but display one or fewer SIRS criteria have a median HBP/WBC ratio of about 0.85: 1, and individuals who display of two or more SIRS criteria in the absence of infection have a median HBP/WBC ratio of about 0.9: 1. The median HBP/WBC ratio for all categories of individual who are suspected of being at risk of developing severe sepsis but do not subsequently develop severe sepsis is about 0.75: 1.
In the present invention, when the concentration of HBP in a fluid sample is measured in ng/ml and the WBC count in a blood sample is measured in number of cells xlO9/l, an increased HBP/WBC ratio associated with increased susceptibility to or risk of developing severe sepsis is typically greater than about 1.4:1, or greater than about 1.5:1, 1.6:1, 1.7: 1, 1.8:1, 1.9:1, 2.0:1, 2.1 : 1, 2.2:1, 2.3: 1 or 2.4:1. The increased HBP/WBC ratio associated with increased susceptibility to or risk of developing severe sepsis is preferably greater than about 2.0:1. According to the present invention, the increase in HBP/WBC ratio associated with increased susceptibility to or risk of developing severe sepsis is at least 1.5 fold, 2 fold, 2.5 fold or 3 fold relative to the baseline ratio. The increase in HBP/WBC ratio associated with increased susceptibility to or risk of developing severe sepsis is preferably at least 2.5 fold relative to the baseline ratio. The present inventors have determined the mean neutrophil count (NC) in individuals suspected of being at risk of developing severe sepsis is about 80% of the white blood cell count (WBC). The present invention may also assess the ratio of HBP/NC to determine the risk of developing severe sepsis.
According to the present invention, an increased HBP/NC ratio compared with the baseline ratio indicates that an individual is susceptible to or at risk of developing severe sepsis. The baseline ratio is typically the HBP/NC ratio in an individual who does not have an infection and/or does not display any of the SIRS criteria. When the concentration of HBP in a fluid sample is measured in ng/ml and the NC count in a blood sample is measured in number of cells xlO9/l, the inventors have shown that, for example, individuals who develop non-severe sepsis have a median HBP/NC ratio of about 0.55:1, individuals who have a confirmed or suspected infection but display one or fewer SIRS criteria have a median HBP/NC ratio of about 0.65:1, and individuals who display of two or more SIRS criteria in the absence of infection have a median HBP/NC ratio of about 0.7:1. The median HBP/NC ratio for all categories of individual who are suspected of being at risk of developing severe sepsis but do not subsequently develop severe sepsis is about 0.6: 1. In the present invention, when the concentration of HBP in a fluid sample is measured in ng/ml and the NC count in a blood sample is measured in number of cells xlO9/l, an increased HBP/NC ratio associated with increased susceptibility to or risk of developing severe sepsis is typically greater than about 1.1 :1, or greater than about 1.2:1, 1.3:1, 1.4:1, 1.5: 1, 1.6: 1, 1.7:1, 1.8:1 or 1.9:1. The increased HBP/NC ratio associated with increased susceptibility to or risk of developing severe sepsis is preferably greater than about 1.6: 1.
According to the present invention, the increase in HBP/NC ratio associated with increased susceptibility to or risk of developing severe sepsis is at least 1.5 fold, 2 fold, 2.5 fold or 3 fold relative to the baseline ratio. The increase in HBP/NC ratio associated with increased susceptibility to or risk of developing severe sepsis is preferably at least 2.5 fold relative to the baseline ratio.
The invention is typically carried out in vitro on a sample obtained from the individual. The sample typically comprises a body fluid of the individual. The sample is preferably a blood, plasma, serum, urine, cerebrospinal fluid or joint fluid sample. The sample is most preferably a blood sample. The sample is typically processed prior to being assayed, for example by centrifugation. The sample may also be typically stored prior to assay, preferably below -70°C.
Standard methods known in the art may be used to assay the level of HBP. These methods typically involve using an agent for the detection of HBP. The agent typically binds specifically to HBP. The agent may be an antibody specific for HBP. By specific, it will be understood that the agent or antibody binds to HBP with no significant cross-reactivity to any other molecule, particularly any other protein. For example, an agent or antibody specific for HBP will show no significant cross- reactivity with human neutrophil elastase. Cross-reactivity may be assessed by any suitable method.
An antibody used in the method of the invention may either be a whole antibody or a fragment thereof which is capable of binding to HBP. The antibody may be monoclonal. Such a whole antibody is typically an antibody which is produced by any suitable method known in the art. For example, polyclonal antibodies may be obtained by immunising a mammal, typically a rabbit or a mouse, with HBP under suitable conditions and isolating antibody molecules from, for example, the serum of said mammal. Monoclonal antibodies may be obtained by hybridoma or recombinant methods.
