WO2008121007A1 - Novel saratan polypeptides and polynucleotides and methods of use thereof - Google Patents

Novel saratan polypeptides and polynucleotides and methods of use thereof Download PDF

Info

Publication number
WO2008121007A1
WO2008121007A1 PCT/NZ2008/000069 NZ2008000069W WO2008121007A1 WO 2008121007 A1 WO2008121007 A1 WO 2008121007A1 NZ 2008000069 W NZ2008000069 W NZ 2008000069W WO 2008121007 A1 WO2008121007 A1 WO 2008121007A1
Authority
WO
WIPO (PCT)
Prior art keywords
saratan
cancer
seq
cells
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/NZ2008/000069
Other languages
French (fr)
Inventor
Liu Dongxu
Peter Edward Lobie
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Auckland Uniservices Ltd
Original Assignee
Auckland Uniservices Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Auckland Uniservices Ltd filed Critical Auckland Uniservices Ltd
Publication of WO2008121007A1 publication Critical patent/WO2008121007A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3015—Breast
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4748—Tumour specific antigens; Tumour rejection antigen precursors [TRAP], e.g. MAGE
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00—Structure or type of the nucleic acid
    • C12N2310/10—Type of nucleic acid
    • C12N2310/11—Antisense
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00—Structure or type of the nucleic acid
    • C12N2310/10—Type of nucleic acid
    • C12N2310/14—Type of nucleic acid interfering nucleic acids [NA]

Definitions

  • the invention relates to Saratan polypeptides, as well as Saratan polynucleotides and antibodies to Saratan.
  • the invention also relates to expression vectors and host cells for producing these polypeptides, polynucleotides, or antibodies.
  • the invention further relates to methods for diagnosis and treatment, especially for cancer, and particularly breast cancer, colon cancer, lung cancer, prostate cancer, endometrial cancer, and stomach cancer, using one or more of the disclosed polypeptides, polynucleotides, antibodies, expression vectors, host cells, or compositions thereof.
  • the present invention stems from the identification of a novel open reading frame which encodes a new polypeptide, termed Saratan, which among other things, acts to promote cancer cell proliferation, migration, and invasion.
  • the invention disclosure features an isolated Saratan polypeptide comprising at least one amino acid sequence selected from the group consisting of SEQ ID NO:1, 3, 8-10, 49-64, 102-104.
  • the polypeptide comprises the amino acid sequence of SEQ ID NO:1, 8-10.
  • the polypeptide comprises the amino acid sequence of SEQ ID NO:1.
  • the polypeptide is a fragment, for example, comprising at least one amino acid sequence extending from amino acids 59-81 of SEQ ID NO:1, or from amino acids 1-61 of SEQ ID NO:1.
  • the invention disclosure also features an isolated Saratan polynucleotide comprising a coding sequence for at least one polypeptide.
  • the polynucleotide comprises a coding sequence for at least one amino acid sequence selected from the group consisting of SEQ ID NO:1, 3, 8-10, 49-64, 102-104.
  • the polynucleotide comprises a coding sequence for SEQ ID NO:1, 8-10.
  • the polynucleotide comprises a coding sequence for SEQ ID NO:1.
  • the polynucleotide comprises a fragment of a coding sequence, for example, at least one amino acid sequence extending from amino acids 59-81 of SEQ ID NO:1, or from amino acids 1-61 of SEQ ID NO:1.
  • the invention disclosure features an isolated Saratan polynucleotide comprising a nucleic acid sequence selected from the group consisting of SEQ ID NO:14-16, 19, 22, 25-27, 28-30, 37, 38, 41, 42, 45-48, 65, 66, 68-73, 74-
  • the polynucleotide comprises the nucleic acid sequence of SEQ ID NO: 14.
  • the polynucleotide is a fragment or an oligonucleotide comprising, for example, the nucleic acid sequence extending from nucleotides 175-249 of SEQ ID NO:14.
  • the invention encompasses an isolated polynucleotide, or fragment thereof, which hybridizes to any one of the nucleic acid sequences of SEQ ID NO:14-16, 19, 22, 25-27, 28-30, 37, 38, 41, 42, 45-48, 65,
  • the invention further encompasses an isolated polynucleotide comprising the complement, reverse complement, reverse sequence, or fragments thereof, of any one of the nucleic acid sequences.
  • inhibitory agents such as Saratan antisense polynucleotides and Saratan interfering RNAs (iRNAs) and small interfering RNAs (siRNAs).
  • the agent is a nucleic acid adapted to inhibit Saratan in use. More preferably, the agent is selected from the group consisting of: an antisense nucleic acid directed to a Saratan transcript; a nucleic acid adapted to express such antisense in use; iRNA directed to a Saratan transcript; and a nucleic acid adapted to express such iRNA in use.
  • the invention disclosure features an iRNA directed to the Saratan transcript, or a nucleic acid adapted in use to express an iRNA directed to the Saratan transcript, wherein the iRNA comprises any one of the nucleotide sequences of SEQ ID NO:16-24, 25-36, 45-48, 68-73, 75-89, 96-100.
  • iRNA comprises any one of the nucleotide sequences of SEQ ID NO:16-24, 25-36, 45-48, 68-73, 75-89, 96-100.
  • antisense polynucleotides and iRNAs in particular, siRNAs, can inhibit expression of a Saratan polynucleotide, e.g., SEQ ID NO:14-16, 19, 22, 75-77, 101, 120-122, or modified sequences thereof.
  • the invention disclosure features expression vectors, as well as host cells, for producing these antisense polynucleotides or iRNAs.
  • the invention disclosure features an expression vector comprising a Saratan polynucleotide.
  • the expression vector comprises a coding sequence for at least one amino acid sequence selected from the group consisting of SEQ ID NO:1, 3,
  • the expression vector comprises a coding sequence for at least one amino acid sequence of SEQ ID NO:1, 8-10. In a further aspect, the expression vector comprises a coding sequence for at least one amino acid sequence of SEQ ID NO:1. In another aspect, the expression vector comprises a coding sequence for at least one amino acid sequence extending from amino acids 59-81 of
  • SEQ ID NO: 1 or from amino acids 1-61 of SEQ ID NO:1.
  • the invention disclosure also features a host cell, for example, a microbial host cell, comprising at least one expression vector.
  • the invention disclosure additionally features modified Saratan polypeptides, e.g., for at least one of SEQ ID NO:1, 3, 8-10, 49-64, 102-104, including biologically active alterations, fragments, variants, and derivatives, described herein. Also featured are polynucleotides encoding these modified polypeptides, as well as alterations, fragments, variants, and derivatives of the disclosed polynucleotides, expression vectors comprising these polynucleotides, and host cells comprising these vectors. In specific aspects, the compositions and methods of the invention employ these modified polynucleotides or polypeptides, or corresponding expression vectors or host cells.
  • Saratan polypeptides e.g., at least one of SEQ ID NO.l, 3, 8-10, 49-64, 102-104, or modified sequences thereof, which include fusions or conjugates with a heterologous agent as described in detail herein.
  • the invention disclosure includes Saratan antibodies.
  • the antibodies can be polyclonal or monoclonal antibodies, and any modified antibodies. Such antibodies can bind to a Saratan polypeptide, e.g., SEQ ID NO:1, 3, 8-10, 49-64, 102- 104, or a modified sequence thereof.
  • the antibodies can be directed to the native polypeptide, any peptides derived from this polypeptide, any modifications of these polypeptides or peptides (e.g., where primary structure is based on the sequence of Saratan), or any polypeptides or peptides which mimic the 3-D conformation of Saratan.
  • the invention disclosure features a composition comprising an isolated Saratan polypeptide, e.g., at least one of SEQ ID NO:1, 3, 8-10, 49-64, 102-104. Also featured is a composition comprising an isolated polynucleotide, e.g., at least one of SEQ ID NO:14-48, 65, 66, 68-73, 74-101, 120-122. Further featured is a composition that includes an antibody, expression vector, or host cell comprising an expression vector, in accordance with the invention. The composition can include any one of the biologically active alterations, fragments, variants, and derivatives described herein. The composition can include at least one fusion or conjugate. The composition can be formulated, for example, as pharmaceutical compositions described in detail herein.
  • kits for diagnosis or treatment, especially for cancer, and particularly breast cancer, colon cancer, lung cancer, prostate cancer, endometrial cancer, or stomach cancer, in accordance with the disclosed methods.
  • kits can comprise: a) at least one Saratan component (e.g., polypeptide, polynucleotide, or antibody) as set out herein; and b) optionally, instructions for use, for example, in diagnosing or treating cancer.
  • Saratan component e.g., polypeptide, polynucleotide, or antibody
  • the invention disclosure also features a method for producing a Saratan polypeptide, the method comprising the steps of: a) culturing an expression vector or host cell comprising an expression vector, which comprises at least part of a coding sequence for at least one Saratan polypeptide under conditions suitable for the expression of the polypeptide; and b) recovering the polypeptide from the culture.
  • the polypeptide comprises at least one amino acid sequence selected from the group consisting of SEQ ID NO:1, 3, 8-10, 49-64, 102-104, or modified sequences thereof.
  • the invention disclosure additionally features a method for producing a Saratan polypeptide, e.g., for at least one of SEQ ID NO:1, 3, 8-10, 49-64, 102-104, which comprises a fusion or conjugate as described in detail herein.
  • Such method comprises: a) culturing an expression vector or host cell comprising an expression vector, which comprises a coding sequence for at least one Saratan polypeptide under conditions suitable for the expression of the polypeptide; b) forming the Saratan fusion or conjugate (e.g., by expression of the fused sequence or by chemical conjugation); and c) recovering the fusion or conjugate.
  • the polypeptide comprises at least one amino acid sequence selected from the group consisting of SEQ ID NO: I 5 3, 8-10, 49-64, 102-104, or modified sequences thereof.
  • the invention disclosure features a method of inhibiting a cancer cell (e.g., inhibiting cell proliferation, cell survival, or cell motility), in particular, a cell from breast cancer, colon cancer, lung cancer, prostate cancer, endometrial cancer, or stomach cancer.
  • the method comprises use of at least one inhibitor of Saratan (e.g., polynucleotides or antibodies) as described herein, comprising contacting the cell with the inhibitor.
  • Saratan e.g., polynucleotides or antibodies
  • the inhibitor is selected from chemical compounds (e.g., small molecules), antagonists, antibodies, antisense polynucleotides, and iRNAs.
  • the invention disclosure encompasses a method of treating cancer in a subject, in particular, breast cancer, colon cancer, lung cancer, prostate cancer, endometrial cancer, or stomach cancer.
  • the method comprises administering at least one inhibitor of Saratan (e.g., polynucleotides or antibodies) to the subject, or a composition, for example, pharmaceutical composition, thereof.
  • Saratan e.g., polynucleotides or antibodies
  • the inhibitor is selected from chemical compounds (e.g., small molecules), antagonists, antibodies, antisense polynucleotides, and iRNAs. Applicable cancers and cancer cells are described in detail herein.
  • the methods of the invention disclosure utilize in vivo or in vitro expression systems.
  • the methods employ polynucleotides or polypeptides produced by recombinant, synthetic, or semi-synthetic means, or polynucleotides or polypeptides produced by endogenous means (e.g., naturally occurring components).
  • the invention comprises an isolated Saratan RNA molecule comprising a nucleic acid sequence selected from the group consisting of SEQ ED NO: 101 and 120-122, or a sequence complementary thereto.
  • the invention comprises an isolated Saratan RNA molecule comprising the nucleic acid sequence of SEQ ID NO:74, or a sequence complementary thereto.
  • the invention comprises an isolated Saratan RNA molecule comprising a nucleic acid sequence selected from the group consisting of SEQ ID NO:75-77, or a sequence complementary thereto.
  • the invention comprises an isolated Saratan RNA molecule comprising a nucleic acid sequence selected from the group consisting of SEQ ID NO:68-73, 78-89, and 96-98, or a sequence complementary thereto.
  • the invention comprises an isolated Saratan KNA molecule comprising a nucleic acid sequence selected from the group consisting of SEQ ID NO:90-95, and 99-100, or a sequence complementary thereto.
  • the invention comprises an isolated Saratan RNA molecule comprising a nucleic acid sequence having at least 95% identity to any one of SEQ ID NO:101 and 120-122, or a sequence complementary thereto.
  • the invention comprises an isolated Saratan RNA molecule comprising a nucleic acid sequence having at least 95% identity to SEQ ID NO:74, or a sequence complementary thereto.
  • the invention also comprises an antisense RNA molecule which binds to the nucleic acid sequence of any one of the preceding aspects.
  • the invention additionally comprises an antisense RNA molecule comprising the nucleic acid sequence of any one of the preceding aspects.
  • the invention further comprises a small interfering RNA molecule which inhibits translation of the nucleic acid sequence of any one of the preceding aspects.
  • the invention yet further comprises a small interfering RNA molecule comprising the nucleic acid sequence of any one of the preceding aspects.
  • the invention still further comprises an RNA oligonucleotide comprising the nucleic acid sequence of any one of the preceding aspects.
  • Also included in the invention is a vector which expresses the nucleic acid sequence of any one of the preceding aspects.
  • the invention comprises a host cell which comprises the vector of any preceding aspect.
  • the invention comprises an isolated. Saratan polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and 102- 104, or a functional fragment thereof.
  • the invention comprises an isolated Saratan polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO:8-10.
  • the invention comprises an isolated Saratan polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO:49-64, and l l5.
  • the invention comprises an isolated Saratan polypeptide comprising an amino acid sequence having at least 97% identity to SEQ ID NO:1.
  • the invention also comprises an isolated Saratan RNA molecule which encodes the amino acid sequence of any one of the preceding aspects.
  • the invention additionally comprises a Saratan antibody or antibody fragment which binds to the amino acid sequence of any one of the preceding aspects.
  • the invention further comprises a Saratan antibody or antibody fragment which binds to the amino acid sequence of any one of the preceding aspects.
  • the invention yet further comprises a Saratan antibody of any one of the preceding aspects which is monoclonal.
  • the invention still further comprises a composition comprising the isolated Saratan RNA molecule of any one of the preceding aspects.
  • compositions comprising the antisense RNA molecule of any one of the preceding aspects, or the small interfering RNA molecule of any one of the preceding aspects. Additionally included in the invention is a composition comprising the vector of any preceding aspect or the host cell of any preceding aspect.
  • composition comprising the isolated Saratan polypeptide of any one of the preceding aspects.
  • composition comprising the Saratan antibody of any one of the preceding aspects.
  • composition comprising the composition of any one of the preceding aspects, and a physiologically acceptable carrier.
  • the invention comprises the use of the composition of any one of the preceding aspects, in the preparation of a medicament for the treatment of cancer in an individual, wherein the cancer is selected from the group consisting of breast cancer, colon cancer, lung cancer, prostate cancer, endometrial cancer, and stomach cancer.
  • the cancer may be metastatic cancer.
  • the invention comprises a method for treating cancer in an individual comprising administering the pharmaceutical composition of any preceding aspect to the individual, thereby treating the cancer, wherein the cancer is selected from the group consisting of breast cancer, colon cancer, lung cancer, prostate cancer, endometrial cancer, and stomach cancer.
  • the cancer may be metastatic cancer.
  • the invention disclosure may also be said broadly to consist in the parts, elements and features referred to or indicated in the specification of the application, individually or collectively, in any or all combinations of two or more of said parts, elements or features, and where specific integers are mentioned herein which have known equivalents in the art to which the invention relates, such known equivalents are deemed to be incorporated herein as if individually set forth. Other aspects and embodiments of the invention disclosure are described herein below.
  • Fig. 1 Expression of Saratan in MCF-7 mammary carcinoma cells. Total RNA was isolated from the MCF-7 cells. The expression of Saratan was detected by RT-PCR using One-step RT-PCR kit (Qiagen). M, 1 kb plus DNA ladder; hST, human Saratan.
  • Fig. 2A-B mRNA expression pattern of human Saratan in human normal tissues and cancer cell lines.
  • Saratan was amplified by PCR with Saratan specific primers from cDNAs made from a panel of different human tissues (Primgen). The tissue of origin is marked above each lane. ⁇ 2M, the ⁇ 2-microglobulin was used as the cDNA input control.
  • Fig. 2B The expression of Saratan in human cancer cell lines was examined by RT-PCR with the same Saratan specific primer pairs using One-step RT- PCR kit (Qiagen). ⁇ -actin was included as the RNA input control.
  • Figs. 3A-B Cytoplasmic localization of Saratan-EGFP in MCF-7 cells.
  • MCF-7 cells were transiently transfected with pEGFP-Nl-hST (Fig. 3A) or the pEGFP-Nl vector (Fig. 3B). 24 h after transfection, cells were fixed and nuclei were counterstained with DAPI (blue). The expression and cellular localization of the green fluorescent Saratan- EGFP fusion protein (hST-EGFP) or EGFP protein in MCF-7 was monitored using a confocal laser scanning microscope. Bar, 10 ⁇ M.
  • Figs. 4A-B The N-terminal of Saratan is located outside of the cell membrane.
  • FIG. 4A Western blot of MCF-7 cells transiently transfected with plasmids phCMVn- hST, phCMVc-hST or the empty phCMVl vector plasmid as a control. The expression of HA-tagged Saratan was detected by the rabbit polyclonal HA-Probe (Y-11) (Santa Cruz Biotech). (Fig.
  • MCF-7 cells were transiently transfected with plasmids phCMVn-hST or phCMVc-hST expressing N-terminal HA-tagged Saratan (HA-hST, panels a-b, Fig. 4B) and a C-terminal HA-tagged Saratan (hST-HA, panels c-d, Fig. 4B), respectively, or with the empty phCMVl vector plasmid as a control (panels e-f, Fig. 4B). After fixation, cells were permeabilized with 0.5% Triton ® X-100 for 30 min (panels a, c and e, Fig.
  • Figs. 5A-B Forced Saratan overexpression in MCF-7 cells.
  • Cells were stably transfected with plasmids expressing Saratan (MCF7-hST, Fig. 5A) or the empty vector plasmid (MCF7-Vec, Fig. 5B) as control as indicated.
  • the expression of Saratan was examined by RT-PCR with Saratan specific primers, ⁇ -actin was used as input control for RT-PCR.
  • M 1 kb plus DNA ladder.
  • MCF-7 cells that stably express hST were produced by introducing an hST expression plasmid (MCF7-hST).
  • MCF7-hST hST expression plasmid
  • cells were transfected with empty vector (MCF7- Vec).
  • Cells were seeded at a density of 50,000 cells per a well in six-well plates in triplicates in 3 ml of RPMI 1640 with 10% serum. Cells were cultured up to 10 days with media changed every other day. Cell number was determined after trypsinization every 2 days.
  • Figs. 7A-B Efficiency of siRNA construct in reducing Saratan expression.
  • MCF-7 cells were stably transfected with plasmids expressing Saratan specific siRNA constructs pSilencer 2.1 -siRNA- A, B, and C, as well as empty vector as a control (siRNA-vec).
  • the expression of Saratan (hST) was determined by RT-PCR (Fig. 7A) with ⁇ -actin as an internal control. The quantification was done with a UVP-system and normalised to ⁇ -actin with the density of siRNA- vec as 1.00 (Fig. 7B).
  • Fig. 8 Inhibition of cell proliferation by siRNA of targeting Saratan.
  • Fig. 9 Over-expression of Saratan increased BrdU incorporation while siRNA specific for Saratan decreased BrdU incorporation.
  • MCF-7 cells that stably express Saratan were produced by transfecting a Saratan expression plasmid (MCF7-hST). Alternatively, cells were transfected with empty vector (MCF7-Vec), or by vector for expressing siRNA specific for hST (siRNA- A), or control siRNA (siRNA-CK). Cells were seeded on glass coverslip in six- well plates in full media and incubated overnight before 18 hours of serum starvation in serum-free media. Cells were then pulse labelled with BrdU.
  • Proliferating cells were detected by anti-BrdU mouse monoclonal antibody using a BrdU staining kit (Zymed). The cell nuclei were counterstained with hematoxylin. Cells with dark brown nuclear staining were counted as BrdU-positive cells. The percentage of BrdU-positive nuclei relative to the total number of nuclei was calculated from 10 random fields per coverslip.
  • Figs. 10A-D Forced expression of Saratan significantly promotes the migration and invasion of mammary carcinoma MCF-7 cells.
  • Fig. 10A Migration assay.
  • MCF7-hST cells over-expressing Saratan or MCF7-Vec control cells in serum-free media were loaded into the upper side of the 8- ⁇ m-pore-size Transwell inserts. These were placed into lower chambers with full media containing 10% FBS. The loaded chambers were incubated for 48h. Cells in the upper chamber were removed with cotton swabs and those that had migrated to the lower surface of the inner chamber were identified microscopically under a UV-visible fluorescence microscope after staining with Hoechst 33258. Representative fields of cells which had migrated to the bottom side of the Transwell filters are presented on the right. (Fig. 10B) Invasion assay.
  • Fig. 10C Additional migration assay. The same as in Fig. 1OA except that transiently transfected MCF-7 cells were used. Cells were transiently transfected by vector producing siRNA to specifically target Saratan mRNA (siRNA-A) or by vector producing siRNA negative control (siRNA-CK).
  • Fig. 10D Invasion assay. The same as in Fig. 1OC except that the upper sides of the filters were coated with a layer of Matrigel. All numerical data presented are the means ⁇ standard deviation (SD) of triplicates. *, p ⁇ 0.05; **, p ⁇ 0.01; ***, pO.001.
  • Fig. 11 Production of recombinant human Saratan protein in bacteria.
  • the N- terminal peptide including 61 amino acids of Saratan was expressed in bacteria as a GST fusion protein (GST-hSTn) and purified with glutathione Sepharose 4B matrix (Amersham Biosciences).
  • Purified human recombinant N-terminal peptide of Saratan (hSTn) protein was analysed by SDS-PAGE and visualised by Coomassie blue staining and was shown as a 12 kDa band as indicated by arrow.
  • GST-hSTn fusion protein is also indicated.
  • Molecular mass markers are indicated in kDa by bars on the left.
  • Fig. 12 Characterization of antiserum against synthesized N-terminal Saratan peptide. Synthesized N-terminal Saratan peptide and the recombinant protein were separated by SDS-PAGE and immunoblotted by polyclonal antibody against the synthesized N-terminal Saratan peptide by Western blot. Molecular mass markers are indicated by bars in kDa on the left.
  • Figs. 13A-H Immunofluorescence staining of Saratan expression in MCF-7 cells.
  • Cells were transfected with EGFP-tagged Saratan expressing plasmid pEGFP-Nl-hST ⁇ right column) or empty pEGFP-Nl vector plasmid ⁇ left column).
  • 24 h after transfection cells were fixed and Saratan expression was detected with the rabbit polyclonal antibody against Saratan by indirect immunofluorescence staining with tetramethyl Rhodamine isothiocyanate (TRITC) conjugated secondary antibody.
  • TRITC tetramethyl Rhodamine isothiocyanate
  • Fig. 14 Rabbit polyclonal antibodies against Saratan significantly inhibit the growth of MCF-7 cells. MCF-7 cells were seeded into 96 wells microplates without
  • Figs. 15A-B Rabbit anti-Saratan polyclonal antibodies significantly impair migration and invasion of mammalian carcinoma MCF- 7 cells.
  • Fig. 15A Cell migration assay. Cells in serum-free media containing affinity purified rabbit anti- Saratan antibodies (Antiserum) or the preimmune serum as the control (Preimmune) at a
  • FIG. 15 microscope after staining with Hoechst 33258. Representative fields of cells which had migrated to the bottom side of the Transwell filters are presented on the right.
  • FIG. 15B Cell invasion assay. Same as the cell migration assay except that the upper side of the filters was coated with a layer of Matrigel. Representative fields of cells which had invaded to the bottom side of the Transwell filters are presented on the right. All
  • Fig. 16 Expression of Saratan in MDA-231 mammary carcinoma cells. Total RNA was isolated from the MDA-231 cells. The expression of Saratan was detected by RT- 25. PCR with hST-F4 and hST-R4 primers using One-step RT-PCR kit (Qiagen). The specific band amplified is indicated by arrow. M, 1 kb plus DNA ladder; hST, human Saratan.
  • Figs. 17A-H Immunofluorescence staining of Saratan expression in MDA-231
  • Figs. 18A-B Rabbit anti-Saratan polyclonal antibody significantly impaired migration and invasion of mammalian carcinoma MDA-231 cells.
  • Fig. 18A Cell migration assay. Cells in serum-free media containing affinity purified rabbit anti- Saratan antibodies (Antiserum) or the preimmune serum as the control (Preimmune) at a concentration of 600 ⁇ g/ml were loaded into the upper chambers of non-coated 8 ⁇ m pore size Transwell inserts. These were placed into lower chambers with full media containing 10% FBS. The loaded chambers were incubated for 24h.
  • Cells in the upper chamber were removed with cotton swabs and those that had migrated to the lower surface of the inner chamber were identified under a UV-visible fluorescence microscope after staining with Hoechst 33258. Representative fields of cells migrated to the bottom side of the Transwell filters were presented on the right.
  • Fig. 18B Cell invasion assay. The same as the cell migration assay except that the upper side of the filters was coated with a layer of Matrigel. Representative fields of cells invaded to the bottom side of the Transwell filters were presented on the right. All numerical data presented are the means ⁇ standard deviation (SD) of triplicates. **, p ⁇ 0.01; ***, pO.001.
  • Figs. 19A-F Saratan amino acid and nucleotide sequence information.
  • the derived amino acid sequence of Saratan protein is presented in single letter code.
  • the predicted transmembrane domain for Saratan is depicted in bold, with underlining.
  • Fig. 19B The nucleotide sequence of Saratan cDNA is shown (GenBank Ace. No. NM_020215).
  • the Saratan coding region extends from nucleotides 161 to 412, with both the start (ATG) and stop (TGA) codons shown in bold.
  • Fig. 19C Schematic diagram of alternatively spliced mRNA isoforms of human Saratan. Exons are shown in solid bars with coding regions representing by bars shaded in red and non- coding regions in yellow. Introns are shown by lines and their sizes are indicated above.
  • GenBank accession numbers of representative EST clones of each transcript are shown in brackets. (Adapted from NCBI Ace View for Homo sapiens gene C14orfl32
  • FIG. 19G Saratan fusion proteins and fragments described in the Examples, below.
  • FIG. 19H Saratan RNA sequences.
  • FIG. 191 Nucleotide sequence of human Saratan transcript a rnRNA deduced from the cloned cDNA of Saratan (GenBank Accession number NM_020215). The initiation codon AUG and the termination codon UGA are underlined and in bold. Polyadenylation signals, AAUAAA and AUUAAA are also underlined and in italics. * indicates the possible position of poly(A) tails.
  • FIG. 19J Nucleotide sequence of human Saratan transcript b rnRNA.
  • initiation codon AUG and the termination codon UGA are underlined and in bold. Polyadenylation signals, AAUAAA and AUUAAA are also underlined and in italics. * indicates the possible position of poly(A) tails.
  • Fig. 19K Nucleotide sequence of human Saratan Transcript c rnRNA. The initiation codon AUG and the termination codon UGA are underlined and in bold. Polyadenylation signals, AAUAAA and AUUAAA are also underlined and in italics. * indicates the possible position of poly(A) tails.
  • Fig. 19L Nucleotide sequence of human Saratan transcript d rnRNA. The initiation codon AUG and the termination codon UGA are underlined and in bold. Polyadenylation signals, AAUAAA and AUUAAA are also underlined and in italics. * indicates the possible position of poly(A) tails.
  • Figs. 20A-D The mouse homolog of human Saratan.
  • Fig. 20A The cDNA sequence of mouse Saratan as predicted (GenBank accession number XM_001476158). The initiation codon ATG and the termination codon TGA are underlined and in bold.
  • Fig. 20B cDNA sequence alignment of human (NM_020215) and mouse (XM_001476158) Saratan by Blast 2 sequence program.
  • Fig. 20C The amino acid sequence of mouse Saratan.
  • Fig. 20D The protein sequence alignment of human and mouse Saratan.
  • antibody should be understood in the broadest possible sense and is intended to include intact monoclonal antibodies and polyclonal antibodies. It is also intended to cover fragments and derivatives of antibodies so long as they exhibit the desired biological activity.
  • Antibodies encompass immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen. These include, but are not limited to, polyclonal, monoclonal, chimeric, single chain, Fc, Fab, Fab', and Fab 2 fragments, and a Fab expression library.
  • Antibody molecules relate to any of the classes IgG, IgM, IgA 5 IgE, and IgD, which differ from one another by the nature of heavy chain present in the molecule. These include subclasses as well, such as IgGl, IgG2, and others.
  • the light chain may be a kappa chain or a lambda chain.
  • Reference herein to antibodies includes a reference to all classes, subclasses, and types. Also included are chimeric antibodies, for example, monoclonal antibodies or fragments thereof that are specific to more than one source, e.g., a mouse or human sequence. Further included are camelid antibodies or nanobodies. It will be understood that each reference to "antibodies” or any like term, herein includes intact antibodies, as well as any fragments, derivatives, or variants thereof.
  • altered polynucleotides include those with deletions, insertions, or substitutions of different nucleotides resulting in polynucleotides that encode the same or functionally equivalent.
  • the encoded polypeptides may also be “altered” and contain deletions, insertions, or substitutions of amino acid residues which produce a silent change and result in functionally equivalent sequences. Deliberate amino acid substitutions may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues as long as at least one biological activity (e.g., stimulation of cell proliferation, cell survival, or cell motility) or immunogenic activity of the polypeptide is retained.
  • biological activity e.g., stimulation of cell proliferation, cell survival, or cell motility
  • immunogenic activity of the polypeptide is retained.
  • negatively charged amino acids may include aspartic acid and glutamic acid; positively charged amino acids may include lysine and arginine; and amino acids with uncharged polar head groups having similar hydrophilicity values may include leucine, isoleucine, and valine, glycine and alanine, asparagine and glutamine, serine and threonine, and phenylalanine and tyrosine.
  • Guidance in making substitutions and/or deletions or additions can be obtained, for example, by sequence comparisons to homologues, orthologues, or paralogues, as shown in the figures, herein. Of particular note are the homologous sequences shown herein as SEQ ID NO:4, 7, 107, 110, 114, 116, 117, and 119.
  • cancer and “cancerous” refer to a physiological condition in mammals that is typically characterized by abnormal or unregulated cell proliferation, cell survival, and/or cell motility. Cancer and cancer pathology can be associated, for example, with metastasis, interference with the normal functioning of neighbouring cells, release of cytokines or other secretory products at abnormal levels, suppression or aggravation of inflammatory or immunological response, neoplasia, premalignancy, malignancy, invasion of surrounding or distant tissues or organs, such as lymph nodes, etc.
  • breast cancers which can include epithelial tumours, nonepithelial tumours, carcinomas, for example, carcinomas in situ, as well as invasive breast cancers. Also included are colon cancers, lung cancers, prostate cancers, endometrial cancers, and stomach cancers, among others.
  • complementarity refers to the natural binding of polynucleotides under permissive salt and temperature conditions by base- pairing.
  • the complementary sequence is T-C-A
  • the reverse complement is A-C-T
  • the reverse sequence is T-G-A.
  • Complementarity between two single stranded molecules may be partial, in which only some of the nucleic acids bind, or it may be complete when total complementarity exists between the single stranded molecules.
  • the degree of complementarity between nucleic acid strands has significant effects on the efficiency and strength of hybridization between nucleic acid strands. This is of particular importance in amplification reactions, which depend upon binding between nucleic acids strands and in the design and use of iRNAs and PNAs.
  • a polynucleotide derivative refers to the chemical modification of a polynucleotide, or a polynucleotide complementary thereto. Such modifications include, for example, replacement of hydrogen by an alkyl, acyl, or amino group.
  • a polynucleotide derivative encodes a polypeptide which retains the biological or immunological function of the natural molecule.
  • a derivative polypeptide is one which is modified by glycosylation, pegylation, or any similar process which retains one or more biological functions (e.g.,, stimulation of cell proliferation, cell survival, or cell motility) or immunogenic function of the sequence from which it was derived.
  • hybrid and recombinant antibodies include, for example, hybrid and recombinant antibodies.
  • hybrid and recombinant versions of an antibody include, for example, humanised antibodies, diabodies, triabodies, and single chain antibodies.
  • expression includes production of polynucleotides and polypeptides, in particular, the production of RNA (e.g., mRNA) from a gene or portion of a gene, and includes the production of a polypeptide encoded by an RNA or gene or portion of a gene, and the appearance of a detectable material associated with expression.
  • RNA e.g., mRNA
  • the formation of a complex for example, from a polypeptide-polypeptide interaction, polypeptide-nucleotide interaction, or the like, is included within the scope of the term "expression”.
  • binding of a binding ligand such as a hybridization probe or antibody
  • a binding ligand such as a hybridization probe or antibody
  • a gene or other polynucleotide or oligonucleotide, a polypeptide or a protein fragment and the visualization of the binding ligand.
  • a binding ligand such as a hybridization probe or antibody
  • a hybridization blot such as a Northern blot
  • an immunoblot such as a Western blot
  • bead array or by PCR analysis
  • “Inhibition” or “inhibiting” Saratan is intended to refer to blocking or reducing biological activity and/or levels of Saratan. While it may be desirable to completely inhibit the activity of Saratan, this need not be essential. “Inhibition” of Saratan may occur at the level of expression and production of Saratan (e.g., transcriptional or translational levels) or by targeting Saratan function, for example.
  • the terms “inhibit” or “inhibition” of Saratan refer to a decrease, for example, hi DNA levels (e.g., decreased DNA synthesis, increased turnover, and/or decreased stability), RNA levels (e.g., decreased transcription, increased turnover, and/or decreased stability), or polypeptide levels (e.g., decreased translation, increased turnover, and/or decreased stability) or activity, or post-translational modification.
  • An inhibitor can also decrease or block the activities or expression levels of downstream or upstream agents in the Saratan pathway. While the invention is generally directed to Saratan inhibitors, hi some circumstances, there may be beneficial aspects in maintaining or increasing Saratan levels.
  • the disclosed polynucleotides and polypeptides can also be used for such purposes, in accordance with well-known methods.
  • modified refers to altered sequences and to sequence fragments, variants, and derivatives, as described herein.
  • the term includes polypeptides, polynucleotides, antibodies, and like agents according to the present disclosure.
  • the modified sequences of the invention retain at least one biological activity (e.g., effect on cell proliferation, cell survival, or cell motility) or binding or immunogenic function. Such modifications can be termed “functional” as noted herein.
  • oligonucleotide refers to a polynucleotide, typically a probe or primer, including, without limitation, single stranded DNAs, single or double stranded RNAs, RNA:DNA hybrids, and double stranded DNAs. Oligonucleotides, such as single stranded DNA probe oligonucleotides, are often synthesized by chemical methods, for example using automated oligonucleotide synthesizers that are commercially available, or by a variety of other methods, including in vitro expression systems, recombinant techniques, and expression in cells and organisms.
  • patient or “subject” includes human and non-human animals.
  • Non-human animals include, but are not limited to, birds and mammals, in particular, mice, rabbits, cats, dogs, pigs, sheep, goats, cows, and horses.
  • pharmaceutically acceptable diluents, carriers, and/or excipients is intended to include substances that are useful in preparing a pharmaceutical composition, and may be co-administered with an agent in accordance with the invention while allowing same to perform its intended function. These are generally safe, non-toxic, and neither biologically nor otherwise undesirable.
  • pharmaceutically acceptable diluents, carriers, and/or excipients include solutions, solvents, dispersion media, delay agents, emulsions, and the like. Diluents, carriers, and/or excipients may contain minor amounts of additives such as substances that enhance isotonicity and chemical stability.
  • Polynucleotide (e.g., “Saratan,” which can be used to discuss a polynucleotide) when used in the singular or plural, generally refers to any nucleic acid sequence, e.g., any polyribonucleotide or polydeoxribonucle ⁇ tide, which may be unmodified RNA or DNA or modified RNA or DNA. This includes, without limitation, single and double stranded DNA, DNA including single and double- stranded regions, single and double stranded RNA, and RNA including single and double stranded regions, hybrid molecules comprising DNA and RNA that may be single stranded or, more typically, double stranded or include single and double stranded regions.
  • triple-stranded regions comprising RNA or DNA or both RNA and DNA.
  • mRNAs, cDNAs, and genomic DNAs and any fragments thereof.
  • the term includes DNAs and RNAs that contain one or more modified bases, such as tritiated bases, or unusual bases, such as inosine.
  • the polynucleotides of the invention can encompass coding or non-coding sequences, or sense or antisense sequences, or iRNAs such as siRNAs. It will be understood that each reference to a "polynucleotide” or like term, herein, will include the full length sequences as well as any fragments, derivatives, or variants thereof.
  • any reference to a "polynucleotide” (or “oligonucleotide,” or “probe,” or “primer,” etc.) having a particular SEQ ID NO. will encompass both the DNA and the counterpart RNA sequences.
  • SEQ ID NO: 74 corresponds to SEQ ID NO: 15;
  • SEQ ID NO: 75 corresponds to SEQ ID NO: 16;
  • SEQ ID NO: 76 corresponds to SEQ ID NO: 19;
  • SEQ ID NO: 77 corresponds to SEQ ID NO: 22;
  • SEQ ID NO: 78 corresponds to SEQ ID NO: 25;
  • SEQ ID NO: 79 corresponds to SEQ ID NO: 26;
  • SEQ ID NO: 80 corresponds to SEQ ID NO: 27;
  • SEQ ID NO: 81 corresponds to SEQ ID NO: 28;
  • SEQ ID NO: 82 corresponds to SEQ ID NO: 29;
  • SEQ ID NO: 83 corresponds to SEQ ID NO: 30;
  • SEQ ID NO: 84 corresponds to SEQ ID NO: 31;
  • SEQ ID NO: 85 corresponds to SEQ ID NO: 32;
  • SEQ ID NO: 86 corresponds to SEQ ID NO: 33;
  • SEQ ID NO: 87 corresponds to
  • Polypeptide refers to an oligopeptide, peptide, or protein, or fragment thereof, and to naturally occurring, recombinant, synthetic, or semi-synthetic molecules.
  • polypeptide is recited herein to refer to an amino acid sequence of a naturally occurring protein molecule, "polypeptide” and like terms, are not meant to limit the amino acid sequence to the complete, native amino acid sequence for the full length molecule. It will be understood that each reference to a “polypeptide” or like term, herein, will include the full length sequence, as well as any fragments, derivatives, or variants thereof.
  • SEQ ID NO: as referred to herein, can indicate each sequence identifier individually, or any combination thereof, or all such sequence identifiers.