Hybridoma methods involve immunising a mammal, typically a rabbit or a mouse, with HBP under suitable conditions, then harvesting the spleen cells of said mammal and fusing them with myeloma cells. The mixture of fused cells is then diluted and clones are grown from single parent cells. The antibodies secreted by the different clones are then tested for their ability to bind to HBP, and the most productive and stable clone is then grown in culture medium to a high volume. The secreted antibody is collected and purified. Recombinant methods involve the cloning into phage or yeast of different immunoglobulin gene segments to create libraries of antibodies with slightly different amino acid sequences. Those sequences which give rise to antibodies which bind to HBP may be selected and the sequences cloned into, for example, a bacterial cell line, for production. Typically the antibody is a mammalian antibody, such as a primate, human, rodent (e.g. mouse or rat), rabbit, ovine, porcine, equine or camel antibody. The antibody may be a camelid antibody or shark antibody. The antibody may be a nanobody. The antibody can be any class or isotype of antibody, for example IgM, but is preferably IgG. The fragment of whole antibody that can be used in the method comprises an antigen binding site, e.g. Fab or F(ab)2 fragments. The whole antibody or fragment may be associated with other moieties, such as linkers which may be used to join together 2 or more fragments or antibodies. Such linkers may be chemical linkers or can be present in the form of a fusion protein with the fragment or whole antibody. The linkers may thus be used to join together whole antibodies or fragments which have the same or different binding specificities, e.g. that can bind the same or different polymorphisms. The antibody may be a bispecifϊc antibody which is able to bind to two different antigens, typically any two of the polymorphisms mentioned herein. The antibody may be a 'diabody' formed by joining two variable domains back to back. In the case where the antibodies used in the method are present in any of the above forms which have different antigen binding sites of different specificities then these different specificities are typically to polymorphisms at different positions or on different proteins. In one embodiment the antibody is a chimeric antibody comprising sequence from different natural antibodies, for example a humanised antibody.
Methods to assess HBP level typically involve contacting a sample with an agent or antibody capable of binding specifically to HBP. Such methods may include dipstick assays and Enzyme-linked Immunosorbant Assay (ELISA). Typically dipsticks comprise one or more antibodies or proteins that specifically bind HBP. If more than one antibody is present, the antibodies preferably have different non-overlapping determinants such that they may bind to HBP simultaneously. ELISA is a heterogeneous, solid phase assay that requires the separation of reagents. ELISA is typically carried out using the sandwich technique or the competitive technique. The sandwich technique requires two antibodies. The first specifically binds HBP and is bound to a solid support. The second antibody is bound to a marker, typically an enzyme conjugate. A substrate for the enzyme is used to quantify the HBP-antibody complex and hence the amount of HBP in a sample. The antigen competitive inhibition assay also typically requires an HBP-specific antibody bound to a support. An HBP-enzyme conjugate is added to the sample (containing HBP) to be assayed. Competitive inhibition between the HBP-enzyme conjugate and unlabeled HBP allows quantification of the amount of HBP in a sample. The solid supports for ELISA reactions preferably contain wells.
The present invention may also employ methods of measuring HBP that do not comprise antibodies. High Performance Liquid Chromatography (HPLC) separation and fluorescence detection is preferably used as a method of determining the HBP level. HPLC apparatus and methods as described previously may be used (Tsikas D et al. J Chromatogr B Biomed Sci Appl 1998; 705: 174-6) Separation during HPLC is typically carried out on the basis of size or charge. Prior to HPLC, endogenous amino acids and an internal standard L-homoarginine are typically added to assay samples and these are phase extracted on CBA cartridges (Varian, Harbor City, CA). Amino acids within the samples are preferably derivatized with o- phthalaldehyde (OPA). The accuracy and precision of the assay is preferably determined within quality control samples for all amino acids. Standard methods known in the art may be used to measure the white blood cell count or neutrophil count in an individual. Such methods included automated or manual counting .
The invention further provides a diagnostic kit that comprises means for measuring the HBP level in an individual and thereby determining whether or not the individual is at risk of developing severe sepsis. The kit typically contains one or more antibodies that specifically bind HBP. For example, the kit may comprise a monoclonal antibody, a polyclonal antibody, a single chain antibody, a chimeric antibody, a CDR-grafted antibody or a humanized antibody. The antibody may be an intact immunoglobulin molecule or a fragment thereof such as a Fab, F(ab')2 or Fv fragment. If more than one antibody is present, the antibodies preferably have different non-overlapping determinants such that they may bind to HBP simultaneously.
The kit may additionally comprise means for the measurement of the WBC count in an individual.
The kit may additionally comprise one or more other reagents or instruments which enable any of the embodiments of the method mentioned above to be carried out. Such reagents or instruments include one or more of the following: suitable buffer(s) (aqueous solutions), means to isolate HBP from sample, means to obtain a sample from the individual (such as a vessel or an instrument comprising a needle) or a support comprising wells on which quantitative reactions can be done. The kit may, optionally, comprise instructions to enable the kit to be used in the method of the invention or details regarding which individuals the method may be carried out upon.
Therapy
The present invention also relates to the treatment of an individual identified by a method of the invention as at risk of developing severe sepsis. Thus, a substance for use in reducing the risk of developing severe sepsis may be used in the manufacture of a medicament for use in the treatment of an individual identified by a method of the invention as at risk of developing severe sepsis. The condition of an individual identified by a method of the invention as at risk of developing severe sepsis can therefore be improved by administration of such a substance. Severe sepsis can thus be prevented. A therapeutically effective amount of a substance useful for reducing the risk of developing severe sepsis may be given to an individual identified by a method of the invention as in need thereof. Substances suitable for reducing the risk of developing severe sepsis typically include one or more antibiotics and/or one or more intravenous fluids. The one or more antibiotics are typically broad spectrum antibiotics. The broad spectrum antibiotics are typically selected from one or more aminoglycosides, cephalosporins, fluoroquinolones, lincosamides, macrolides, penicillins, sulfonamides, or tetracyclins. For example, suitable antibiotics include, but are not limited to, Gentamicin, Kanamycin, Neomycin, Streptomycin, Tobramycin, Cefazolin, Cephalexin, Cephapirin, Cephradine, Cefuroxime, Cefixime, Cefotaxime, Ceftazidime, Ceftizoxime, Ceftriaxone, Ciprofloxacin, Levofloxacin, Ofloxacin, Clindamycin, Azithromycin, Clarithromycin, Erythromycin, Amoxicillin, Ampicillin, Ampicillin-Sulbactam, Cloxacillin, Dicloxacillin, Mezlocillin, Nafcillin, Oxacillin, Penicillin G Benzathine, Penicillin G Potassium, Penicillin G Procaine, Penicillin V Potassium, Piperacillin, Ticarcillin, Ticarcillin-Clavulanate potassium, Pyrimethamine-Sulfadoxine, Sulfadizine, Sulfisoxazole, Sulfamethoxazole, Trimethoprim-sulfamethoxazole, Chlortetracycline, Doxycycline, and Tetracycline.
A substance useful for reducing the risk of developing severe sepsis according to the invention is typically formulated for administration in the present invention with a pharmaceutically acceptable carrier or diluent. The pharmaceutical carrier or diluent may be, for example, an isotonic solution. For example, solid oral forms may contain, together with the active substance, diluents, e.g. lactose, dextrose, saccharose, cellulose, corn starch or potato starch; lubricants, e.g. silica, talc, stearic acid, magnesium or calcium stearate, and/or polyethylene glycols; binding agents; e.g. starches, gum arabic, gelatin, methylcellulose, carboxymethylcellulose or polyvinyl pyrrolidone; disaggregating agents, e.g. starch, alginic acid, alginates or sodium starch glycolate; effervescing mixtures; dyestuffs; sweeteners; wetting agents, such as lecithin, polysorbates, laurylsulphates; and, in general, non-toxic and pharmacologically inactive substances used in pharmaceutical formulations. Such pharmaceutical preparations may be manufactured in known manner, for example, by means of mixing, granulating, tabletting, sugar-coating, or film-coating processes.
Liquid dispersions for oral administration may be syrups, emulsions or suspensions. The syrups may contain as carriers, for example, saccharose or saccharose with glycerine and/or mannitol and/or sorbitol.
Suspensions and emulsions may contain as carrier, for example a natural gum, agar, sodium alginate, pectin, methylcellulose, carboxymethylcellulose, or polyvinyl alcohol. The suspensions or solutions for intramuscular injections may contain, together with the active substance, a pharmaceutically acceptable carrier, e.g. sterile water, olive oil, ethyl oleate, glycols, e.g. propylene glycol, and if desired, a suitable amount of lidocaine hydrochloride.
Solutions for intravenous administration or infusion may contain as carrier, for example, sterile water or preferably they may be in the form of sterile, aqueous, isotonic saline solutions. A therapeutically effective amount of a substance used in the prevention of severe sepsis is administered to a patient identified according to a method of the invention. The dose, for example of an antibiotic, may be determined according to various parameters, especially according to the substance used; the age, weight and condition of the patient to be treated; the route of administration; and the required regimen. Again, a physician will be able to determine the required route of administration and dosage for any particular patient. A typical daily dose is from about 0.1 to 50 mg per kg of body weight, according to the activity of the specific antibiotic, the age, weight and conditions of the subject to be treated and the frequency and route of administration. Preferably, daily dosage levels are from 5 mg to 2 g. That dose may be provided as a single dose or may be provided as multiple doses, for example taken at regular intervals, for example 2, 3 or 4 doses administered daily.