  • substantially purified refers to nucleic or amino acid sequences that are removed from their cellular, recombinant, or synthetic environment, and are at least 60% free, preferably 75% free, and most preferably at least 90% free or at least 99% free from other components with which they are associated in their environment.
  • isolated polynucleotides and polypeptides have been identified and separated from at least one contaminant nucleic acid molecule with which they are associated in their natural state. Accordingly, it will be understood that isolated polynucleotides and polypeptides are in a form which differs from the form or setting in which they are found in nature. It will further be appreciated that “isolated” does not necessarily reflect the exact extent (e.g., a specific percentage) to which the sequence has been purified.
  • Treatment refers to methods and compositions to prevent, cure, or ameliorate a medical disorder (e.g., medical disease, condition, or syndrome), or reduce at least a symptom of such disorder.
  • this includes methods and compositions to prevent or delay onset of a medical disorder; to cure, correct, reduce, slow, or ameliorate the physical or developmental effects of a disorder; and/or to prevent, end, reduce, or ameliorate the pain or suffering caused the disorder.
  • treatment is to be considered in its broadest context. The term does not necessarily imply that the subject is treated until total recovery.
  • treatment broadly includes inhibiting, reducing or preventing cell proliferation, cell survival, and/or cell motility; ameliorating the symptoms or severity of cell proliferation, cell survival, and/or cell motility; or preventing or otherwise reducing the risk of developing cell proliferation, cell survival, and/or cell motility, for example cancer, and in particular, breast cancer, colon cancer, lung cancer, prostate cancer, endometrial cancer, and stomach cancer, among others.
  • a “variant" of polypeptide refers to an amino acid sequence that is altered by one or more amino acids.
  • a variant antibody is altered by one or more amino acids.
  • a variant polynucleotide is altered by one or more nucleotides.
  • a variant may result in "conservative" changes, wherein a substituted amino acid has similar structural or chemical properties, e.g., replacement of leucine with isoleucine. More rarely, a variant may result in "nonconservative" changes, e.g., replacement of a glycine with a tryptophan.
  • Analogous minor variations may also include amino acid deletions or insertions, or both.
  • the invention also encompasses variants which retain at least one biological activity (e.g., effect on cell proliferation, cell survival, or cell motility) or immunogenic function.
  • a preferred variant is one having at least 80%, and more preferably at least 90%, sequence identity to a disclosed sequence.
  • a most preferred variant is one having at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to a sequence disclosed herein.
  • the percentage identity is determined by aligning the two sequences to be compared as described below, determinmg the number of identical residues in the aligned portion, dividing that number by the total number of residues in the inventive (queried) sequence, and multiplying the result by 100.
  • a useful alignment program is AlignX (Vector NTI).
  • Blackwell eds., Blackwell Science Inc., 1987; Gene Transfer Vectors for Mammalian Cells, JAM. Miller & MAP. Calos, eds., 1987; Current Protocols in Molecular Biology, FEM. Ausubel et al., eds., 1987; and PCR: The Polymerase Chain Reaction, Mullis et al., eds., 1994.
  • Saratan comprises a novel amino acid sequence that, to the inventors' knowledge, has not been previously published.
  • the previously predicted sequence for Saratan (GenBank Ace. No. NM_020215) has been suppressed from the database as erroneous.
  • the coding sequence for Saratan was previously calculated by a computer programme to include a 5' untranslated region of 4,219 bp. This prior coding sequence was found to be unsupported by experimental data, and the protein sequence was suppressed by GenBank.
  • the correct open reading frame for Saratan codes for a novel protein of 83 amino acids (Fig. 19A). With the corrected data, the Saratan transcript is predicted as 7.5 kb (Fig.
  • Saratan is predicted to comprise a small protein with theoretical molecular mass of 8.8 kDa. According to the disclosed sequence analysis, the Saratan protein includes a large extracellular region at its N-terminus, followed by a single transmembrane region of 22 amino acids and a relatively short (4 amino acids) cellular region at C-terminus (Fig. 19A).
  • Transcript a is shown in Fig. 19B, and is represented by IMAGE clone 5493356 (GenBank accession number BC043593). The protein it encodes is designated herein as isoform ⁇ .
  • Transcript b is shown in Fig. 19C 5 and is represented by EST clones BM967279, BI791809, BM352639, BI713575, BQ 189729, and BM893938. Transcript b includes an extra intron as compared with transcript a.
  • Transcript c is also shown in Fig. 19C, and is represented by an EST clone DA249054. Transcript c includes an extra exon, in- frame, located in the 4.6 kb intron of transcript a. This exon encodes an additional sequence of 31 amino acids (NKDKSRISPSVCDPREDPELAPGKGCVWPGR; SEQ ID NO: 115). Thus, the full-length protein (designated as isoform ⁇ ) is 114 amino acids (Fig. 19D). Transcript d is shown in Fig. 19C, and is represented by EST clone DAl 14412.
  • Transcript d includes an extra exon situated in the intron of transcript a. However, this exon is not in-frame with the coding region of transcript a, and a downstream start codon is used. Transcript d is therefore predicted to encode a distinct protein (designated isoform ⁇ ) comprising 92 amino acids, with a divergent N-terminal sequence.
  • Saratan is highly or moderately expressed in several cancer cell lines, including cell lines for breast cancer, colon cancer, lung cancer, prostate cancer, endometrial cancer, and stomach cancer (see, Examples).
  • MCF-7 breast cancer cells overexpressing Saratan grow significant faster than control cells stably transfected by the empty vector phCMVl, as shown by total cell number assays over a period of time of 10 days. BrdU incorporation assays showed that the increase in total cell number was the result of increased cell proliferation. Further, this increase in cell proliferation could be effectively reversed by limiting the endogenous expression levels of Saratan using siRNA technology.
  • siRNA reduced the expression of endogenous Saratan, resulting in a reduction in growth rate and inhibition of cell proliferation (see, Examples).
  • Saratan represents an ideal novel target for cancer treatment and diagnosis, particularly for breast cancer.
  • Any reagents that inhibit the biological activity of Saratan can be used to inhibit the proliferation, survival, and/or motility of cancer cells.
  • These reagents can include, for example, chemical compounds (e.g., small molecules), antagonists, antibodies, and iRNAs.
  • diagnostic agents e.g., polynucleotides and antibodies
  • a cancerous condition e.g., cancer onset, progression, or recurrence.
  • Saratan polynucleotides and polypeptides encompasses Saratan polypeptides, including those comprising at least one of SEQ ID NO: 1, 3, 8-10, 49-64, 102-104, and fragments, variants, and derivatives thereof.
  • the invention also encompasses the use of these polypeptides in the diagnosis of cancer, especially breast cancer.
  • the invention further encompasses the use of the polypeptides for preparing antibodies to inhibit the cell proliferation, cell survival, or cell motility of such cells .
  • polypeptides of the present invention comprise at least one sequence selected from the group consisting of: (a) polypeptides comprising at least one amino acid sequence selected from the group consisting of SEQ ID NO:1, 3, 8-10, 49-64, 102-104, or fragments, variants, or derivatives thereof; (b) polypeptides comprising a functional domain of at least one amino acid sequence selected from-the group consisting of SEQ ID NO:1 3, 8-10, 49-64, 102-104, and fragments and variants thereof; and (c) polypeptides comprising at least a specified number of contiguous residues of at least one amino acid sequence selected from the group consisting of SEQ ID NO:1, 3, 8-10, 49-64, 102-104, or variants or derivatives thereof.
  • the invention encompasses an isolated Saratan polypeptide comprising the amino acid sequence of at least one of SEQ ID NO:1, 3, 8-10, 49-64, 102-104. All of these sequences are collectively referred to herein as polypeptides of the invention.
  • polypeptides of the present invention may be expressed and used in various assays to determine their biological activity.
  • the polypeptides may be used for large-scale synthesis and isolation protocols, for example, for commercial production.
  • Such polypeptides may be used to raise antibodies, to isolate corresponding amino acid sequences, and to quantitatively determine levels of the amino acid sequences.
  • the invention encompasses Saratan polynucleotides including those of SEQ ID NO: 14- 24, 25-27, 28-30, 37, 38, 41, 42, 45-48, 65, 66, 68-73, 74-101, 120-122, and fragments, variants, and derivatives thereof.
  • the invention also encompasses the use of these polynucleotides in the diagnosis of cancer, especially breast cancer.
  • the invention further encompasses the use of Saratan polynucleotides for the inhibition of cell proliferation, cell survival, or cell motility of such cells. Accordingly, the invention encompasses the use of these polynucleotides for preparing expression vectors and host cells, and for preparing antisense polynucleotides and iRNAs.
  • the polynucleotides of the present invention comprise at least one sequence selected from the group consisting of: (a) sequences comprising a coding sequence for at least one amino acid sequence selected from the group consisting of SEQ ID NO:1, 3, 8-10, 49-64, 102-104, or fragments, variants, or derivatives thereof; (b) complements, reverse sequences, and reverse complements of a coding sequence for at least one amino acid sequence selected from the group consisting of SEQ ID NO:1, 3, 8-10, 49-64, 102-104, or fragments, variants, or derivatives thereof; (c) open reading frames contained in the coding sequence for at least one amino acid sequence selected from the group consisting of SEQ ID NO:1, 3, 8-10, 49-64, 102-104, or their fragments, variants; or derivatives (d) functional domains of a coding sequence for at least one amino acid sequence selected from the group consisting of SEQ ID NO:1, 3, 8-10, 49-64, 102-104, or fragments, variants
  • the invention encompasses an isolated polynucleotide comprising a coding sequence for at least one amino acid sequence selected from the group consisting of SEQ ID NO:l-3, 5, 6, 8-10, 49-64, 102-104.
  • the invention encompasses an isolated polynucleotide comprising a sequence selected from the group consisting of SEQ ID NO:14-21, 23, 24-48, 49-64, 102-104. Oligonucleotide probes and primers and their variants are also provided. All of these polynucleotides and oligonucleotide probes and primers are collectively referred to herein, as polynucleotides of the invention.
  • the isolated polynucleotides of the present invention also have utility in genome mapping, in physical mapping, and in cloning of genes of more or less related species.
  • Probes designed using the polynucleotides of the present invention may be used to detect the presence and examine the expression patterns of genes in any organism having sufficiently homologous DNA and RNA sequences in their cells, using techniques that are well known in the art, such as slot blot techniques or microarray analysis.
  • Primers designed using the polynucleotides of the present invention may be used for sequencing and PCR amplifications.
  • the polynucleotides of the present invention may also be used as compositions, for example, pharmaceutical compositions.
  • the polynucleotides of the present invention can also be used to provide health benefits. For such benefits, the polynucleotides can be presented as expression vectors or host cells comprising expression vectors.
  • nucleotide sequences encoding the polypeptides of the invention may be produced.
  • the invention contemplates each and every possible variation of nucleotide sequence that could be made by selecting combinations based on possible codon choices. These combinations are made in accordance with the standard triplet genetic code as applied to naturally occurring amino acid sequences, and all such variations are to be considered as being specifically disclosed.
  • Nucleotide sequences which encode the Saratan polypeptides, or their fragments or variants, are preferably capable of hybridizing to the nucleotide sequence of the naturally occurring sequence under appropriately selected conditions of stringency.
  • nucleotide sequences encoding a polypeptide, or its fragment or derivative, possessing a substantially different codon usage may be selected to increase the rate at which expression of the polypeptide occurs in a particular prokaryotic or eukaryotic host in accordance with the frequency with which particular codons are utilized by the host.
  • Codons may be selected to increase the rate at which expression of the polypeptide occurs in a particular prokaryotic or eukaryotic host in accordance with the frequency with which particular codons are utilized by the host.
  • Other reasons for substantially altering the nucleotide sequence encoding polypeptides and its derivatives without altering the encoded amino acid sequences include the production of RNA transcripts having more desirable properties, such as a greater half-life, than transcripts produced from the naturally occurring sequence.
  • the invention also encompasses production of Saratan polynucleotides, or fragments variants, or derivatives thereof, entirely by synthetic chemistry.
  • the synthetic sequence may be inserted into any of the many available expression vectors and cell systems using reagents that are well known in the art.
  • synthetic chemistry may be used to introduce mutations into a sequence encoding a Saratan polypeptide, or any variants, fragments, or derivatives thereof.
  • polynucleotide sequences that are capable of hybridizing to the disclosed nucleotide sequences, and in particular, those shown in SEQ ID NO: 14- 16, 19, 22, under various conditions of stringency as taught in Wahl, G. M. and S. L. Berger (1987; Methods Enzymol. 152:399-407) and Kimmel, A. R. (1987; Methods Enzymol. 152:507-511).
  • Methods for DNA sequencing which are well known and generally available in the art may be used to practice any of the embodiments of the invention.
  • the methods may employ such enzymes as the Klenow fragment of DNA polymerase I, SEQUENASE (U.S. Biochemical Corp, Cleveland, OH), Taq polymerase (Perkin Elmer), thermostable T7 polymerase (Amersham Pharmacia Biotech, Piscataway, NJ), or combinations of polymerases and proofreading exonucleases such as those found in the ELONGASE Amplification System (Life Technologies, Gaithersburg, MD).
  • the process is automated with machines such as the Hamilton Micro Lab 2200 (Hamilton, Reno, NV), Peltier Thermal Cycler (PTC200; MJ Research, Watertown, MA) the ABI Catalyst and 373 and 377 DNA Sequencers (Perkin Elmer), or the Genome Sequencer 20TM (Roche Diagnostics).
  • machines such as the Hamilton Micro Lab 2200 (Hamilton, Reno, NV), Peltier Thermal Cycler (PTC200; MJ Research, Watertown, MA) the ABI Catalyst and 373 and 377 DNA Sequencers (Perkin Elmer), or the Genome Sequencer 20TM (Roche Diagnostics).
  • the nucleic acid sequences encoding the Saratan polypeptides may be extended utilizing a partial nucleotide sequence and employing various methods known in the art to detect upstream sequences such as promoters and regulatory elements.
  • one method which may be employed, "restriction-site" PCR uses universal primers to retrieve unknown sequence adjacent to a known locus (Sarkar, G. (1993) PCR Methods Applic. 2:318-322).
  • genomic DNA is first amplified in the presence of primer to a linker sequence and a primer specific to the known region.
  • the amplified sequences are then subjected to a second round of PCR with the same linker primer and another specific primer internal to the first one.
  • Products of each round of PCR are transcribed with an appropriate RNA polymerase and sequenced using reverse transcriptase.
  • Capillary electrophoresis systems which are commercially available may be used to analyze the size or confirm the nucleotide sequence of sequencing or PCR products.
  • capillary sequencing may employ flowable polymers for electrophoretic separation, four different fluorescent dyes (one for each nucleotide), which are laser activated, and detection of the emitted wavelengths by a charge coupled device camera.
  • Output/light intensity may be converted to electrical signal using, appropriate software (e.g., GENOTYPER and Sequence NAVIGATOR, Perkin Elmer) and the entire process from loading of samples to computer analysis and electronic data display may be computer controlled.
  • Capillary electrophoresis is especially preferable for the sequencing of small pieces of DNA which might be present hi limited amounts in a particular sample.
  • Saratan polynucleotides or fragments thereof which encode polypeptides may be used hi recombinant DNA molecules to direct expression of the polypeptides, or fragments or variants thereof, in appropriate host cells. Due to the inherent degeneracy of the genetic code, other DNA sequences which encode substantially the same or a functionally equivalent amnio acid sequence may be produced, and these sequences may be used to clone and express Saratan polypeptides.
  • nucleotide sequences of the present invention can be engineered using methods generally known in the art hi order to alter amino acid encoding sequences for a variety of reasons, including but not limited to, alterations which modify the cloning, processing, and/or expression of the gene product DNA shuffling by random fragmentation and PCR reassembly of gene fragments and synthetic oligonucleotides may be used to engineer the nucleotide sequences. For example, site-directed mutagenesis may be used to insert new restriction sites, alter glycosylation patterns, change codon preference, introduce mutations, and so forth.
  • a natural, modified, or recombinant nucleic acid sequence encoding a polypeptide may be ligated to a heterologous sequence to encode a fusion protein.
  • a fusion protein may also be engineered to contain a cleavage site located between the polypeptide of the invention and the heterologous protein sequence, so that the polypeptide may be cleaved and purified away from the heterologous moiety.
  • sequences encoding polypeptides may be synthesized, in whole or in part, using chemical methods well known in the art (see Caruthers, M. H. et al. (1980) Nucl. Acids Res. Symp. Ser. 215-223, Horn, T. et al. (1980) Nucl. Acids Res. Symp. Ser. 225-232).
  • the polypeptide itself may be produced using chemical methods to synthesize the amino acid sequence, or a fragment thereof.
  • polypeptide synthesis can be performed using various solid-phase techniques (Roberge, J. Y. et al. (1995) Science 269:202-204; Merrifield J. (1963) J. Am. Chem. Soc.
  • the newly synthesized polypeptide may be isolated by preparative high performance liquid chromatography (e.g., Creighton, T. (1983) Proteins Structures and Molecular Principles, WH Freeman and Co., New York, NY).
  • the composition of the synthetic polypeptides may be confirmed by amino acid analysis or sequencing (e.g., the Edman degradation procedure; Creighton, supra). Additionally, the amino acid sequence of the polypeptide, or any part thereof, may be altered during direct synthesis and/or combined using chemical methods with sequences from other proteins, or any part thereof, to produce a variant molecule.
  • the nucleotide sequences encoding the polypeptide or functional equivalents may be inserted into appropriate expression vector, e.g., a vector which contains the necessary elements for the transcription and translation of the inserted coding sequence.
  • appropriate expression vector e.g., a vector which contains the necessary elements for the transcription and translation of the inserted coding sequence.
  • Methods which are well known to those skilled in the art may be used to construct expression vectors containing sequences encoding the polypeptide and appropriate transcriptional and translational control elements. These methods include in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination. Such techniques are described in Sambrook, J. et al. (1989) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press, Plainview, NY; also, Sambrook, J. et al. (2000) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press, Plainview, NY; and Ausubel, F. M. et al. (1989) Current Protocols in
  • a variety of expression vector/host systems may be utilized to contain and express sequences encoding the polypeptides of the invention. These include, but are not limited to, microorganisms such as bacteria transformed with recombinant phage, plasmid, or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected with virus expression vectors (e.g., baculovirus); plant cell systems transformed with virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or with bacterial expression vectors (e.g., Ti or pBR322 plasmids); or animal cell systems.
  • microorganisms such as bacteria transformed with recombinant phage, plasmid, or cosmid DNA expression vectors
  • yeast transformed with yeast expression vectors insect cell systems infected with virus expression vectors (e.g., baculovirus)
  • plant cell systems transformed with virus expression vectors e.g., cauliflower mosaic virus, CaMV; tobacco mosaic
  • useful plasmids include pET, pRSET, pTrcHis2, and pBAD plasmids from Invitrogen, pET and pCDF plasmids from Novagen, and DirectorTM plasmids from Sigma-Aldrich.
  • E. coli can be used with the expression vector pET.
  • the invention is not limited by the expression vector or host cell employed.
  • control elements are those non-translated regions (e.g., enhancers, promoters, 5' and 3' untranslated regions) which interact with host cellular proteins to carry out transcription and translation. Such elements may vary in their strength and specificity. Depending on the vector system and host utilized, any number of suitable transcription and translation elements, including constitutive and inducible promoters, may be used. For example, when cloning in bacterial systems, inducible promoters such as the hybrid lacZ promoter of the BLUESCRIPT phagemid
  • baculovirus polyhedrin promoter may be used in insect cells. Promoters or enhancers derived from the genomes of plant cells (e.g., heat shock, RUBISCO, and storage protein genes) or from plant viruses (e.g., viral promoters or leader sequences) may be cloned into the vector.
  • a number of expression vectors may be selected depending upon the use intended for the polypeptide. For example, when large quantities of polypeptide are needed, vectors which direct high level expression of fusion proteins that are readily purified may be used.
  • vectors include, but are not limited to, the multifunctional E. coli cloning and expression vectors such as BLUESCRIPT (Stratagene), in which the sequence encoding a polypeptide may be ligated into the vector in frame with sequences for the ammo-terminal Met and the subsequent 7 residues of ⁇ -galactosidase so that a hybrid protein is produced; pIN vectors (Van Heeke, G. and S. M. Schuster (1989) J.
  • pGEX vectors may also be used to express the polypeptides as fusion proteins with glutathione S-transferase (GST).
  • GST glutathione S-transferase
  • fusion proteins are soluble and can easily be purified from lysed cells by adsorption to glutathione- agarose beads followed by elution in the presence of free glutathione.
  • Proteins made in such systems may be designed to include heparin, thrombin, or factor Xa protease cleavage sites so that the cloned polypeptide of interest can be released from the GST moiety at will.
  • yeast Saccharomyces cerevisiae
  • a number of vectors containing constitutive or inducible promoters such as alpha factor, alcohol oxidase, and PGH may be used.
  • constitutive or inducible promoters such as alpha factor, alcohol oxidase, and PGH.
  • Specific initiation signals may also be used to achieve more efficient translation of sequences encoding the polypeptides of the invention. Such signals include the ATG initiation codon and adjacent sequences. In cases where sequences encoding a polypeptide, its initiation codon, and upstream sequences are inserted into the appropriate expression vector, no additional transcriptional or translational control signals may be needed. However, in cases where only coding sequence, or a fragment thereof, is inserted, exogenous translational control signals including the ATG initiation codon should be provided. Furthermore, the initiation codon should be in the correct reading frame to ensure translation of the entire insert. Exogenous translational elements and initiation codons may be of various origins, both natural and synthetic. The efficiency of expression may be enhanced by the inclusion of enhancers which are appropriate for the particular cell system which is used, such as those described in the literature (Scharf, D. et al. (1994) Results Probl. Cell Differ. 20:125-162).
  • a host cell may be chosen for its ability to modulate the expression of the inserted sequences or to process the expressed polypeptide in the desired fashion.
  • modifications of the sequence include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation, and acylation.
  • Post-translational processing which cleaves a "prepro" form of the polypeptide may also be used to facilitate correct insertion, folding, and/or function.
  • Different host cells which have specific cellular machinery and characteristic mechanisms for post-translational activities are available from the American Type Culture Collection (ATCC; Bethesda, MD) and may be chosen to ensure the correct modification and processing of the sequence.
  • ATCC American Type Culture Collection
  • Specific host cells include, but are not limited to, Rhodotorula, Aureobasidium, Saccharomyces, Sporobolomyces, Pseudomonas, Erwinia and Flavobacterium; or such other organisms as Escherichia, Lactobacillus, Bacillus, Streptomyces, and the like.
  • Particular host cells include Escherichia coli, which is particularly suited for use with the present invention, Saccharomyces cerevisiae, Bacillus thuringiensis, Bacillus subtilis, Streptomyces lividans, and the like.
  • nucleic acids there are several techniques for introducing nucleic acids into eukaryotic cells cultured in vitro. These include chemical methods (Feigner et al., Proc. Natl. Acad. ScL, USA, 84:7413 7417 (1987); Bothwell et al., Methods for Cloning and Analysis of Eukaryotic Genes, Eds., Jones and Bartlett Publishers Inc., Boston, Mass. (1990), Ausubel et al., Short Protocols in Molecular Biology, John Wiley and Sons, New York, NY (1992); and Farhood, Annal. NY Acad.
  • a variety of protocols for detecting and measuring the expression of the polypeptides of the invention, using either polyclonal or monoclonal antibodies specific for the protein are known in the art. Examples include enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), and fluorescence activated cell sorting (FACS).
  • ELISA enzyme-linked immunosorbent assay
  • RIA radioimmunoassay
  • FACS fluorescence activated cell sorting
  • a two-site, monoclonal-based immunoassay can be used with monoclonal antibodies reactive to two non-interfering epitopes on the polypeptide, but a competitive binding assay can also be used. These and other assays are described, among other places, in Hampton, R. et al. (1990; Serological Methods, a laboratory Manual, APS Press, St Paul, MN) and Maddox, D. E. et al. (1983; J. Exp. Med. 158:1211-1216).
  • Means for producing labeled hybridization or PCR probes for detecting sequences related to polynucleotides include oligolabeling, nick translation, end-labeling or PCR amplification using a labeled nucleotide.
  • sequences encoding the polypeptides, or any fragments or variants thereof may be cloned into a vector for the production of an mRNA probe.
  • RNA polymerase such as T7, T3, or SP6 and labeled nucleotides. These procedures may be conducted using a variety of commercially available kits Amersham Pharmacia Biotech, Promega, and US Biochemical.
  • Suitable reporter molecules or labels which may be used for ease of detection, include radionuclides, enzymes, fluorescent, chemiluminescent, or chromogenic agents as well as substrates, cofactors, inhibitors, magnetic particles, and the like.
  • Expression vectors or host cells transformed with expression vectors may be cultured under conditions suitable for the expression and recovery of the polypeptide from culture.
  • the culture can comprise components for in vitro or in vivo expression.
  • In vitro expression components include those for rabbit reticulocyte lysates, E. coli lysates, and wheat germ extracts, for example, ExpresswayTM or RiPs systems from Invitrogen,
  • polypeptide produced from culture may be secreted or contained intracellularly depending on the sequence and/or the vector used.
  • expression vectors which encode a phage polypeptide can be designed to contain signal sequences which direct secretion of the polypeptide through a prokaryotic or eukaryotic cell membrane.
  • constructs may include an amino acid domain which will facilitate purification of the polypeptide.
  • domains include, but are not limited to, metal chelating peptides such as histidine-tryptophan (e.g., 6*-HIS) modules that allow purification on immobilized metals, protein A domains that allow purification on immobilized immunoglobulin, and the domain utilized in the FLAG ® extension/affinity purification system (Immunex Corp., Seattle, WA).
  • Useful epitope tags include 3X-FLAG ® , HA, VSV-G, V5, HSV, GST, GFP, MBP, GAL4, and ⁇ -galactosidase.
  • Useful plasmids include those comprising a biotin tag (e.g., PinPointTM plasmids from Promega), calmodulin binding protein (e.g., pCAL plasmids from Stratagene), streptavidin binding peptide (e.g., InterPlayTM plasmids from Stratagene), a c-myc or FLAG ® tag (e.g., hnmunoprecipitation plasmids from Sigma-Aldrich), or a histidine tag (e.g.,
  • expression vectors can include a cleavable linker sequences such as those specific for Factor Xa or enterokinase (Invitrogen, San Diego, CA).
  • the vector can include one or more linkers between the purification domain and the polypeptide.
  • One such expression vector provides for expression of a fusion protein comprising a polypeptide of the invention and a nucleic acid encoding 6 histidine residues preceding a thioredoxin or an enterokinase cleavage site. The histidine residues facilitate purification on IMAC (immobilized metal ion affinity chromatography as described in Porath, J. et al.
  • polynucleotides for inhibition of Saratan may be utilised to inhibit Saratan in accordance with the invention.
  • Such polynucleotides may be DNA, RNA, single stranded, or double stranded.
  • Polynucleotides for use with the invention may be referred to herein as "isolated" polynucleotides.
  • Isolated Saratan polynucleotides may be obtained using a number of techniques known in the art. For example, recombinant DNA technology may be used as described for example in Sambrook, J. et al.
  • Polynucleotides may be designed on the basis of the disclosed Saratan nucleic acid sequence data, the known relative interactions between nucleotide bases, known sequence homology, and the particular nucleic acid technology to be employed, as may be exemplified herein after.
  • interfering RNAs may be utilised to inhibit Saratan.
  • Polynucleotides of use in iRNA techniques will typically have 100% complementarity to their target. However, it should be appreciated that this need not be the case, provided the iRNA retains specificity for its target and the ability to block translation.
  • Exemplary iRNA molecules may be in the form of ⁇ 18 to 21 bp double stranded RNAs with 3' dinucleotide overhangs, although shorter or longer molecules may be appropriate.
  • the iRNA In cases where the iRNA is produced in vivo by an appropriate nucleic acid vector, it will typically take the form of an RNA molecule having a stem- loop structure, for example, an approximately 19 nucleotide stem and a 9 nucleotide loop with 2-3 Us at the 3' end.
  • Algorithms of use in designing siRNA are available from Cenix (Dresden, Germany, via Ambion, TX).
  • siRNA molecules can include the following sequences:
  • Target sequence 1 5'- " AAATAATCACTCGTGTGACTT -3' SEQ ID NO: 16
  • Sense siRNA strand 5'- AUAAUCACUCG ⁇ GUGACUUtt - SEQ ID NO: 17
  • Antisense strand 3' SEQ ID NO: 18
  • Target sequence 2 5'- AATTACAAGAAAGCTGGACTT -3' SEQ ID NO: 19
  • Sense siRNA strand 5'- ⁇ ACAAGAAAGCUGGAC ⁇ tt - SEQ ID NO: 20
  • Antisense strand 3' SEQ ID NO: 21
  • Target sequence 3 5'- AAGAGCAACTTACTGCTTTGT -3' SEQ ID NO: 22
  • Sense siRNA strand 5'- GAGCAACUUACDGCUUUGUtt - SEQ ID NO: 23
  • Antisense strand 3' SEQ ID NO: 24 "
  • Exemplary iRNA molecules can include the structures described as follows.
  • the iRNA comprises a nucleotide sequence selected from the group consisting of:
  • the iRNA comprises a nucleotide sequence selected from the group consisting of:
  • the iRNA comprises a nucleotide sequence selected from the group consisting of:
  • X indicates any number of additional nucleotides which may be present; for example termination signals and restriction sites which may be of use in cloning and expressing the iRNA.
  • nucleic acids may be used to clone and express, in desired vectors, the iRNAs of use in the invention: BamBX Hind
  • iRNA molecules can be produced in accordance with techniques described within the section entitled “Examples” herein. Further information regarding how to produce and design such molecules can be gained, for example, from: McManus MT and Sharp PA
  • siRNA refers to short/small interfering RNA 5 which comprises double-stranded RNA 3 typically including 21 to 23 base pairs, which can be chemically synthesized.
  • shRNA refers to short hairpin RNA, also called vector based siRNA, which comprises single strand RNA, for example, transcribed in vitro or in vivo.
  • shRNA includes a sequence homologous to the target mRNA (sense sequence), a "loop" region and a sequence complementary to the target sequence (anti-sense sequence).
  • the shRNA forms a hairpin secondary structure, and an enzyme dicer cleaves the structure, removes the hairpin, and converts it into siRNA.
  • the sequences disclosed herein can be used to produce shRNAs, and then converted to siRNAs, as desired.
  • an antisense molecule is used.
  • the term "antisense” should be taken broadly. It is intended to mean any nucleic acid (preferably RNA 5 but including single stranded DNA) capable of binding to Saratan transcript.
  • antisense molecules or oligonucleotides comprise about 15 to 25 nucleotides which are completely complementary to their target mRNA.
  • larger antisense oligonucleotides can be used including full length sequences.
  • antisense molecules which are not completely complementary to their targets may be utilised provided they retain specificity for their target and the ability to inhibit expression.
  • antisense molecules of use in the invention having regard to the description provided herein, and available Saratan sequence data. Further information regarding antisense technology can be gained, for example, from: Kandimalla ER, Manning A, Lathan C, Byrn RA, Agrawal S. Design, biochemical, biophysical and biological properties of cooperative antisense oligonucleotides; Nucleic Acids Res. 1995 Sep 11;23(17):3578- 84; Tseng BY, Brown KD. Antisense oligonucleotide technology in the development of cancer therapeutics; Cancer Gene Ther. 1994 Mar;l(l):65-71; Brysch W, Schlingensiepen KH.
  • DNAzymes, single stranded DNA, ribozymes, and triple helix DNA may also be of use in inhibiting Saratan in accordance with the invention.
  • Ribozymes, DNAzymes, triple helix, and single stranded DNA may be readily appreciated by persons of general skill in the art to which the invention relates having regard to the description provided herein, available Saratan sequence data and current methodologies. However, by way of example methodology associated with these technologies is described in Joseph Sambrook and David W. Russell. Molecular Cloning: A Laboratory Manual (Third Edition), Cold Spring Harbor Laboratory Press, NY.
  • Polynucleotides of use in the invention including antisense, iRNA, ribozymes and DNAzymes may be chemically modified to increase stability or prevent degradation or otherwise.
  • the nucleic acid molecules may include analogs with unnatural bases, modified sugars, especially at the 2' position of the ribose, or altered phosphate backbones.
  • Polynucleotides of use in the invention may also include sequences which allow for targeted degradation of any transcript to which they bind. For example, a sequence specific for RNase H, may be included. Another example is the use of External Guide Sequences (EGSs), which may recruit a ribozyme (RNase P) to digest the transcript to which an antisense molecule is bound.
  • EGSs External Guide Sequences
  • RNase P ribozyme
  • Polynucleotides of use in the invention may be used in the form of nucleic acid molecules produced in vitro, for example, single stranded DNA, iRNA, antisense RNA, or DNAzymes. Alternatively, where appropriate, they may be used in the form of a vector adapted to produce appropriate nucleic acids, for example, antisense molecules,
  • RNA 15 iRNA, or ribozymes.
  • the inventors contemplate the use of any vectors as may be known in the art.
  • naked plasmids that employ CMV promoters may be used.
  • Viral vectors may also be suitable, such as adeno-associated virus (AAV) and lentiviruses.
  • AAV adeno-associated virus
  • suitable promoters and viral vectors are provided herein after.
  • One advantage of using such viral vectors is that they may allow for systemic
  • the vectors or constructs of use in the invention may include appropriate genetic elements, such as promoters, enhancers, origins of replication as are known in the art, including inducible, constitutive, or tissue-specific promoters.
  • appropriate genetic elements such as promoters, enhancers, origins of replication as are known in the art, including inducible, constitutive, or tissue-specific promoters.
  • a vector comprises an inducible promoter operably linked to the region coding a nucleic acid of the invention (for example, antisense Saratan or suitable siRNA), such that expression of the nucleic acid is controllable by controlling the presence or absence of the appropriate inducer of transcription.
  • nucleic acid molecules of the invention are flanked by regions that promote homologous recombination at a
  • PNAs are used. PNAs are peptide-nucleic acid hybrids in which the phosphate backbone has been replaced by an achiral and neutral backbone made from N-(2-aminoethyl)-glycine units (see, e.g., Eurekah Bioscience Collection.
  • PNA and Oligonucleotide Inhibitors of Human Telomerase G. Gavory and S. Balasubramanian, Austin Bioscience, 2003.
  • the bases A, G, T, C are attached to the amino nitrogen on the backbone via methylenecarbonyl linkages (P.E. Nielsen et al., Science 1991. 254: 1497-1500; M. Egholm et al., Nature 1993. 365: 566-568).
  • PNAs bind complementary sequences with high specificity, and higher affinity relative to analogous DNA or RNA (M. Egholm et al., supra).
  • PNA/DNA or PNA/RNA hybrids also exhibit higher thermal stability, compared to the corresponding DNA/DNA or DNA/RNA duplexes (M.
  • PNAs also, possess high chemical and biological stability, due to the unnatural amide backbone that is not recognized by nucleases or proteases (V. Demidov et al., Biochem Pharmacol 1994. 48: 1310-1313).
  • PNAs are at least 5 bases in length, and include a terminal lysine. PNAs may be pegylated to further extend their lifespan (Nielsen, P. E. et al. (1993) Anticancer Drug Des. 8:53-63).
  • the following antigene PNAs are provided as complementary to unique sequences in the coding DNA strand of the first exon of the Saratan gene, and are designed to inhibit mRNA synthesis.
  • the invention encompasses Saratan antibodies, for example, antibodies that bind to at least a portion of or a modified sequence thereof, ha certain aspects of the invention, antibodies may be used to inhibit Saratan.
  • a fragment or derivative of an antibody need not act fully as an antibody; that is to say, the fragment or derivative need not be capable of recruiting immune system cells to the site of binding to Saratan in vivo. It is not necessary to produce neutralising antibodies.
  • Those of ordinary skill in the art to which the invention relates will recognise methods to generate antibody fragments. However, by way of general example proteolytic digestion of intact antibodies may be used, or the fragments may be directly produced via recombinant nucleic acid technology.
  • Humanisation of antibodies may be used to reduce the immunogenicity of antibodies generated in other animals.
  • Production of humanised antibodies or humanization of antibodies can be achieved using techniques known in the art, for example in the case of humanisation of murine antibodies by epitope-guided selection.
  • the most frequently used strategies for the humanization of rodent monoclonal antibodies are CDR grafting
  • the resulting antibody molecules may be monospecific or multispecific (e.g., bispecific in the case of diabodies).
  • Such antibody molecules may be created from two or more antibodies using methodology standard in the art to which the invention relates; for example, as described by Todorovska et al. (Design and application of diabodies, triabodies and tetrabodies for cancer targeting. J. Immunol. Methods. 2001 Feb l;248(l-2):47-66).
  • the production of antibodies may be carried out according to standard methodology in the art.
  • the methodology described by Bean Eric S. Bean (2001) Polyclonal Antibodies. In: Basic Methods in Antibody Production and Characterization antibodies. Howard, G, and Bethel D. (ed.), CRC Press, 5:21-50, 2000) may be used.
  • Monoclonal antibodies may be prepared, for example, in accordance with the methodology of Stewart (Sandy J. Stewart (2001) Monoclonal Antibody Production. In: Basic Methods in Antibody Production and Characterization antibodies. Howard, G. and Bethel D. (ed.), CRC Press, 6:51-68, 2000) or in "Monocolonal Antibody Production Techniques and Applications," Lawrence B Schook eds., Marcel Dekker Inc., New York, 1987.
  • Antigenic segments of a polypeptide can be predicted, for example, by Abie Pro 3.0: Peptide Antibody Design (hypertext transfer protocol://world wide web.changbioscience.com/abie/abie.html). More particularly, antigenic segments can be predicted according to the Hopp- Woods scale (Hopp TP, Woods KR. Prediction of protein antigenic determinants from amino acid sequences. Proc Natl Acad Sci U S A. 1981 Jun;78(6):3824-8.) and/or the Kyte and Doolittle scale (Kyte J, Doolittle RF. A simple method for displaying the hydropathic character of a protein. J MoI Biol. 1982
  • Such epitopes may be conformational specific, in that they may include non-contiguous residues, and may constitute various portions of the predicted antigenic sequences (e.g., portions of any one of SEQ ID NO:49-64, see below), or a combination of one or more portions of the predicted antigenic sequences (e.g., combinations of one or more of SEQ ID NO:49-64), or one or more of the full length sequences (e.g., one or more of SEQ ID NO:49-64).
  • Antigenic sequences can comprise any combination of amino acids or their derivatives that would form a similar 3-D structure (e.g., surface residues) as would be encountered in the native polypeptide.
  • sequence analysis shows two highly antigenic sequences, including NVHAAANGQGQPEDPPRSSNDAVL (residues 37-60, SEQ ID NO:49) and
  • FMDSPNEDFSTEYSLF (residues 17-32, SEQ ID NO:50). Fourteen antigenic sequences of 14 amino acids are also included: FMDSPNEDFSTEYS (residues 17-30,
  • DSPNEDFSTEYSLF (residues 19-32, SEQ ID NO:53), NVHAAANGQGQPED (residues 37-50, SEQ ID NO:54), VHAAANGQGQPEDP (residues 38-51, SEQ ID NO:
  • HAAANGQGQPEDPP (residues 39-52, SEQ ID NO:56),
  • AAANGQGQPEDPPR (residues 40-53, SEQ ID NO:57), AANGQGQPEDPPRS
  • NGQGQPEDPPRSSN (residues 43-56, SEQ ID NO:60), GQGQPEDPPRSSND (residues 44-57, SEQ ID NO:61), QGQPEDPPRSSNDA (residues 45-58, SEQ ID NO:
  • GQPEDPPRSSNDAV (residues 46-59, SEQ ID NO:63), and
  • Antibodies of use in the invention may also be produced via standard recombinant techniques and as described for example by Welschof et al. (Welschof, M., C. Christ, I.
  • Nucleic acids encoding an antibody may be readily identified on the basis of the amino acid sequence of the antibody, the genetic code, and the understood degeneracy therein.
  • Nucleic acids encoding antibodies may be isolated from hybridoma cells, for example, and subsequently characterised using procedures standard in the art. For example, a nucleic acid probe may be designed based on the amino acid sequence of a portion of an antibody and then used to isolate genes encoding the heavy and/or light chains of the antibody.
  • nucleic acids may be generated by standard chemical synthesis methodology, for example, using phosphoramidite and solid phase chemistry.
  • the amino acid sequence of an antibody of the invention may be determined using standard methodology; for example, Edman degradation and HPLC or mass spectroscopy analysis, may be used.
  • antibodies directed against Saratan may find use in purification of Saratan or in diagnostic applications.
  • the antibodies may be immobilised on a solid phase. This would aid in purification and/or quantitation of the level of Saratan in a sample. In the case of diagnostic procedures and purification of Saratan it is not necessary for the antibody to have to inhibit Saratan activity.
  • antibodies may be modified by labelling with a compound which provides a detectable signal; for example, enzymes, fluorescent agents, and radioisotopes can be used. Those of general skill in the art to which the invention relates will readily identify such suitable labelling systems.
  • antibodies may be used as carriers, for example to carry toxins, radionucleotides, isotopes, genes, or other therapeutic molecules to cells or tissues to aid in therapy.
  • compositions for inhibition of Saratan Compositions for inhibition of Saratan
  • the agents of use in inhibiting Saratan may be used on their own, or in the form of compositions in combination with one or more pharmaceutically acceptable diluents, carriers, and/or excipients.
  • pharmaceutically acceptable diluents, carriers, and/or excipients which may be employed in compositions of the invention.
  • suitable carriers include isotonic solutions, water, aqueous saline solution, aqueous dextrose solution, and the like.
  • a pharmaceutical composition of the invention may be formulated with additional constituents, or in such a manner, so as to enhance the activity of the agent or help protect the integrity of the agent.
  • the composition may further comprise adjuvants or constituents which provide protection against degradation, or decrease antigenicity of an agent, upon administration to a subject.
  • the agent may be modified so as to allow for targeting to specific cells, tissues, or tumours.
  • compositions may include semi-permeable polymer matrices in the form of shaped articles, e.g., films, or microcapsules.
  • Sustained-release matrices include polylactides (U.S. Pat. No. 3,773,919; EP 58,481), copolymers of L-glutamic acid and gamma-ethyl-L-glutamate (Sidman et al., 1983, Biopolymers: 22: 547-56), poly(2- hydroxyethyl methacrylate) (Langer et al., 1981, J. Biomed. Mater.
  • Liposomes comprising the compound may be prepared using techniques known in the art to which the invention relates. By way of example see: DE 3,218,121, EP 52,322, EP 36,676, EP
  • the liposomes are of the small
  • composition in accordance with the invention may be formulated with other ingredients which may be of benefit to a subject in particular instances. For example, there may be benefit hi incorporating, where appropriate, one or more anti-neoplastic agents.
  • alkylating agents for example, chlorambucil (e.g., LeukeranTM), cyclophosphamide (e.g., EndoxanTM, CycloblastinTM, NeosarTM, CyclophosphamideTM), ifosfamide (e.g., HoloxanTM, HexTM, MesnexTM), thiotepa (e.g., ThioplexTM, ThiotepaTM); and ant ⁇ netabolites/S-phase inhibitors, for example, methotrexate sodium (e.g., FolexTM, AbitrexateTM, EdertrexateTM), 5-fluorouracil (e.g., EfudixTM, EfudexTM), hydroxyurea (e.g., DroxiaTM, Hydroxyurea, HydreaTM), amsacrine, gemcitabine (e.g., GemzarTM), dacarbazine, thioguanine (e
  • antimetabolites/mitotic poisons for example, etoposide (EtopophosTM, Etoposide, ToposarTM), vinblastine (e.g., VelbeTM, VelbanTM), vindestine (e.g., EldesineTM), vinorelbine (e.g., NavelbineTM), paclitaxel (e.g., TaxolTM); antibiotic- type agents, for example, doxorubicin (e.g., RubexTM), bleomycin (e.g., BlenoxaneTM), dactinomycin (e.g., CosmegenTM), daunorubicin (e.g., CerubidinTM), mitomycin (e.g., MutamycinTM); hormonal agents, for example, ammoglutethimide (e.g., CytadrenTM), anastrozole (e.g., ArimidexTM), estramustine (e.g., EstracytTM, EmcytTM), gosereli
  • any two or more anti-neoplastic agents for example, Adriamycin/5-fluorouracil/cyclophosphamide (FAC); and cyclophosphamide/methotrexate/S-fluorouracil (CMF)
  • Particularly useful are combinations that include, for example, at least two or more agents such as cyclophosphamide (e.g., CYTOXAN), methotrexate (e.g., RHEUMATREX), 5- fluorouracil (e.g., ADRUCEL), doxorubicin (e.g., ADRIAMYCIN), and cyclophosphamide (e.g., CYTOXAN).
  • cyclophosphamide e.g., CYTOXAN
  • methotrexate e.g., RHEUMATREX
  • 5- fluorouracil e.g., ADRUCEL
  • doxorubicin e.g., ADRIAM
  • agents such as capecitabine (e.g., XELODA), doxorubicin (e.g., ADRIAMYCIN), including its liposomal formulation, gemcitabine (e.g., GEMZAR), the taxanes, including paclitaxel
  • capecitabine e.g., XELODA
  • doxorubicin e.g., ADRIAMYCIN
  • gemcitabine e.g., GEMZAR
  • the taxanes including paclitaxel
  • Agents of the invention may also be formulated with compounds and agents, other than those specifically mentioned herein, in accordance with accepted pharmaceutical practice.
  • polynucleotides in the case of administration of polynucleotides, they may be packaged into viral delivery systems, which viral systems may themselves be formulated into compositions as herein described.
  • Persons of skill in the art to which the invention relates may appreciate a variety of suitable viral vectors having regard to the nature of the invention described herein.
  • retroviral vectors adenoviral vectors, and adeno-associated virus (AAV) can be used.
  • AAV adeno-associated virus
  • compositions of the invention may be adapted into customary dosage forms such as solutions, orally administrable liquids, injectable liquids, tablets, coated tablets, capsules, pills, granules, suppositories, transdermal patches, suspensions, emulsions, sustained release formulations, gels, aerosols, liposomes, powders and immunoliposomes.
  • the dosage form chosen will reflect the mode of administration desired to be used, the disorder to be treated, and the nature of the agent to be used.
  • compositions are prepared by contacting or mixing specific agents and ingredients with one another. Then, if necessary, the product is shaped into the desired formulation.
  • Gennaro AR Remington: The Science and Practice of Pharmacy, 20th ed., Lippincott, Williams & Wilkins, 2000.
  • the amount of an agent of the invention in a composition can vary widely depending on the type of composition, size of a unit dosage, kind of carriers, diluents and/or excipients, and other factors well known to those of ordinary skill in the art.
  • the final composition can comprise from 0.0001 percent by weight (% w) to 100% w of the actives of this invention, preferably 0.001% w to 10% w, with the remainder being any other active agents present and/or carrier(s), diluent(s) and/or excipient(s).
  • Saratan is predicted to also act in the small intestine, spleen, liver, fetal liver and kidney, and also heart, prostate, uterus, colon, stomach, skin, lung, trachea, brain, cerebellum, fetal brain, spinal cord, placenta, adrenal gland, adipose, cartilage, hematopoietic and immune systems, pancreas, and also skeletal muscle, thymus, salivary gland, thyroid, umbilical cord, and ovaries.
  • Saratan is predicted to act in breast cancer, colon cancer, lung cancer, prostate cancer, endometrial cancer, and stomach cancer, among others.
  • Saratan being applicable to the treatment of a variety of disorders characterised by altered cell proliferation, cell survival, or cell motility.
  • the inventors contemplate the inhibition of Saratan being applicable to the treatment of a variety of disorders characterised by altered cell proliferation, cell survival, or cell motility.
  • ALS Amyotrophic Lateral Sclerosis
  • the invention relates to a method of preventing, reducing, or inhibiting cell proliferation, cell survival, or cell motility by inhibiting Saratan.
  • the method is for the treatment of a disorder characterised by aberrant cell in subject.
  • This aberrant cell proliferation, cell survival, or cell motility may occur in one or more cell type within a subject and can include metastatic disorders.
  • Specific disorders include, for example, cancer (breast, colon, lung prostate, endometrial, or stomach cancer, for example) and endometriosis.
  • disorders include cancers such as adenocarcinoma, leukemia, lymphoma, melanoma, myeloma, sarcoma, teratocarcinoma, and cancers of the adrenal gland, bladder, bone, brain, breast, cervix, gall bladder, ganglia, gastrointestinal tract, heart, kidney, liver, lung, bone marrow, muscle, ovary, pancreas, parathyroid, penis, prostate, salivary glands, skin, spleen, testis, thymus, thyroid, and uterus.
  • cancers such as adenocarcinoma, leukemia, lymphoma, melanoma, myeloma, sarcoma, teratocarcinoma
  • cancers such as adenocarcinoma, leukemia, lymphoma, melanoma, myeloma, sarcoma, teratocarcinoma, and cancers of the adrenal
  • the disorder is an epithelial tumor of the breast, colon, lung, prostate, pancreas, stomach, endometrium, or ovary, or squamous cell carcinoma, or a melanoma, or a renal cancer or tumour.
  • breast cancers these can include epithelial tumours (e.g., from cells lining ducts or lobules) or nonepithelial tumours (e.g., from the supporting stroma), such as angiosarcomas, primary stromal sarcomas, and phyllodes tumor.
  • breast cancers can also include carcinomas, for example, carcinomas in situ, as well as invasive cancers.
  • Carcinoma in situ includes proliferation of cancer cells within ducts or lobules and without invasion of stromal tissue.
  • Lobular carcinoma in situ includes nonpalpable lesions which can indicate increased risk of subsequent invasive carcinoma in either breast, hi breast cancer, invasive carcinoma generally comprises adenocarcinoma, with most comprising infiltrating ductal type carcinoma and the remainder comprising infiltrating lobular carcinoma.
  • Rare forms of breast cancer include medullary, mucinous, and tubular carcinomas.
  • Breast cancer disorders also include Paget's disease of the nipple, and metastatic breast cancer.
  • this can generally include cancer of the colon, rectum, and/or anus, and especially, adenocarcinomas, and also carcinomas (e.g., squamous cloacogenic carcinomas), melanomas, lymphomas, and sarcomas.
  • carcinomas e.g., squamous cloacogenic carcinomas
  • melanomas lymphomas
  • sarcomas e.g., sarcomas.
  • the colon cancer may be associated with particular types of polyps or other lesions, for example, tubular adenomas, tubulovillous adenomas (e.g., villoglandular polyps), villous (e.g., papillary) adenomas (with or without adenocarcinoma), hyperplastic polyps, hamartomas, juvenile polyps, polypoid carcinomas, pseudopolyps, lipomas, or leiomyomas.
  • the cancer may be associated with familial polyposis and related conditions such as Gardner's syndrome or Peutz-Jeghers syndrome.
  • the cancer may be associated, for example, with chronic fistulas, irradiated anal skin, leukoplakia, lymphogranuloma venereum, Bowen's disease (intraepithelial carcinoma), condyloma acuminatum, or human papillomavirus.
  • the cancer may be associated with basal cell carcinoma, extramammary Paget's disease, cloacogenic carcinoma, or malignant melanoma.
  • nucleic acid technology including iRNA, antisense, and triple helix DNA may be employed to inhibit expression.
  • antibodies directed against Saratan or functional derivatives of such antibodies may be used.
  • Exemplary agents are described in detail herein. Those agents of use in the invention will preferably exhibit one or more of the following characteristics: 1) the ability to prevent, reduce or inhibit cell proliferation; 2) the ability to prevent, reduce or inhibit cell survival; 3) the ability to prevent, reduce or inhibit cell motility; 3) the ability to prevent, reduce or inhibit expression or activity of Saratan; 4) the ability to prevent, decrease, reduce or control metastasis of tumours.
  • suitable agents will exhibit two or more of these characteristics.
  • Saratan is encoded as a cellular factor that is expressed in certain cancer cells, and also by at least one subset of normal adult cells. Therefore, Saratan can be considered a tumor-associated antigen.
  • Several approaches can be used to target Saratan based on differences in expression and access in normal and cancer cells (reviewed, generally, in Paul, Fundamental Immunology, 1999, Lippincott-Raven Publishers, Philadelphia, PA, Chapter 37).
  • Cancer cells are likely to express Saratan at much higher levels and such differences in expression levels between normal and cancer cells can be exploited therapeutically (see, e.g., Brown JP, et al., Quantitative analysis of melanoma-associated antigen p97 in normal and neoplastic tissues. Proc Natl Acad Sci USA 1981;78:539-543). Targeting may also be attained because of better access of Saratan-specific effector cells to cancer cells than to normal cells. For example, Saratan expressed on cancer cells may be more available for binding due to incomplete glycosylation (e.g., as in the case of epithelial mucins).
  • MHC molecules may make tumours a direct target for T cells (see, e.g., Uyttenhove C, et al.
  • PlA mouse gene PlA in testis does not prevent safe induction of cytolytic T cells against a PlA-encoded tumor antigen. Int J Cancer 1997;70:349-356).
  • Saratan (d) passive therapy with Saratan antibodies; and (e) adoptive transfer of effector cells (e.g., T cells).
  • Active immunization against Saratan can be used to induce immune responses or passive immunization with a murine monoclonal antibody directed against Saratan.
  • Riethmuller G et al.
  • Synthetic peptides used in vaccines can be designed for particular MHC haplotypes (see, e.g., Toes RE et al. Peptide vaccination can lead to enhanced tumor growth through specific T-cell tolerance induction. Proc Natl Acad Sci USA 1996;93:7855-7860).
  • Antigenic peptides can be loaded onto heat-shock protein (or as recombinant virus-like particles) to increase the efficacy of immunization.
  • effective induction of an immune response requires antigen presentation in an environment that provides appropriate help or secondary signals.
  • Dendritic cells pulsed with virus-specific or tumor- associated peptides to induce tumor-reactive T cells and rejection of transplanted tumor cells.
  • Dendritic cells can be loaded with synthetic antigenic peptides or recombinant proteins. Dendritic cells can also be loaded with one or more of: native peptides stripped from tumor cell surfaces; tumor-derived, peptide-loaded heat-shock proteins; tumor-derived rnRNA; or fused tumor cells (for review, see Shurin MR. Dendritic cells presenting tumor antigen. Cancer Immunol Immunother 1996;43: 158-164).
  • One advantage of these strategies is that powerful immunity can be induced to (unique) individually distinct tumor antigens, as well as tumor-associated antigens.
  • recombinant vaccines can be developed using vaccinia, Listeria, or virus-like particles.
  • genetic vaccination can be used, for example, by injecting naked DNA plasmid constructs, intramuscularly encoding the tumor antigen (see e.g., Donnelly JJ, Ulmer JB, Liu MA. DNA vaccines. Life Sci 1997;60:163-172).
  • GM-CSF may also be used to improve the presentation of the antigen by dendritic cells at the site of injection (see, e.g., Syrengelas AD, Chen TT, Levy R. DNA immunization induces protective immunity against B-cell lymphoma. Nat Med 1996;2:1038-1041).
  • vaccination with anti-idiotypic antibodies can be used.
  • passive antibody therapy or adoptive transfer of tumor-specific T cells can be used.
  • passive immunization with Saratan antibody can protect against challenge with tumor cells and can be therapeutic when given soon after challenge with the cancer cells (e.g., see Riethm ⁇ ller G, et al. Monoclonal antibody therapy for resected Dukes' C colorectal cancer: seven-year outcome of a multicenter randomized trial. J Clin Oncol 1998;16:1788-1794; Riethm ⁇ ller G, et al. Randomized trial of monoclonal antibody for adjuvant therapy of resected Dukes' C colorectal carcinoma. German Cancer Aid 17-1A Study Group. Lancet 1994;343:1177-1183; Herlyn DM, et al. Inhibition of growth of colorectal carcinoma in nude mice by monoclonal antibody. Cancer Res 1980;40:717-721).
  • anti-idiotypic antibody treatment can be used to induce cancer cells to go into a long-lasting dormant state (see, e.g., Miller RA, Maloney DG, Warnke R, Levy R. Treatment of B-cell lymphoma with monoclonal anti-idiotype antibody. N Engl J Med 1982;306:517— 522).
  • antibodies to tumour cells can be used as carriers for cytokines or cytotoxic agents, such as radiochemicals or natural toxins (see, e.g., Ghetie V, Vitetta E. Lnmunotoxins in the therapy of cancer: from bench to clinic. Pharmacol Ther 1994;63:209-234; Reisfeld RA, Gillies SD.
  • the recombinant antibody-cytokine or antibody-toxin fusion proteins may be used to concentrate these agents in the stroma surrounding the tumor cells.
  • bispecific monoclonal antibodies can be engineered to bind effector cells as well as tumor antigens on the cancer cells.
  • Monoclonal antibodies can also be humanized to reduce the stimulation of neutralizing anti-murine antibodies by patients.
  • adoptive transfer of T cells can be used with longer established tumor loads.
  • T cells that have been isolated from patients can be expanded in vitro with EL-2 and then infused into patients who receive IL-2 as well (see, e.g., Smith CA, et al. Adoptive immunotherapy for Epstein-Barr virus-related lymphoma. Leuk Lymphoma 1996;23:213-220).
  • the efficacy of an agent in inhibiting Saratan may be determined having regard to the description of the invention herein and known methodology.
  • efficacy of agents may be determined by observing their ability to prevent, reduce, or inhibit expression of Saratan or one or more of the functional effects of Saratan.
  • the affect of the agent on one or more of cellular invasion, cellular migration, the level of gene transcription of Saratan and Saratan responsive genes may be studied. Such studies may be conducted in vitro or in vivo.
  • Examples may be used to determine the suitability of an agent in accordance with the invention.
  • RT- PCR and Northern blot analysis can be used to detect Saratan expression at the mRNA level
  • Western blotting and direct or indirect immunostaining can be used to detect the expression at the protein level.
  • cell-based assays for cell proliferation, cell survival, or cell motility can be used.
  • an in vivo assay may be used, as described, for example, in Fidler, I. J. (1973) Nat. New Biol. 242, 148-149; and Price J. E. The biology of cancer metastasis. Prog. Clin. Biol. Res., 354A: 237-255,
  • a target site may be any site within the body which may have or be susceptible to a disorder, and may include one or more cells, tissues or a specific tumor.
  • administration may include parenteral administration routes, systemic administration routes, oral and topical administration.
  • Administration may be by way of injection, subcutaneous, intraorbital, ophthalmic, intraspinal, intracisternal, topical, infusion (using, e.g., slow release devices or minipumps such as osmotic pumps or skin patches), implant, aerosol, inhalation, scarification, intraperitoneal, intracapsular, intramuscular, intratumoral, intranasal, oral, buccal, transdermal, pulmonary, rectal or vaginal delivery.
  • the administration route chosen may be dependent on the position of the target site within the body of a subject, as well as the nature of the agent or composition being used.
  • polynucleotides in the case of polynucleotides, they may be administered for example by infection using defective or attenuated retroviral or other viral vectors (see e.g., U.S. Patent No. 4,980,286), or by direct injection of naked DNA, or by use of microparticle bombardment (e.g., a gene gun; Biolistic, DuPont); by coating with lipids or cell-surface receptors or transfecting agents; encapsulation in liposomes, microparticles, or microcapsules; by linkage to a peptide which is known to enter the nucleus; or by administering it in linkage to a ligand subject to receptor-mediated endocytosis (see, e.g., Wu and Wu, 1987, J.
  • a ligand subject to receptor-mediated endocytosis see, e.g., Wu and Wu, 1987, J.
  • nucleic acid-ligand complexes can be formed in which the ligand comprises a fusogenic viral peptide to disrupt endosomes, allowing the nucleic acid molecules to avoid lysosomal degradation.
  • the polynucleotides can be targeted in vivo for cell specific uptake and expression, by targeting a specific receptor, as described for example in WO 92/06180 dated April 16, 1992 (Wu et al.); WO 92/22635 dated December 23, 1992 (Wilson et al.); WO 92/20316 dated November 26, 1992 (Findeis et al.); WO 93/14188 dated July 22, 1993 (Clarke et al.); and, WO 93/20221 dated October 14, 1993 (Young).
  • the polynucleotides can be introduced intracellularly and incorporated within host cell DNA for expression, by homologous recombination Koller and Smithies, 1989, Proc. Natl. Acad. Sci. USA 86:8932-8935; Zijlstra et al., 1989, Nature 342:435-438.
  • Cells into which polynucleotides can be introduced for purposes of the present invention encompass any desired, available cell type. The appropriate cell type will depend on the nature of the disorder to be treated. However, by way of example, the polynucleotide can be introduced to a cancer cell.
  • the dose of an agent or composition administered, the period of administration, and the general administration regime may differ between subjects depending on such variables as the nature of the condition to be treated, severity of symptoms of a subject, the size of any tumour to be treated, the target site to be treated, the mode of administration chosen, and the age, sex and/or general health of a subject.
  • Persons of average skill in the art to which the invention relates will readily appreciate or be able to determine appropriate administration regimes having regard to such factors.
  • ad ⁇ iinistration may include a single daily dose or administration of a number of discrete divided doses as may be appropriate.
  • the inventors also contemplate the administration regimes which combine different modes or routes of administration. For example, intratumoural injection and systemic administration could be combined.
  • a method of the invention may comprise further steps such as the administration of additional agents or compositions which may be beneficial to a subject having regard to the condition to be treated.
  • additional agents or compositions which may be beneficial to a subject having regard to the condition to be treated.
  • other agents of use in treating proliferative disorders such as the anti-neoplastic agents mentioned above
  • additional agents and compositions may be administered concurrently with the agents and compositions of the invention, or in a sequential manner.
  • the additional agents or compositions could be administered before or after administration of the agents or compositions of the invention.
  • sequential administration of one agent or composition after the other need not occur immediately, although this may be preferable.
  • the invention relates to use of one or more reagents of the invention in a method of diagnosing a disorder associated with cell proliferation, cell survival, or cell motility.
  • the method is for the diagnosis of a disorder characterised by aberrant cell proliferation, cell survival, or cell motility in subject.
  • This aberrant cell proliferation, cell survival, or cell motility may occur in one or more cell type within a subject and can include metastatic disorders.
  • Specific disorders include, for example, cancer (breast, lung, colon, prostate, endometrial, or stomach cancer, for example) and endometriosis.
  • disorders include cancers such as adenocarcinoma, leukemia, lymphoma, melanoma, myeloma, sarcoma, teratocarcinoma, and cancers of the adrenal gland, bladder, bone, brain, breast, cervix, gall bladder, ganglia, gastrointestinal tract, heart, kidney, liver, lung, bone marrow, muscle, ovary, pancreas, parathyroid, penis, prostate, salivary glands, skin, spleen, testis, thymus, thyroid, and uterus.
  • cancers such as adenocarcinoma, leukemia, lymphoma, melanoma, myeloma, sarcoma, teratocarcinoma
  • cancers such as adenocarcinoma, leukemia, lymphoma, melanoma, myeloma, sarcoma, teratocarcinoma, and cancers of the adrenal
  • the disorder is an epithelial tumor of the breast, lung, prostate, colon, pancreas, endometrium, stomach, or ovary, or a squamous cell carcinoma, or a melanoma, or a renal cancer or tumour.
  • epithelial tumor of the breast, lung, prostate, colon, pancreas, endometrium, stomach, or ovary or a squamous cell carcinoma, or a melanoma, or a renal cancer or tumour.
  • Specific breast and colon cancers are described in detail herein.
  • antibodies which specifically bind Saratan may be used for the diagnosis of conditions or disorders characterized by expression of Saratan, or in assays to monitor patients being treated with Saratan inhibitors.
  • the antibodies useful for diagnostic purposes may be prepared hi the same manner as those described above for therapeutics.
  • Diagnostic assays for Saratan include methods which utilize the antibody and a label to detect Saratan in human body fluids or extracts of cells or tissues.
  • the antibodies may be used with or without modification, and may be labeled by joining them, either covalently or non-covalently, with a reporter molecule.
  • a wide variety of reporter molecules which are known in the art may be used, several of which are described above.
  • a variety of protocols, including ELISA, RIA, and FACS, are known in the art and provide a basis for diagnosing altered or abnormal levels of Saratan expression.
  • Normal or standard values for Saratan expression are established by combining body fluids or cell extracts taken from normal mammalian subjects, preferably human, with antibody to Saratan under conditions suitable for complex formation. The amount of standard complex formation may be quantified by various methods, but preferably by photometric means. Quantities of Saratan expressed in subject, control, and disease, samples from biopsied tissues are compared with the standard values. Deviation between standard and subject values establishes the parameters for diagnosing disorders.
  • the polynucleotides encoding Saratan may be used for diagnostic purposes.
  • the polynucleotides which may be used include oligonucleotide sequences, complementary RNA and DNA molecules, and PNAs.
  • the polynucleotides may be used to detect and quantitate gene expression in biopsied tissues in which expression of Saratan may be correlated with disorders.
  • the diagnostic assay may be used to distinguish between absence, presence, and excess expression of Saratan, and to monitor regulation of Saratan levels during therapeutic intervention.
  • hybridization with PCR probes which are capable of detecting polynucleotide sequences, including genomic sequences, encoding Saratan or closely related molecules, may be used to , identify nucleic acid sequences which encode
  • the specificity of the probe whether it is made from a highly specific region, e.g., 10 unique nucleotides in the 5' regulatory region, or a less specific region, e.g., especially in the 3' coding region, and the stringency of the hybridization or amplification (maximal, high, intermediate, or low) will determine whether the probe identifies only naturally occurring sequences encoding Saratan, alleles, or related sequences.
  • Probes may also be used for the detection of related sequences, and should preferably contain at least 50% of the nucleotides from any of the Saratan encoding sequences.
  • the hybridization probes of the subject invention may be DNA or RNA and derived from the nucleotide sequence of SEQ ID NO: 14-16, 19, 22, or fragments encompassing a nucleic acid sequence of SEQ ID NO: 17, 18, 20, 21, 23, 24-48, or from genomic sequences including promoter, enhancer elements, and introns of the naturally occurring Saratan.
  • Means for producing specific hybridization probes for DNAs encoding Saratan include the cloning of nucleic acid sequences encoding Saratan or modified sequences into vectors for the production of mRNA probes.
  • Such vectors are known in the art, commercially available, and may be used to synthesize RNA probes in vitro by means of the addition of the appropriate RNA polymerases and the appropriate labeled nucleotides.
  • Hybridization probes may be labeled by a variety of reporter groups, for example, radionuclides such as 32 P or S, or enzymatic labels, such as alkaline phosphatase coupled to the probe via avidin/biotin coupling systems, and the like.
  • Polynucleotide sequences encoding Saratan may be used for the diagnosis of disorders which are associated with either increased or decreased expression of Saratan.
  • the polynucleotide sequences encoding Saratan may be used in Southern or northern analysis; dot blot or other membrane-based technologies; in PCR technologies; or in dipstick, pin, ELISA assays; or microarrays utilizing fluids or tissues from patient biopsies to detect altered Saratan expression. Such qualitative or quantitative methods are well known in the art.
  • the nucleotide sequences encoding Saratan may be useful in assays that detect activation or induction of various cancers, particularly those mentioned above.
  • the nucleotide sequences encoding Saratan may be labeled by standard methods, and added to a fluid or tissue sample from a patient under conditions suitable for the formation of hybridization complexes. After a suitable incubation period, the sample is washed and the signal is quantitated and compared with a standard value.
  • nucleotide sequences have hybridized with nucleotide sequences in the sample, and the presence of altered levels of nucleotide sequences encoding Saratan in the sample indicates the presence of the associated disorder.
  • assays may also be used to evaluate the efficacy of a particular therapeutic treatment regimen in animal studies, in clinical trials, or in monitoring the treatment of an individual patient.
  • a normal or standard profile for expression is established. This may be accomplished by combining body fluids or cell extracts taken from normal subjects, either animal or human, with a sequence, or a fragment thereof, which encodes Saratan, under conditions suitable for hybridization or amplification. Standard hybridization may be quantified by comparing the values obtained from normal subjects with those from an experiment where a known amount of a substantially purified polynucleotide is used.
  • Standard values obtained from normal samples may be compared with values obtained from samples from patients who are symptomatic for a disorder. Deviation between standard and subject values is used to establish the presence of the disorder.
  • hybridization assays may be repeated on a regular basis to evaluate whether the level of expression in the patient begins to approximate that which is observed in the normal patient.
  • the results obtained from successive assays may be used to show the efficacy of treatment over a period ranging from several days to months.
  • the presence of a relatively high amount of transcript in biopsied tissue from an individual may indicate a predisposition for the development of the disorder, or may provide a means for detecting the disorder prior to the appearance of actual clinical symptoms.
  • a more definitive diagnosis of this type may allow health professionals to employ preventative measures or aggressive treatment earlier thereby preventing the development or further progression of the cancer.
  • oligonucleotides designed from the sequences encoding Saratan may involve the use of PCR. Such oligomers may be chemically synthesized, generated enzymatically, or produced in vitro. Oligomers will preferably consist of two nucleotide sequences, one with sense orientation (5'.fwdarw.3') and another with antisense (3'.fwdarw.5'), employed under optimized conditions for identification of a specific gene or condition. The same two oligomers, nested sets of oligomers, or even a degenerate pool of oligomers may be employed under less stringent conditions for detection and/or quantitation of closely related DNA or RNA sequences.
  • Methods which may also be used to quantitate the expression of Saratan include radiolabeling or biotinylathig nucleotides, coamplification of a control nucleic acid, and standard curves onto which the experimental results are interpolated (Melby, P. C. et al. (1993) J. Immunol. Methods, 159:235-244; Duplaa, C. et al. (1993) Anal. Biochem. 229-236).
  • the speed of quantitation of multiple samples may be accelerated by running the assay in an ELISA format where the oligomer of interest is presented in various dilutions and a spectrophotometric or colorimetric response gives rapid quantitation.
  • oligonucleotides or longer fragments derived from any of the polynucleotide sequences described herein may be used as targets in a microarray.
  • the microarray can be used to monitor the expression level of large numbers of genes simultaneously (to produce a transcript image), and to identify genetic variants, mutations and polymorphisms. This information may be used to determine gene function, to understand the genetic basis of the disorder, to diagnose the disorder, and to develop and monitor the activities of therapeutic agents.
  • the microarray is prepared and used according to the methods known in the art such as those described in PCT application WO 95/11995 (Chee et al.), Lockhart, D. J. et al. (1996; Nat. Biotech. 14: 1675-1680) and Schena, M. et al. (1996; Proc. Natl. Acad. Sci. 93: 10614-10619).
  • the microarray is preferably composed of a large number of unique, single stranded nucleic acid sequences, usually either synthetic antisense oligonucleotides or fragments of cDNAs, fixed to a solid support.
  • the oligonucleotides are preferably about 6 to 60 nucleotides Til length, more preferably about 15 to 30 nucleotides in length, and most preferably about 20 to 25 nucleotides in length. For a certain type of microarray, it may be preferable to use oligonucleotides which are 7 to 10 nucleotides in length.
  • the microarray may contain oligonucleotides which cover the known 5' or 3' sequence, or may contain sequential oligonucleotides which cover the full length sequence; or unique oligonucleotides selected from particular areas along the length of the sequence.
  • Polynucleotides used in the microarray may be oligonucleotides that are specific to a gene or genes of interest in which at least a fragment of the sequence is known or that are specific to one or more unidentified cDNAs which are common to a particular cell or tissue type or to a normal, developmental, or disease state.
  • pairs of oligonucleotides on a microarray will be identical, except for one nucleotide preferably located in the centre of the sequence.
  • the second oligonucleotide in the pair serves as a control.
  • the number of oligonucleotide pairs may range from 1 to 1,000,000.
  • the gene of interest is examined using a computer algorithm which starts at the 5' or more preferably at the 3' end of the nucleotide sequence.
  • the algorithm identifies oligomers of defined length that are unique to the gene, have a GC content within a range suitable for hybridization, and lack predicted secondary structure that may interfere with hybridization.
  • the oligomers are synthesized at designated areas on a substrate using a light-directed chemical process.
  • the substrate may be paper, nylon or any other type of membrane, filter, chip, glass slide, or any other suitable solid support.
  • the oligonucleotides may be synthesized on the surface of the substrate by using a chemical coupling procedure and an ink jet application apparatus, such as that described in PCT application WO 95/251116 (Baldeschweiler et al.).
  • a gridded array analogous to a dot or slot blot may be used to arrange and link cDNA fragments or oligonucleotides to the surface of a substrate using a vacuum system, thermal, UV, mechanical or chemical bonding procedures.
  • an array may be produced by hand or by using available devices, materials, and machines (including multichannel pipettors or robotic instruments; Brinkmann, Westbury, NY) and may include about 8, 24, 96, 384, 1536 or 6144 oligonucleotides, or any other multiple from 2 to 1,000,000, which lends itself to the efficient use of commercially available instrumentation.
  • polynucleotides are extracted from a biological sample.
  • the biological samples may be obtained from any bodily fluid (e.g., blood, urine, saliva, phlegm, gastric juices, etc.), cultured cells, biopsies, or other tissue preparations.
  • the polynucleotides extracted from the sample are used to produce nucleic acid sequences which are complementary to the oligonucleotides on the microarray. If the microarray consists of cDNAs, antisense RNAs are appropriate probes.
  • mRNA is used to produce cDNA which, in turn and in the presence of fluorescent nucleotides, is used to produce fragment or oligonucleotide antisense RNA probes. These fmorescently labeled probes are incubated with the microarray so that the probe sequences hybridize to the cDNA oligonucleotides of the microarray.
  • nucleic acid sequences used as probes can include polynucleotides, fragments, and complementary or antisense sequences produced using restriction enzymes, PCR technologies, and oligolabeling kits (Amersham Pharmacia Biotech), which are well known in the area of hybridization technology.
  • Incubation conditions are adjusted so that hybridization occurs with precise complementary matches or with various degrees of less complementarity.
  • a scanner is used to determine the levels and patterns of fluorescence.
  • the scanned images are examined to determine degree of complementarity and the relative abundance of each oligonucleotide sequence on the microarray.
  • a detection system may be used to measure the absence, presence, and amount of hybridization for all of the distinct sequences simultaneously. This data may be used for large scale correlation studies or functional analysis of the sequences, mutations, variants, or polymorphisms among samples (Heller, R. A. et al., (1997) Proc. Natl. Acad. Sci. 94:2150-55).
  • the nucleic acid sequences which encode Saratan may be used to generate hybridization probes which are useful for mapping the naturally occurring genomic sequence.
  • the sequences may be mapped to a particular chromosome, to a specific region of a chromosome, or to artificial chromosome constructions, such as human artificial chromosomes (HACs), yeast artificial chromosomes (YACs), bacterial artificial chromosomes (BACs), bacterial Pl constructions or single chromosome cDNA libraries (cf. Price, C. M. (1993) Blood Rev. 7:127-134; Trask, B. J. (1991) Trends Genet. 7:149-154).
  • Fluorescent in situ hybridization FISH as described in Verma et al. (1988) Human Chromosomes: A Manual of Basic Techniques, Pergamon Press, New York, NY
  • FISH Fluorescent in situ hybridization
  • OMIM Online Mendelian Inheritance hi Man
  • New sequences can be assigned to chromosomal arms, or parts thereof, by physical mapping. This provides valuable information to investigators searching for disease genes using positional cloning or other gene discovery techniques. Once the disorder has been crudely localized by genetic linkage to a particular genomic region, for example, AT to l lq22-23 (Gatti, R. A. et al. (1988) Nature 336:577-580), any sequences mapping to that area may represent associated or regulatory genes for further investigation.
  • the nucleotide sequence of the subject invention may also be used to detect differences in the chromosomal location due to translocation, inversion, etc., among normal, carrier, and affected individuals.
  • Saratan in another embodiment, Saratan, or its functional or immunogenic fragments or oligopeptides thereof, can be used for screening libraries of compounds in any of a variety of drug screening techniques.
  • the fragment employed in such screening may be free in solution, affixed to a solid support, borne on a cell surface, or located intracellularly.
  • the formation of binding complexes, between Saratan and the agent being tested, may be measured.
  • the antibodies can be used to detect the presence of any amino acid sequence which shares one or more antigenic determinants with Saratan.
  • Another technique for drug screening which may be used provides for high throughput screening of compounds having suitable binding affinity to the protein of interest as described in WO 84/03564.
  • Saratan large numbers of different small test compounds are synthesized on a solid substrate, such as plastic pins or some other surface. The test compounds are reacted with Saratan, or fragments thereof, and washed. Bound Saratan is then detected by methods well known in the art. Purified Saratan can also be coated directly onto plates for use in the aforementioned drug screening techniques. Alternatively, non-neutralizing antibodies can be used to capture the peptide and immobilize it on a solid support.