The following Example illustrates the invention: Example
1. Methods
Study Participants
202 adult patients with clinically suspected infection were enrolled in a prospective study at the Infectious Disease Clinic, Lund University Hospital,
Sweden, between March 2006 and April 2007. Inclusion criteria were fever > 38° C and antibiotic treatment for less than 24 hours. Duration of antibiotic treatment, demographics, SIRS criteria and systolic blood pressure (SBP) were recorded at admittance. C-reactive protein (CRP), lactate and WBC count were analysed, and plasma samples for later analysis of HBP, IL-6 levels were obtained within 12 hours from admission. In 20 patients serial plasma samples were obtained for up to 96 hours in parallel with recording SIRS criteria and SBP. After discharge, the final diagnosis and 28 d mortality was recorded and the patients were classified according to the SIRS criteria (Bone et al, Chest 1992; 101(6): 1644-55). Severe sepsis (group 1) was defined as the presence of sepsis and SBP < 90 mmHg or a > 40 mmHg SBP fall from baseline within 24 h of collection of the blood samples, sepsis (group 2) was defined as display of two or more SIRS criteria together with an infection, non-sepsis (group 3) was defined as display of one SIRS criterion together with an infection, and non-infection (group 4) was defined as display of two or more SIRS criteria together with a non-infectious final diagnosis.
Final infection diagnoses were pneumonia (n=61), upper respiratory tract infection (n=35), urinary tract infection (n=38), cutaneous and subcutaneous infection (n=29), endocarditis (n=4), gastroenteritis (n=12), or other infections including tropical infections (n=l 1). In 35 patients (17%) bacteremia was diagnosed (17 Gram-negative and 18 Gram-positive bacteria). Non-infectious diagnoses with display of two or more SIRS criteria were pulmonary embolis and systemic vasculitis). Blood samples were collected in 4 mL plastic plasma citrate tubes, immediately centrifuged at 3000 rpm for 10 min, alloquated and stored at -7O0C until analysis. Analysis of HBP. IL-6, CRP. lactate, WBC and HBP/WBC ratio
The concentration of HBP (ng/ml) was determined by a sandwich ELISA as described in (Tapper et al\ Blood 2002; 99(5): 1785-93). Plasma samples were diluted 1/40 in PBS and run in duplicates. Recombinant human HBP was produced and purified as described in (Rasmussen et al\ FEBS Lett 1996; 390(1): 109-12). Mouse monoclonal antibodies (2F23A) and rabbit antiserum (409A) to recombinant HBP were prepared and purified as described in (Lindmark et al\ J. Leukoc. Biol 1999; 66(4):634-43) and used at 1/3000 and 1/7000 respectively. Peroxidase- conjugated goat antirabbit IgG from Bio-Rad Laboratories (Richmond, CA), were used at 1/3000. A HBP/WBC ratio was calculated by dividing the HBP concentration (ng/ml) with the WBC (xlO9 cells/L).
IL-6 was measured with a commercial human IL-6 kit (Quantikine, R&D Systems, UK), detection limit 3pg/mL. Plasma samples were diluted 1/40. CRP and lactate analyses were performed on a Roche Hitachi Modular-P with reagents from Roche Diagnostics (Mannheim, Germany) according to the manufacturer's description with the exception that the samples for the lactate analysis were taken from plasma citrate tubes instead of oxalate-flouride tubes.
White blood cell count (WBC) was measured in a Sysmex XE2100 according to the manufacturer's description (Sysmex).
Statistical analysis
Data are presented as medians, interquartile ranges. Significance testing was carried out using the Mann -Whitney rank sum test. A two-tailed p-value <0.05 was considered statistically significant. Receiver-operating characteristic (ROC) curves (DeLong et al; Biometrics 1988; 44(3): 837-45) and the area under the curve (AUC) were determined for HBP, HBP/WBC ratio, CRP, WBC and IL-6. AUC values are reported with the 95% confidence interval (95% CI). Sensitivities, specificities, positive predictive values and negative predictive values were calculated from cross- tabulations. The positive likelihood ratio and negative likelihood ratio are also reported in Table 1. 2. Results
Characteristics of the Study Participants
202 patients who met the inclusion criteria were included. The patients were classified into the 4 following groups: 51 patients with severe sepsis (group 1), 95 patients with sepsis (group 2), 44 patients with non-sepsis (group 3) and 12 patients with non- infection (group 4), Median age and male/female ratio of the 4 groups were 62 y; 31/20, 57 y; 42/53, 44 y; 15/29, and 73 y; 11/1 respectively. Bacteremia was found in 22, 11, and 2 patients in group 1, 2, and 3 respectively.
Analysis of HBP levels and HBP/WBC ratios in Study Participants