  • nucleotide sequences which encode Saratan may be used in any molecular biology techniques that have yet to be developed, provided the new techniques rely on properties of nucleotide sequences that are currently known, including, but not limited to, such properties as the triplet genetic code and specific base pair interactions.
  • kits suitable for controlling or inhibiting Saratan or for the treatment of a disorder as defined herein may be used in diagnostic kits.
  • Kits can comprise at least one agent of the invention in a suitable container.
  • the agents may be formulated suitable for direct administration to a subject for example, as agents or pharmaceutical compositions.
  • the kit may comprise one or more agents in one container and pharmaceutical diluents, carriers and/or excipients in another; the contents of each container being mixed together prior to administration.
  • the kit may also comprise additional agents and compositions in further separate containers as may be necessary for a particular application. Any container suitable for storing and/or administering an agent or composition may be used in a kit of the invention.
  • kits of the invention can also comprise instructions for the use and administration of the components of the kit. The invention is further elucidated with reference to the examples below.
  • MCF-7 and MDA-MB-231 (referred to as MDA-231) cell lines were obtained from the American Type Culture Collection (Manassas, VA). MCF- 7 cells were cultured in RPMI 1640 medium supplemented with 10% heat-inactivated foetal bovine serum (FBS), 100 units/ml penicillin, 100 ⁇ g/ml streptomycin, and 2 rnM
  • MDA-231 cells were cultured in Dulbecco's modified Eagle's medium
  • DMEM fetal bovine serum
  • Plasmid constructs The insert (-7.5 kb) of IMAGE cDNA clone (5493356) was excised by EcoRV and Notl digestion and subcloned into phCMVl vector (Genlantis, CA). The resulting plasmid was designated phCMV-hST.
  • a sequence encoding the HA (hemagglutinin YPYDVPDYA, SEQ ID NO:11) tag was added in frame at the 5' or 3' end of the coding sequence for Saratan. This was cloned into phCMVl vector to obtain expression plasmids phCMVn-hST and phCMVc-hST for N- or C-terminal HA-tagged Saratan fusion proteins, respectively.
  • the N-terminal HA-tagged Saratan included the sequence MYPYD VPD YASLEF (SEQ ID NO: 12) prior to the first amino acid of Saratan.
  • the C-terminal HA-tagged Saratan included the sequence EFYPYDVPDYA (SEQ ID NO:13) immediately after the last amino acid of Saratan.
  • the coding sequence of Saratan was also cloned into the pEGFP-Nl vector in frame with the 5' EGFP tag (pEGFP-Nl-hST) to express the C-terminal EGFP tagged Saratan.
  • the Glutathione S-transferase (GST) Gene Fusion System from Amersham Biosciences was used to produce recombinant Saratan protein in E. coli.
  • the human Saratan cDNA fragment coding for the N-terminal peptide of the first 61 amino acids was amplified by
  • the insert was verified by DNA sequencing.
  • the human breast cancer cell line MCF-7 was stably transfected with phCMV-hST using Saint-Mix (Synvolux Therapeutics B. V., the Netherlands) transfection reagent. The resulting cells were designated as MCF7-hST. As a control, MCF-7 cells were stably transfected with the empty vector phCMVl to produce cells designated as MCF7-Vec. Cell clones were selected by addition of G418 (Bio-Rad Laboratories, CA) to a concentration of 0.8 mg/ml in the medium. Transfected cell lines were generated as pools of positive cell clones. The overexpression of Saratan in MCF7-Saratan was confirmed by Western blotting.
  • RNA samples were isolated from MCF-7 cells with Trizol reagent (Invitrogen) at 1 ml/10 cm 2 according to the manufacturer's instructions and resuspended in diethyl pyrocarbonate-treated nuclease-free water. RNA samples were further treated with DNase I for 30 rnin. at 37°C. The reaction was stopped by addition of 25 mM EDTA and incubation at 65 0 C for 15 min. RNA samples were then purified by extraction in phenol/chloroform (pH 5.2, phenol:chloroform:isoamyl alcohol at 25:24:1) followed by an additional chloroform extraction and ethanol precipitation.
  • Trizol reagent Invitrogen
  • RNA samples with ratios of A 26O /A 28 o greater than 1.6 were stored at - 80°C for further analysis.
  • RT-PCR kit Qiagen
  • RT-PCR the following procedure was employed. To start, 1 ⁇ g of total RNA was diluted to 0.1 ⁇ g/ ⁇ l to minimize the variation of sample handling. This dilution was treated by DNase I for 15 min, followed by inactivation of DNase by adding EDTA to 5 mM and heating to 70 0 C for 15 min.
  • the DNase-treated RNA was then mixed with a master cocktail containing RT-PCR buffer, sense and antisense primers, dNTPs, RNase inhibitor, and an enzyme mixture containing reverse transcriptase (Omniscript and Sensiscript) and HotStart Taq DNA polymerase at the concentrations recommended by the manufacturer to a final volume of 50 ⁇ l.
  • the temperature-cycle protocol included: 60 min at 50 0 C for RT reaction, followed by denaturation and activation of HotStart DNA polymerase for 15 min at 95°C, and PCR amplification for 10 sec at 95°C, 30 sec at 60 0 C, and 1 min at 72°C for
  • RNA sequencing 30 cycles. A final extension for 5 min at 72°C was performed at the end of the cycles, ⁇ - actin was similarly amplified by RT-PCR using 0.2 ⁇ g of total RNA as an internal control. Ten microlitres of each of the RT-PCR product was fractionated on 1% agarose gels. The identity of RT-PCR product was confirmed by the size, restriction enzyme digestion, and DNA sequencing.
  • a cDNA panel (Primgen) consisting of 10 ng of first- strand cDNA from various human tissues was screened by PCR with the Saratan specific hST5 and hST3 primers. As recommended by the manufacturer, human beta-2- microglobulin gene was used as the cDNA input control.
  • the primers used to amplified beta-2-microglobulin gene included 5'-TCTCGCTCCGTGGCCTTAGCTG-S' (sense primer, SEQ ID NO:43) and 5'-AACATGTCTCGATCCCACTTAACTATC-S' (anti- sense primer, (SEQ ID NO:44).
  • the expression of Saratan in a variety of cancer cell lines was determined by RT-PCR.
  • the cell lines included A549 human lung carcinoma cells; AGS human stomach cancer cells; Colo320DM and DLD-I neuroendocrine colon carcinoma cells;, DU145 and PC3 human prostate cancer cells; BxPC3 pancreatic cancer; RL95-2 endometrial carcinoma cells; HepG2 human liver cancer cells; and T47D, BT459 and MCF-7 human breast cancer cells.
  • MCF-7 mammary carcinoma cells grown on glass coverslips were transiently transfected with pEGFP-Nl-hST or the empty pEGFP-Nl vector.
  • Cells were grown in RPMI 1640 containing 10% serum for 24 h.
  • Cells were fixed in ice-cold 4% paraformaldehyde;, washed with PBS, permeabilized for 10 min with 0.1% Triton X-100, and nuclei were counterstained with DAPI.
  • MCF-7 cells grown on glass coverslips were transiently transfected with phCMVn-hST, phCMVc-hST, or the empty phCMVl vector as a control. ⁇
  • Cells were fixed in ice-cold 4% paraformaldehyde and washed with PBS. A subset of each group of transfectants was permeabilized with 0.5% Triton ® X-100 for 30 min. The remaining subset was left untreated. Cells were incubated with primary rabbit polyclonal HA-Probe (Y-11) (Cat # sc-805, Santa Cruz Biotech) followed by incubation with a FITC-labeled goat anti-rabbit second antibody (Cat # F -0511, Sigma). Coverslips were mounted on slides with the nuclei counterstained by DAPI.
  • SDS-polyacrylamide gel electrophoresis (PAGE) sample buffer 50 mM Tris-HCl, pH 6.8; 2% SDS; 2% ⁇ -mercaptoethanol, and bromophenol blue was added to each sample and the samples were boiled for 5 min.
  • Samples were subjected to discontinuous SDS-PAGE with a 12% resolving gel and transferred to nitrocellulose membranes (HybondTM C-extra) using standard electroblotting procedures.
  • Membranes were blocked with 5% non-fat dry milk in PBS with 0.1% Tween 20 (PBST) for 1 h at room temperature. The blots were then immunolabelled with monoclonal antibodies 9E10 against c-Myc (1:1000 dilution) in PBST containing 1% non-fat dry milk at 4°C overnight. After three washes with PBST at room temperature, ixnmunolabelling was detected by ECL plusTM chemiluminescence as described by the manufacturer (GE Healthcare). Blots were stripped and reprobed with monoclonal antibody against ⁇ -actin to ensure equal loading of the cell lysate proteins.
  • Blots were stripped by incubation for 30 min at 5O 0 C in a solution containing 62.5 mM Tris ⁇ Cl, pH 6.7; 2% SDS; and 0.7% ⁇ -mercaptoethanol. Blots were then washed for 30 min with several changes of PBST at room temperature. Efficacy of stripping was determined by re-exposure of the membranes to ECL plusTM. Thereafter, blots were re-blocked and immunolabelled as described above.
  • Apoptotic cell death was measured by fluorescent microscopic analysis of cell DNA staining patterns with karyophilic Hoechst 33258 (Del, B. G., Z. Darzynkiewicz, C. Degraef, R. Mosselmans, D. Fokan, and P. Galand. 1999. Comparison of methods based on annexin-V binding, DNA content or TUNEL for evaluating cell death in HL-60 and adherent MCF-7 cells. Cell Prolif. 32:25-37). Cells were seeded onto 6-well. " plates. Cells were serum depleted for 24 hours.
  • cells at near confluence were trypsinized the day before the assay, passed through an 18G needle several times and incubated at least 12 hours prior to assays. The next day, cells were harvested with 5 mM EDTA in PBS, pH 7.4, washed twice, and then suspended in serum-free RPMI/BSA. A 100- ⁇ l volume of cells (1.0 x 10 5 ) was loaded into Transwell inserts. The lower chambers were filled with 600 ⁇ l of RPMI containing 10% FBS. The loaded chamber was placed in a 37 0 C incubator in a humidified atmosphere with 5% CO 2 .
  • cells were cultured in 6-well plates first covered with a layer of agar (0.5%). Cells were grown in RPMI 1640 media containing 10% FBS. The middle layer contained 5 x 10 3 cells in 0.35% agar in RPMI 1640 media containing 10% FBS. Medium was added as the top layer to prevent drying of the agarose gels. The plates are incubated at 37 0 C in a humidified incubator for 14 days, after which the cells were stained with 0.5 ml of 0.005% crystal violet in distilled water for 1 h and disfained for 2 h in water. Colonies were inspected and photographed.
  • the pSilencer 2.1-U6 vector (Ambion) was used to express Saratan siRNA using the RNA polymerase III U6 promoter. Briefly, oligonucleotides with 3' single stranded overhangs were designed to contain a 19mer hairpin sequence specific for Saratan mRNA target. The oligonucleotides also included a loop sequence separating the two complementary domains and a transcription termination sequence. The oligonucleotides were annealed to form the hairpin, and ligated into pSilencer digested with Bam HI and
  • the recombinant N-terminal peptide from Saratan protein was GST tagged, expressed, and purified from E. coli.
  • the pGEX 4Tl-hSTn plasmid was used to transform BL21-Gold cells (Stratagene).
  • a single recombinant E. coli colony was inoculated into LB medium containing carbenicillin (50 ⁇ g/ml).
  • the overnight culture was diluted 1:200 in LB medium with carbenicillin, pH 7.4, and cultured at 37°C to optical density at 600 nm of ⁇ 0.5.
  • Protein expression was induced by addition of isopropyl- ⁇ -D-thiogalactopyranoside (IPTG) to a final concentration of 0.2 mM and the cultures were incubated for an additional 5-6 hours at room temperature.
  • IPTG isopropyl- ⁇ -D-thiogalactopyranoside
  • GST-hSTn was purified from the lysate with columns containing glutathione
  • Sepharose ® 4B matrix (Amersham Biosciences). In-column bound protein was incubated for 10 min in buffer A containing 5 mM ATP, 5 mM MgSO4 and 0.1 mg/ml denatured E. coli proteins. This was washed with a buffer of 5OmM Tris ⁇ Cl (pH 8.0),
  • Saratan While recombinant Saratan was produced in E coli, the N-terminal peptide including 61 amino acids of Saratan (MDLSFMAAQLPMMGGAFMDSPNEDFSTEYSLFNSSA NYHAAANGQGQPEDPPRSSNDAVLL; SEQ ID NO: 10) was synthesized by Open Biosystems, AL 5 USA. Polyclonal antisera against the synthesized peptide were also produced by Open Biosystems. This was done using subcutaneous and intramuscular injections of the immunogen into rabbits as described by Bean (Eric S. Bean (2001) Polyclonal Antibodies. In: Basic Methods in Antibody Production and Characterization antibodies. Howard, G. and Bethel D. (ed.), CRC Press, 5:31-50, 2000). The antibodies were affinity purified from the antisera using standard methodology.
  • HMMTOP 2.0 world wide web enzim.hu/hmmtop/
  • TMHMM 2.0 world wide web cbs.dtu.dk/services/TMHMM-2.0/
  • MCF-7 cells were seeded at a concentration of 5 x 10 3 cells/well in 100 ⁇ l RPMI- 1640 culture medium containing 10% FBS into 96 well flat bottom tissue culture microplates with affinity purified rabbit anti-Saratan antibodies or the preimmune serum as the control at a concentration of 600 ⁇ g/ml, or with PBS as the untreated control.
  • the cells were incubated for 48 h in a humidified incubator with 5% CO 2 at 37°C.
  • EXAMPLE 2 RESULTS Expression ofSaratan in MCF-7 mammary carcinoma cells.
  • RT-PCR was used to detect Saratan expression in mammary carcinoma MCF-7 cells. As shown in Fig. I 5 RT-PCR produced a specifically amplified fragment of the predicted size (515 bp). The identity of the PCR product was confirmed by restriction enzyme digestion and DNA sequencing.
  • a panel of cDNAs from various human tissues was screened for mRNA expression with primers that are specific for human Saratan. Saratan transcript was detected in most tissues tested (Fig. 2A). The highest expression was found in fetal brain, cerebellum, brain, and spinal cord: Modest expression was seen in skin, kidney, fetal liver, adrenal gland, cartilage, ovary, uterus, and pancreas. Some expression or undetected expression was noted in prostate, skeletal muscle, normal colon, small intestine, stomach, thymus, liver, lung, trachea, placenta, adipose, stimulated PBL, thyroid, umbilical cord and PBL, salivary gland, heart, and spleen.
  • Saratan was differentially expressed in the cancer cells tested. Higher expression was detected in DLD-I colon carcinoma cells and T47D (estrogen receptor positive), BT549 (estrogen receptor negative) and MCF-7 (estrogen receptor positive) breast cancer cells. Moderate expression was observed in A549 lung carcinoma cells, DU145 prostate cancer cells, and RL95-2 endometrial carcinoma cells. Some expression was observed in AGS stomach cancer cells. Saratan is a cytoplasmic and membrane bound protein.
  • MCF-7 cells were transiently transfected with an expression construct that expresses Saratan with a C-terminal EGFP-tag, or with the pEGFP-Nl vector as a negative control.
  • the localization of the fluorescent fusion protein was determined by using laser-scanning confocal microscopy. As shown in Fig. 3, Saratan-EGFP fusion protein was localized in discrete cytoplasmic structures and also at the cell membrane whereas the EGFP alone was diffusely present in both the cytoplasm and nucleus.
  • Saratan is exposed to the outside of the cell membrane.
  • MCF-7 cells were also transfected with the empty control vector phCMVl, however, no immunofluorescence was observed in cells with treatment (panel e, Fig. 4B) or without treatment (panel f, Fig. 4B) with permeabilisation agent.
  • Saratan was cloned and Saratan- overexpressing cells were generated.
  • An insert containing the coding sequence of Saratan in an IMAGE cDNA clone was subcloned into phCMVl expression vector.
  • the human breast cancer cell line MCF-7 was stably transfected with the Saratan expression plasmid construct phCMV-hST (designated MCF7-hST) or the empty vector phCMVl (designated MCF7-Vec).
  • overexpression of Saratan was detected in MCF7-hST cells compared with the control MCF7-Vec cells.
  • MCF7-hST cells replicated much faster than the control MCF7-Vec cells. After 10 days, the cell number of MCF7-hST transfectants increased by 85% (calculated as 1.85 fold) as compared with that of MCF7-Vec transfectants.
  • BrdU incorporation assays were used to examine the mechanism by which Saratan stimulates proliferation of MCF-7 cells. As shown in Fig. 9, forced overexpression of Saratan in stable trasfectant MCF-7 cells increased BrdU incorporation by 27% compared with the stably transfected control cells with vector alone. Reduction of Saratan expression in MCF-7 siRNA-A cells resulted in decreased BrdU incorporation by 82% compared to control MCF-7 siRNA-CK cells. From these experiments, we deduced that the stimulatory effect of Saratan on cell proliferation was due to increased DNA synthesis. Conversely, the inhibitory effect of effect of siRNA-A was due to decreased DNA synthesis.
  • Saratan-specific siRNA specifically decreases such migration and invasion.
  • GST fusion protein expression vector pGEX 4Tl After transforming the pGEX 4Tl- hSTn plasmid into BL21-Gold cells, the production of GST-hSTn was successfully achieved upon induction with IPTG. GST-hSTn fusion protein was purified with glutathione Sepharose 4B matrix. After cleavage of GST tag, recombinant Saratan protein was produced. The integrity and purity of the recombinant GST-hSTn protein was determined by SDS-PAGE (Fig. 11).
  • the recombinant N-terminal peptide included a sequence of gsMDLSFMAAQLPMMGGAFMDSPNEDFSTEYSLFNSSANVHAAA NGQGQPEDPPRSSNDAVLL (SEQ ID NO:67; the linker sequence is shown in lower case) with a predicted MW of 6.6 kDa, and an apparent MW of ⁇ 12 kDa on SDS- PAGE.
  • the antiserum was able to recognise not only the immunogen but also recombinant Saratan in Western blot analysis.
  • the antiserum recognised the recombinant N-terminal Saratan as a band of ⁇ 12 kDa, as shown by Coomassie blue stained SDS-PAGE (Fig. 11), and the synthesized immunogen as a band of 6.5 kDa, as predicted.
  • the antibodies recognised both synthesized and bacterially produced Saratan in Western blots, in amounts as low as 5 ng.
  • the rabbit polyclonal antibodies raised against Saratan were used to examine the endogenous expression of Saratan in MCF-7 cells.
  • MCF-7 cells were transiently transfected with pEGFP-Nl -hST expressing EGFP-tagged Saratan or pEGFP-Nl empty vector.
  • EGFP-tagged Saratan or EGFP proteins were viewed as green fluorescence using UV- visible fluorescence microscopy. Consistent with the results shown hi Fig. 3, Saratan-EGFP fusion protein was localized to discrete cytoplasmic structures and also at the cell membrane (Fig. 13B), while EGFP alone was diffusely localized to both the cytoplasm and nucleus (Fig. 13A).
  • MTT assay is based on the observation that only metabolically active cells are able to cleave MTT (yellow tetrazolium salt), to produce formazan (purple crystals), which can be solubilized and quantified by spectrophotometric means.
  • MTT assay has been accepted as one of the most sensitive and reliable cell biological approaches to quantitatively measure cellular proliferation, viability, and activation of a population in response to external factors.
  • MCF-7 cells express Saratan at relative high levels.
  • MTT assay to test the effect of rabbit anti-Saratan polyclonal antibodies on the proliferation of MCF-7 cells.
  • the Saratan antiserum strongly inhibited the MCF-7 cell proliferation. After 48 h of incubation, Saratan antiserum reduced the viability of MCF-7 cells by 56.1% compared with the preimmune control.
  • Rabbit anti-Saratan polyclonal antibodies significantly impair migration and invasion of mammalian carcinoma MCF-7 cells.
  • MDA-231 cells were treated with the purified rabbit anti- Saratan antibodies or the preimmune serum as the control at a concentration of 600 ⁇ g/ml in migration and invasion assays. As shown in Figs. 18A and B, both migration and invasion of MDA-231 cells were markedly reduced by inclusion of the rabbit anti- Saratan polyclonal antibodies compared with the preimmune serum control. We observed a 41.0% decrease in migration and a 87.4% decrease in invasion.
  • MDA-231 is estrogen-independent and highly invasive (Hiraguri S, Godfrey T, Nakamura H, Graff J, Collins C, Shayesteh L, Doggett N, Johnson K, Wheelock M, Herman J, Baylin S, Pinkel D, Gray J. Mechanisms of inactivation of E-cadherin in breast cancer cell lines. Cancer Res. 1998 May l;58(9):1972-7; and Larkins TL, Nowell M, Singh S, Sanford GL. Inhibition of cyclooxygenase-2 decreases breast cancer cell motility, invasion and matrix metalloproteinase expression. BMC Cancer. 2006 JuI 10;6:181). Therefore, it was not surprising that a more dramatic decrease in cell invasion was observed (Fig. 18B).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biomedical Technology (AREA)
  • Cell Biology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Plant Pathology (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)

Abstract

The invention relates to Saratan polypeptides, polynucleotides, and antibodies. The invention also relates to expression vectors and host cells for producing these polypeptides, polynucleotides, or antibodies. The invention further relates to diagnostics and therapeutics, especially for cancer, and particularly breast cancer, comprising one or more of the disclosed polypeptides, polynucleotides, antibodies, expression vectors, host cells, or compositions thereof.

Description

NOVEL SARATAN POLYPEPTmES AND POLYNUCLEOTmES AND METHODS OF USE THEREOF
FIELD OF THE INVENTION The invention relates to Saratan polypeptides, as well as Saratan polynucleotides and antibodies to Saratan. The invention also relates to expression vectors and host cells for producing these polypeptides, polynucleotides, or antibodies. The invention further relates to methods for diagnosis and treatment, especially for cancer, and particularly breast cancer, colon cancer, lung cancer, prostate cancer, endometrial cancer, and stomach cancer, using one or more of the disclosed polypeptides, polynucleotides, antibodies, expression vectors, host cells, or compositions thereof.
BACKGROUND OF THE INVENTION
Traditional therapies used to treat cancer patients include surgery, radiation, chemotherapy, and sex hormone therapy. However, there are always a large number of cancer patients whose condition does not respond to these traditional therapies. Because uncontrolled cell proliferation, cell survival, and/or cell motility are the hallmarks of cancer, for many decades, the most direct and effective strategy in the field of cancer therapy has been to attempt to stop cancer growth by blocking cell division. Traditional chemotherapy agents are therefore toxic to healthy cells as well as cancer cells.
Moreover, the inherent genetic instability of neoplastic cells eventually results in the selection of drug-resistant clones after prolonged exposure to chemotherapy.
Targeting specific pathways to stop cancer growth has emerged as an alternative strategy for new drug development because of less toxicity and high tolerability. For example, an increasing number of compounds directed against the EGFR and HER2 receptors have entered clinical development and are currently in clinical trials. Thus, there is a continuing need for new anti-cancer agents, hi particular, there is a need to identify specific genes and proteins that can be targeted to inhibit cancer cells. SUMMARY OF INVENTION
The present invention stems from the identification of a novel open reading frame which encodes a new polypeptide, termed Saratan, which among other things, acts to promote cancer cell proliferation, migration, and invasion.
The invention disclosure features an isolated Saratan polypeptide comprising at least one amino acid sequence selected from the group consisting of SEQ ID NO:1, 3, 8-10, 49-64, 102-104. In a particular aspect, the polypeptide comprises the amino acid sequence of SEQ ID NO:1, 8-10. hi a further aspect, the polypeptide comprises the amino acid sequence of SEQ ID NO:1. In another aspect, the polypeptide is a fragment, for example, comprising at least one amino acid sequence extending from amino acids 59-81 of SEQ ID NO:1, or from amino acids 1-61 of SEQ ID NO:1.
The invention disclosure also features an isolated Saratan polynucleotide comprising a coding sequence for at least one polypeptide. In one aspect, the polynucleotide comprises a coding sequence for at least one amino acid sequence selected from the group consisting of SEQ ID NO:1, 3, 8-10, 49-64, 102-104. In a particular aspect, the polynucleotide comprises a coding sequence for SEQ ID NO:1, 8-10. hi a further aspect, the polynucleotide comprises a coding sequence for SEQ ID NO:1. In another aspect, the polynucleotide comprises a fragment of a coding sequence, for example, at least one amino acid sequence extending from amino acids 59-81 of SEQ ID NO:1, or from amino acids 1-61 of SEQ ID NO:1.
In an additional aspect, the invention disclosure features an isolated Saratan polynucleotide comprising a nucleic acid sequence selected from the group consisting of SEQ ID NO:14-16, 19, 22, 25-27, 28-30, 37, 38, 41, 42, 45-48, 65, 66, 68-73, 74-
101, 120-122. In a particular aspect, the polynucleotide comprises the nucleic acid sequence of SEQ ID NO: 14. In another aspect, the polynucleotide is a fragment or an oligonucleotide comprising, for example, the nucleic acid sequence extending from nucleotides 175-249 of SEQ ID NO:14. In addition, the invention encompasses an isolated polynucleotide, or fragment thereof, which hybridizes to any one of the nucleic acid sequences of SEQ ID NO:14-16, 19, 22, 25-27, 28-30, 37, 38, 41, 42, 45-48, 65,
66, 68-73, 74-101, 120-122. The invention further encompasses an isolated polynucleotide comprising the complement, reverse complement, reverse sequence, or fragments thereof, of any one of the nucleic acid sequences.
Further featured as part of the invention disclosure are inhibitory agents, such as Saratan antisense polynucleotides and Saratan interfering RNAs (iRNAs) and small interfering RNAs (siRNAs). Preferably, the agent is a nucleic acid adapted to inhibit Saratan in use. More preferably, the agent is selected from the group consisting of: an antisense nucleic acid directed to a Saratan transcript; a nucleic acid adapted to express such antisense in use; iRNA directed to a Saratan transcript; and a nucleic acid adapted to express such iRNA in use. In a particular aspect, the invention disclosure features an iRNA directed to the Saratan transcript, or a nucleic acid adapted in use to express an iRNA directed to the Saratan transcript, wherein the iRNA comprises any one of the nucleotide sequences of SEQ ID NO:16-24, 25-36, 45-48, 68-73, 75-89, 96-100. Such antisense polynucleotides and iRNAs, in particular, siRNAs, can inhibit expression of a Saratan polynucleotide, e.g., SEQ ID NO:14-16, 19, 22, 75-77, 101, 120-122, or modified sequences thereof. The invention disclosure features expression vectors, as well as host cells, for producing these antisense polynucleotides or iRNAs.
The invention disclosure features an expression vector comprising a Saratan polynucleotide. In one aspect, the expression vector comprises a coding sequence for at least one amino acid sequence selected from the group consisting of SEQ ID NO:1, 3,
8-10, 49-64, 102-104. In a particular aspect, the expression vector comprises a coding sequence for at least one amino acid sequence of SEQ ID NO:1, 8-10. In a further aspect, the expression vector comprises a coding sequence for at least one amino acid sequence of SEQ ID NO:1. In another aspect, the expression vector comprises a coding sequence for at least one amino acid sequence extending from amino acids 59-81 of
SEQ ID NO: 1, or from amino acids 1-61 of SEQ ID NO:1.
The invention disclosure also features a host cell, for example, a microbial host cell, comprising at least one expression vector.
The invention disclosure additionally features modified Saratan polypeptides, e.g., for at least one of SEQ ID NO:1, 3, 8-10, 49-64, 102-104, including biologically active alterations, fragments, variants, and derivatives, described herein. Also featured are polynucleotides encoding these modified polypeptides, as well as alterations, fragments, variants, and derivatives of the disclosed polynucleotides, expression vectors comprising these polynucleotides, and host cells comprising these vectors. In specific aspects, the compositions and methods of the invention employ these modified polynucleotides or polypeptides, or corresponding expression vectors or host cells.
hi addition, the invention disclosure features Saratan polypeptides, e.g., at least one of SEQ ID NO.l, 3, 8-10, 49-64, 102-104, or modified sequences thereof, which include fusions or conjugates with a heterologous agent as described in detail herein.
As another feature, the invention disclosure includes Saratan antibodies. The antibodies can be polyclonal or monoclonal antibodies, and any modified antibodies. Such antibodies can bind to a Saratan polypeptide, e.g., SEQ ID NO:1, 3, 8-10, 49-64, 102- 104, or a modified sequence thereof. In particular aspects, the antibodies can be directed to the native polypeptide, any peptides derived from this polypeptide, any modifications of these polypeptides or peptides (e.g., where primary structure is based on the sequence of Saratan), or any polypeptides or peptides which mimic the 3-D conformation of Saratan.
The invention disclosure features a composition comprising an isolated Saratan polypeptide, e.g., at least one of SEQ ID NO:1, 3, 8-10, 49-64, 102-104. Also featured is a composition comprising an isolated polynucleotide, e.g., at least one of SEQ ID NO:14-48, 65, 66, 68-73, 74-101, 120-122. Further featured is a composition that includes an antibody, expression vector, or host cell comprising an expression vector, in accordance with the invention. The composition can include any one of the biologically active alterations, fragments, variants, and derivatives described herein. The composition can include at least one fusion or conjugate. The composition can be formulated, for example, as pharmaceutical compositions described in detail herein.
The invention disclosure also features a composition of the invention as part of a kit for diagnosis or treatment, especially for cancer, and particularly breast cancer, colon cancer, lung cancer, prostate cancer, endometrial cancer, or stomach cancer, in accordance with the disclosed methods. The kits can comprise: a) at least one Saratan component (e.g., polypeptide, polynucleotide, or antibody) as set out herein; and b) optionally, instructions for use, for example, in diagnosing or treating cancer.
The invention disclosure also features a method for producing a Saratan polypeptide, the method comprising the steps of: a) culturing an expression vector or host cell comprising an expression vector, which comprises at least part of a coding sequence for at least one Saratan polypeptide under conditions suitable for the expression of the polypeptide; and b) recovering the polypeptide from the culture. In particular aspects, the polypeptide comprises at least one amino acid sequence selected from the group consisting of SEQ ID NO:1, 3, 8-10, 49-64, 102-104, or modified sequences thereof.
The invention disclosure additionally features a method for producing a Saratan polypeptide, e.g., for at least one of SEQ ID NO:1, 3, 8-10, 49-64, 102-104, which comprises a fusion or conjugate as described in detail herein. Such method comprises: a) culturing an expression vector or host cell comprising an expression vector, which comprises a coding sequence for at least one Saratan polypeptide under conditions suitable for the expression of the polypeptide; b) forming the Saratan fusion or conjugate (e.g., by expression of the fused sequence or by chemical conjugation); and c) recovering the fusion or conjugate. In particular aspects, the polypeptide comprises at least one amino acid sequence selected from the group consisting of SEQ ID NO: I5 3, 8-10, 49-64, 102-104, or modified sequences thereof.
In addition, the invention disclosure features a method of inhibiting a cancer cell (e.g., inhibiting cell proliferation, cell survival, or cell motility), in particular, a cell from breast cancer, colon cancer, lung cancer, prostate cancer, endometrial cancer, or stomach cancer. The method comprises use of at least one inhibitor of Saratan (e.g., polynucleotides or antibodies) as described herein, comprising contacting the cell with the inhibitor. In particular aspects, the inhibitor is selected from chemical compounds (e.g., small molecules), antagonists, antibodies, antisense polynucleotides, and iRNAs.
Exemplary cancers and cancer cells are described in detail herein. As an added feature, the invention disclosure encompasses a method of treating cancer in a subject, in particular, breast cancer, colon cancer, lung cancer, prostate cancer, endometrial cancer, or stomach cancer. In certain aspects, the method comprises administering at least one inhibitor of Saratan (e.g., polynucleotides or antibodies) to the subject, or a composition, for example, pharmaceutical composition, thereof. In particular aspects, the inhibitor is selected from chemical compounds (e.g., small molecules), antagonists, antibodies, antisense polynucleotides, and iRNAs. Applicable cancers and cancer cells are described in detail herein.
In various aspects, the methods of the invention disclosure utilize in vivo or in vitro expression systems. In other aspects, the methods employ polynucleotides or polypeptides produced by recombinant, synthetic, or semi-synthetic means, or polynucleotides or polypeptides produced by endogenous means (e.g., naturally occurring components).
In one specific aspect, the invention comprises an isolated Saratan RNA molecule comprising a nucleic acid sequence selected from the group consisting of SEQ ED NO: 101 and 120-122, or a sequence complementary thereto.
In another aspect, the invention comprises an isolated Saratan RNA molecule comprising the nucleic acid sequence of SEQ ID NO:74, or a sequence complementary thereto.
In yet another aspect, the invention comprises an isolated Saratan RNA molecule comprising a nucleic acid sequence selected from the group consisting of SEQ ID NO:75-77, or a sequence complementary thereto.
In still another aspect, the invention comprises an isolated Saratan RNA molecule comprising a nucleic acid sequence selected from the group consisting of SEQ ID NO:68-73, 78-89, and 96-98, or a sequence complementary thereto. In an additional aspect, the invention comprises an isolated Saratan KNA molecule comprising a nucleic acid sequence selected from the group consisting of SEQ ID NO:90-95, and 99-100, or a sequence complementary thereto.
In a further aspect, the invention comprises an isolated Saratan RNA molecule comprising a nucleic acid sequence having at least 95% identity to any one of SEQ ID NO:101 and 120-122, or a sequence complementary thereto.
In yet a further aspect, the invention comprises an isolated Saratan RNA molecule comprising a nucleic acid sequence having at least 95% identity to SEQ ID NO:74, or a sequence complementary thereto.
The invention also comprises an antisense RNA molecule which binds to the nucleic acid sequence of any one of the preceding aspects.
The invention additionally comprises an antisense RNA molecule comprising the nucleic acid sequence of any one of the preceding aspects.
The invention further comprises a small interfering RNA molecule which inhibits translation of the nucleic acid sequence of any one of the preceding aspects.
The invention yet further comprises a small interfering RNA molecule comprising the nucleic acid sequence of any one of the preceding aspects.
The invention still further comprises an RNA oligonucleotide comprising the nucleic acid sequence of any one of the preceding aspects.
Also included in the invention is a vector which expresses the nucleic acid sequence of any one of the preceding aspects.
Additionally included in the invention is a host cell which comprises the vector of any preceding aspect. In another aspect, the invention comprises an isolated. Saratan polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO:1 and 102- 104, or a functional fragment thereof.
In yet another aspect, the invention comprises an isolated Saratan polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO:8-10.
In still another aspect, the invention comprises an isolated Saratan polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO:49-64, and l l5.
In an additional aspect, the invention comprises an isolated Saratan polypeptide comprising an amino acid sequence having at least 97% identity to SEQ ID NO:1.
The invention also comprises an isolated Saratan RNA molecule which encodes the amino acid sequence of any one of the preceding aspects.
The invention additionally comprises a Saratan antibody or antibody fragment which binds to the amino acid sequence of any one of the preceding aspects.
The invention further comprises a Saratan antibody or antibody fragment which binds to the amino acid sequence of any one of the preceding aspects.
The invention yet further comprises a Saratan antibody of any one of the preceding aspects which is monoclonal.
The invention still further comprises a composition comprising the isolated Saratan RNA molecule of any one of the preceding aspects.
Also included in the invention is a composition comprising the antisense RNA molecule of any one of the preceding aspects, or the small interfering RNA molecule of any one of the preceding aspects. Additionally included in the invention is a composition comprising the vector of any preceding aspect or the host cell of any preceding aspect.
Further included in the invention is a composition comprising the isolated Saratan polypeptide of any one of the preceding aspects.
Yet further included in the invention is a composition comprising the Saratan antibody of any one of the preceding aspects.
Still further included in the invention is pharmaceutical composition comprising the composition of any one of the preceding aspects, and a physiologically acceptable carrier.
In another aspect, the invention comprises the use of the composition of any one of the preceding aspects, in the preparation of a medicament for the treatment of cancer in an individual, wherein the cancer is selected from the group consisting of breast cancer, colon cancer, lung cancer, prostate cancer, endometrial cancer, and stomach cancer. In particular aspects of the invention, the cancer may be metastatic cancer.
La yet another aspect, the invention comprises a method for treating cancer in an individual comprising administering the pharmaceutical composition of any preceding aspect to the individual, thereby treating the cancer, wherein the cancer is selected from the group consisting of breast cancer, colon cancer, lung cancer, prostate cancer, endometrial cancer, and stomach cancer. In particular aspects, the cancer may be metastatic cancer.
The invention disclosure may also be said broadly to consist in the parts, elements and features referred to or indicated in the specification of the application, individually or collectively, in any or all combinations of two or more of said parts, elements or features, and where specific integers are mentioned herein which have known equivalents in the art to which the invention relates, such known equivalents are deemed to be incorporated herein as if individually set forth. Other aspects and embodiments of the invention disclosure are described herein below.
BRIEF DESCRIPTION OF THE DRAWINGS These and other aspects of the present invention, which should be considered in all its aspects, will become apparent from the following description, which is given by way of example only, with reference to the accompanying figures:
Fig. 1. Expression of Saratan in MCF-7 mammary carcinoma cells. Total RNA was isolated from the MCF-7 cells. The expression of Saratan was detected by RT-PCR using One-step RT-PCR kit (Qiagen). M, 1 kb plus DNA ladder; hST, human Saratan.
Fig. 2A-B. mRNA expression pattern of human Saratan in human normal tissues and cancer cell lines. (Fig. 2A) Saratan was amplified by PCR with Saratan specific primers from cDNAs made from a panel of different human tissues (Primgen). The tissue of origin is marked above each lane. β2M, the β2-microglobulin was used as the cDNA input control. (Fig. 2B) The expression of Saratan in human cancer cell lines was examined by RT-PCR with the same Saratan specific primer pairs using One-step RT- PCR kit (Qiagen). β-actin was included as the RNA input control.
Figs. 3A-B. Cytoplasmic localization of Saratan-EGFP in MCF-7 cells. MCF-7 cells were transiently transfected with pEGFP-Nl-hST (Fig. 3A) or the pEGFP-Nl vector (Fig. 3B). 24 h after transfection, cells were fixed and nuclei were counterstained with DAPI (blue). The expression and cellular localization of the green fluorescent Saratan- EGFP fusion protein (hST-EGFP) or EGFP protein in MCF-7 was monitored using a confocal laser scanning microscope. Bar, 10 μM.
Figs. 4A-B. The N-terminal of Saratan is located outside of the cell membrane. (Fig. 4A) Western blot of MCF-7 cells transiently transfected with plasmids phCMVn- hST, phCMVc-hST or the empty phCMVl vector plasmid as a control. The expression of HA-tagged Saratan was detected by the rabbit polyclonal HA-Probe (Y-11) (Santa Cruz Biotech). (Fig. 4B) MCF-7 cells were transiently transfected with plasmids phCMVn-hST or phCMVc-hST expressing N-terminal HA-tagged Saratan (HA-hST, panels a-b, Fig. 4B) and a C-terminal HA-tagged Saratan (hST-HA, panels c-d, Fig. 4B), respectively, or with the empty phCMVl vector plasmid as a control (panels e-f, Fig. 4B). After fixation, cells were permeabilized with 0.5% Triton® X-100 for 30 min (panels a, c and e, Fig. 4B) or were not permeabilized (panels b, d and f, Fig. 4B). Then, the expression of HA-tagged Saratan was examined with the rabbit polyclonal HA- Probe (Y-Il) (Santa Cruz Biotech) followed by incubation with a FITC-labeled anti- rabbit second antibody (Sigma). Nuclei were counterstained with DAPI (blue). Bar, 10 μM.
Figs. 5A-B. Forced Saratan overexpression in MCF-7 cells. Cells were stably transfected with plasmids expressing Saratan (MCF7-hST, Fig. 5A) or the empty vector plasmid (MCF7-Vec, Fig. 5B) as control as indicated. The expression of Saratan was examined by RT-PCR with Saratan specific primers, β-actin was used as input control for RT-PCR. M, 1 kb plus DNA ladder.
Fig. 6. Forced overexpression of Saratan significantly increases cell proliferation.
MCF-7 cells that stably express hST were produced by introducing an hST expression plasmid (MCF7-hST). As a control, cells were transfected with empty vector (MCF7- Vec). Cells were seeded at a density of 50,000 cells per a well in six-well plates in triplicates in 3 ml of RPMI 1640 with 10% serum. Cells were cultured up to 10 days with media changed every other day. Cell number was determined after trypsinization every 2 days.
Figs. 7A-B. Efficiency of siRNA construct in reducing Saratan expression. MCF-7 cells were stably transfected with plasmids expressing Saratan specific siRNA constructs pSilencer 2.1 -siRNA- A, B, and C, as well as empty vector as a control (siRNA-vec). The expression of Saratan (hST) was determined by RT-PCR (Fig. 7A) with β-actin as an internal control. The quantification was done with a UVP-system and normalised to β-actin with the density of siRNA- vec as 1.00 (Fig. 7B).
Fig. 8. Inhibition of cell proliferation by siRNA of targeting Saratan. MCF-7 cells that stably express siRNA specific for Saratan (siRNA-A), and control siRNA with limited homology to any known sequences in the human genomes (Ambion) (siRNA- CK), were seeded at a density of 50,000 cells per a well in six-well plates in triplicate in 3 ml of RPMI 1640 with 10% serum. Cells were cultured up to 10 days with media changed every other day. Cell number was determined after trypsinization every 2 days.
Fig. 9. Over-expression of Saratan increased BrdU incorporation while siRNA specific for Saratan decreased BrdU incorporation. MCF-7 cells that stably express Saratan were produced by transfecting a Saratan expression plasmid (MCF7-hST). Alternatively, cells were transfected with empty vector (MCF7-Vec), or by vector for expressing siRNA specific for hST (siRNA- A), or control siRNA (siRNA-CK). Cells were seeded on glass coverslip in six- well plates in full media and incubated overnight before 18 hours of serum starvation in serum-free media. Cells were then pulse labelled with BrdU. Proliferating cells were detected by anti-BrdU mouse monoclonal antibody using a BrdU staining kit (Zymed). The cell nuclei were counterstained with hematoxylin. Cells with dark brown nuclear staining were counted as BrdU-positive cells. The percentage of BrdU-positive nuclei relative to the total number of nuclei was calculated from 10 random fields per coverslip.
Figs. 10A-D. Forced expression of Saratan significantly promotes the migration and invasion of mammary carcinoma MCF-7 cells. (Fig. 10A) Migration assay.
MCF7-hST cells over-expressing Saratan or MCF7-Vec control cells in serum-free media were loaded into the upper side of the 8-μm-pore-size Transwell inserts. These were placed into lower chambers with full media containing 10% FBS. The loaded chambers were incubated for 48h. Cells in the upper chamber were removed with cotton swabs and those that had migrated to the lower surface of the inner chamber were identified microscopically under a UV-visible fluorescence microscope after staining with Hoechst 33258. Representative fields of cells which had migrated to the bottom side of the Transwell filters are presented on the right. (Fig. 10B) Invasion assay. The same as the cell migration assay except that the upper side of the filters was coated with a layer of Matrigel. Representative fields of cells which had invaded to the bottom side of the Transwell filters are presented on the right. (Fig. 10C) Additional migration assay. The same as in Fig. 1OA except that transiently transfected MCF-7 cells were used. Cells were transiently transfected by vector producing siRNA to specifically target Saratan mRNA (siRNA-A) or by vector producing siRNA negative control (siRNA-CK). (Fig. 10D) Invasion assay. The same as in Fig. 1OC except that the upper sides of the filters were coated with a layer of Matrigel. All numerical data presented are the means ± standard deviation (SD) of triplicates. *, p<0.05; **, p<0.01; ***, pO.001.
Fig. 11. Production of recombinant human Saratan protein in bacteria. The N- terminal peptide including 61 amino acids of Saratan was expressed in bacteria as a GST fusion protein (GST-hSTn) and purified with glutathione Sepharose 4B matrix (Amersham Biosciences). Purified human recombinant N-terminal peptide of Saratan (hSTn) protein was analysed by SDS-PAGE and visualised by Coomassie blue staining and was shown as a 12 kDa band as indicated by arrow. GST-hSTn fusion protein is also indicated. Molecular mass markers are indicated in kDa by bars on the left.
Fig. 12. Characterization of antiserum against synthesized N-terminal Saratan peptide. Synthesized N-terminal Saratan peptide and the recombinant protein were separated by SDS-PAGE and immunoblotted by polyclonal antibody against the synthesized N-terminal Saratan peptide by Western blot. Molecular mass markers are indicated by bars in kDa on the left.
Figs. 13A-H. Immunofluorescence staining of Saratan expression in MCF-7 cells. Cells were transfected with EGFP-tagged Saratan expressing plasmid pEGFP-Nl-hST {right column) or empty pEGFP-Nl vector plasmid {left column). 24 h after transfection, cells were fixed and Saratan expression was detected with the rabbit polyclonal antibody against Saratan by indirect immunofluorescence staining with tetramethyl Rhodamine isothiocyanate (TRITC) conjugated secondary antibody. Nuclei of cells were visualized by DAP staining. Images were taken using a UV-visible fluorescence microscope with proper filters. Merged, combined images of green, red and blue fluorescence.
Fig. 14. Rabbit polyclonal antibodies against Saratan significantly inhibit the growth of MCF-7 cells. MCF-7 cells were seeded into 96 wells microplates without
(PBS) or with affinity purified rabbit anti-Saratan antibodies (Antiserum) or the preimmune serum as the control (Preimmune) at a concentration of 600 μg/ml. After incubation of 48 h, the cell proliferation was determined by MTT assay. All numerical data presented are the means ± standard deviation (SD) of triplicates. **, p<0.01; ***, pO.001. 5
Figs. 15A-B. Rabbit anti-Saratan polyclonal antibodies significantly impair migration and invasion of mammalian carcinoma MCF- 7 cells. (Fig. 15A) Cell migration assay. Cells in serum-free media containing affinity purified rabbit anti- Saratan antibodies (Antiserum) or the preimmune serum as the control (Preimmune) at a
10 concentration of 600 μg/ml were loaded into the upper chambers of non-coated 8 μm pore size Transwell inserts. These were placed into lower chambers with full media containing 10% FBS. The loaded chambers were incubated for 24h. Cells in the upper chamber were removed with cotton swabs and those that had migrated to the lower surface of the inner chamber were identified under a UV-visible fluorescence
15 microscope after staining with Hoechst 33258. Representative fields of cells which had migrated to the bottom side of the Transwell filters are presented on the right. (Fig. 15B) Cell invasion assay. Same as the cell migration assay except that the upper side of the filters was coated with a layer of Matrigel. Representative fields of cells which had invaded to the bottom side of the Transwell filters are presented on the right. All
20 numerical data presented are the means ± standard deviation (SD) of triplicates. **, pO.OL
Fig. 16. Expression of Saratan in MDA-231 mammary carcinoma cells. Total RNA was isolated from the MDA-231 cells. The expression of Saratan was detected by RT- 25. PCR with hST-F4 and hST-R4 primers using One-step RT-PCR kit (Qiagen). The specific band amplified is indicated by arrow. M, 1 kb plus DNA ladder; hST, human Saratan.
Figs. 17A-H. Immunofluorescence staining of Saratan expression in MDA-231
30 cells. Indirect immunofluorescence staining was performed on fixed cells with either the affinity-purified rabbit anti-Saratan polyclonal antibodies (Antiserum, right panels) or the preimmune serum (Preimmune, left panels) with fluorescein isothiocyanate (FITC) conjugated secondary antibodies. Nuclei of cells were visualized by propidium iodide (PI) staining. Images were taken using a UV-visible fluorescence microscope with proper filters. Merged, combined images of green and red fluorescence; Visible, images of cell morphology under a normal visible light.
Figs. 18A-B. Rabbit anti-Saratan polyclonal antibody significantly impaired migration and invasion of mammalian carcinoma MDA-231 cells. (Fig. 18A) Cell migration assay. Cells in serum-free media containing affinity purified rabbit anti- Saratan antibodies (Antiserum) or the preimmune serum as the control (Preimmune) at a concentration of 600 μg/ml were loaded into the upper chambers of non-coated 8 μm pore size Transwell inserts. These were placed into lower chambers with full media containing 10% FBS. The loaded chambers were incubated for 24h. Cells in the upper chamber were removed with cotton swabs and those that had migrated to the lower surface of the inner chamber were identified under a UV-visible fluorescence microscope after staining with Hoechst 33258. Representative fields of cells migrated to the bottom side of the Transwell filters were presented on the right. (Fig. 18B) Cell invasion assay. The same as the cell migration assay except that the upper side of the filters was coated with a layer of Matrigel. Representative fields of cells invaded to the bottom side of the Transwell filters were presented on the right. All numerical data presented are the means ± standard deviation (SD) of triplicates. **, p<0.01; ***, pO.001.
Figs. 19A-F. Saratan amino acid and nucleotide sequence information. (Fig. 19A)
The derived amino acid sequence of Saratan protein is presented in single letter code. The predicted transmembrane domain for Saratan is depicted in bold, with underlining. (Fig. 19B) The nucleotide sequence of Saratan cDNA is shown (GenBank Ace. No. NM_020215). The Saratan coding region (underlined) extends from nucleotides 161 to 412, with both the start (ATG) and stop (TGA) codons shown in bold. (Fig. 19C) Schematic diagram of alternatively spliced mRNA isoforms of human Saratan. Exons are shown in solid bars with coding regions representing by bars shaded in red and non- coding regions in yellow. Introns are shown by lines and their sizes are indicated above. The GenBank accession numbers of representative EST clones of each transcript are shown in brackets. (Adapted from NCBI Ace View for Homo sapiens gene C14orfl32
(Thierry-Mieg D, Thierry-Mieg J. Ace View: a comprehensive cDNA-supported gene and transcripts annotation. Genome Biol. 2006;7 Suppl 1:S12.1-14. Epub 2006 Aug T). (Fig. 19D) The amino acid sequences and their alignment of Saratan isoforms α, β, and γ encoded by alternatively spliced transcripts a and b, c, and d, respectively. (Fig. 19 E) Amino acid sequence alignments of Saratan with XP_875290 (Bos taurus), XP_001147850 (Pan troglodytes), XP_001476208 (Mus musculus), EDL81821 (Rattus norvegicus) and XP_001334647 (Danio rerio) obtained from BLAST (hypertext transfer protocol://world wide web.ncbi.nlm.nih.gov/BLAST/) and CLUSTAL W (hypertext transfer protocol://world wide web.ebi.ac.uk/clustalw/) analysis. (Fig. 19F). Multiple sequence alignments. (Fig. 19G) Saratan fusion proteins and fragments described in the Examples, below. (Fig. 19H) Saratan RNA sequences. (Fig. 191) Nucleotide sequence of human Saratan transcript a rnRNA deduced from the cloned cDNA of Saratan (GenBank Accession number NM_020215). The initiation codon AUG and the termination codon UGA are underlined and in bold. Polyadenylation signals, AAUAAA and AUUAAA are also underlined and in italics. * indicates the possible position of poly(A) tails. (Fig. 19J) Nucleotide sequence of human Saratan transcript b rnRNA. The initiation codon AUG and the termination codon UGA are underlined and in bold. Polyadenylation signals, AAUAAA and AUUAAA are also underlined and in italics. * indicates the possible position of poly(A) tails. (Fig. 19K) Nucleotide sequence of human Saratan Transcript c rnRNA. The initiation codon AUG and the termination codon UGA are underlined and in bold. Polyadenylation signals, AAUAAA and AUUAAA are also underlined and in italics. * indicates the possible position of poly(A) tails. (Fig. 19L) Nucleotide sequence of human Saratan transcript d rnRNA. The initiation codon AUG and the termination codon UGA are underlined and in bold. Polyadenylation signals, AAUAAA and AUUAAA are also underlined and in italics. * indicates the possible position of poly(A) tails.
Figs. 20A-D. The mouse homolog of human Saratan. (Fig. 20A) The cDNA sequence of mouse Saratan as predicted (GenBank accession number XM_001476158). The initiation codon ATG and the termination codon TGA are underlined and in bold. (Fig. 20B) cDNA sequence alignment of human (NM_020215) and mouse (XM_001476158) Saratan by Blast 2 sequence program. (Fig. 20C) The amino acid sequence of mouse Saratan. (Fig. 20D) The protein sequence alignment of human and mouse Saratan.
DETAILED DESCRIPTION OF THE INVENTION The following is a description of. the present invention, including preferred embodiments thereof, given in general terms. The invention is further elucidated from the disclosure given under the section "Examples" which provides experimental data supporting the invention and specific examples thereof.
Definitions
The term "antibody" should be understood in the broadest possible sense and is intended to include intact monoclonal antibodies and polyclonal antibodies. It is also intended to cover fragments and derivatives of antibodies so long as they exhibit the desired biological activity. Antibodies encompass immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen. These include, but are not limited to, polyclonal, monoclonal, chimeric, single chain, Fc, Fab, Fab', and Fab2 fragments, and a Fab expression library. Antibody molecules relate to any of the classes IgG, IgM, IgA5 IgE, and IgD, which differ from one another by the nature of heavy chain present in the molecule. These include subclasses as well, such as IgGl, IgG2, and others. The light chain may be a kappa chain or a lambda chain. Reference herein to antibodies includes a reference to all classes, subclasses, and types. Also included are chimeric antibodies, for example, monoclonal antibodies or fragments thereof that are specific to more than one source, e.g., a mouse or human sequence. Further included are camelid antibodies or nanobodies. It will be understood that each reference to "antibodies" or any like term, herein includes intact antibodies, as well as any fragments, derivatives, or variants thereof.
"Altered" polynucleotides, as used herein, include those with deletions, insertions, or substitutions of different nucleotides resulting in polynucleotides that encode the same or functionally equivalent. The encoded polypeptides may also be "altered" and contain deletions, insertions, or substitutions of amino acid residues which produce a silent change and result in functionally equivalent sequences. Deliberate amino acid substitutions may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues as long as at least one biological activity (e.g., stimulation of cell proliferation, cell survival, or cell motility) or immunogenic activity of the polypeptide is retained. For example, negatively charged amino acids may include aspartic acid and glutamic acid; positively charged amino acids may include lysine and arginine; and amino acids with uncharged polar head groups having similar hydrophilicity values may include leucine, isoleucine, and valine, glycine and alanine, asparagine and glutamine, serine and threonine, and phenylalanine and tyrosine. Guidance in making substitutions and/or deletions or additions can be obtained, for example, by sequence comparisons to homologues, orthologues, or paralogues, as shown in the figures, herein. Of particular note are the homologous sequences shown herein as SEQ ID NO:4, 7, 107, 110, 114, 116, 117, and 119.
The terms "cancer" and "cancerous" refer to a physiological condition in mammals that is typically characterized by abnormal or unregulated cell proliferation, cell survival, and/or cell motility. Cancer and cancer pathology can be associated, for example, with metastasis, interference with the normal functioning of neighbouring cells, release of cytokines or other secretory products at abnormal levels, suppression or aggravation of inflammatory or immunological response, neoplasia, premalignancy, malignancy, invasion of surrounding or distant tissues or organs, such as lymph nodes, etc. Specifically included are breast cancers, which can include epithelial tumours, nonepithelial tumours, carcinomas, for example, carcinomas in situ, as well as invasive breast cancers. Also included are colon cancers, lung cancers, prostate cancers, endometrial cancers, and stomach cancers, among others.
The terms "complementary" or "complementarity," as used herein, refer to the natural binding of polynucleotides under permissive salt and temperature conditions by base- pairing. For the sequence A-G-T, the complementary sequence is T-C-A, the reverse complement is A-C-T, and the reverse sequence is T-G-A. Complementarity between two single stranded molecules may be partial, in which only some of the nucleic acids bind, or it may be complete when total complementarity exists between the single stranded molecules. The degree of complementarity between nucleic acid strands has significant effects on the efficiency and strength of hybridization between nucleic acid strands. This is of particular importance in amplification reactions, which depend upon binding between nucleic acids strands and in the design and use of iRNAs and PNAs.
The term "derivative," as used herein, refers to the chemical modification of a polynucleotide, or a polynucleotide complementary thereto. Such modifications include, for example, replacement of hydrogen by an alkyl, acyl, or amino group. In preferred aspects, a polynucleotide derivative encodes a polypeptide which retains the biological or immunological function of the natural molecule. A derivative polypeptide is one which is modified by glycosylation, pegylation, or any similar process which retains one or more biological functions (e.g.,, stimulation of cell proliferation, cell survival, or cell motility) or immunogenic function of the sequence from which it was derived. In reference to antibodies, the term "derivatives" includes, for example, hybrid and recombinant antibodies. "Hybrid" and "recombinant" versions of an antibody include, for example, humanised antibodies, diabodies, triabodies, and single chain antibodies.
The term "expression" includes production of polynucleotides and polypeptides, in particular, the production of RNA (e.g., mRNA) from a gene or portion of a gene, and includes the production of a polypeptide encoded by an RNA or gene or portion of a gene, and the appearance of a detectable material associated with expression. For example, the formation of a complex, for example, from a polypeptide-polypeptide interaction, polypeptide-nucleotide interaction, or the like, is included within the scope of the term "expression". Another example is the binding of a binding ligand, such as a hybridization probe or antibody, to a gene or other polynucleotide or oligonucleotide, a polypeptide or a protein fragment, and the visualization of the binding ligand. Thus, increased intensity of a spot on a microarray, on a hybridization blot such as a Northern blot, or on an immunoblot such as a Western blot, or on a bead array, or by PCR analysis, is included within the term "expression" of the underlying biological molecule.
"Inhibition" or "inhibiting" Saratan is intended to refer to blocking or reducing biological activity and/or levels of Saratan. While it may be desirable to completely inhibit the activity of Saratan, this need not be essential. "Inhibition" of Saratan may occur at the level of expression and production of Saratan (e.g., transcriptional or translational levels) or by targeting Saratan function, for example. The terms "inhibit" or "inhibition" of Saratan, as used herein, refer to a decrease, for example, hi DNA levels (e.g., decreased DNA synthesis, increased turnover, and/or decreased stability), RNA levels (e.g., decreased transcription, increased turnover, and/or decreased stability), or polypeptide levels (e.g., decreased translation, increased turnover, and/or decreased stability) or activity, or post-translational modification. An inhibitor can also decrease or block the activities or expression levels of downstream or upstream agents in the Saratan pathway. While the invention is generally directed to Saratan inhibitors, hi some circumstances, there may be beneficial aspects in maintaining or increasing Saratan levels. The disclosed polynucleotides and polypeptides can also be used for such purposes, in accordance with well-known methods.
The term "modified" refers to altered sequences and to sequence fragments, variants, and derivatives, as described herein. The term includes polypeptides, polynucleotides, antibodies, and like agents according to the present disclosure. Preferably, the modified sequences of the invention retain at least one biological activity (e.g., effect on cell proliferation, cell survival, or cell motility) or binding or immunogenic function. Such modifications can be termed "functional" as noted herein.
The term "oligonucleotide" refers to a polynucleotide, typically a probe or primer, including, without limitation, single stranded DNAs, single or double stranded RNAs, RNA:DNA hybrids, and double stranded DNAs. Oligonucleotides, such as single stranded DNA probe oligonucleotides, are often synthesized by chemical methods, for example using automated oligonucleotide synthesizers that are commercially available, or by a variety of other methods, including in vitro expression systems, recombinant techniques, and expression in cells and organisms.
The term "patient" or "subject" includes human and non-human animals. Non-human animals include, but are not limited to, birds and mammals, in particular, mice, rabbits, cats, dogs, pigs, sheep, goats, cows, and horses.
As used herein, the phrase "pharmaceutically acceptable diluents, carriers, and/or excipients" is intended to include substances that are useful in preparing a pharmaceutical composition, and may be co-administered with an agent in accordance with the invention while allowing same to perform its intended function. These are generally safe, non-toxic, and neither biologically nor otherwise undesirable. Examples of pharmaceutically acceptable diluents, carriers, and/or excipients include solutions, solvents, dispersion media, delay agents, emulsions, and the like. Diluents, carriers, and/or excipients may contain minor amounts of additives such as substances that enhance isotonicity and chemical stability.
"Polynucleotide" (e.g., "Saratan," which can be used to discuss a polynucleotide) when used in the singular or plural, generally refers to any nucleic acid sequence, e.g., any polyribonucleotide or polydeoxribonucleόtide, which may be unmodified RNA or DNA or modified RNA or DNA. This includes, without limitation, single and double stranded DNA, DNA including single and double- stranded regions, single and double stranded RNA, and RNA including single and double stranded regions, hybrid molecules comprising DNA and RNA that may be single stranded or, more typically, double stranded or include single and double stranded regions. Also included are triple-stranded regions comprising RNA or DNA or both RNA and DNA. Specifically included are mRNAs, cDNAs, and genomic DNAs, and any fragments thereof. The term includes DNAs and RNAs that contain one or more modified bases, such as tritiated bases, or unusual bases, such as inosine. The polynucleotides of the invention can encompass coding or non-coding sequences, or sense or antisense sequences, or iRNAs such as siRNAs. It will be understood that each reference to a "polynucleotide" or like term, herein, will include the full length sequences as well as any fragments, derivatives, or variants thereof.
It will be further understood that any reference to a "polynucleotide" (or "oligonucleotide," or "probe," or "primer," etc.) having a particular SEQ ID NO. will encompass both the DNA and the counterpart RNA sequences. Regarding the particular RNA/DNA sequences disclosed herein, it is noted that SEQ ID NO: 74 corresponds to SEQ ID NO: 15; SEQ ID NO: 75 corresponds to SEQ ID NO: 16; SEQ ID NO: 76 corresponds to SEQ ID NO: 19; SEQ ID NO: 77 corresponds to SEQ ID NO: 22; SEQ ID NO: 78 corresponds to SEQ ID NO: 25; SEQ ID NO: 79 corresponds to SEQ ID NO: 26; SEQ ID NO: 80 corresponds to SEQ ID NO: 27; SEQ ID NO: 81 corresponds to SEQ ID NO: 28; SEQ ID NO: 82 corresponds to SEQ ID NO: 29; SEQ ID NO: 83 corresponds to SEQ ID NO: 30; SEQ ID NO: 84 corresponds to SEQ ID NO: 31; SEQ ID NO: 85 corresponds to SEQ ID NO: 32; SEQ ID NO: 86 corresponds to SEQ ID NO: 33; SEQ ID NO: 87 corresponds to SEQ ID NO: 34; SEQ ID NO: 88 corresponds to SEQ ID NO: 35; SEQ ID NO: 89 corresponds to SEQ ID NO: 36; SEQ ID NO: 90 corresponds to SEQ ID NO: 37; SEQ ID NO: 91 corresponds to SEQ ID NO: 38; SEQ ID NO: 92 corresponds to SEQ ID NO: 39; SEQ ID NO: 93 corresponds to SEQ ID NO: 40; SEQ ID NO: 94 corresponds to SEQ ID NO: 41; SEQ ID NO: 95 corresponds to SEQ ID NO: 42; SEQ ID NO: 96 corresponds to SEQ ID NO: 45; SEQ ID NO: 97 corresponds to SEQ ID NO: 46; SEQ ID NO: 98 corresponds to SEQ ID NO: 47; SEQ ID NO: 99 corresponds to SEQ ID NO: 65; SEQ ID NO: 100 corresponds to SEQ ID NO: 66.
"Polypeptide" (e.g., "Saratan," which can be used to discuss a polypeptide) as used herein, refers to an oligopeptide, peptide, or protein, or fragment thereof, and to naturally occurring, recombinant, synthetic, or semi-synthetic molecules. Where
"polypeptide" is recited herein to refer to an amino acid sequence of a naturally occurring protein molecule, "polypeptide" and like terms, are not meant to limit the amino acid sequence to the complete, native amino acid sequence for the full length molecule. It will be understood that each reference to a "polypeptide" or like term, herein, will include the full length sequence, as well as any fragments, derivatives, or variants thereof.
"SEQ ID NO:" as referred to herein, can indicate each sequence identifier individually, or any combination thereof, or all such sequence identifiers.
The terms "substantially purified" or "isolated" as used herein, refer to nucleic or amino acid sequences that are removed from their cellular, recombinant, or synthetic environment, and are at least 60% free, preferably 75% free, and most preferably at least 90% free or at least 99% free from other components with which they are associated in their environment. "Isolated" polynucleotides and polypeptides have been identified and separated from at least one contaminant nucleic acid molecule with which they are associated in their natural state. Accordingly, it will be understood that isolated polynucleotides and polypeptides are in a form which differs from the form or setting in which they are found in nature. It will further be appreciated that "isolated" does not necessarily reflect the exact extent (e.g., a specific percentage) to which the sequence has been purified.
"Treatment" and like terms refer to methods and compositions to prevent, cure, or ameliorate a medical disorder (e.g., medical disease, condition, or syndrome), or reduce at least a symptom of such disorder. In particular, this includes methods and compositions to prevent or delay onset of a medical disorder; to cure, correct, reduce, slow, or ameliorate the physical or developmental effects of a disorder; and/or to prevent, end, reduce, or ameliorate the pain or suffering caused the disorder. The term "treatment" is to be considered in its broadest context. The term does not necessarily imply that the subject is treated until total recovery. Accordingly, "treatment" as used herein broadly includes inhibiting, reducing or preventing cell proliferation, cell survival, and/or cell motility; ameliorating the symptoms or severity of cell proliferation, cell survival, and/or cell motility; or preventing or otherwise reducing the risk of developing cell proliferation, cell survival, and/or cell motility, for example cancer, and in particular, breast cancer, colon cancer, lung cancer, prostate cancer, endometrial cancer, and stomach cancer, among others.
A "variant" of polypeptide, as used herein, refers to an amino acid sequence that is altered by one or more amino acids. Similarly, a variant antibody is altered by one or more amino acids. A variant polynucleotide is altered by one or more nucleotides. A variant may result in "conservative" changes, wherein a substituted amino acid has similar structural or chemical properties, e.g., replacement of leucine with isoleucine. More rarely, a variant may result in "nonconservative" changes, e.g., replacement of a glycine with a tryptophan. Analogous minor variations may also include amino acid deletions or insertions, or both. Guidance in determining which amino acid residues may be substituted, inserted, or deleted without abolishing biological or immunogenic activity may be found using computer programs well known in the art, for example, LASERGENE software (DNASTAR). The invention also encompasses variants which retain at least one biological activity (e.g., effect on cell proliferation, cell survival, or cell motility) or immunogenic function. A preferred variant is one having at least 80%, and more preferably at least 90%, sequence identity to a disclosed sequence. A most preferred variant is one having at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to a sequence disclosed herein. The percentage identity is determined by aligning the two sequences to be compared as described below, determinmg the number of identical residues in the aligned portion, dividing that number by the total number of residues in the inventive (queried) sequence, and multiplying the result by 100. A useful alignment program is AlignX (Vector NTI).
The practice of the present invention will employ, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, and biochemistry, which are within the skill of the art. Such techniques are explained fully in the literature, such as, Molecular Cloning: A Laboratory Manual, 2nd edition, Sambrook et al., 1989; also, Molecular Cloning: A Laboratory Manual, 3rd Edition, Sambrook et al., 2000; Oligonucleotide Synthesis, MY Gait, ed., 1984; Animal Cell Culture, RJ. Freshney, ed., 1987; Methods in Enzymology, Academic Press, Inc.; Handbook of Experimental Immunology, 4th edition, D .M. Weir & CC. Blackwell, eds., Blackwell Science Inc., 1987; Gene Transfer Vectors for Mammalian Cells, JAM. Miller & MAP. Calos, eds., 1987; Current Protocols in Molecular Biology, FEM. Ausubel et al., eds., 1987; and PCR: The Polymerase Chain Reaction, Mullis et al., eds., 1994.
Saratan
Saratan comprises a novel amino acid sequence that, to the inventors' knowledge, has not been previously published. The previously predicted sequence for Saratan (GenBank Ace. No. NM_020215) has been suppressed from the database as erroneous. The coding sequence for Saratan was previously calculated by a computer programme to include a 5' untranslated region of 4,219 bp. This prior coding sequence was found to be unsupported by experimental data, and the protein sequence was suppressed by GenBank. In contrast, as determined by the inventors, the correct open reading frame for Saratan codes for a novel protein of 83 amino acids (Fig. 19A). With the corrected data, the Saratan transcript is predicted as 7.5 kb (Fig. 19B; also designated as transcript a, see below). It is the inventors' understanding that there has been no prior public record of the corrected sequence information. As shown herein, Saratan is predicted to comprise a small protein with theoretical molecular mass of 8.8 kDa. According to the disclosed sequence analysis, the Saratan protein includes a large extracellular region at its N-terminus, followed by a single transmembrane region of 22 amino acids and a relatively short (4 amino acids) cellular region at C-terminus (Fig. 19A).
Database searching has revealed that, in addition to transcript a, there are at least three other alternatively spliced mRNAs. Transcript a is shown in Fig. 19B, and is represented by IMAGE clone 5493356 (GenBank accession number BC043593). The protein it encodes is designated herein as isoform α. Transcript b is shown in Fig. 19C5 and is represented by EST clones BM967279, BI791809, BM352639, BI713575, BQ 189729, and BM893938. Transcript b includes an extra intron as compared with transcript a. However, its coding region is the same as transcript a, and therefore the protein it encodes is the same as isoform α. Transcript c is also shown in Fig. 19C, and is represented by an EST clone DA249054. Transcript c includes an extra exon, in- frame, located in the 4.6 kb intron of transcript a. This exon encodes an additional sequence of 31 amino acids (NKDKSRISPSVCDPREDPELAPGKGCVWPGR; SEQ ID NO: 115). Thus, the full-length protein (designated as isoform β) is 114 amino acids (Fig. 19D). Transcript d is shown in Fig. 19C, and is represented by EST clone DAl 14412. Transcript d includes an extra exon situated in the intron of transcript a. However, this exon is not in-frame with the coding region of transcript a, and a downstream start codon is used. Transcript d is therefore predicted to encode a distinct protein (designated isoform γ) comprising 92 amino acids, with a divergent N-terminal sequence.
A database search using BlastP in NCBI revealed that Saratan protein shares significant homology with two predicted hypothetical proteins XP_875290 (Bos taurus) XPJ)Ol 147850 (Pan troglodytes), XP_001476208 (Mus musculus), EDL81821 (Rattus norvegicus) and XP_001334647 (Danio rerio) at the corresponding N-terminal region (Fig. 19 E). The cDNA sequence of predicted mouse Saratan (GenBank accession number XM_001476158) based on an EST clone AK052429 is shown in Fig. 2OA. It is supported by numerous other EST clones such as CB521084, CD351912, CD350794, CF182588, CB245973, CB520382, CB246030, BU704198, BB354535, CA752314, CF532626, CF537731, BB659851, BQ921856, CJ162628, CJ176112, CJ164386, CJ169326, AA450691, CJ167344, AI481362, AI613651, CJ179881, BY004487, BY727205, BB644402, BB639576, CJ173864, CJ170896, and CJ159608. There is nominal sequence similarity shared by the human and mouse sequences within the 5' and 3'-UTR. However, we found 87% sequence identity (229/261) in the ORF regions, which indicates that the coding regions are highly conserved (Fig. 20B). The predicted mouse homolog shows the same length (83 amino acids) as human Saratan (Fig. 20C). At the protein level, the similarity is as high as 92%, and 74 out of 83 amino acids are identical (Fig. 20D).
In accordance with the findings disclosed herein, Saratan is highly or moderately expressed in several cancer cell lines, including cell lines for breast cancer, colon cancer, lung cancer, prostate cancer, endometrial cancer, and stomach cancer (see, Examples). Moreover, MCF-7 breast cancer cells overexpressing Saratan grow significant faster than control cells stably transfected by the empty vector phCMVl, as shown by total cell number assays over a period of time of 10 days. BrdU incorporation assays showed that the increase in total cell number was the result of increased cell proliferation. Further, this increase in cell proliferation could be effectively reversed by limiting the endogenous expression levels of Saratan using siRNA technology. siRNA reduced the expression of endogenous Saratan, resulting in a reduction in growth rate and inhibition of cell proliferation (see, Examples).
Thus, the data shown herein demonstrate that Saratan expression promotes the proliferation of MCF-7 breast carcinoma cells, and that this proliferation can be effectively inhibited by reducing the expression levels, of Saratan via siRNA. As such, Saratan represents an ideal novel target for cancer treatment and diagnosis, particularly for breast cancer. Any reagents that inhibit the biological activity of Saratan can be used to inhibit the proliferation, survival, and/or motility of cancer cells. These reagents can include, for example, chemical compounds (e.g., small molecules), antagonists, antibodies, and iRNAs. Similarly, diagnostic agents (e.g., polynucleotides and antibodies) can be used to determine Saratan levels and detect a cancerous condition, e.g., cancer onset, progression, or recurrence.
Saratan polynucleotides and polypeptides The invention encompasses Saratan polypeptides, including those comprising at least one of SEQ ID NO: 1, 3, 8-10, 49-64, 102-104, and fragments, variants, and derivatives thereof. The invention also encompasses the use of these polypeptides in the diagnosis of cancer, especially breast cancer. The invention further encompasses the use of the polypeptides for preparing antibodies to inhibit the cell proliferation, cell survival, or cell motility of such cells .
The polypeptides of the present invention comprise at least one sequence selected from the group consisting of: (a) polypeptides comprising at least one amino acid sequence selected from the group consisting of SEQ ID NO:1, 3, 8-10, 49-64, 102-104, or fragments, variants, or derivatives thereof; (b) polypeptides comprising a functional domain of at least one amino acid sequence selected from-the group consisting of SEQ ID NO:1 3, 8-10, 49-64, 102-104, and fragments and variants thereof; and (c) polypeptides comprising at least a specified number of contiguous residues of at least one amino acid sequence selected from the group consisting of SEQ ID NO:1, 3, 8-10, 49-64, 102-104, or variants or derivatives thereof. In one particular embodiment, the invention encompasses an isolated Saratan polypeptide comprising the amino acid sequence of at least one of SEQ ID NO:1, 3, 8-10, 49-64, 102-104. All of these sequences are collectively referred to herein as polypeptides of the invention.
The polypeptides of the present invention may be expressed and used in various assays to determine their biological activity. The polypeptides may be used for large-scale synthesis and isolation protocols, for example, for commercial production. Such polypeptides may be used to raise antibodies, to isolate corresponding amino acid sequences, and to quantitatively determine levels of the amino acid sequences.
The invention encompasses Saratan polynucleotides including those of SEQ ID NO: 14- 24, 25-27, 28-30, 37, 38, 41, 42, 45-48, 65, 66, 68-73, 74-101, 120-122, and fragments, variants, and derivatives thereof. The invention also encompasses the use of these polynucleotides in the diagnosis of cancer, especially breast cancer. The invention further encompasses the use of Saratan polynucleotides for the inhibition of cell proliferation, cell survival, or cell motility of such cells. Accordingly, the invention encompasses the use of these polynucleotides for preparing expression vectors and host cells, and for preparing antisense polynucleotides and iRNAs.
The polynucleotides of the present invention comprise at least one sequence selected from the group consisting of: (a) sequences comprising a coding sequence for at least one amino acid sequence selected from the group consisting of SEQ ID NO:1, 3, 8-10, 49-64, 102-104, or fragments, variants, or derivatives thereof; (b) complements, reverse sequences, and reverse complements of a coding sequence for at least one amino acid sequence selected from the group consisting of SEQ ID NO:1, 3, 8-10, 49-64, 102-104, or fragments, variants, or derivatives thereof; (c) open reading frames contained in the coding sequence for at least one amino acid sequence selected from the group consisting of SEQ ID NO:1, 3, 8-10, 49-64, 102-104, or their fragments, variants; or derivatives (d) functional domains of a coding sequence for at least one amino acid sequence selected from the group consisting of SEQ ID NO:1, 3, 8-10, 49-64, 102-104, or fragments, variants, or derivatives thereof; (e) sequences comprising at least a specified number of contiguous residues of a coding sequence for at least one amino acid sequence selected from the group consisting of SEQ ID NO: 1, 3, 8-10, 49-64, 102-104, or variants or derivatives thereof; and (f) sequences comprising at least a specified number of contiguous nucleotides of SEQ ID NO:14-24, 25-27, 28-30, 37, 38, 41, 42, 45-48, 65, 66, 68-73, 74-101, 120-122, or variants or derivatives thereof. In one particular embodiment, the invention encompasses an isolated polynucleotide comprising a coding sequence for at least one amino acid sequence selected from the group consisting of SEQ ID NO:l-3, 5, 6, 8-10, 49-64, 102-104. In another particular embodiment, the invention encompasses an isolated polynucleotide comprising a sequence selected from the group consisting of SEQ ID NO:14-21, 23, 24-48, 49-64, 102-104. Oligonucleotide probes and primers and their variants are also provided. All of these polynucleotides and oligonucleotide probes and primers are collectively referred to herein, as polynucleotides of the invention. The isolated polynucleotides of the present invention also have utility in genome mapping, in physical mapping, and in cloning of genes of more or less related species. Probes designed using the polynucleotides of the present invention may be used to detect the presence and examine the expression patterns of genes in any organism having sufficiently homologous DNA and RNA sequences in their cells, using techniques that are well known in the art, such as slot blot techniques or microarray analysis. Primers designed using the polynucleotides of the present invention may be used for sequencing and PCR amplifications. The polynucleotides of the present invention may also be used as compositions, for example, pharmaceutical compositions. The polynucleotides of the present invention can also be used to provide health benefits. For such benefits, the polynucleotides can be presented as expression vectors or host cells comprising expression vectors.