At admission, HBP levels were significantly higher in the severe sepsis group (pO.OOOl) (Fig. Ia), with 42/51 patients exceeding a cut-off level of 20 ng/ml, as compared to 1/95, 0/44 and 0/12 patients in group 2, group 3 and group 4, respectively. Also, patients in the severe sepsis group showed significantly (p < 0.0001) higher HBP/WBC ratios as compared to the other groups (Fig. Ib). A HBP/WBC ratio above 2.0 was found in 44/51 patients in the severe sepsis group, 2/95 patients in the sepsis group, 0/44 patients in the non-sepsis group and 0/12 patients in the non-infection group. Moreover, in the severe sepsis group 47/51 patients had either a plasma HBP level > 20 ng/ml or a HBP/WBC ratio > 2.0, as compared to 2/95 patients in the sepsis group and 0 patients in the 2 other groups (Table 1).
Similarly, CRP, IL-6 and lactate levels were also significantly higher (p=0.003, pO.OOOl, pO.OOOl) in the severe sepsis group although there was a considerable overlapping between groups (Fig. 1 c-e).
Analysis of predictive value of HBP level and HBP/WBC ratio
Assuming a 25 % prevalence of severe sepsis, as in the present study, the following variables showed better specificity, sensitivity, positive predictive value (PPV), negative predictive value (NPV), positive likelihood ratio (PLR) and negative likelihood ratio (NLR) in diagnosing severe sepsis as compared to all different cut off levels of CRP and IL-6 calculated: - a HBP level > 20 ng/ml indicates individual will develop severe sepsis; or
- a HBP/WBC ratio >2.0 indicates individual will develop severe sepsis; or
- either a HBP level > 20 ng/ml or a HBP/WBC ratio >2.0 indicates individual will develop severe sepsis These findings are summarised in Tables Ia, Ib and Ic, and are supported by the ROC curve (figure T). Statistical analysis of the ROC curve is shown in table 2.
HBP level and HBP/WBC ratio predict severe sepsis before onset of clinical symptoms In 20 of the 51 patients in the severe sepsis group the HBP value was elevated up to 12h before the lowest SBP was reached (figures 3a and 3b). The HBP levels rapidly decreased within 24h in the 11 patients who were treated with adequate antibiotics and intravenous fluids and who recovered without complications. In 5 cases where the patients continued to be circulatory unstable the HBP levels, however, remained elevated, 1 of these patient died within 28 days of the inclusion date (Fig 4a).
In all 5 patients died, all in the severe sepsis group and all within 1 -4 days after the last collected elevated HBP sample. The HBP levels remained low below 20 ng/ml in 6 patients with sepsis and 1 patient with non-sepsis who were followed with serial sampling (fig 4b).
20 patients in the severe sepsis group had increased HBP levels or HBP/WBC ratios at admission but normal SBP, indicating that these indicators are able to predict severe sepsis before standard clinical diagnosis is possible. This is exemplified by a 70-year-old woman presenting with a 3-day history of fever, diarrhoea and vomiting. The physical examination was unremarkable except for fever 38 0C, pulse rate 100 but normal SBP of 130 mm/Hg, and she was hospitalized with a tentative diagnosis of gastroenteritis. She was given 1000 ml i.v. crystalloid fluid. Six hours later she developed severe hypotension with SBP 70 mm/Hg, respiratory distress and was immediately transferred to the ICU, where ARDS (Adult Respiratory Distress Syndrome) with disseminated intravascular coagulation due to E.coli septicemia was later diagnosed. At admission her HBP level was 80 ng/ml and HBP/WBC ratio was 4.2. Table Ia: Sensitivity, specificity, positive predictive value, negative predictive value, positive likelihood ratio and negative likelihood ratio of tested variables in diagnosing severe bacterial sepsis
Variable Cut-off Sensitivity Specificity PPV NPV PLR NLR
% % % %
HBP (ng/ml) >20 82.4 99.3 97.7 94.3 118 0.18
HBP/WBC >2 86.3 98.7 95.6 95.5 66.4 0.14 ratio
HBP/WBC >2 92.2 98.7 95.9 97.4 71 0.08 ratio or or
HBP level >20
(ng/ml)
CRP (mg/1) >50 88.2 36.4 31.9 90.2 1.39 0.32
>100 82.3 53.6 37.5 90.0 1.77 0.33
>150 64.7 71.3 42.9 85.6 2.25 0.49
>200 37.2 80.8 39.6 79.2 1.94 0.77
IL6 (pg/ml) >100 78.4 72.8 49.4 91.0 2.88 0.30
>200 62.7 77.5 48.5 86.0 2.78 0.48
>500 47.0 84.0 50.0 82.5 2.94 0.63
>1000 43.0 90.0 59.5 82.4 4.30 0.23
Lactate(mmol/1) >2.5 27.5 98.0 82.4 79.6 13.7 0.74
>2.0 41.2 91.8 63.6 81.8 5.0 0.64
>1.5 52.9 77.6 45.0 82.6 2.4 0.61
>1 88.2 46.3 36.3 91.9 1.6 0.25 Table Ib: Sensitivity and specificity of different cut off levels of HBP in diagnosing severe bacterial sepsis
HBP cut off Specificity Sensitivity
(ng/ml)
>15 95.1 88.2
>16 98.0 88.2
>17 98.6 84.3
>19 98.6 84.3
>20 99.3 82.4
>21 99.3 80.4
>22 99.3 78.4
>23 99.3 76.5
>24 99.3 74.5
Table Ic: Sensitivity and specificity of different cut off levels of HBP/WBC ratio in diagnosing severe bacterial sepsis
HBPAVBC Specificity Sensitivity ratio cut off
1.4 87.1 92.2
1.5 95.0 88.2
1.7 95.5 86.3
1.8 96.3 86.3
1.9 98.0 86.3
2.0 98.6 86.3
2.1 98.6 84.3
2.2 98.6 81.4
2.3 98.6 78.4
2.4 98.6 74.5
3.6 99.3 54.9 Table 2: Analysis of ROC curve for tested variables in diagnosing severe bacterial sepsis
Test Result Area Under Std. Asymptotic Asymptotic 95%
Variable(s) Curve Error (a) Sig. (b) Confidence Interval Lower Upper
Bound Bound
HBP (ng/ml)
.954 .017 .000 .920 .988
HBP/WBC ratio
.949 .022 .000 .905 .993
HBP/WBC ratio or
HBP level .960 .019 .000 .923 .997
(ng/ml)
CRP (mg/ml) .719 .040 .000 .641 .797
IL6 (pg/ml) .789 .038 .000 .714 .863
Lactate(mmol/1) .769 .050 .000 .697 .841
WBC count .511 .050 .820 .413 .608

Claims

1. A method of identifying whether or not an individual is at risk of developing severe sepsis, which method comprises measuring HBP in the individual and thereby determining whether or not the individual is at risk of developing severe sepsis.
2. A method according to claim 1, wherein the HBP is measured in a fluid sample taken from the individual.
3. A method according to claim 1 or 2, further comprising measuring the
White Blood Cell count (WBC) or neutrophil count (NC) in the individual, calculating the HBP/WBC ratio or HBP/NC ratio respectively, and thereby determining whether or not the individual is at risk of developing severe sepsis.
4. A method according to claim 3, wherein the WBC or NC is measured in a blood sample taken from the individual.
5. A method according to claim 2, wherein determining whether or not the individual is at risk of developing severe sepsis comprises determining whether or not the concentration of HBP is greater than 20 ng/ml in the fluid sample.
6. A method according to claim 2, wherein the level or concentration of
HBP in the fluid sample is increased by at least 2.5 fold relative to the baseline level or concentration of HBP.
7. A method according to claim 4, wherein, when the concentration of HBP in the fluid sample is measured in ng/ml and the WBC in the blood sample is measured in number of cells xlO /1, determining whether or not the individual is at risk of developing severe sepsis comprises determining whether or not the HBP/WBC ratio is greater than 2.
8. A method according to claim 4, wherein the HBP/WBC ratio or HBP/NC ratio in the blood sample is increased by at least 2.5 fold relative to the baseline HBP/WBC ratio or HBP/NC ratio respectively.
9. A method according to any one of the preceding claims, wherein the individual is suspected of being at risk of developing severe sepsis.
10. A method according to claim 9, wherein the individual has a confirmed or suspected infection and/or displays one or more of the SIRS criteria.
11. A method according to claim 9, wherein the individual has a confirmed or suspected infection and/or displays two or more of the SIRS criteria.
12. A method according to claim 10 or 11 , wherein the confirmed or suspected infection affects: the lungs; the respiratory tract; the liver; the kidneys; the urinary tract; the skin (cutaneous and subcutaneous); the heart; the stomach; the intestines; the blood; the bones; the joints or any combination thereof.
13. A method according to any one of claims 9 to 12 wherein the individual is: immuno-compromised; a diabetic; a hospitalised patient with an intravenous line, a surgical wound, a surgical drain or a bedsore; or any combination thereof.
14. A method according to any one of the preceding claims wherein the individual is a mammal.
15. The method of claim 14 wherein the mammal is a human.
16. An agent for the detection of HBP for use in determining whether or not an individual is at risk of developing severe sepsis.
17. An agent according to claim 16 wherein the agent comprises an HBP- specific antibody.
18. A method of reducing the risk of an individual developing severe sepsis, comprising; (i) determining whether or not an individual is at risk of developing severe sepsis using a method according to any one of claims 1 to 15; and
(ii) administering to an individual identified in (i) as at risk, a therapeutically effective amount of an agent suitable for the treatment of infection and/or intravenous fluids.
19. The method of claim 18 wherein the agent suitable for the treatment of infection is an antibiotic.
20. The method of claim 19 wherein the antibiotic is a broad-spectrum antibiotic.
21. The method of claim 19 wherein the antibiotic is clindamycin.
22. A test kit for use in a method for determining whether or not an individual is at risk of developing severe sepsis, which test kit comprises an agent for the detection of HBP in an individual.
23. The kit of claim 21 additionally comprising means for the measurement of the WBC in an individual.
PCT/EP2008/004743 2007-06-12 2008-06-12 Diagnostic method Ceased WO2008151808A1 (en)

Priority Applications (14)

Application Number Priority Date Filing Date Title
SI200830645T SI2129391T1 (en) 2007-06-12 2008-06-12 Diagnostic method
CN200880019915.XA CN101687023B (en) 2007-06-12 2008-06-12 Diagnostic method
EP08759218A EP2129391B1 (en) 2007-06-12 2008-06-12 Diagnostic method
DK08759218.4T DK2129391T3 (en) 2007-06-12 2008-06-12 DIAGNOSTIC PROCEDURE
US12/161,330 US8518648B2 (en) 2007-06-12 2008-06-12 Diagnostic method
AU2008261252A AU2008261252B2 (en) 2007-06-12 2008-06-12 Diagnostic method
PL08759218T PL2129391T3 (en) 2007-06-12 2008-06-12 Diagnostic method
JP2010511540A JP5166522B2 (en) 2007-06-12 2008-06-12 Diagnosis method
ES08759218T ES2380875T3 (en) 2007-06-12 2008-06-12 Diagnostic method
CA2690067A CA2690067C (en) 2007-06-12 2008-06-12 A diagnostic method by measuring the levels of heparin-binding protein
AT08759218T ATE548050T1 (en) 2007-06-12 2008-06-12 DIAGNOSTIC PROCEDURE
BRPI0812875A BRPI0812875B8 (en) 2007-06-12 2008-06-12 "IN VITRO METHOD TO IDENTIFY WHETHER OR NOT AN INDIVIDUAL IS AT RISK FOR DEVELOPING SEVERE SEPSIS, AND, TEST KIT
US13/797,749 US20130252347A1 (en) 2007-06-12 2013-03-12 Diagnostic method
US14/094,679 US9784741B2 (en) 2007-06-12 2013-12-02 Diagnostic method

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GBGB0711327.7A GB0711327D0 (en) 2007-06-12 2007-06-12 Diagnostic method
GB0711327.7 2007-06-12

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US12/161,330 A-371-Of-International US8518648B2 (en) 2007-06-12 2008-06-12 Diagnostic method
US13/797,749 Division US20130252347A1 (en) 2007-06-12 2013-03-12 Diagnostic method

Publications (1)

Publication Number Publication Date
WO2008151808A1 true WO2008151808A1 (en) 2008-12-18

Family

ID=38331957

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2008/004743 Ceased WO2008151808A1 (en) 2007-06-12 2008-06-12 Diagnostic method

Country Status (16)