It will be appreciated by those skilled in the art that as a result of the degeneracy of the genetic code, a multitude of nucleotide sequences encoding the polypeptides of the invention, some bearing minimal homology to the nucleotide sequences of any known and naturally occurring gene, may be produced. Thus, the invention contemplates each and every possible variation of nucleotide sequence that could be made by selecting combinations based on possible codon choices. These combinations are made in accordance with the standard triplet genetic code as applied to naturally occurring amino acid sequences, and all such variations are to be considered as being specifically disclosed.
Nucleotide sequences which encode the Saratan polypeptides, or their fragments or variants, are preferably capable of hybridizing to the nucleotide sequence of the naturally occurring sequence under appropriately selected conditions of stringency.
However, it may be advantageous to produce nucleotide sequences encoding a polypeptide, or its fragment or derivative, possessing a substantially different codon usage. Codons may be selected to increase the rate at which expression of the polypeptide occurs in a particular prokaryotic or eukaryotic host in accordance with the frequency with which particular codons are utilized by the host. Other reasons for substantially altering the nucleotide sequence encoding polypeptides and its derivatives without altering the encoded amino acid sequences include the production of RNA transcripts having more desirable properties, such as a greater half-life, than transcripts produced from the naturally occurring sequence.
The invention also encompasses production of Saratan polynucleotides, or fragments variants, or derivatives thereof, entirely by synthetic chemistry. After production, the synthetic sequence may be inserted into any of the many available expression vectors and cell systems using reagents that are well known in the art. Moreover, synthetic chemistry may be used to introduce mutations into a sequence encoding a Saratan polypeptide, or any variants, fragments, or derivatives thereof. Also encompassed by the invention are polynucleotide sequences that are capable of hybridizing to the disclosed nucleotide sequences, and in particular, those shown in SEQ ID NO: 14- 16, 19, 22, under various conditions of stringency as taught in Wahl, G. M. and S. L. Berger (1987; Methods Enzymol. 152:399-407) and Kimmel, A. R. (1987; Methods Enzymol. 152:507-511).
Methods for DNA sequencing which are well known and generally available in the art may be used to practice any of the embodiments of the invention. The methods may employ such enzymes as the Klenow fragment of DNA polymerase I, SEQUENASE (U.S. Biochemical Corp, Cleveland, OH), Taq polymerase (Perkin Elmer), thermostable T7 polymerase (Amersham Pharmacia Biotech, Piscataway, NJ), or combinations of polymerases and proofreading exonucleases such as those found in the ELONGASE Amplification System (Life Technologies, Gaithersburg, MD). Preferably, the process is automated with machines such as the Hamilton Micro Lab 2200 (Hamilton, Reno, NV), Peltier Thermal Cycler (PTC200; MJ Research, Watertown, MA) the ABI Catalyst and 373 and 377 DNA Sequencers (Perkin Elmer), or the Genome Sequencer 20™ (Roche Diagnostics).
The nucleic acid sequences encoding the Saratan polypeptides may be extended utilizing a partial nucleotide sequence and employing various methods known in the art to detect upstream sequences such as promoters and regulatory elements. For example, one method which may be employed, "restriction-site" PCR, uses universal primers to retrieve unknown sequence adjacent to a known locus (Sarkar, G. (1993) PCR Methods Applic. 2:318-322). In particular, genomic DNA is first amplified in the presence of primer to a linker sequence and a primer specific to the known region. The amplified sequences are then subjected to a second round of PCR with the same linker primer and another specific primer internal to the first one. Products of each round of PCR are transcribed with an appropriate RNA polymerase and sequenced using reverse transcriptase.
Capillary electrophoresis systems which are commercially available may be used to analyze the size or confirm the nucleotide sequence of sequencing or PCR products. In particular, capillary sequencing may employ flowable polymers for electrophoretic separation, four different fluorescent dyes (one for each nucleotide), which are laser activated, and detection of the emitted wavelengths by a charge coupled device camera. Output/light intensity may be converted to electrical signal using, appropriate software (e.g., GENOTYPER and Sequence NAVIGATOR, Perkin Elmer) and the entire process from loading of samples to computer analysis and electronic data display may be computer controlled. Capillary electrophoresis is especially preferable for the sequencing of small pieces of DNA which might be present hi limited amounts in a particular sample.
In another embodiment of the invention, Saratan polynucleotides or fragments thereof which encode polypeptides may be used hi recombinant DNA molecules to direct expression of the polypeptides, or fragments or variants thereof, in appropriate host cells. Due to the inherent degeneracy of the genetic code, other DNA sequences which encode substantially the same or a functionally equivalent amnio acid sequence may be produced, and these sequences may be used to clone and express Saratan polypeptides. The nucleotide sequences of the present invention can be engineered using methods generally known in the art hi order to alter amino acid encoding sequences for a variety of reasons, including but not limited to, alterations which modify the cloning, processing, and/or expression of the gene product DNA shuffling by random fragmentation and PCR reassembly of gene fragments and synthetic oligonucleotides may be used to engineer the nucleotide sequences. For example, site-directed mutagenesis may be used to insert new restriction sites, alter glycosylation patterns, change codon preference, introduce mutations, and so forth. In another embodiment of the invention, a natural, modified, or recombinant nucleic acid sequence encoding a polypeptide may be ligated to a heterologous sequence to encode a fusion protein. For example, it may be useful to encode a chimeric sequence that can be recognized by a commercially available antibody. A fusion protein may also be engineered to contain a cleavage site located between the polypeptide of the invention and the heterologous protein sequence, so that the polypeptide may be cleaved and purified away from the heterologous moiety.
In another embodiment, sequences encoding polypeptides may be synthesized, in whole or in part, using chemical methods well known in the art (see Caruthers, M. H. et al. (1980) Nucl. Acids Res. Symp. Ser. 215-223, Horn, T. et al. (1980) Nucl. Acids Res. Symp. Ser. 225-232). Alternatively, the polypeptide itself may be produced using chemical methods to synthesize the amino acid sequence, or a fragment thereof. For example, polypeptide synthesis can be performed using various solid-phase techniques (Roberge, J. Y. et al. (1995) Science 269:202-204; Merrifield J. (1963) J. Am. Chem. Soc. 85:2149:2154) and automated synthesis may be achieved, for example, using the ABI 43 IA Peptide Synthesizer (Perkin Elmer). Various fragments of polypeptides may be chemically synthesized separately and combined using chemical methods to produce the full length molecule.
The newly synthesized polypeptide may be isolated by preparative high performance liquid chromatography (e.g., Creighton, T. (1983) Proteins Structures and Molecular Principles, WH Freeman and Co., New York, NY). The composition of the synthetic polypeptides may be confirmed by amino acid analysis or sequencing (e.g., the Edman degradation procedure; Creighton, supra). Additionally, the amino acid sequence of the polypeptide, or any part thereof, may be altered during direct synthesis and/or combined using chemical methods with sequences from other proteins, or any part thereof, to produce a variant molecule.
In order to express a biologically active polypeptides, the nucleotide sequences encoding the polypeptide or functional equivalents, may be inserted into appropriate expression vector, e.g., a vector which contains the necessary elements for the transcription and translation of the inserted coding sequence. Methods which are well known to those skilled in the art may be used to construct expression vectors containing sequences encoding the polypeptide and appropriate transcriptional and translational control elements. These methods include in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination. Such techniques are described in Sambrook, J. et al. (1989) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press, Plainview, NY; also, Sambrook, J. et al. (2000) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press, Plainview, NY; and Ausubel, F. M. et al. (1989) Current Protocols in Molecular Biology, John Wiley & Sons, New York, NY.
A variety of expression vector/host systems may be utilized to contain and express sequences encoding the polypeptides of the invention. These include, but are not limited to, microorganisms such as bacteria transformed with recombinant phage, plasmid, or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected with virus expression vectors (e.g., baculovirus); plant cell systems transformed with virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or with bacterial expression vectors (e.g., Ti or pBR322 plasmids); or animal cell systems. For bacteria, useful plasmids include pET, pRSET, pTrcHis2, and pBAD plasmids from Invitrogen, pET and pCDF plasmids from Novagen, and Director™ plasmids from Sigma-Aldrich. In particular, E. coli can be used with the expression vector pET. The invention is not limited by the expression vector or host cell employed.
The "control elements" or "regulatory sequences" are those non-translated regions (e.g., enhancers, promoters, 5' and 3' untranslated regions) which interact with host cellular proteins to carry out transcription and translation. Such elements may vary in their strength and specificity. Depending on the vector system and host utilized, any number of suitable transcription and translation elements, including constitutive and inducible promoters, may be used. For example, when cloning in bacterial systems, inducible promoters such as the hybrid lacZ promoter of the BLUESCRIPT phagemid
(Stratagene, LaJolla, CA) or pSPORTl plasmid (Life Technologies) and the like may be used. The baculovirus polyhedrin promoter may be used in insect cells. Promoters or enhancers derived from the genomes of plant cells (e.g., heat shock, RUBISCO, and storage protein genes) or from plant viruses (e.g., viral promoters or leader sequences) may be cloned into the vector.
In bacterial systems, a number of expression vectors may be selected depending upon the use intended for the polypeptide. For example, when large quantities of polypeptide are needed, vectors which direct high level expression of fusion proteins that are readily purified may be used. Such vectors include, but are not limited to, the multifunctional E. coli cloning and expression vectors such as BLUESCRIPT (Stratagene), in which the sequence encoding a polypeptide may be ligated into the vector in frame with sequences for the ammo-terminal Met and the subsequent 7 residues of β-galactosidase so that a hybrid protein is produced; pIN vectors (Van Heeke, G. and S. M. Schuster (1989) J.
Biol. Chem. 264:5503-5509); and the like.
pGEX vectors (Promega, Madison, WI) may also be used to express the polypeptides as fusion proteins with glutathione S-transferase (GST). In general, such fusion proteins are soluble and can easily be purified from lysed cells by adsorption to glutathione- agarose beads followed by elution in the presence of free glutathione. Proteins made in such systems may be designed to include heparin, thrombin, or factor Xa protease cleavage sites so that the cloned polypeptide of interest can be released from the GST moiety at will. In the yeast, Saccharomyces cerevisiae, a number of vectors containing constitutive or inducible promoters such as alpha factor, alcohol oxidase, and PGH may be used. For reviews, see Ausubel et al. (supra) and Grant et al. (1987) Methods Enzymol. 153:516-544.
Specific initiation signals may also be used to achieve more efficient translation of sequences encoding the polypeptides of the invention. Such signals include the ATG initiation codon and adjacent sequences. In cases where sequences encoding a polypeptide, its initiation codon, and upstream sequences are inserted into the appropriate expression vector, no additional transcriptional or translational control signals may be needed. However, in cases where only coding sequence, or a fragment thereof, is inserted, exogenous translational control signals including the ATG initiation codon should be provided. Furthermore, the initiation codon should be in the correct reading frame to ensure translation of the entire insert. Exogenous translational elements and initiation codons may be of various origins, both natural and synthetic. The efficiency of expression may be enhanced by the inclusion of enhancers which are appropriate for the particular cell system which is used, such as those described in the literature (Scharf, D. et al. (1994) Results Probl. Cell Differ. 20:125-162).
In addition, a host cell may be chosen for its ability to modulate the expression of the inserted sequences or to process the expressed polypeptide in the desired fashion. Such modifications of the sequence include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation, and acylation. Post-translational processing which cleaves a "prepro" form of the polypeptide may also be used to facilitate correct insertion, folding, and/or function. Different host cells which have specific cellular machinery and characteristic mechanisms for post-translational activities are available from the American Type Culture Collection (ATCC; Bethesda, MD) and may be chosen to ensure the correct modification and processing of the sequence. Specific host cells include, but are not limited to, Rhodotorula, Aureobasidium, Saccharomyces, Sporobolomyces, Pseudomonas, Erwinia and Flavobacterium; or such other organisms as Escherichia, Lactobacillus, Bacillus, Streptomyces, and the like. Particular host cells include Escherichia coli, which is particularly suited for use with the present invention, Saccharomyces cerevisiae, Bacillus thuringiensis, Bacillus subtilis, Streptomyces lividans, and the like.
There are several techniques for introducing nucleic acids into eukaryotic cells cultured in vitro. These include chemical methods (Feigner et al., Proc. Natl. Acad. ScL, USA, 84:7413 7417 (1987); Bothwell et al., Methods for Cloning and Analysis of Eukaryotic Genes, Eds., Jones and Bartlett Publishers Inc., Boston, Mass. (1990), Ausubel et al., Short Protocols in Molecular Biology, John Wiley and Sons, New York, NY (1992); and Farhood, Annal. NY Acad. ScL, 716:23 34 (1994)), use of protoplasts (Bothwell, supra) or electrical pulses (Vatteroni et al., Mutn. Res., 291:163 169 (1993); Sabelnikov, Prog. Biophys. MoI. Biol., 62: 119 152 (1994); Bothwell et al., supra; and Ausubel et al., supra), use of attenuated viruses (Davis et al., J. Virol. 1996, 70(6), 3781 3787; Brinster et al. J. Gen. Virol. 2002, 83(Pt 2), 369 381; Moss, Dev. Biol. Stan., 82:55 63 (1994); and Bothwell et al., supra), as well as physical methods (Fynan et al., supra; Johnston et al., Meth. Cell Biol, 43(Pt A):353 365 (1994); Bothwell et al., supra; and Ausubel et al., supra).
Successful delivery of nucleic acids to animal tissue can be achieved by cationic liposomes (Watanabe et al., MoL Reprod. Dev., 38:268 274 (1994)), direct injection of naked DNA or RNA into animal muscle tissue (Robinson et al., Vacc, 11:957 960 (1993); Hoffman et al., Vacc. 12:1529 1533; (1994); Xiang et al., Virol., 199:132 140 (1994); Webster et al., Vacc, 12:1495 1498 (1994); Davis et al., Vacc, 12:1503 1509 (1994); Davis et al., Hum. Molec. Gen., 2:1847 1851 (1993); Dalemans et al. Ann NY Acad. Sci. 1995, 772, 255 256. Conry, et al. Cancer Res. 1995, 55(7), 1397-1400), and embryos (Naito et al., MoI. Reprod. Dev., 39:153 161 (1994); and Burdon et al., MoI. Reprod. Dev., 33:436 442 (1992)), intramuscular injection of self replicating RNA vaccines (Davis et al., J. Virol. 1996, 70(6), 3781 3787; Balasuriya et al. Vaccine 2002, 20(11 12), 1609 1617) or intradermal injection of DNA using "gene gun" technology (Johnston et al., supra).
A variety of protocols for detecting and measuring the expression of the polypeptides of the invention, using either polyclonal or monoclonal antibodies specific for the protein are known in the art. Examples include enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), and fluorescence activated cell sorting (FACS). A two-site, monoclonal-based immunoassay can be used with monoclonal antibodies reactive to two non-interfering epitopes on the polypeptide, but a competitive binding assay can also be used. These and other assays are described, among other places, in Hampton, R. et al. (1990; Serological Methods, a laboratory Manual, APS Press, St Paul, MN) and Maddox, D. E. et al. (1983; J. Exp. Med. 158:1211-1216).
A wide variety of labels and conjugation techniques are known by those skilled in the art and may be used in various nucleic acid and amino acid assays. Means for producing labeled hybridization or PCR probes for detecting sequences related to polynucleotides include oligolabeling, nick translation, end-labeling or PCR amplification using a labeled nucleotide. Alternatively, the sequences encoding the polypeptides, or any fragments or variants thereof, may be cloned into a vector for the production of an mRNA probe. Such vectors are known in the art, are commercially available, and may be used to synthesize RNA probes in vitro by addition of an appropriate RNA polymerase such as T7, T3, or SP6 and labeled nucleotides. These procedures may be conducted using a variety of commercially available kits Amersham Pharmacia Biotech, Promega, and US Biochemical. Suitable reporter molecules or labels, which may be used for ease of detection, include radionuclides, enzymes, fluorescent, chemiluminescent, or chromogenic agents as well as substrates, cofactors, inhibitors, magnetic particles, and the like.
Expression vectors or host cells transformed with expression vectors may be cultured under conditions suitable for the expression and recovery of the polypeptide from culture. The culture can comprise components for in vitro or in vivo expression. In vitro expression components include those for rabbit reticulocyte lysates, E. coli lysates, and wheat germ extracts, for example, Expressway™ or RiPs systems from Invitrogen,
Genelator™ systems from iNtRON Biotechnology, EcoPro™ or STP3™ systems from Novagen, TNT® Quick Coupled systems from Promega, and EasyXpress systems from
QIAGEN. The polypeptide produced from culture may be secreted or contained intracellularly depending on the sequence and/or the vector used. In particular aspects, expression vectors which encode a phage polypeptide can be designed to contain signal sequences which direct secretion of the polypeptide through a prokaryotic or eukaryotic cell membrane.
Other constructions may include an amino acid domain which will facilitate purification of the polypeptide. Such domains include, but are not limited to, metal chelating peptides such as histidine-tryptophan (e.g., 6*-HIS) modules that allow purification on immobilized metals, protein A domains that allow purification on immobilized immunoglobulin, and the domain utilized in the FLAG® extension/affinity purification system (Immunex Corp., Seattle, WA). Useful epitope tags include 3X-FLAG®, HA, VSV-G, V5, HSV, GST, GFP, MBP, GAL4, and β-galactosidase. Useful plasmids include those comprising a biotin tag (e.g., PinPoint™ plasmids from Promega), calmodulin binding protein (e.g., pCAL plasmids from Stratagene), streptavidin binding peptide (e.g., InterPlay™ plasmids from Stratagene), a c-myc or FLAG® tag (e.g., hnmunoprecipitation plasmids from Sigma-Aldrich), or a histidine tag (e.g.,
QIAExpress plasmids from QIAGEN). To facilitate purification, expression vectors can include a cleavable linker sequences such as those specific for Factor Xa or enterokinase (Invitrogen, San Diego, CA). For example, the vector can include one or more linkers between the purification domain and the polypeptide. One such expression vector provides for expression of a fusion protein comprising a polypeptide of the invention and a nucleic acid encoding 6 histidine residues preceding a thioredoxin or an enterokinase cleavage site. The histidine residues facilitate purification on IMAC (immobilized metal ion affinity chromatography as described in Porath, J. et al. (1992) Prot. Exp. Purif. 3: 263-281) while the enterokinase cleavage site provides a means for purifying the polypeptide from the fusion protein. A discussion of vectors which contain fusion proteins is provided in Kroll, D. J. et al. (1993; DNA Cell Biol. 12:441-453).
Polynucleotides for inhibition of Saratan As mentioned herein before, in one embodiment, polynucleotides may be utilised to inhibit Saratan in accordance with the invention. Such polynucleotides may be DNA, RNA, single stranded, or double stranded. Polynucleotides for use with the invention may be referred to herein as "isolated" polynucleotides. Isolated Saratan polynucleotides may be obtained using a number of techniques known in the art. For example, recombinant DNA technology may be used as described for example in Sambrook, J. et al. (1989) Molecular Cloning: A Laboratory Manual (2nd edition), Cold Spring Harbor Laboratory Press, Plainview, NY and Sambrook and Russell (2000) Molecular Cloning: A Laboratory Manual (3rd Edition), Cold Spring Harbor Laboratory Press, Plainview, NY. Similarly, chemical synthesis, for example, using phosphoramidite and solid phase chemistry, may be used. Polynucleotides may be designed on the basis of the disclosed Saratan nucleic acid sequence data, the known relative interactions between nucleotide bases, known sequence homology, and the particular nucleic acid technology to be employed, as may be exemplified herein after.
In one embodiment, interfering RNAs (iRNAs or siRNAs) may be utilised to inhibit Saratan. Polynucleotides of use in iRNA techniques will typically have 100% complementarity to their target. However, it should be appreciated that this need not be the case, provided the iRNA retains specificity for its target and the ability to block translation. Exemplary iRNA molecules may be in the form of ~18 to 21 bp double stranded RNAs with 3' dinucleotide overhangs, although shorter or longer molecules may be appropriate. In cases where the iRNA is produced in vivo by an appropriate nucleic acid vector, it will typically take the form of an RNA molecule having a stem- loop structure, for example, an approximately 19 nucleotide stem and a 9 nucleotide loop with 2-3 Us at the 3' end. Algorithms of use in designing siRNA are available from Cenix (Dresden, Germany, via Ambion, TX).
Exemplary siRNA molecules can include the following sequences:
Target sequence 1: 5'- "AAATAATCACTCGTGTGACTT -3' SEQ ID NO: 16
Sense siRNA strand: 5'- AUAAUCACUCGϋGUGACUUtt - SEQ ID NO: 17
Antisense strand: 3' SEQ ID NO: 18
3'- ttUAUUAGUGAGCACACUGAA -5'
Sense sequence SEQ ID NO: 68
Antisense sequence AUAAϋCACUCGUGUGACUD SEQ ID NO: 69
UAUϋAGDGAGCACACUGAA
Target sequence 2: 5'- AATTACAAGAAAGCTGGACTT -3' SEQ ID NO: 19
Sense siRNA strand: 5'- ϋϋACAAGAAAGCUGGACϋϋtt - SEQ ID NO: 20
Antisense strand: 3' SEQ ID NO: 21
3'- ttAAUGϋUCϋϋUCGACCUGAA -5'
Sense sequence SEQ ID NO: 70
Antisense sequence UUACAAGAAAGCUGGACϋU SEQ ID NO: 71
AAϋGOϋCUϋUCGACCOGAA
Target sequence 3: 5'- AAGAGCAACTTACTGCTTTGT -3' SEQ ID NO: 22
Sense siRNA strand: 5'- GAGCAACUUACDGCUUUGUtt - SEQ ID NO: 23
Antisense strand: 3' SEQ ID NO: 24 "
3'- ttCϋCGUϋGAAUGACGAAACA -5'
Sense sequence SEQ ID NO: 72
Antisense sequence GAGCAACϋσACϋGCσUUGU SEQ ID NO: 73
CUCGUUGAAUGACGAAACA
Exemplary iRNA molecules can include the structures described as follows.
In one aspect, the iRNA comprises a nucleotide sequence selected from the group consisting of:
1) 5'-ATAATCACTCGTGTGACTT-S' (SEQ ID NO.-25)
2) 5'-TTACAAGAAAGCTGGACTT-S' (SEQ ID NO:26)
3) 5'-GAGCAACTTACTGCTTTGT-S' (SEQ ID NO: 27) In one preferred aspect, the iRNA comprises a nucleotide sequence selected from the group consisting of:
5 ' -ATAATCACTCGTGTGACTTCTCAAGAGAAAGTCACACGAGTGATTAT-S ' I Sense Strand | —Loop— 1 -Antisense Strand- |
(SEQ ID NO:28)
5 ' -TTACAAGAAAGCTGGACTTCTCAAGAGAAAGTCCAGCTTTCTTGTAA-S '
I Sense Strand | —Loop— | -Antisense Strand- | (SEQ ID NO: 29)
5 ' -GAGCAACTTACTGCTTTGTTTCAAGAGAACAAAGCAGTAAGTTGCTC-S '
I Sense Strand | —Loop— |-Antisense Strand- |
(SEQ ID NO:30)
In another preferred aspect, the iRNA comprises a nucleotide sequence selected from the group consisting of:
5 ' -XXXXATAATCACTCGTGTGACTTCTCAAGAGAAAGTCACACGAGTGATTATXXXX-S '
I Sense Strand | —Loop— |-Antisense Strand- 1
(SEQ ID NO: 31)
5 ' -XXXXGTTACAAGAAAGCTGGACTTCTCAAGAGAAAGTCCAGCTTTCTTGTAAXXXX- 3'
I Sense Strand | —Loop— | -Antisense Strand- |
(SEQ ID NO: 32)
5 ' -XXXXGAGCAACTTACTGCTTTGTTTCAAGAGAACAAAGCAGTAAGTTGCTCXXXX-S ' I Sense Strand | —Loop— I -Antisense Strand- |
(SEQ ID NO: 33)
"X" indicates any number of additional nucleotides which may be present; for example termination signals and restriction sites which may be of use in cloning and expressing the iRNA.
By way of non-limiting examples, the following nucleic acids may be used to clone and express, in desired vectors, the iRNAs of use in the invention: BamBX Hind
III
5 ' -ggatccATAATCACTCGTGTGACTTCTCaΛGAGAAAGTCACACGAGTGATTAT TTTTTTβGAAAagtcc- 3 '
I Sense Strand | Loop ] Antisense Strand | Terminator (SEQ ID NO : 34)
BamSl Hind
III 5'- ggatccGTTACAAGAAAGCTGGACTTCTCAAGAGAAAGTCCaGCTTTCTTGTAArrriTIXSGaAaagtcc-S' I Sense Strand | Loop | Antisense Strand I Terminator (SEQ ID NO:35)
BamB.1 Hind
III
5 ' -ggatccGAGCAACTTACTGCTTTGTTrcaAGAGAACAaAGCAGTAAGTTGCrcrrrrriiSGAAaagtcc- 31 I Sense Strand | Loop I Antisense Strand I Terminator
(SEQ ID NO:36)
iRNA molecules can be produced in accordance with techniques described within the section entitled "Examples" herein. Further information regarding how to produce and design such molecules can be gained, for example, from: McManus MT and Sharp PA
(2002) Gene silencing in mammals by small interfering RNAs. Nature Rev. Genet. 3:
737747; Dillin A (2003) The specifics of small interfering RNA specificity. Proc. Natl. Acad. Sci. USA 100(11): 6289-6291; and Tuschl T (2002) Expanding small RNA interference. Nature Biotechnol. 20: 446-448.
It will be understood by one of skill in the art that siRNA refers to short/small interfering RNA5 which comprises double-stranded RNA3 typically including 21 to 23 base pairs, which can be chemically synthesized. By comparison, shRNA refers to short hairpin RNA, also called vector based siRNA, which comprises single strand RNA, for example, transcribed in vitro or in vivo. Typically, shRNA includes a sequence homologous to the target mRNA (sense sequence), a "loop" region and a sequence complementary to the target sequence (anti-sense sequence). The shRNA forms a hairpin secondary structure, and an enzyme dicer cleaves the structure, removes the hairpin, and converts it into siRNA. Thus, the sequences disclosed herein can be used to produce shRNAs, and then converted to siRNAs, as desired.
In another embodiment of the invention, an antisense molecule is used. As used herein, the term "antisense" should be taken broadly. It is intended to mean any nucleic acid (preferably RNA5 but including single stranded DNA) capable of binding to Saratan transcript. Typically, antisense molecules or oligonucleotides comprise about 15 to 25 nucleotides which are completely complementary to their target mRNA. However, it should be appreciated that larger antisense oligonucleotides can be used including full length sequences. Also, it should be appreciated that antisense molecules which are not completely complementary to their targets may be utilised provided they retain specificity for their target and the ability to inhibit expression.
Persons of ordinary skill in the art to which the invention relates will appreciate antisense molecules of use in the invention having regard to the description provided herein, and available Saratan sequence data. Further information regarding antisense technology can be gained, for example, from: Kandimalla ER, Manning A, Lathan C, Byrn RA, Agrawal S. Design, biochemical, biophysical and biological properties of cooperative antisense oligonucleotides; Nucleic Acids Res. 1995 Sep 11;23(17):3578- 84; Tseng BY, Brown KD. Antisense oligonucleotide technology in the development of cancer therapeutics; Cancer Gene Ther. 1994 Mar;l(l):65-71; Brysch W, Schlingensiepen KH. Design and application of antisense oligonucleotides in cell culture, in vivo, and as therapeutic agents; Cell MoI Neurobiol. 1994 Oct;14(5):557-68; Han J, Zhu Z, Hsu C, Finley WH. Selection of antisense oligonucleotides on the basis of genomic frequency of the target sequence; Antisense Res Dev. 1994 Spring;4(l):53-65.
It should be appreciated that DNAzymes, single stranded DNA, ribozymes, and triple helix DNA may also be of use in inhibiting Saratan in accordance with the invention. Ribozymes, DNAzymes, triple helix, and single stranded DNA may be readily appreciated by persons of general skill in the art to which the invention relates having regard to the description provided herein, available Saratan sequence data and current methodologies. However, by way of example methodology associated with these technologies is described in Joseph Sambrook and David W. Russell. Molecular Cloning: A Laboratory Manual (Third Edition), Cold Spring Harbor Laboratory Press, NY.
Polynucleotides of use in the invention, including antisense, iRNA, ribozymes and DNAzymes may be chemically modified to increase stability or prevent degradation or otherwise. For example, the nucleic acid molecules may include analogs with unnatural bases, modified sugars, especially at the 2' position of the ribose, or altered phosphate backbones. Polynucleotides of use in the invention may also include sequences which allow for targeted degradation of any transcript to which they bind. For example, a sequence specific for RNase H, may be included. Another example is the use of External Guide Sequences (EGSs), which may recruit a ribozyme (RNase P) to digest the transcript to which an antisense molecule is bound.
One can help ensure specificity of the likes of antisense oligonucleotides, iRNAs, 5 ribozymes, DNAzymes, and cDNAs by screening candidate sequences for homology with other sequences in the transcriptome, the full complement of activated genes, mRNAs, or transcripts in a particular cell. Also, skilled persons may appreciate appropriate algorithms of use in designing and ensuring specificity of such polynucleotides.
10
Polynucleotides of use in the invention may be used in the form of nucleic acid molecules produced in vitro, for example, single stranded DNA, iRNA, antisense RNA, or DNAzymes. Alternatively, where appropriate, they may be used in the form of a vector adapted to produce appropriate nucleic acids, for example, antisense molecules,
15 iRNA, or ribozymes. The inventors contemplate the use of any vectors as may be known in the art. For example, naked plasmids that employ CMV promoters may be used. Viral vectors may also be suitable, such as adeno-associated virus (AAV) and lentiviruses. Other examples of suitable promoters and viral vectors are provided herein after. One advantage of using such viral vectors is that they may allow for systemic
20 administration, as opposed to localised administration to a tissue or tumour.
The vectors or constructs of use in the invention may include appropriate genetic elements, such as promoters, enhancers, origins of replication as are known in the art, including inducible, constitutive, or tissue-specific promoters. In a specific embodiment,
25. a vector comprises an inducible promoter operably linked to the region coding a nucleic acid of the invention (for example, antisense Saratan or suitable siRNA), such that expression of the nucleic acid is controllable by controlling the presence or absence of the appropriate inducer of transcription. In another embodiment, nucleic acid molecules of the invention are flanked by regions that promote homologous recombination at a
30 desired site in the genome, thus providing for intrachromosomal integration of the desired nucleic acids (Koller and Smithies, 1989, Proc. Natl. Acad. Sci. USA 86:8932- 8935; Zijlstra et al., 1989, Nature 342:435-438). Of course, the vectors may remain extrachromosomal. In another embodiment of the invention, PNAs are used. PNAs are peptide-nucleic acid hybrids in which the phosphate backbone has been replaced by an achiral and neutral backbone made from N-(2-aminoethyl)-glycine units (see, e.g., Eurekah Bioscience Collection. PNA and Oligonucleotide Inhibitors of Human Telomerase. G. Gavory and S. Balasubramanian, Landes Bioscience, 2003). The bases A, G, T, C are attached to the amino nitrogen on the backbone via methylenecarbonyl linkages (P.E. Nielsen et al., Science 1991. 254: 1497-1500; M. Egholm et al., Nature 1993. 365: 566-568). PNAs bind complementary sequences with high specificity, and higher affinity relative to analogous DNA or RNA (M. Egholm et al., supra). PNA/DNA or PNA/RNA hybrids also exhibit higher thermal stability, compared to the corresponding DNA/DNA or DNA/RNA duplexes (M. Egholm et al., supra). PNAs also, possess high chemical and biological stability, due to the unnatural amide backbone that is not recognized by nucleases or proteases (V. Demidov et al., Biochem Pharmacol 1994. 48: 1310-1313). Typically, PNAs are at least 5 bases in length, and include a terminal lysine. PNAs may be pegylated to further extend their lifespan (Nielsen, P. E. et al. (1993) Anticancer Drug Des. 8:53-63).
As non-limiting examples, the following antigene PNAs are provided as complementary to unique sequences in the coding DNA strand of the first exon of the Saratan gene, and are designed to inhibit mRNA synthesis.
1) H-AGTGCGCCGTGCGGTCT-NH2 (SEQ ID NO: 37)
2) H-TCTCCGGACGCTCGCTG-NH2 (SEQ ID NO: 38)
Antibodies for inhibition of Saratan
The invention encompasses Saratan antibodies, for example, antibodies that bind to at least a portion of or a modified sequence thereof, ha certain aspects of the invention, antibodies may be used to inhibit Saratan. It will be understood that, for the purposes of the invention, a fragment or derivative of an antibody need not act fully as an antibody; that is to say, the fragment or derivative need not be capable of recruiting immune system cells to the site of binding to Saratan in vivo. It is not necessary to produce neutralising antibodies. Those of ordinary skill in the art to which the invention relates will recognise methods to generate antibody fragments. However, by way of general example proteolytic digestion of intact antibodies may be used, or the fragments may be directly produced via recombinant nucleic acid technology.
5 Humanisation of antibodies may be used to reduce the immunogenicity of antibodies generated in other animals. Production of humanised antibodies or humanization of antibodies can be achieved using techniques known in the art, for example in the case of humanisation of murine antibodies by epitope-guided selection. The most frequently used strategies for the humanization of rodent monoclonal antibodies are CDR grafting
10 (Reichmann, L., M. Clark, H. Waldman, and G. Winter. 1998. Reshaping human antibodies for therapy. Nature 332L323-327) and resurfacing (Pedersen, J. T., A. H. Henry, S. J. Searle, B. C. Guild, M. Roguska, and A. R. Rees. 1994. Comparison of surface accessible residues in human and murine immunoglobulin Fv domains. Implication for humanization of murine antibodies. J. MoI. Biol. 235:959-973). These
15 are based on a rational design approach and iterative optimization, i.e., site-directed mutagenesis of framework residues aided by computer modelling.
Other selective humanization strategies using phage display may be used (Baca, M., L. G. Presta, S. J. O'Connor, and J. A. Wells. 1997. Antibody humanization using
20 monovalent phage display. J. Biol. Chem. 272:10678-10684; Hoogenboom, H. R., A. P. de Bruine, S. E. Hufton, R. M. Hoet, J. W. Arends, and R. C. Roovers. 1998. Antibody phage display technology and its applications. Immunotechnology. 4:1-20; Jespers, L. S., A. Roberts, S. M. Mahler, G. Winter, and H. R. Hoogenboom. 1994. Guiding the selection of human antibodies from phage display repertoires to a single epitope of an
25. antigen. Biotechnology (NY) 12:899-903; Rader, C. and C. F. Barbas, III. 1997. Phage display of combinatorial antibody libraries. Curr. Opin. Biotechnol. 8:503-508; Rader, C, D. A. Cheresh, and C. F. Barbas, III. 1998. A phage display approach for rapid antibody humanization: designed combinatorial V gene libraries. Proc. Natl. Acad. Sci. U. S. A 95:8910-8915; Rosok, M. J., D. E. Yelton, L. J. Harris, J. Bajorath, K. E.
30 Hellstrom, I. Hellstrom, G. A. Cruz, K. Kristensson, H. Lin, W. D. Huse, and S. M. Glaser. 1996. A combinatorial library strategy for the rapid humanization of anticarcinoma BR96 Fab. J. Biol. Chem. 271:22611-22618). Those of skill in the art to which the invention relates will appreciate the terms "diabodies" and "triabodies". These are molecules which comprise a heavy chain variable domain (VET) connected to a light chain variable domain (VL) by a short peptide linker that is too short to allow pairing between the two domains on the same chain. This promotes pairing with the complementary domains of one or more other chains and encourages the formation of dimeric or trimeric molecules with two or more functional antigen binding sites. The resulting antibody molecules may be monospecific or multispecific (e.g., bispecific in the case of diabodies). Such antibody molecules may be created from two or more antibodies using methodology standard in the art to which the invention relates; for example, as described by Todorovska et al. (Design and application of diabodies, triabodies and tetrabodies for cancer targeting. J. Immunol. Methods. 2001 Feb l;248(l-2):47-66).
The production of antibodies may be carried out according to standard methodology in the art. For example, in the case of the production of polyclonal antibodies the methodology described by Bean (Eric S. Bean (2001) Polyclonal Antibodies. In: Basic Methods in Antibody Production and Characterization antibodies. Howard, G, and Bethel D. (ed.), CRC Press, 5:21-50, 2000) may be used. Monoclonal antibodies may be prepared, for example, in accordance with the methodology of Stewart (Sandy J. Stewart (2001) Monoclonal Antibody Production. In: Basic Methods in Antibody Production and Characterization antibodies. Howard, G. and Bethel D. (ed.), CRC Press, 6:51-68, 2000) or in "Monocolonal Antibody Production Techniques and Applications," Lawrence B Schook eds., Marcel Dekker Inc., New York, 1987.
Standard methods can be used to identify amino acid sequences useful for antibody production. Antigenic segments of a polypeptide can be predicted, for example, by Abie Pro 3.0: Peptide Antibody Design (hypertext transfer protocol://world wide web.changbioscience.com/abie/abie.html). More particularly, antigenic segments can be predicted according to the Hopp- Woods scale (Hopp TP, Woods KR. Prediction of protein antigenic determinants from amino acid sequences. Proc Natl Acad Sci U S A. 1981 Jun;78(6):3824-8.) and/or the Kyte and Doolittle scale (Kyte J, Doolittle RF. A simple method for displaying the hydropathic character of a protein. J MoI Biol. 1982
May 5;157(l):105-32.). Such epitopes may be conformational specific, in that they may include non-contiguous residues, and may constitute various portions of the predicted antigenic sequences (e.g., portions of any one of SEQ ID NO:49-64, see below), or a combination of one or more portions of the predicted antigenic sequences (e.g., combinations of one or more of SEQ ID NO:49-64), or one or more of the full length sequences (e.g., one or more of SEQ ID NO:49-64). Antigenic sequences can comprise any combination of amino acids or their derivatives that would form a similar 3-D structure (e.g., surface residues) as would be encountered in the native polypeptide.
In Saratan, sequence analysis shows two highly antigenic sequences, including NVHAAANGQGQPEDPPRSSNDAVL (residues 37-60, SEQ ID NO:49) and
FMDSPNEDFSTEYSLF (residues 17-32, SEQ ID NO:50). Fourteen antigenic sequences of 14 amino acids are also included: FMDSPNEDFSTEYS (residues 17-30,
SEQ ID NO:51), MDSPNEDFSTEYSL (residues 18-31, SEQ ID NO:52),
DSPNEDFSTEYSLF (residues 19-32, SEQ ID NO:53), NVHAAANGQGQPED (residues 37-50, SEQ ID NO:54), VHAAANGQGQPEDP (residues 38-51, SEQ ID
NO:55), HAAANGQGQPEDPP (residues 39-52, SEQ ID NO:56),
AAANGQGQPEDPPR (residues 40-53, SEQ ID NO:57), AANGQGQPEDPPRS
(residues 41-54, SEQ ID NO:58), ANGQGQPEDPPRSS (42-55, SEQ ID NO:59),
NGQGQPEDPPRSSN (residues 43-56, SEQ ID NO:60), GQGQPEDPPRSSND (residues 44-57, SEQ ID NO:61), QGQPEDPPRSSNDA (residues 45-58, SEQ ID
NO:62), GQPEDPPRSSNDAV (residues 46-59, SEQ ID NO:63), and
QPEDPPRSSNDAVL (residues 47-60, SEQ IDNO:64).
Antibodies of use in the invention may also be produced via standard recombinant techniques and as described for example by Welschof et al. (Welschof, M., C. Christ, I.
Hermes, A. Keller, C. Kleist, and M. Braunagel. 2003. Generation and screening of a modular human scFv expression library from multiple donors. Methods MoI. Biol.
207:103-121). The inventors consider recombinant techniques to be a preferable means of producing antibodies on a commercial scale. Nucleic acids encoding an antibody may be readily identified on the basis of the amino acid sequence of the antibody, the genetic code, and the understood degeneracy therein. Nucleic acids encoding antibodies may be isolated from hybridoma cells, for example, and subsequently characterised using procedures standard in the art. For example, a nucleic acid probe may be designed based on the amino acid sequence of a portion of an antibody and then used to isolate genes encoding the heavy and/or light chains of the antibody. Alternatively, nucleic acids may be generated by standard chemical synthesis methodology, for example, using phosphoramidite and solid phase chemistry. The amino acid sequence of an antibody of the invention may be determined using standard methodology; for example, Edman degradation and HPLC or mass spectroscopy analysis, may be used.
In addition to therapeutic use of antibodies directed against Saratan, they may find use in purification of Saratan or in diagnostic applications. For example, the antibodies may be immobilised on a solid phase. This would aid in purification and/or quantitation of the level of Saratan in a sample. In the case of diagnostic procedures and purification of Saratan it is not necessary for the antibody to have to inhibit Saratan activity. Additionally, as may be useful for certain applications, antibodies may be modified by labelling with a compound which provides a detectable signal; for example, enzymes, fluorescent agents, and radioisotopes can be used. Those of general skill in the art to which the invention relates will readily identify such suitable labelling systems. Additionally, antibodies may be used as carriers, for example to carry toxins, radionucleotides, isotopes, genes, or other therapeutic molecules to cells or tissues to aid in therapy.
Persons of ordinary skill in the art will readily appreciate methods for determining the efficacy of an antibody in preventing, decreasing, or inhibiting cell proliferation, cell survival, or cell motility. However, by way of example, the methodology described elsewhere herein, including one or more of the assays referred to in the "Examples" . section, may be used.
Compositions for inhibition of Saratan
The agents of use in inhibiting Saratan may be used on their own, or in the form of compositions in combination with one or more pharmaceutically acceptable diluents, carriers, and/or excipients. Those skilled in the art to which the invention relates will readily appreciate a variety of pharmaceutically acceptable diluents, carriers, and/or excipients which may be employed in compositions of the invention. As will be
■ appreciated, the choice of such diluents, carriers, and/or excipients will be dictated to some extent by the nature of the agent to be used, the intended dosage form of the composition, and the mode of administration. By way of example, in the case of administration of polynucleotides, such as vectors adapted to express antisense or iRNA, suitable carriers include isotonic solutions, water, aqueous saline solution, aqueous dextrose solution, and the like.
In addition to standard diluents, carriers, and/or excipients, a pharmaceutical composition of the invention may be formulated with additional constituents, or in such a manner, so as to enhance the activity of the agent or help protect the integrity of the agent. For example, the composition may further comprise adjuvants or constituents which provide protection against degradation, or decrease antigenicity of an agent, upon administration to a subject. Alternatively, the agent may be modified so as to allow for targeting to specific cells, tissues, or tumours.
Agents may be formulated to incorporate a sustained-release system. Inasmuch as this is the case, compositions may include semi-permeable polymer matrices in the form of shaped articles, e.g., films, or microcapsules. Sustained-release matrices include polylactides (U.S. Pat. No. 3,773,919; EP 58,481), copolymers of L-glutamic acid and gamma-ethyl-L-glutamate (Sidman et al., 1983, Biopolymers: 22: 547-56), poly(2- hydroxyethyl methacrylate) (Langer et al., 1981, J. Biomed. Mater. Res.: 15: 267), ethylene vinyl acetate (Langer et al., 1981, J. Biomed. Mater. Res.: 15: 267), or poly-D- (-)-3-hydroxybutyric acid (EP 133,988).
Agents of the invention may also be formulated into liposomes. Liposomes comprising the compound may be prepared using techniques known in the art to which the invention relates. By way of example see: DE 3,218,121, EP 52,322, EP 36,676, EP
88,046, EP 143,949, EP 142,641, Japanese Pat. Appln. 83-118008. U.S. Pat. Nos.
4,485,045 and 4,544,545, and EP 102,324. Ordinarily, the liposomes are of the small
(from or about 200 to 800 Angstroms) unilamellar type in which the lipid content is greater than about 30 mol percent cholesterol, the selected proportion being adjusted for the most efficacious therapy. Agents of use in the invention may also be pegylated to increase their lifetime. Additionally, it is contemplated that a composition in accordance with the invention may be formulated with other ingredients which may be of benefit to a subject in particular instances. For example, there may be benefit hi incorporating, where appropriate, one or more anti-neoplastic agents. Examples of such agents include: alkylating agents, for example, chlorambucil (e.g., Leukeran™), cyclophosphamide (e.g., Endoxan™, Cycloblastin™, Neosar™, Cyclophosphamide™), ifosfamide (e.g., Holoxan™, Hex™, Mesnex™), thiotepa (e.g., Thioplex™, Thiotepa™); and antϋnetabolites/S-phase inhibitors, for example, methotrexate sodium (e.g., Folex™, Abitrexate™, Edertrexate™), 5-fluorouracil (e.g., Efudix™, Efudex™), hydroxyurea (e.g., Droxia™, Hydroxyurea, Hydrea™), amsacrine, gemcitabine (e.g., Gemzar™), dacarbazine, thioguanine (e.g., Lanvis™).
Also included are antimetabolites/mitotic poisons, for example, etoposide (Etopophos™, Etoposide, Toposar™), vinblastine (e.g., Velbe™, Velban™), vindestine (e.g., Eldesine™), vinorelbine (e.g., Navelbine™), paclitaxel (e.g., Taxol™); antibiotic- type agents, for example, doxorubicin (e.g., Rubex™), bleomycin (e.g., Blenoxane™), dactinomycin (e.g., Cosmegen™), daunorubicin (e.g., Cerubidin™), mitomycin (e.g., Mutamycin™); hormonal agents, for example, ammoglutethimide (e.g., Cytadren™), anastrozole (e.g., Arimidex™), estramustine (e.g., Estracyt™, Emcyt™), goserelin (e.g., Zoladex™), hexamethylmelanine (e.g., Hexamet™), letrozole (e.g., Femara™), anastrozole (e.g., Arimidex™), and tamoxifen (e.g., Estroxyn™, Genox™, Novaldex™, Soltamox™, Tamofen™).
Further included are combinations of any two or more anti-neoplastic agents (for example, Adriamycin/5-fluorouracil/cyclophosphamide (FAC); and cyclophosphamide/methotrexate/S-fluorouracil (CMF)). Particularly useful are combinations that include, for example, at least two or more agents such as cyclophosphamide (e.g., CYTOXAN), methotrexate (e.g., RHEUMATREX), 5- fluorouracil (e.g., ADRUCEL), doxorubicin (e.g., ADRIAMYCIN), and cyclophosphamide (e.g., CYTOXAN). Useful for metastatic disease are agents such as capecitabine (e.g., XELODA), doxorubicin (e.g., ADRIAMYCIN), including its liposomal formulation, gemcitabine (e.g., GEMZAR), the taxanes, including paclitaxel
(e.g., TAXOL) and docetaxel (e.g., TAXOTERE), vinorelbine (e.g., NAVELBINE), and trastuzumab (e.g., HERCEPTIN). Persons of ordinary skill in the art to which the invention relates will readily appreciate examples of other agents which may be of benefit. Agents of the invention may also be formulated with compounds and agents, other than those specifically mentioned herein, in accordance with accepted pharmaceutical practice.
As will be appreciated, in the case of administration of polynucleotides, they may be packaged into viral delivery systems, which viral systems may themselves be formulated into compositions as herein described. Persons of skill in the art to which the invention relates may appreciate a variety of suitable viral vectors having regard to the nature of the invention described herein. However, by way of example, retroviral vectors, adenoviral vectors, and adeno-associated virus (AAV) can be used. Persons of skill in the art to which the invention relates will readily appreciate methods which may be employed to implement such vectors in the present invention. However, by way of example only: the use of retroviral vectors is reported in Miller et al., 1993, Meth. Enzymol. 217:581-599, and Boesen et al., 1994, Biotherapy 6:291-302; the use of adenoviral vectors is reported for example in Kozarsky and Wilson, 1993, Current Opinion in Genetics and Development 3:499-503; Rosenfeld et al., 1991, Science 252:431-434; Rosenfeld et al., 1992, Cell 68:143-155; Mastrangeli et al., 1993, J. Clin. Invest. 91:225-234; PCT Publication WO 94/12649; and Wang, et al., 1995, Gene Therapy 2:775-783; and, the use of AAV has been reported in Walsh et al., 1993, Proc. Soc. Exp. Biol. Med. 204:289-300; U.S. Patent No. 5,436,146.
In accordance with the mode of administration to be used, and the suitable pharmaceutical excipients, diluents and/or carriers employed, compositions of the invention may be adapted into customary dosage forms such as solutions, orally administrable liquids, injectable liquids, tablets, coated tablets, capsules, pills, granules, suppositories, transdermal patches, suspensions, emulsions, sustained release formulations, gels, aerosols, liposomes, powders and immunoliposomes. The dosage form chosen will reflect the mode of administration desired to be used, the disorder to be treated, and the nature of the agent to be used. Particularly preferred dosage forms include orally administrable tablets, gels, pills, capsules, semisolids, powders, sustained release formulations, suspensions, elixirs, aerosols, ointments, or solutions for topical administration, and injectable liquids. Skilled persons will readily recognise appropriate dosage forms and formulation methods. Generally, compositions are prepared by contacting or mixing specific agents and ingredients with one another. Then, if necessary, the product is shaped into the desired formulation. By way of example, certain methods of formulating compositions may be found in references such as Gennaro AR: Remington: The Science and Practice of Pharmacy, 20th ed., Lippincott, Williams & Wilkins, 2000.
The amount of an agent of the invention in a composition can vary widely depending on the type of composition, size of a unit dosage, kind of carriers, diluents and/or excipients, and other factors well known to those of ordinary skill in the art. hi general, the final composition can comprise from 0.0001 percent by weight (% w) to 100% w of the actives of this invention, preferably 0.001% w to 10% w, with the remainder being any other active agents present and/or carrier(s), diluent(s) and/or excipient(s).
Methods of treatment
While the inventors' primary studies have involved breast cancer cells, Saratan is predicted to also act in the small intestine, spleen, liver, fetal liver and kidney, and also heart, prostate, uterus, colon, stomach, skin, lung, trachea, brain, cerebellum, fetal brain, spinal cord, placenta, adrenal gland, adipose, cartilage, hematopoietic and immune systems, pancreas, and also skeletal muscle, thymus, salivary gland, thyroid, umbilical cord, and ovaries. Specifically, Saratan is predicted to act in breast cancer, colon cancer, lung cancer, prostate cancer, endometrial cancer, and stomach cancer, among others. Accordingly, the inventors contemplate the inhibition of Saratan being applicable to the treatment of a variety of disorders characterised by altered cell proliferation, cell survival, or cell motility. In addition, based on homology to the mouse Saratan sequence, we predict a role for human Saratan in treating disorders of the brain, for example, brain cancers, and neurodegenerative diseases such as multiple sclerosis, Parkinson's disease, Alzheimer's disease, or Amyotrophic Lateral Sclerosis (ALS) (see, e.g., hypertext transfer protocol://www.ncbi.nhn.nih.gov/IEB/Research/Acembly/ av.cgi?c=geneid&org=9606&l:=5696). For such disorders, it is In one embodiment, the invention relates to a method of preventing, reducing, or inhibiting cell proliferation, cell survival, or cell motility by inhibiting Saratan. Preferably, the method is for the treatment of a disorder characterised by aberrant cell in subject. This aberrant cell proliferation, cell survival, or cell motility may occur in one or more cell type within a subject and can include metastatic disorders. Specific disorders include, for example, cancer (breast, colon, lung prostate, endometrial, or stomach cancer, for example) and endometriosis. Examples of disorders include cancers such as adenocarcinoma, leukemia, lymphoma, melanoma, myeloma, sarcoma, teratocarcinoma, and cancers of the adrenal gland, bladder, bone, brain, breast, cervix, gall bladder, ganglia, gastrointestinal tract, heart, kidney, liver, lung, bone marrow, muscle, ovary, pancreas, parathyroid, penis, prostate, salivary glands, skin, spleen, testis, thymus, thyroid, and uterus. In various embodiments, the disorder is an epithelial tumor of the breast, colon, lung, prostate, pancreas, stomach, endometrium, or ovary, or squamous cell carcinoma, or a melanoma, or a renal cancer or tumour.
Regarding breast cancers, these can include epithelial tumours (e.g., from cells lining ducts or lobules) or nonepithelial tumours (e.g., from the supporting stroma), such as angiosarcomas, primary stromal sarcomas, and phyllodes tumor. Breast cancers can also include carcinomas, for example, carcinomas in situ, as well as invasive cancers. Carcinoma in situ includes proliferation of cancer cells within ducts or lobules and without invasion of stromal tissue. Lobular carcinoma in situ (LCIS) includes nonpalpable lesions which can indicate increased risk of subsequent invasive carcinoma in either breast, hi breast cancer, invasive carcinoma generally comprises adenocarcinoma, with most comprising infiltrating ductal type carcinoma and the remainder comprising infiltrating lobular carcinoma. Rare forms of breast cancer include medullary, mucinous, and tubular carcinomas. Breast cancer disorders also include Paget's disease of the nipple, and metastatic breast cancer.
Regarding colon cancer, this can generally include cancer of the colon, rectum, and/or anus, and especially, adenocarcinomas, and also carcinomas (e.g., squamous cloacogenic carcinomas), melanomas, lymphomas, and sarcomas. Epidermoid
(nonkeratinizing squamous cell or basaloid) carcinomas are also included. The colon cancer may be associated with particular types of polyps or other lesions, for example, tubular adenomas, tubulovillous adenomas (e.g., villoglandular polyps), villous (e.g., papillary) adenomas (with or without adenocarcinoma), hyperplastic polyps, hamartomas, juvenile polyps, polypoid carcinomas, pseudopolyps, lipomas, or leiomyomas. The cancer may be associated with familial polyposis and related conditions such as Gardner's syndrome or Peutz-Jeghers syndrome. The cancer may be associated, for example, with chronic fistulas, irradiated anal skin, leukoplakia, lymphogranuloma venereum, Bowen's disease (intraepithelial carcinoma), condyloma acuminatum, or human papillomavirus. In other aspects, the cancer may be associated with basal cell carcinoma, extramammary Paget's disease, cloacogenic carcinoma, or malignant melanoma.
Persons of general skill in the art to which the invention relates may readily appreciate alternative types of disorder which the invention may be applicable, especially having regard to the expression of Saratan provided herein. In addition, it will be appreciated by those of general skill in the art to which the invention relates, having regard to the nature of the invention and the results reported herein, that the present invention is applicable to a variety of different animals. Accordingly, the diagnostics and treatments can apply to any animal of interest. In particular, the invention is applicable to mammals, more particularly humans.
Person's of ordinary skill in the art to which the invention relates will appreciate various means and agents of use to inhibit Saratan. By way of example, nucleic acid technology including iRNA, antisense, and triple helix DNA may be employed to inhibit expression. Alternatively antibodies directed against Saratan or functional derivatives of such antibodies may be used. Exemplary agents are described in detail herein. Those agents of use in the invention will preferably exhibit one or more of the following characteristics: 1) the ability to prevent, reduce or inhibit cell proliferation; 2) the ability to prevent, reduce or inhibit cell survival; 3) the ability to prevent, reduce or inhibit cell motility; 3) the ability to prevent, reduce or inhibit expression or activity of Saratan; 4) the ability to prevent, decrease, reduce or control metastasis of tumours. Preferably, suitable agents will exhibit two or more of these characteristics. As shown herein, Saratan is encoded as a cellular factor that is expressed in certain cancer cells, and also by at least one subset of normal adult cells. Therefore, Saratan can be considered a tumor-associated antigen. Several approaches can be used to target Saratan based on differences in expression and access in normal and cancer cells (reviewed, generally, in Paul, Fundamental Immunology, 1999, Lippincott-Raven Publishers, Philadelphia, PA, Chapter 37). Cancer cells are likely to express Saratan at much higher levels and such differences in expression levels between normal and cancer cells can be exploited therapeutically (see, e.g., Brown JP, et al., Quantitative analysis of melanoma-associated antigen p97 in normal and neoplastic tissues. Proc Natl Acad Sci USA 1981;78:539-543). Targeting may also be attained because of better access of Saratan-specific effector cells to cancer cells than to normal cells. For example, Saratan expressed on cancer cells may be more available for binding due to incomplete glycosylation (e.g., as in the case of epithelial mucins). For cancer cells, increased expression of MHC molecules may make tumours a direct target for T cells (see, e.g., Uyttenhove C, et al. The expression of mouse gene PlA in testis does not prevent safe induction of cytolytic T cells against a PlA-encoded tumor antigen. Int J Cancer 1997;70:349-356).
Multiple immunotherapeutic strategies involving innate or acquired immunity can be used to control Saratan-associated cancer, including (a) local application of a live bacterial vaccine, e.g., BCG; (b) use of cytokines; (c) active immunization against
Saratan; (d) passive therapy with Saratan antibodies; and (e) adoptive transfer of effector cells (e.g., T cells). Active immunization against Saratan can be used to induce immune responses or passive immunization with a murine monoclonal antibody directed against Saratan. For general guidance, see, e.g., Riethmuller G, et al.,
Monoclonal antibody therapy for resected Dukes' C colorectal cancer: seven-year outcome of a multicenter randomized trial. J Clin Oncol 1998;16:1788-1794;
Riethmuller G, et al., Randomized trial of monoclonal antibody for adjuvant therapy of resected Dukes' C colorectal carcinoma. German Cancer Aid 17- IA Study Group. Lancet 1994;343:1177-1183; Herlyn DM, et al., Inhibition of growth of colorectal carcinoma in nude mice by monoclonal antibody. Cancer Res 1980;40:717-721. For immunization, pure antigens are often ineffective in inducing an acquired (i.e., antigen-specific) immune response unless certain adjuvants are used to stimulate innate immunity- Therefore, numerous approaches are designed to stimulate innate immunity at the site of vaccinations by the use of chemical and/or bacterial agents. Synthetic peptides used in vaccines can be designed for particular MHC haplotypes (see, e.g., Toes RE et al. Peptide vaccination can lead to enhanced tumor growth through specific T-cell tolerance induction. Proc Natl Acad Sci USA 1996;93:7855-7860). Antigenic peptides can be loaded onto heat-shock protein (or as recombinant virus-like particles) to increase the efficacy of immunization. Generally, effective induction of an immune response requires antigen presentation in an environment that provides appropriate help or secondary signals.
Several experimental designs use dendritic cells pulsed with virus-specific or tumor- associated peptides to induce tumor-reactive T cells and rejection of transplanted tumor cells. Dendritic cells can be loaded with synthetic antigenic peptides or recombinant proteins. Dendritic cells can also be loaded with one or more of: native peptides stripped from tumor cell surfaces; tumor-derived, peptide-loaded heat-shock proteins; tumor-derived rnRNA; or fused tumor cells (for review, see Shurin MR. Dendritic cells presenting tumor antigen. Cancer Immunol Immunother 1996;43: 158-164). One advantage of these strategies is that powerful immunity can be induced to (unique) individually distinct tumor antigens, as well as tumor-associated antigens.
For Saratan antigens, recombinant vaccines can be developed using vaccinia, Listeria, or virus-like particles. In other approaches, genetic vaccination can be used, for example, by injecting naked DNA plasmid constructs, intramuscularly encoding the tumor antigen (see e.g., Donnelly JJ, Ulmer JB, Liu MA. DNA vaccines. Life Sci 1997;60:163-172). GM-CSF may also be used to improve the presentation of the antigen by dendritic cells at the site of injection (see, e.g., Syrengelas AD, Chen TT, Levy R. DNA immunization induces protective immunity against B-cell lymphoma. Nat Med 1996;2:1038-1041). In other approaches, vaccination with anti-idiotypic antibodies can be used. As further approaches, passive antibody therapy or adoptive transfer of tumor-specific T cells can be used. For example, passive immunization with Saratan antibody can protect against challenge with tumor cells and can be therapeutic when given soon after challenge with the cancer cells (e.g., see Riethmϋller G, et al. Monoclonal antibody therapy for resected Dukes' C colorectal cancer: seven-year outcome of a multicenter randomized trial. J Clin Oncol 1998;16:1788-1794; Riethmϋller G, et al. Randomized trial of monoclonal antibody for adjuvant therapy of resected Dukes' C colorectal carcinoma. German Cancer Aid 17-1A Study Group. Lancet 1994;343:1177-1183; Herlyn DM, et al. Inhibition of growth of colorectal carcinoma in nude mice by monoclonal antibody. Cancer Res 1980;40:717-721).
As alternate approaches, anti-idiotypic antibody treatment can be used to induce cancer cells to go into a long-lasting dormant state (see, e.g., Miller RA, Maloney DG, Warnke R, Levy R. Treatment of B-cell lymphoma with monoclonal anti-idiotype antibody. N Engl J Med 1982;306:517— 522). In addition, antibodies to tumour cells can be used as carriers for cytokines or cytotoxic agents, such as radiochemicals or natural toxins (see, e.g., Ghetie V, Vitetta E. Lnmunotoxins in the therapy of cancer: from bench to clinic. Pharmacol Ther 1994;63:209-234; Reisfeld RA, Gillies SD. Recombinant antibody fusion proteins for cancer immunotherapy. Curr Top Microbiol Immunol 1996;213:27— 53). The recombinant antibody-cytokine or antibody-toxin fusion proteins may be used to concentrate these agents in the stroma surrounding the tumor cells. As alternatives, bispecific monoclonal antibodies can be engineered to bind effector cells as well as tumor antigens on the cancer cells. Monoclonal antibodies can also be humanized to reduce the stimulation of neutralizing anti-murine antibodies by patients. As still further approaches, adoptive transfer of T cells can be used with longer established tumor loads. T cells that have been isolated from patients can be expanded in vitro with EL-2 and then infused into patients who receive IL-2 as well (see, e.g., Smith CA, et al. Adoptive immunotherapy for Epstein-Barr virus-related lymphoma. Leuk Lymphoma 1996;23:213-220).
The efficacy of an agent in inhibiting Saratan may be determined having regard to the description of the invention herein and known methodology. For example, efficacy of agents may be determined by observing their ability to prevent, reduce, or inhibit expression of Saratan or one or more of the functional effects of Saratan. By way of particular example, the affect of the agent on one or more of cellular invasion, cellular migration, the level of gene transcription of Saratan and Saratan responsive genes may be studied. Such studies may be conducted in vitro or in vivo.
The assays described herein after under the heading "Examples" may be used to determine the suitability of an agent in accordance with the invention. Specifically, RT- PCR and Northern blot analysis can be used to detect Saratan expression at the mRNA level, and Western blotting and direct or indirect immunostaining can be used to detect the expression at the protein level. To detect Saratan activity, cell-based assays for cell proliferation, cell survival, or cell motility can be used.
In respect of the effects of Saratan inhibition on metastasis, an in vivo assay may be used, as described, for example, in Fidler, I. J. (1973) Nat. New Biol. 242, 148-149; and Price J. E. The biology of cancer metastasis. Prog. Clin. Biol. Res., 354A: 237-255,
1"99O, or Kerbel R. S. What is the optimal rodent model for anti-tumor drug testing?
Cancer Metastasis Rev., 17: 301-304, 1998; Killion J. J., Radinsky R., Fidler I. J.
Orthotopic models are necessary to predict therapy of transplantable tumours in mice.
Cancer Metastasis Rev., 17: 279-284, 1998; and Price J. E. Analyzing the metastatic phenotype. J. Cell. Biochem., 56: 16-22, 1994.
Administration routes/regimes
The inventors contemplate administration of any of the agents or compositions of the invention by any means capable of delivering the desired activity (e.g., inhibition of Saratan) to a target site within the body of a subject. A target site may be any site within the body which may have or be susceptible to a disorder, and may include one or more cells, tissues or a specific tumor. For example, administration may include parenteral administration routes, systemic administration routes, oral and topical administration. Administration may be by way of injection, subcutaneous, intraorbital, ophthalmic, intraspinal, intracisternal, topical, infusion (using, e.g., slow release devices or minipumps such as osmotic pumps or skin patches), implant, aerosol, inhalation, scarification, intraperitoneal, intracapsular, intramuscular, intratumoral, intranasal, oral, buccal, transdermal, pulmonary, rectal or vaginal delivery. As will be appreciated, the administration route chosen may be dependent on the position of the target site within the body of a subject, as well as the nature of the agent or composition being used.
In a specific embodiment, in the case of polynucleotides, they may be administered for example by infection using defective or attenuated retroviral or other viral vectors (see e.g., U.S. Patent No. 4,980,286), or by direct injection of naked DNA, or by use of microparticle bombardment (e.g., a gene gun; Biolistic, DuPont); by coating with lipids or cell-surface receptors or transfecting agents; encapsulation in liposomes, microparticles, or microcapsules; by linkage to a peptide which is known to enter the nucleus; or by administering it in linkage to a ligand subject to receptor-mediated endocytosis (see, e.g., Wu and Wu, 1987, J. Biol. Chem. 262:4429-4432), which can be used to target cell types specifically expressing the receptors, and the like. In addition, nucleic acid-ligand complexes can be formed in which the ligand comprises a fusogenic viral peptide to disrupt endosomes, allowing the nucleic acid molecules to avoid lysosomal degradation.
In yet another embodiment, the polynucleotides can be targeted in vivo for cell specific uptake and expression, by targeting a specific receptor, as described for example in WO 92/06180 dated April 16, 1992 (Wu et al.); WO 92/22635 dated December 23, 1992 (Wilson et al.); WO 92/20316 dated November 26, 1992 (Findeis et al.); WO 93/14188 dated July 22, 1993 (Clarke et al.); and, WO 93/20221 dated October 14, 1993 (Young). Alternatively, the polynucleotides can be introduced intracellularly and incorporated within host cell DNA for expression, by homologous recombination Koller and Smithies, 1989, Proc. Natl. Acad. Sci. USA 86:8932-8935; Zijlstra et al., 1989, Nature 342:435-438. Cells into which polynucleotides can be introduced for purposes of the present invention encompass any desired, available cell type. The appropriate cell type will depend on the nature of the disorder to be treated. However, by way of example, the polynucleotide can be introduced to a cancer cell.
As will be appreciated, the dose of an agent or composition administered, the period of administration, and the general administration regime may differ between subjects depending on such variables as the nature of the condition to be treated, severity of symptoms of a subject, the size of any tumour to be treated, the target site to be treated, the mode of administration chosen, and the age, sex and/or general health of a subject. Persons of average skill in the art to which the invention relates will readily appreciate or be able to determine appropriate administration regimes having regard to such factors. It should be appreciated that adπiinistration may include a single daily dose or administration of a number of discrete divided doses as may be appropriate. The inventors also contemplate the administration regimes which combine different modes or routes of administration. For example, intratumoural injection and systemic administration could be combined.
It should be appreciated that a method of the invention may comprise further steps such as the administration of additional agents or compositions which may be beneficial to a subject having regard to the condition to be treated. For example, other agents of use in treating proliferative disorders (such as the anti-neoplastic agents mentioned above) could be administered. It should be appreciated that such additional agents and compositions may be administered concurrently with the agents and compositions of the invention, or in a sequential manner. For example, the additional agents or compositions could be administered before or after administration of the agents or compositions of the invention. It should be appreciated in relation to sequential delivery of agents or compositions, that sequential administration of one agent or composition after the other need not occur immediately, although this may be preferable. There may be a time delay between delivery of the agents or compositions. The period of the delay will depend on factors such as the condition to be treated and the nature of the compositions or agents to be delivered. However, by way of example, the inventors contemplate periods of between hours to several days or months.
Diagnostic methods and compositions
In one embodiment, the invention relates to use of one or more reagents of the invention in a method of diagnosing a disorder associated with cell proliferation, cell survival, or cell motility. Preferably, the method is for the diagnosis of a disorder characterised by aberrant cell proliferation, cell survival, or cell motility in subject. This aberrant cell proliferation, cell survival, or cell motility may occur in one or more cell type within a subject and can include metastatic disorders. Specific disorders include, for example, cancer (breast, lung, colon, prostate, endometrial, or stomach cancer, for example) and endometriosis. Examples of disorders include cancers such as adenocarcinoma, leukemia, lymphoma, melanoma, myeloma, sarcoma, teratocarcinoma, and cancers of the adrenal gland, bladder, bone, brain, breast, cervix, gall bladder, ganglia, gastrointestinal tract, heart, kidney, liver, lung, bone marrow, muscle, ovary, pancreas, parathyroid, penis, prostate, salivary glands, skin, spleen, testis, thymus, thyroid, and uterus. In various embodiments, the disorder is an epithelial tumor of the breast, lung, prostate, colon, pancreas, endometrium, stomach, or ovary, or a squamous cell carcinoma, or a melanoma, or a renal cancer or tumour. Specific breast and colon cancers are described in detail herein.
In accordance with the invention, antibodies which specifically bind Saratan may be used for the diagnosis of conditions or disorders characterized by expression of Saratan, or in assays to monitor patients being treated with Saratan inhibitors. The antibodies useful for diagnostic purposes may be prepared hi the same manner as those described above for therapeutics. Diagnostic assays for Saratan include methods which utilize the antibody and a label to detect Saratan in human body fluids or extracts of cells or tissues. The antibodies may be used with or without modification, and may be labeled by joining them, either covalently or non-covalently, with a reporter molecule. A wide variety of reporter molecules which are known in the art may be used, several of which are described above.
A variety of protocols, including ELISA, RIA, and FACS, are known in the art and provide a basis for diagnosing altered or abnormal levels of Saratan expression. Normal or standard values for Saratan expression are established by combining body fluids or cell extracts taken from normal mammalian subjects, preferably human, with antibody to Saratan under conditions suitable for complex formation. The amount of standard complex formation may be quantified by various methods, but preferably by photometric means. Quantities of Saratan expressed in subject, control, and disease, samples from biopsied tissues are compared with the standard values. Deviation between standard and subject values establishes the parameters for diagnosing disorders. In another embodiment of the invention, the polynucleotides encoding Saratan may be used for diagnostic purposes. The polynucleotides which may be used include oligonucleotide sequences, complementary RNA and DNA molecules, and PNAs. The polynucleotides may be used to detect and quantitate gene expression in biopsied tissues in which expression of Saratan may be correlated with disorders. The diagnostic assay may be used to distinguish between absence, presence, and excess expression of Saratan, and to monitor regulation of Saratan levels during therapeutic intervention.
In one aspect, hybridization with PCR probes which are capable of detecting polynucleotide sequences, including genomic sequences, encoding Saratan or closely related molecules, may be used to , identify nucleic acid sequences which encode
Saratan. The specificity of the probe, whether it is made from a highly specific region, e.g., 10 unique nucleotides in the 5' regulatory region, or a less specific region, e.g., especially in the 3' coding region, and the stringency of the hybridization or amplification (maximal, high, intermediate, or low) will determine whether the probe identifies only naturally occurring sequences encoding Saratan, alleles, or related sequences.
Probes may also be used for the detection of related sequences, and should preferably contain at least 50% of the nucleotides from any of the Saratan encoding sequences. The hybridization probes of the subject invention may be DNA or RNA and derived from the nucleotide sequence of SEQ ID NO: 14-16, 19, 22, or fragments encompassing a nucleic acid sequence of SEQ ID NO: 17, 18, 20, 21, 23, 24-48, or from genomic sequences including promoter, enhancer elements, and introns of the naturally occurring Saratan.
Means for producing specific hybridization probes for DNAs encoding Saratan include the cloning of nucleic acid sequences encoding Saratan or modified sequences into vectors for the production of mRNA probes. Such vectors are known in the art, commercially available, and may be used to synthesize RNA probes in vitro by means of the addition of the appropriate RNA polymerases and the appropriate labeled nucleotides. Hybridization probes may be labeled by a variety of reporter groups, for example, radionuclides such as 32P or S, or enzymatic labels, such as alkaline phosphatase coupled to the probe via avidin/biotin coupling systems, and the like.
Polynucleotide sequences encoding Saratan may be used for the diagnosis of disorders which are associated with either increased or decreased expression of Saratan. The polynucleotide sequences encoding Saratan may be used in Southern or northern analysis; dot blot or other membrane-based technologies; in PCR technologies; or in dipstick, pin, ELISA assays; or microarrays utilizing fluids or tissues from patient biopsies to detect altered Saratan expression. Such qualitative or quantitative methods are well known in the art.
hi a particular aspect, the nucleotide sequences encoding Saratan may be useful in assays that detect activation or induction of various cancers, particularly those mentioned above. The nucleotide sequences encoding Saratan may be labeled by standard methods, and added to a fluid or tissue sample from a patient under conditions suitable for the formation of hybridization complexes. After a suitable incubation period, the sample is washed and the signal is quantitated and compared with a standard value. If the amount of signal in the biopsied or extracted sample is significantly altered from that of a comparable control sample, the nucleotide sequences have hybridized with nucleotide sequences in the sample, and the presence of altered levels of nucleotide sequences encoding Saratan in the sample indicates the presence of the associated disorder. Such assays may also be used to evaluate the efficacy of a particular therapeutic treatment regimen in animal studies, in clinical trials, or in monitoring the treatment of an individual patient.
hi order to provide a basis for the diagnosis of a disorder associated with expression of Saratan, a normal or standard profile for expression is established. This may be accomplished by combining body fluids or cell extracts taken from normal subjects, either animal or human, with a sequence, or a fragment thereof, which encodes Saratan, under conditions suitable for hybridization or amplification. Standard hybridization may be quantified by comparing the values obtained from normal subjects with those from an experiment where a known amount of a substantially purified polynucleotide is used.
Standard values obtained from normal samples may be compared with values obtained from samples from patients who are symptomatic for a disorder. Deviation between standard and subject values is used to establish the presence of the disorder.
Once the disorder is diagnosed and a treatment protocol is initiated, hybridization assays may be repeated on a regular basis to evaluate whether the level of expression in the patient begins to approximate that which is observed in the normal patient. The results obtained from successive assays may be used to show the efficacy of treatment over a period ranging from several days to months. With respect to cancer, the presence of a relatively high amount of transcript in biopsied tissue from an individual may indicate a predisposition for the development of the disorder, or may provide a means for detecting the disorder prior to the appearance of actual clinical symptoms. A more definitive diagnosis of this type may allow health professionals to employ preventative measures or aggressive treatment earlier thereby preventing the development or further progression of the cancer.
Additional diagnostic uses for oligonucleotides designed from the sequences encoding Saratan may involve the use of PCR. Such oligomers may be chemically synthesized, generated enzymatically, or produced in vitro. Oligomers will preferably consist of two nucleotide sequences, one with sense orientation (5'.fwdarw.3') and another with antisense (3'.fwdarw.5'), employed under optimized conditions for identification of a specific gene or condition. The same two oligomers, nested sets of oligomers, or even a degenerate pool of oligomers may be employed under less stringent conditions for detection and/or quantitation of closely related DNA or RNA sequences.
Methods which may also be used to quantitate the expression of Saratan include radiolabeling or biotinylathig nucleotides, coamplification of a control nucleic acid, and standard curves onto which the experimental results are interpolated (Melby, P. C. et al. (1993) J. Immunol. Methods, 159:235-244; Duplaa, C. et al. (1993) Anal. Biochem. 229-236). The speed of quantitation of multiple samples may be accelerated by running the assay in an ELISA format where the oligomer of interest is presented in various dilutions and a spectrophotometric or colorimetric response gives rapid quantitation. In further embodiments, oligonucleotides or longer fragments derived from any of the polynucleotide sequences described herein may be used as targets in a microarray. The microarray can be used to monitor the expression level of large numbers of genes simultaneously (to produce a transcript image), and to identify genetic variants, mutations and polymorphisms. This information may be used to determine gene function, to understand the genetic basis of the disorder, to diagnose the disorder, and to develop and monitor the activities of therapeutic agents. In one embodiment, the microarray is prepared and used according to the methods known in the art such as those described in PCT application WO 95/11995 (Chee et al.), Lockhart, D. J. et al. (1996; Nat. Biotech. 14: 1675-1680) and Schena, M. et al. (1996; Proc. Natl. Acad. Sci. 93: 10614-10619).
The microarray is preferably composed of a large number of unique, single stranded nucleic acid sequences, usually either synthetic antisense oligonucleotides or fragments of cDNAs, fixed to a solid support. The oligonucleotides are preferably about 6 to 60 nucleotides Til length, more preferably about 15 to 30 nucleotides in length, and most preferably about 20 to 25 nucleotides in length. For a certain type of microarray, it may be preferable to use oligonucleotides which are 7 to 10 nucleotides in length. The microarray may contain oligonucleotides which cover the known 5' or 3' sequence, or may contain sequential oligonucleotides which cover the full length sequence; or unique oligonucleotides selected from particular areas along the length of the sequence.