Country Link
US (3) US8518648B2 (en)
EP (1) EP2129391B1 (en)
JP (1) JP5166522B2 (en)
KR (1) KR101563997B1 (en)
CN (2) CN101687023B (en)
AT (1) ATE548050T1 (en)
AU (1) AU2008261252B2 (en)
BR (1) BRPI0812875B8 (en)
CA (1) CA2690067C (en)
DK (1) DK2129391T3 (en)
ES (1) ES2380875T3 (en)
GB (1) GB0711327D0 (en)
PL (1) PL2129391T3 (en)
PT (1) PT2129391E (en)
SI (1) SI2129391T1 (en)
WO (1) WO2008151808A1 (en)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2011095052A (en) * 2009-10-28 2011-05-12 Univ Of Tokyo Disease marker of infectious disease
WO2012038541A1 (en) 2010-09-24 2012-03-29 Hansa Medical Ab Diagnostic method for bacterial meningitis
WO2012107450A1 (en) * 2011-02-07 2012-08-16 Hansa Medical Ab Diagnostic method for urinary tract infection
US9784741B2 (en) 2007-06-12 2017-10-10 Hansa Medical Ab Diagnostic method

Families Citing this family (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100240049A1 (en) 2009-01-16 2010-09-23 Cepheid Methods of Detecting Cervical Cancer
WO2012068642A1 (en) * 2010-11-26 2012-05-31 Immunexpress Pty Ltd Diagnostic and/or screening agents and uses therefor
CA2848873A1 (en) * 2011-09-16 2013-03-21 Cepheid Methods of detecting sepsis
US10260111B1 (en) 2014-01-20 2019-04-16 Brett Eric Etchebarne Method of detecting sepsis-related microorganisms and detecting antibiotic-resistant sepsis-related microorganisms in a fluid sample
US10761093B2 (en) 2014-10-09 2020-09-01 Texas Tech University System Microdevice for cell separation utilizing activation phenotype
CN109541235A (en) * 2018-08-19 2019-03-29 重庆早柒天生物科技股份有限公司 Heparin-binding protein and Procalcitonin two joint detection reagent box and preparation method thereof
US20220178932A1 (en) 2019-04-24 2022-06-09 Japanese Foundation For Cancer Research Cancer detection method and detection reagent
CN111208305B (en) * 2020-02-16 2023-04-25 重庆翼锋生物科技有限公司 Use of HBP and PCT in preparation of sepsis diagnostic reagent
CN111951963B (en) 2020-07-30 2022-09-02 中翰盛泰生物技术股份有限公司 Application of HBP in prognosis risk early warning of COVID-19 patient
JP2024516677A (en) * 2021-04-30 2024-04-16 エフ. ホフマン-ラ ロシュ アーゲー NGAL Marker Panel for Early Detection of Sepsis - Patent application
CN117242350A (en) * 2021-04-30 2023-12-15 豪夫迈·罗氏有限公司 IL6 marker panel for early detection of sepsis
CN117280218A (en) * 2021-04-30 2023-12-22 豪夫迈·罗氏有限公司 STREM1 marker panel for early detection of sepsis

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20030170745A1 (en) * 2002-03-08 2003-09-11 Pereira Heloise Anne Early detection marker for chronic inflammatory associated diseases
WO2004088324A2 (en) * 2003-03-25 2004-10-14 Proteogenix, Inc. Proteomic analysis of biological fluids
WO2005028512A1 (en) * 2003-09-19 2005-03-31 Leukotech A/S Pro-inflammatory and anti-inflammatory antibodies against the heparin-binding protein (hbp)

Family Cites Families (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5627262A (en) 1989-07-05 1997-05-06 The Board Of Regents Of The University Of Oklahoma Method and composition for the treatment of septic shock
US5962241A (en) * 1989-07-28 1999-10-05 The University Of Arizona Monoclonal antibody detection of proteins on sperm related to fertility
US5314804A (en) * 1992-03-24 1994-05-24 Serim Research Corporation Test for Helicobacter pylori
RU2200573C2 (en) 1994-04-21 2003-03-20 Леукотех А/С Heparin-binding protein for sepsis treatment
US5976536A (en) 1995-08-09 1999-11-02 Emory University Neisseria mutants, lipooligosaccharides and immunogenic compositions
US5778895A (en) 1997-01-29 1998-07-14 Uab Research Foundation Method of discriminating bacterial from aseptic meningitis
US6303321B1 (en) 1999-02-11 2001-10-16 North Shore-Long Island Jewish Research Institute Methods for diagnosing sepsis
US7655480B2 (en) 2002-03-08 2010-02-02 The Board Of Regents Of The University Of Oklahoma Method for predicting sepsis or an acute infectious inflammatory response
EP1581556A2 (en) 2002-08-15 2005-10-05 Leukotech A/S Bactericidal, anti-apoptotic, pro-inflammatory and anti-inflammatory peptides of heparin-binding protein (hbp)
JP2006515227A (en) * 2003-02-24 2006-05-25 ジーティーシー バイオセラピューティックス インコーポレイテッド Cross-flow filtration method and apparatus therefor
US20070110804A1 (en) * 2003-06-20 2007-05-17 Royer Biomedical, Inc. Drug polymer complexes
US20050196817A1 (en) 2004-01-20 2005-09-08 Molecular Staging Inc. Biomarkers for sepsis
US20070092911A1 (en) 2005-10-03 2007-04-26 Buechler Kenneth F Methods and compositions for diagnosis and /or prognosis in systemic inflammatory response syndromes
KR20080006617A (en) * 2005-04-15 2008-01-16 백톤 디킨슨 앤드 컴퍼니 Diagnosis of Sepsis
FR2894675B1 (en) 2005-12-14 2008-06-27 Assist Publ Hopitaux De Paris DISTINCTION OF BACTERIAL AND VIRAL MENINGITIS
GB0711327D0 (en) 2007-06-12 2007-07-25 Hansa Medical Ab Diagnostic method
GB201016161D0 (en) 2010-09-24 2010-11-10 Hansa Medical Ab Diagnostic method
GB201102108D0 (en) 2011-02-07 2011-03-23 Hansa Medical Ab Diagnostic method

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20030170745A1 (en) * 2002-03-08 2003-09-11 Pereira Heloise Anne Early detection marker for chronic inflammatory associated diseases
WO2004088324A2 (en) * 2003-03-25 2004-10-14 Proteogenix, Inc. Proteomic analysis of biological fluids
WO2005028512A1 (en) * 2003-09-19 2005-03-31 Leukotech A/S Pro-inflammatory and anti-inflammatory antibodies against the heparin-binding protein (hbp)

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
BOSSINK AILKO W J ET AL: "The clinical host response to microbial infection in medical patients with fever", CHEST, vol. 116, no. 2, August 1999 (1999-08-01), pages 380 - 390, XP002494882 *
LENNARD E S ET AL: "IMPLICATIONS OF LEUKOCYTOSIS AND FEVER AT CONCLUSION OF ANTIBIOTIC THERAPY FOR INTRA ABDOMINAL SEPSIS", ANNALS OF SURGERY, vol. 195, no. 1, 1982, pages 19 - 24, XP002494881, ISSN: 0003-4932 *
WEISS MANFRED ET AL: "Transient leukocytosis, granulocyte colony-stimulating factor plasma concentrations, and apoptosis determined by binding of annexin V by peripheral leukocytes in patients with severe sepsis.", ANNALS OF THE NEW YORK ACADEMY OF SCIENCES, vol. 1010, December 2003 (2003-12-01), pages 742 - 747, XP002494883 *

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9784741B2 (en) 2007-06-12 2017-10-10 Hansa Medical Ab Diagnostic method
JP2011095052A (en) * 2009-10-28 2011-05-12 Univ Of Tokyo Disease marker of infectious disease
WO2012038541A1 (en) 2010-09-24 2012-03-29 Hansa Medical Ab Diagnostic method for bacterial meningitis
JP2013543581A (en) * 2010-09-24 2013-12-05 ハンサ メディカル アクチボラゲット Method for treating bacterial meningitis
US9759720B2 (en) 2010-09-24 2017-09-12 Hansa Medical Ab Diagnostic method for bacterial meningitis
WO2012107450A1 (en) * 2011-02-07 2012-08-16 Hansa Medical Ab Diagnostic method for urinary tract infection
US10126312B2 (en) 2011-02-07 2018-11-13 Hansa Medical Ab Diagnostic method for urinary tract infection

Also Published As

Publication number Publication date
ES2380875T3 (en) 2012-05-21
US9784741B2 (en) 2017-10-10
BRPI0812875B8 (en) 2022-07-12
US20130252347A1 (en) 2013-09-26
EP2129391A1 (en) 2009-12-09
CN101687023B (en) 2016-04-20
AU2008261252A1 (en) 2008-12-18
PL2129391T3 (en) 2012-09-28
SI2129391T1 (en) 2012-07-31
CA2690067C (en) 2023-09-19
DK2129391T3 (en) 2012-06-11
JP2010529468A (en) 2010-08-26
KR101563997B1 (en) 2015-10-28
US20140187503A1 (en) 2014-07-03
BRPI0812875A2 (en) 2014-12-09
KR20100021578A (en) 2010-02-25
PT2129391E (en) 2012-06-06
EP2129391B1 (en) 2012-03-07
JP5166522B2 (en) 2013-03-21
CN101687023A (en) 2010-03-31
AU2008261252B2 (en) 2013-03-14
BRPI0812875B1 (en) 2017-12-05
GB0711327D0 (en) 2007-07-25
ATE548050T1 (en) 2012-03-15
CN103543271A (en) 2014-01-29
CA2690067A1 (en) 2008-12-18
US20100305185A1 (en) 2010-12-02
US8518648B2 (en) 2013-08-27

Similar Documents

Publication Publication Date Title
AU2008261252B2 (en) Diagnostic method
EP1587409B1 (en) Diagnosis and monitoring of acute coronary syndrome
EP1709444B1 (en) Method of diagnosing infectious disease by measuring the level of soluble trem-1 in a sample
CN111044725B (en) Evaluation and treatment of bradykinin-mediated disorders
JP2944721B2 (en) Endotoxin measuring agent
EP2673646B1 (en) Diagnostic method for urinary tract infection
US9759720B2 (en) Diagnostic method for bacterial meningitis
CN115975025B (en) C-reactive protein (CRP) detection kit
US20240272178A1 (en) A method for predicting sepsis and septic shock
CN116063482B (en) C-reactive protein (CRP) urine detection kit

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200880019915.X

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 08759218

Country of ref document: EP

Kind code of ref document: A1

DPE1 Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101)
WWE Wipo information: entry into national phase

Ref document number: 2008759218

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2008261252

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 20097025171

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2690067

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2010511540

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2008261252

Country of ref document: AU

Date of ref document: 20080612

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 52/DELNP/2010

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 12161330

Country of ref document: US

ENP Entry into the national phase

Ref document number: PI0812875

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20091210