Polynucleotides used in the microarray may be oligonucleotides that are specific to a gene or genes of interest in which at least a fragment of the sequence is known or that are specific to one or more unidentified cDNAs which are common to a particular cell or tissue type or to a normal, developmental, or disease state. In certain situations, it may be appropriate to use pairs of oligonucleotides on a microarray. The pairs will be identical, except for one nucleotide preferably located in the centre of the sequence. The second oligonucleotide in the pair (mismatched by one) serves as a control. The number of oligonucleotide pairs may range from 1 to 1,000,000.
In order to produce oligonucleotides to a known sequence for a microarray, the gene of interest is examined using a computer algorithm which starts at the 5' or more preferably at the 3' end of the nucleotide sequence. The algorithm identifies oligomers of defined length that are unique to the gene, have a GC content within a range suitable for hybridization, and lack predicted secondary structure that may interfere with hybridization. In one aspect, the oligomers are synthesized at designated areas on a substrate using a light-directed chemical process. The substrate may be paper, nylon or any other type of membrane, filter, chip, glass slide, or any other suitable solid support.
In one aspect, the oligonucleotides may be synthesized on the surface of the substrate by using a chemical coupling procedure and an ink jet application apparatus, such as that described in PCT application WO 95/251116 (Baldeschweiler et al.). In another aspect, a gridded array analogous to a dot or slot blot (HYBRIDOT apparatus, Life Technologies) may be used to arrange and link cDNA fragments or oligonucleotides to the surface of a substrate using a vacuum system, thermal, UV, mechanical or chemical bonding procedures. In yet another aspect, an array may be produced by hand or by using available devices, materials, and machines (including multichannel pipettors or robotic instruments; Brinkmann, Westbury, NY) and may include about 8, 24, 96, 384, 1536 or 6144 oligonucleotides, or any other multiple from 2 to 1,000,000, which lends itself to the efficient use of commercially available instrumentation.
In order to conduct sample analysis using the microarrays, polynucleotides are extracted from a biological sample. The biological samples may be obtained from any bodily fluid (e.g., blood, urine, saliva, phlegm, gastric juices, etc.), cultured cells, biopsies, or other tissue preparations. To produce probes, the polynucleotides extracted from the sample are used to produce nucleic acid sequences which are complementary to the oligonucleotides on the microarray. If the microarray consists of cDNAs, antisense RNAs are appropriate probes. Therefore, in one aspect, mRNA is used to produce cDNA which, in turn and in the presence of fluorescent nucleotides, is used to produce fragment or oligonucleotide antisense RNA probes. These fmorescently labeled probes are incubated with the microarray so that the probe sequences hybridize to the cDNA oligonucleotides of the microarray. In another aspect, nucleic acid sequences used as probes can include polynucleotides, fragments, and complementary or antisense sequences produced using restriction enzymes, PCR technologies, and oligolabeling kits (Amersham Pharmacia Biotech), which are well known in the area of hybridization technology.
Incubation conditions are adjusted so that hybridization occurs with precise complementary matches or with various degrees of less complementarity. After removal of non-hybridized probes, a scanner is used to determine the levels and patterns of fluorescence. The scanned images are examined to determine degree of complementarity and the relative abundance of each oligonucleotide sequence on the microarray. A detection system may be used to measure the absence, presence, and amount of hybridization for all of the distinct sequences simultaneously. This data may be used for large scale correlation studies or functional analysis of the sequences, mutations, variants, or polymorphisms among samples (Heller, R. A. et al., (1997) Proc. Natl. Acad. Sci. 94:2150-55).
In another embodiment of the invention, the nucleic acid sequences which encode Saratan may be used to generate hybridization probes which are useful for mapping the naturally occurring genomic sequence. The sequences may be mapped to a particular chromosome, to a specific region of a chromosome, or to artificial chromosome constructions, such as human artificial chromosomes (HACs), yeast artificial chromosomes (YACs), bacterial artificial chromosomes (BACs), bacterial Pl constructions or single chromosome cDNA libraries (cf. Price, C. M. (1993) Blood Rev. 7:127-134; Trask, B. J. (1991) Trends Genet. 7:149-154).
Fluorescent in situ hybridization (FISH as described in Verma et al. (1988) Human Chromosomes: A Manual of Basic Techniques, Pergamon Press, New York, NY) may be correlated with other physical chromosome mapping techniques and genetic map data. Examples of genetic map data can be found in various scientific journals or at the
Online Mendelian Inheritance hi Man (OMIM) site. Correlation between the location of the gene encoding Saratan on a physical chromosomal map and a specific disorder, or predisposition to a specific disorder, may help delimit the region of DNA associated with that disorder. The nucleotide sequences of the subject invention may be used to detect differences in gene sequences between normal, carrier, and affected individuals. In situ hybridization of chromosomal preparations and physical mapping techniques, linkage analysis using established chromosomal markers, may be used to extend genetic maps. Often the placement of a gene on the chromosome of another mammalian species, such as mouse, may reveal associated markers even if the number or arm of a particular human chromosome is not known. New sequences can be assigned to chromosomal arms, or parts thereof, by physical mapping. This provides valuable information to investigators searching for disease genes using positional cloning or other gene discovery techniques. Once the disorder has been crudely localized by genetic linkage to a particular genomic region, for example, AT to l lq22-23 (Gatti, R. A. et al. (1988) Nature 336:577-580), any sequences mapping to that area may represent associated or regulatory genes for further investigation. The nucleotide sequence of the subject invention may also be used to detect differences in the chromosomal location due to translocation, inversion, etc., among normal, carrier, and affected individuals.
In another embodiment of the invention, Saratan, or its functional or immunogenic fragments or oligopeptides thereof, can be used for screening libraries of compounds in any of a variety of drug screening techniques. The fragment employed in such screening may be free in solution, affixed to a solid support, borne on a cell surface, or located intracellularly. The formation of binding complexes, between Saratan and the agent being tested, may be measured. In a further embodiment, one may use competitive drug screening assays in which neutralizing antibodies capable of binding Saratan specifically compete with a test compound for binding Saratan. In this same manner, the antibodies can be used to detect the presence of any amino acid sequence which shares one or more antigenic determinants with Saratan.
Another technique for drug screening which may be used provides for high throughput screening of compounds having suitable binding affinity to the protein of interest as described in WO 84/03564. In this method, as applied to Saratan, large numbers of different small test compounds are synthesized on a solid substrate, such as plastic pins or some other surface. The test compounds are reacted with Saratan, or fragments thereof, and washed. Bound Saratan is then detected by methods well known in the art. Purified Saratan can also be coated directly onto plates for use in the aforementioned drug screening techniques. Alternatively, non-neutralizing antibodies can be used to capture the peptide and immobilize it on a solid support.
In additional embodiments, the nucleotide sequences which encode Saratan may be used in any molecular biology techniques that have yet to be developed, provided the new techniques rely on properties of nucleotide sequences that are currently known, including, but not limited to, such properties as the triplet genetic code and specific base pair interactions.
Kits for treatment or diagnosis
The agents and compositions of the invention may be used in kits suitable for controlling or inhibiting Saratan or for the treatment of a disorder as defined herein. In other aspects, the agents and compositions may be used in diagnostic kits. Kits can comprise at least one agent of the invention in a suitable container. The agents may be formulated suitable for direct administration to a subject for example, as agents or pharmaceutical compositions. Alternatively, the kit may comprise one or more agents in one container and pharmaceutical diluents, carriers and/or excipients in another; the contents of each container being mixed together prior to administration. The kit may also comprise additional agents and compositions in further separate containers as may be necessary for a particular application. Any container suitable for storing and/or administering an agent or composition may be used in a kit of the invention. Suitable containers will be appreciated by persons skilled in the art. By way of example, such containers include vials and syringes. The containers may be suitably sterilised and hermetically sealed. Further, kits of the invention can also comprise instructions for the use and administration of the components of the kit. The invention is further elucidated with reference to the examples below.
EXAMPLES
The examples described herein are for purposes of illustrating embodiments of the invention. Other embodiments, methods, and types of analyses are within the scope of persons of ordinary skill in the molecular diagnostic arts and need not be described in detail herein. Other embodiments within the scope of the art are considered to be part of this invention. EXAMPLE l: MATERIALS AND METHODS
Cell culture
The human breast cancer MCF-7 and MDA-MB-231 (referred to as MDA-231) cell lines were obtained from the American Type Culture Collection (Manassas, VA). MCF- 7 cells were cultured in RPMI 1640 medium supplemented with 10% heat-inactivated foetal bovine serum (FBS), 100 units/ml penicillin, 100 μg/ml streptomycin, and 2 rnM
L-glutamine. MDA-231 cells were cultured in Dulbecco's modified Eagle's medium
(DMEM) supplemented with 10% FBS and 100 units/ml penicillin, 100 μg/ml streptomycin. All cell cultures were incubated in a humidified incubator with 5% CO2 at 37°C.
Plasmid constructs The insert (-7.5 kb) of IMAGE cDNA clone (5493356) was excised by EcoRV and Notl digestion and subcloned into phCMVl vector (Genlantis, CA). The resulting plasmid was designated phCMV-hST.
A sequence encoding the HA (hemagglutinin YPYDVPDYA, SEQ ID NO:11) tag was added in frame at the 5' or 3' end of the coding sequence for Saratan. This was cloned into phCMVl vector to obtain expression plasmids phCMVn-hST and phCMVc-hST for N- or C-terminal HA-tagged Saratan fusion proteins, respectively. The N-terminal HA-tagged Saratan included the sequence MYPYD VPD YASLEF (SEQ ID NO: 12) prior to the first amino acid of Saratan. The C-terminal HA-tagged Saratan included the sequence EFYPYDVPDYA (SEQ ID NO:13) immediately after the last amino acid of Saratan.
The coding sequence of Saratan was also cloned into the pEGFP-Nl vector in frame with the 5' EGFP tag (pEGFP-Nl-hST) to express the C-terminal EGFP tagged Saratan.
The Glutathione S-transferase (GST) Gene Fusion System from Amersham Biosciences was used to produce recombinant Saratan protein in E. coli. The human Saratan cDNA fragment coding for the N-terminal peptide of the first 61 amino acids was amplified by
PCR with the following primer pair: 5'-ctaggatccATGGATCTCTCCTTTATGGCCG-
3' (SEQ ID NO:39, forward, cloning linker in lower case) and . 5'- tgactcgagtcaTAGCAAGACGGCGTCGTTG-3' (SEQ ID NO:40, reverse). The PCR product was cloned into the pGEX 4Tl vector (Amersham Biosciences) upon 5' Bam HI and 3' Xhόl digestion to generate pGEX 4Tl-hSTn plasmid for the expression of GST fusion proteins in E. coli.
For each construct, the insert was verified by DNA sequencing.
Establishing MCF-7 cells stably expressing Saratan
The human breast cancer cell line MCF-7 was stably transfected with phCMV-hST using Saint-Mix (Synvolux Therapeutics B. V., the Netherlands) transfection reagent. The resulting cells were designated as MCF7-hST. As a control, MCF-7 cells were stably transfected with the empty vector phCMVl to produce cells designated as MCF7-Vec. Cell clones were selected by addition of G418 (Bio-Rad Laboratories, CA) to a concentration of 0.8 mg/ml in the medium. Transfected cell lines were generated as pools of positive cell clones. The overexpression of Saratan in MCF7-Saratan was confirmed by Western blotting.
Preparation of total RNA
Total RNA was isolated from MCF-7 cells with Trizol reagent (Invitrogen) at 1 ml/10 cm2 according to the manufacturer's instructions and resuspended in diethyl pyrocarbonate-treated nuclease-free water. RNA samples were further treated with DNase I for 30 rnin. at 37°C. The reaction was stopped by addition of 25 mM EDTA and incubation at 650C for 15 min. RNA samples were then purified by extraction in phenol/chloroform (pH 5.2, phenol:chloroform:isoamyl alcohol at 25:24:1) followed by an additional chloroform extraction and ethanol precipitation. Quantification and purity of the RNA was assessed by A26o/A28O absorption, and RNA quality was assessed by agarose gel electrophoresis. RNA samples with ratios of A26O/A28o greater than 1.6 were stored at - 80°C for further analysis.
Reverse transcription-PCR
One-step reverse transcription (RT)-PCR kit (Qiagen) was used to determine the presence of Saratan using specific primers hST5 (sense, 5'-
ATGGCGCAGCTCTTCCTACTC-3', SEQ ID NO:41) and hST3 (antisense, 5'- CGTGCATCTCTCTGCATCCTC-3', SEQ ID NO:42) or hST-F4 (sense, 5'- ACACCATGGATCTCTCCTTTATG-3', SEQ ID NO:65) and hST-R4 (antisense, 5'- TGACTCGAGTCATAGCAAGACGGCGTCGTTG-3', SEQ ID NO:66). For RT-PCR, the following procedure was employed. To start, 1 μg of total RNA was diluted to 0.1 μg/μl to minimize the variation of sample handling. This dilution was treated by DNase I for 15 min, followed by inactivation of DNase by adding EDTA to 5 mM and heating to 700C for 15 min.
The DNase-treated RNA was then mixed with a master cocktail containing RT-PCR buffer, sense and antisense primers, dNTPs, RNase inhibitor, and an enzyme mixture containing reverse transcriptase (Omniscript and Sensiscript) and HotStart Taq DNA polymerase at the concentrations recommended by the manufacturer to a final volume of 50 μl. The temperature-cycle protocol included: 60 min at 500C for RT reaction, followed by denaturation and activation of HotStart DNA polymerase for 15 min at 95°C, and PCR amplification for 10 sec at 95°C, 30 sec at 600C, and 1 min at 72°C for
30 cycles. A final extension for 5 min at 72°C was performed at the end of the cycles, β- actin was similarly amplified by RT-PCR using 0.2 μg of total RNA as an internal control. Ten microlitres of each of the RT-PCR product was fractionated on 1% agarose gels. The identity of RT-PCR product was confirmed by the size, restriction enzyme digestion, and DNA sequencing.
mJRNA expression assays
For mRNA expression studies,, a cDNA panel (Primgen) consisting of 10 ng of first- strand cDNA from various human tissues was screened by PCR with the Saratan specific hST5 and hST3 primers. As recommended by the manufacturer, human beta-2- microglobulin gene was used as the cDNA input control. The primers used to amplified beta-2-microglobulin gene included 5'-TCTCGCTCCGTGGCCTTAGCTG-S' (sense primer, SEQ ID NO:43) and 5'-AACATGTCTCGATCCCACTTAACTATC-S' (anti- sense primer, (SEQ ID NO:44). The expression of Saratan in a variety of cancer cell lines was determined by RT-PCR. The cell lines included A549 human lung carcinoma cells; AGS human stomach cancer cells; Colo320DM and DLD-I neuroendocrine colon carcinoma cells;, DU145 and PC3 human prostate cancer cells; BxPC3 pancreatic cancer; RL95-2 endometrial carcinoma cells; HepG2 human liver cancer cells; and T47D, BT459 and MCF-7 human breast cancer cells.
Confocal Laser Scanning Microscopy To investigate the subcellular localization of Saratan, MCF-7 mammary carcinoma cells grown on glass coverslips were transiently transfected with pEGFP-Nl-hST or the empty pEGFP-Nl vector. Cells were grown in RPMI 1640 containing 10% serum for 24 h. Cells were fixed in ice-cold 4% paraformaldehyde;, washed with PBS, permeabilized for 10 min with 0.1% Triton X-100, and nuclei were counterstained with DAPI. In another experiment, MCF-7 cells grown on glass coverslips were transiently transfected with phCMVn-hST, phCMVc-hST, or the empty phCMVl vector as a control. ■
Cells were fixed in ice-cold 4% paraformaldehyde and washed with PBS. A subset of each group of transfectants was permeabilized with 0.5% Triton® X-100 for 30 min. The remaining subset was left untreated. Cells were incubated with primary rabbit polyclonal HA-Probe (Y-11) (Cat # sc-805, Santa Cruz Biotech) followed by incubation with a FITC-labeled goat anti-rabbit second antibody (Cat # F -0511, Sigma). Coverslips were mounted on slides with the nuclei counterstained by DAPI. The fluorescent images were collected from equatorial planes of cells with optical thickness of 2 μm using an inverted Zeiss LSM 510 confocal microscope (40x oil immersion objective, NA=IJ). Images were converted to the tagged-information-file format and processed with Adobe Photoshop.
Immunoblotting
Cells were washed twice with ice-cold phosphate-buffered saline (PBS) and lysed at 4°C in lysis buffer (20 mM Tris»HCl, pH 7.4, 150 mM NaCl, 1 mM EDTA5 1 mM EGTA, 1% Triton® X-100, 1% Nonidet P-40, 1 μg/ml protease inhibitor cocktail (GE Healthcare) and 0.1 mM PMSF). The lysates were next sonicated and then cleared by centrifugation at 15,000 x g for 15 min at 40C. SDS-polyacrylamide gel electrophoresis (PAGE) sample buffer (50 mM Tris-HCl, pH 6.8; 2% SDS; 2% β-mercaptoethanol, and bromophenol blue) was added to each sample and the samples were boiled for 5 min.
Samples were subjected to discontinuous SDS-PAGE with a 12% resolving gel and transferred to nitrocellulose membranes (Hybond™ C-extra) using standard electroblotting procedures.
Membranes were blocked with 5% non-fat dry milk in PBS with 0.1% Tween 20 (PBST) for 1 h at room temperature. The blots were then immunolabelled with monoclonal antibodies 9E10 against c-Myc (1:1000 dilution) in PBST containing 1% non-fat dry milk at 4°C overnight. After three washes with PBST at room temperature, ixnmunolabelling was detected by ECL plus™ chemiluminescence as described by the manufacturer (GE Healthcare). Blots were stripped and reprobed with monoclonal antibody against β-actin to ensure equal loading of the cell lysate proteins. Blots were stripped by incubation for 30 min at 5O0C in a solution containing 62.5 mM TrisΗCl, pH 6.7; 2% SDS; and 0.7% β-mercaptoethanol. Blots were then washed for 30 min with several changes of PBST at room temperature. Efficacy of stripping was determined by re-exposure of the membranes to ECL plus™. Thereafter, blots were re-blocked and immunolabelled as described above.
Cell growth and proliferation assay
Cells were seeded onto 6-well plates at a density of 5 x 104 cells per well in triplicate in
3 ml of complete RPMI medium containing 10% FBS. Cells were cultured under this condition for up to 10 days with medium change every other day until being harvested. To compare the cell proliferation rate, the total cell number in each well was quantified with use of a haemocytometer every 2 days. Cell viability was assessed by using trypan blue. Cell cycle kinetics were measured by Bromodeoxyuridine (BrdU) incorporation using a BrdU staining kit (Zymed) following the manufacturer's protocol. Briefly, cells were seeded on glass coverslips in 6-well plates in full media and incubated overnight before 18 hours of serum starvation in serum-free media. Then cells were pulse labelled with BrdU at a concentration of 10 μM in serum-free media for 45 min.
After fixing, denaturing, and blocking, cells were incubated with biotinylated anti-BrdU mouse monoclonal antibody. Cells were then incubated with streptavidin-peroxidase followed by incubation with Diarninobenzidine (DAB) chromogen solution for colour development in the presence of hydrogen peroxide. The cell nuclei were counterstained with hematoxylin. Cells with dark brown nuclear staining were counted as BrdU- labelled cells. For quantification, 10 random fields per coverslip (magnification of 40χ) were documented by photomicroscopy. The percentage of BrdU-positive cell nuclei relative to the total number of cell nuclei was calculated. A rninimum of 500 cells per coverslip were counted.
Apoptosis assay
Apoptotic cell death was measured by fluorescent microscopic analysis of cell DNA staining patterns with karyophilic Hoechst 33258 (Del, B. G., Z. Darzynkiewicz, C. Degraef, R. Mosselmans, D. Fokan, and P. Galand. 1999. Comparison of methods based on annexin-V binding, DNA content or TUNEL for evaluating cell death in HL-60 and adherent MCF-7 cells. Cell Prolif. 32:25-37). Cells were seeded onto 6-well. "plates. Cells were serum depleted for 24 hours. Cells were then fixed with 4% paraformaldehyde, permeabilized with 0.6% Tween® 20, and stained with Hoechst 33258 (1:10,000; Molecular Probes, Eugene, OR) for 5 min at room temperature. Following washing with PBS5 nuclear morphology was examined under a UV- visible fluorescence microscope with a 4Ox objective. Cells with apoptotic nuclear characteristics such as nuclear condensation and fragmentation were scored as apoptotic. For each treatment, 200-300 cells were examined on each treatment.
Cell migration and invasion
Cell migration was assayed using modified Boyden chambers containing polycarbonate membranes (tissue culture treated, 6.5-mm diameter, 10-μm thickness, 8-μm pores, Transwell®; Costar, Cambridge, MA) as previously described (Doerr, M. E. and J. I. Jones. 1996. The roles of integrins and extracellular matrix proteins in the insulin-like growth factor I-stimulated chemotaxis of human breast cancer cells. J. Biol. Chem. 271:2443-2447) with some modification. Cell invasion assays were carried using the same protocol, except that a layer of Matrigel was polymerized onto the membranes according to the manufacturer's specifications. This was done prior to the addition of cells to the upper wells.
To ensure single cell suspension for migration/invasion assay, cells at near confluence were trypsinized the day before the assay, passed through an 18G needle several times and incubated at least 12 hours prior to assays. The next day, cells were harvested with 5 mM EDTA in PBS, pH 7.4, washed twice, and then suspended in serum-free RPMI/BSA. A 100-μl volume of cells (1.0 x 105) was loaded into Transwell inserts. The lower chambers were filled with 600 μl of RPMI containing 10% FBS. The loaded chamber was placed in a 370C incubator in a humidified atmosphere with 5% CO2. After 24 h, the inserts were removed and the cells were then fixed with 4% paraformaldehyde. Cells (and Matrigel) on the upper surface were removed by scraping with cotton swabs. Those that migrated to the lower surface of the membrane were identified microscopically using a UV-visible fluorescence microscope, following staining with Hoechst 33258.
Cell counts were obtained by counting all cells in six grids on one row across the centre of the round filter. This was done using a Lovins Microslide field finder (Gurley, Troy, NY) under a microscope at a total magnification of 100 χ. Pictures were taken from representative fields of each membrane. All data presented are the means ± standard deviation (SD) of triplicate wells.
Soft agar assay for colony formation
For soft agar colony formation assay, cells were cultured in 6-well plates first covered with a layer of agar (0.5%). Cells were grown in RPMI 1640 media containing 10% FBS. The middle layer contained 5 x 103 cells in 0.35% agar in RPMI 1640 media containing 10% FBS. Medium was added as the top layer to prevent drying of the agarose gels. The plates are incubated at 370C in a humidified incubator for 14 days, after which the cells were stained with 0.5 ml of 0.005% crystal violet in distilled water for 1 h and disfained for 2 h in water. Colonies were inspected and photographed.
Construction ofSaratan siENA vector
The pSilencer 2.1-U6 vector (Ambion) was used to express Saratan siRNA using the RNA polymerase III U6 promoter. Briefly, oligonucleotides with 3' single stranded overhangs were designed to contain a 19mer hairpin sequence specific for Saratan mRNA target. The oligonucleotides also included a loop sequence separating the two complementary domains and a transcription termination sequence. The oligonucleotides were annealed to form the hairpin, and ligated into pSilencer digested with Bam HI and
Hind HI using standard methods. Three different siRNA constructs were generated to target the following sequence specific for Saratan mRNA: ATAATCACTCGTGTGACTT (SEQ ID NO:45) for siRNA-A; TTACAAGAAAGCTGGACTT (SEQ ID NO:46) for siRNA-B and GAGCAACTTACTGCTTTGT (SEQ ID NO:47) for siRNA-C. The sequence ACTACCGTTGTTATAGGTG (SEQ ID NO:48) was designed to include limited homology to any known sequences in the human genomes (Ambion) and used as the negative control.
Production of recombinant human Saratan protein in bacteria The recombinant N-terminal peptide from Saratan protein was GST tagged, expressed, and purified from E. coli. In particular, the pGEX 4Tl-hSTn plasmid was used to transform BL21-Gold cells (Stratagene). A single recombinant E. coli colony was inoculated into LB medium containing carbenicillin (50 μg/ml). The overnight culture was diluted 1:200 in LB medium with carbenicillin, pH 7.4, and cultured at 37°C to optical density at 600 nm of ~ 0.5. Protein expression was induced by addition of isopropyl-β-D-thiogalactopyranoside (IPTG) to a final concentration of 0.2 mM and the cultures were incubated for an additional 5-6 hours at room temperature.
Cells were harvested and lysed by sonication in buffer A (5OmM TrisΗCl, pH 8.0, 15OmM NaCl, ImM EDTA and 5mM DTT) containing Iyso2yme. The lysate was cleared by centrifugation and Triton® X-100 was added to a final concentration of 1%.
GST-hSTn was purified from the lysate with columns containing glutathione
Sepharose® 4B matrix (Amersham Biosciences). In-column bound protein was incubated for 10 min in buffer A containing 5 mM ATP, 5 mM MgSO4 and 0.1 mg/ml denatured E. coli proteins. This was washed with a buffer of 5OmM TrisΗCl (pH 8.0),
15OmM NaCl and ImM EDTA with/without 1% Triton® X-100. The GST tag was cleaved by in-column incubation with Thrombin for 2 h at room temperature. Purified protein was eluted with PBS. This was analysed by SDS-PAGE on a 4-12% NuPAGE
Bis-tris gel (Invitrogen) and visualised by Coomassie blue staining. The yield of purified protein was estimated by Bradford's assay.
Protein Synthesis and production of polyclonal antibodies
While recombinant Saratan was produced in E coli, the N-terminal peptide including 61 amino acids of Saratan (MDLSFMAAQLPMMGGAFMDSPNEDFSTEYSLFNSSA NYHAAANGQGQPEDPPRSSNDAVLL; SEQ ID NO: 10) was synthesized by Open Biosystems, AL5 USA. Polyclonal antisera against the synthesized peptide were also produced by Open Biosystems. This was done using subcutaneous and intramuscular injections of the immunogen into rabbits as described by Bean (Eric S. Bean (2001) Polyclonal Antibodies. In: Basic Methods in Antibody Production and Characterization antibodies. Howard, G. and Bethel D. (ed.), CRC Press, 5:31-50, 2000). The antibodies were affinity purified from the antisera using standard methodology.
Sequence analysis and transmembrane domain prediction
Sequence analysis of Saratan protein was performed with the following programs: HMMTOP 2.0 (world wide web enzim.hu/hmmtop/) (Tusnady GE, Simon I. Principles governing amino acid composition of integral membrane proteins: application to topology prediction. J MoI Biol. 1998 Oct 23;283(2):489-506, and Tusnady GE, Simon I. The HMMTOP transmembrane topology prediction server. Bioinformatics. 2001 Sep;17(9):849-50), TMHMM 2.0 (world wide web cbs.dtu.dk/services/TMHMM-2.0/) (Krogh A, Larsson B, von Heijne G, Sonnhammer EL. Predicting transmembrane protein topology with a hidden Markov model: application to complete genomes. J MoI Biol. 2001 Jan 19;305(3):567-80.), Tmpred (hypertext transfer protocol ://world wide web ch.embnet.org/software/TMPRED_form.html), and PRODIV-TMHMM (hypertext transfer protocol ://world wide web pdc.km.se/~hakanv/prodiv-tmhmm/) (Viklund H, Elofsson A. Best alpha-helical transmembrane protein topology predictions are achieved using hidden Markov models and evolutionary information. Protein Sci. 2004 Jul;13(7):1908-17.).
MTT cell proliferation assay
MCF-7 cells were seeded at a concentration of 5 x 103 cells/well in 100 μl RPMI- 1640 culture medium containing 10% FBS into 96 well flat bottom tissue culture microplates with affinity purified rabbit anti-Saratan antibodies or the preimmune serum as the control at a concentration of 600 μg/ml, or with PBS as the untreated control. The cells were incubated for 48 h in a humidified incubator with 5% CO2 at 37°C. After the incubation period, 10 μl of the MTT (3-[4,5-dimethylthiazol-2-yl]-255-diphenyl tetrazolium bromide) labelling reagent was added at a final concentration 0.5 mg/ml to each well and the cells were labelled for 5 h in the incubator. At the end of the incubation period, the medium was removed and the converted dye was solubilized with 100 μl solubilizing solution (0.01N HCl in 10 % SDS in water). The plates were then sealed and placed at 37°C overnight to completely solubilize the purple formazan crystals. The absorbance of the converted dye was measured using Spectra Max 250 multiplate reader at a wavelength of 595 nm. Each treatment was performed in triplicate.
EXAMPLE 2: RESULTS Expression ofSaratan in MCF-7 mammary carcinoma cells.
RT-PCR was used to detect Saratan expression in mammary carcinoma MCF-7 cells. As shown in Fig. I5 RT-PCR produced a specifically amplified fragment of the predicted size (515 bp). The identity of the PCR product was confirmed by restriction enzyme digestion and DNA sequencing.
Tissue-specific mRNA expression
A panel of cDNAs from various human tissues was screened for mRNA expression with primers that are specific for human Saratan. Saratan transcript was detected in most tissues tested (Fig. 2A). The highest expression was found in fetal brain, cerebellum, brain, and spinal cord: Modest expression was seen in skin, kidney, fetal liver, adrenal gland, cartilage, ovary, uterus, and pancreas. Some expression or undetected expression was noted in prostate, skeletal muscle, normal colon, small intestine, stomach, thymus, liver, lung, trachea, placenta, adipose, stimulated PBL, thyroid, umbilical cord and PBL, salivary gland, heart, and spleen.
We also examined the expression of Saratan in a number of human cancer cell lines using RT-PCR. As shown in Fig. 2B, Saratan was differentially expressed in the cancer cells tested. Higher expression was detected in DLD-I colon carcinoma cells and T47D (estrogen receptor positive), BT549 (estrogen receptor negative) and MCF-7 (estrogen receptor positive) breast cancer cells. Moderate expression was observed in A549 lung carcinoma cells, DU145 prostate cancer cells, and RL95-2 endometrial carcinoma cells. Some expression was observed in AGS stomach cancer cells. Saratan is a cytoplasmic and membrane bound protein.
To investigate the subcellular localization of Saratan, MCF-7 cells were transiently transfected with an expression construct that expresses Saratan with a C-terminal EGFP-tag, or with the pEGFP-Nl vector as a negative control. The localization of the fluorescent fusion protein was determined by using laser-scanning confocal microscopy. As shown in Fig. 3, Saratan-EGFP fusion protein was localized in discrete cytoplasmic structures and also at the cell membrane whereas the EGFP alone was diffusely present in both the cytoplasm and nucleus.
Saratan is exposed to the outside of the cell membrane.
On the basis of hydropathy analysis using the web-based prediction programs HMMTOP, TMHMM, Tmpred and PRODIV-TMHMM, Saratan was predicted to contain a single transmembrane domain (residues 59-81) at the C-terminus. However, the topographical analysis by those programmes differs. The large portion of the N- terminal (residues 1-58) was predicted outside of the cell membrane by HMMTOP5 TMHMM, and Tmpred.
To investigate the membrane topology of Saratan, we constructed two Saratan expression plasmids that express Saratan with the HA epitope tag attached to either the N or C terminus, respectively. As shown by Western blot analysis (Fig. 4A), both N- and C- terminal HA-tagged Saratan could be easily detected by the rabbit polyclonal HA-Probe (Y-I l). We thus used a membrane permeabilisation strategy coupled with confocal immunofluorescence microscopy to directly examine the membrane orientation of Saratan (panels a-f, Figs. 4B). Triton® X-IOO is the most commonly used permeabilisation agent for immunofluorescent staining and it efficiently solvates cellular membranes without disturbing protein-protein interactions. MCF-7 cells transfected with phCMVc-hST or phCMVn-hST were fixed with formaldehyde, permeabilized with 0.5% Triton® X-100, and then immunostained with antibodies against HA.
When we permeabilized MCF-7 cells containing phCMVn-hST (panel a, Fig. 4B) or phCMVc-hST (panel c, Fig. 4B) with Triton® X-100, we observed the cytoplasmic distribution of HA-tagged Saratan immunofluorescence, similar to the pattern observed with EGFP-tagged Saratan (Fig. 3). Thus, the HA epitope tags did not alter the localization of Saratan, and both the N- and the C-termini of Saratan were accessible when the membranes were permeabilized. Without permeabilisation with Triton® X- 100, F£A-tagged Saratan immunofluorescence was still observed in cells containing phCMVn-hST with clumped distribution around cell membrane (panel b, Fig. 4B), indicating that the outer membrane remained permeable to FIA-specific antibodies. However, the HA-tagged Saratan immunofluorescence was not detected in cells containing phCMVc-hST without permeabilisation (panel d, Fig. 4B), indicating that the inner membrane remained impermeable to the antibodies.
As a control, MCF-7 cells were also transfected with the empty control vector phCMVl, however, no immunofluorescence was observed in cells with treatment (panel e, Fig. 4B) or without treatment (panel f, Fig. 4B) with permeabilisation agent.
Therefore, we concluded that human Saratan contained a C-proximal transmembrane domain with its N-teπninal portion exposed to the outside of the cell membrane which was accessible by antibodies without detergent treatment.
Establishing MCF- 7 cells stably expressing Saratan.
To elucidate the role of Saratan in breast cancer, Saratan was cloned and Saratan- overexpressing cells were generated. An insert containing the coding sequence of Saratan in an IMAGE cDNA clone was subcloned into phCMVl expression vector. The human breast cancer cell line MCF-7 was stably transfected with the Saratan expression plasmid construct phCMV-hST (designated MCF7-hST) or the empty vector phCMVl (designated MCF7-Vec). As shown in Fig. 5, overexpression of Saratan was detected in MCF7-hST cells compared with the control MCF7-Vec cells.
Forced expression of Saratan significantly increases mammary carcinoma cell proliferation.
To see whether Saratan expression affects cell proliferation, total cell number was assessed for MCF-7 cells overexpressing Saratan. As shown in Fig. 6, forced overexpression of Saratan in MCF-7 cells significantly increased cell proliferation.
MCF7-hST cells replicated much faster than the control MCF7-Vec cells. After 10 days, the cell number of MCF7-hST transfectants increased by 85% (calculated as 1.85 fold) as compared with that of MCF7-Vec transfectants.
Inhibition ofSaratan inhibits cancer cell proliferation.
Three different target sites in Saratan mRNA were used to knock down Saratan expression. MCF-7 cells stably expressing each of these siRNAs were established. The effectiveness of each siRNA to knock down Saratan expression was determined by RT-
PCR with Saratan specific primers. As shown in Figs. 7A-B, all three siRNA constructs tested were able to reduce the mRNA level of Saratan. The knock down efficiencies were measured as 88%, 74%, and 12% for siRNA-A, -B and -C, respectively. MCF7- siRNA-A cells were used in subsequent assays.
To investigate the functional consequences of reduced Saratan expression by siRNA, total cell number was assessed. As shown in Fig. 8, siRNA depletion of Saratan in MCF-7 cells significantly reduced cell count. The total cell number of MCF-7 cells stably expressing siRNA-A was decreased by 40% compared with MCF-7 cells expressing control siRNA-CK. This indicated that the stimulatory effect of Saratan on cell proliferation could be reversed by reducing the expression of endogenous Saratan via siRNA.
Forced expression of Saratan increases BrdU incorporation in MCF-7 cells while Saratan-specific siRNA specific decreases BrdU incorporation.
BrdU incorporation assays were used to examine the mechanism by which Saratan stimulates proliferation of MCF-7 cells. As shown in Fig. 9, forced overexpression of Saratan in stable trasfectant MCF-7 cells increased BrdU incorporation by 27% compared with the stably transfected control cells with vector alone. Reduction of Saratan expression in MCF-7 siRNA-A cells resulted in decreased BrdU incorporation by 82% compared to control MCF-7 siRNA-CK cells. From these experiments, we deduced that the stimulatory effect of Saratan on cell proliferation was due to increased DNA synthesis. Conversely, the inhibitory effect of effect of siRNA-A was due to decreased DNA synthesis.
Forced expression of Saratan significantly promotes the migration and invasion of mammary carcinoma MCF- 7 cells, while Saratan-specific siRNA specifically decreases such migration and invasion.
The effect of Saratan on cell mobility was evaluated by migration and invasion assays using the standard Transwell inserts. As shown in Figs. 1OA and B, forced expression of Saratan significantly increased MCF-7 cell migration and invasion through Matrigel. Compared with MCF7-Vec control cells, MCF7-hST cells overexpressing Saratan showed a 1.6 fold increase in migration (Fig. 10A) and a 5.5 fold increase in invasion (Fig. 10B).
To examine the effect of Saratan on cell mobility, we knocked down the endogenous expression of Saratan using siRNA specific to Saratan mRNA. As shown in Figs. 1OC and D, in contrast with forced expression, inhibition of Saratan expression by siRNA significantly inhibited both MCF-7 cell migration and invasion. Compared with the siRNA-CK control, Saratan-specific siRNA-A reduced migration by 40.5% (Fig. .10C) and invasion by 57.9% (Fig. 10D). As noted for forced expression, the knock down of endogenous Saratan had more effect on invasion than migration.
Production of recombinant human Saratan protein in bacteria.
The cDNA coding for the first 61 amino acids of human Saratan was cloned into the
GST fusion protein expression vector pGEX 4Tl. After transforming the pGEX 4Tl- hSTn plasmid into BL21-Gold cells, the production of GST-hSTn was successfully achieved upon induction with IPTG. GST-hSTn fusion protein was purified with glutathione Sepharose 4B matrix. After cleavage of GST tag, recombinant Saratan protein was produced. The integrity and purity of the recombinant GST-hSTn protein was determined by SDS-PAGE (Fig. 11). The recombinant N-terminal peptide included a sequence of gsMDLSFMAAQLPMMGGAFMDSPNEDFSTEYSLFNSSANVHAAA NGQGQPEDPPRSSNDAVLL (SEQ ID NO:67; the linker sequence is shown in lower case) with a predicted MW of 6.6 kDa, and an apparent MW of ~12 kDa on SDS- PAGE.
Characterization of antiserum against synthesized Saratan N-terminal peptide.
While recombinant Saratan was being produced in bacteria, rabbit polyclonal antibodies were generated against the synthesized N-terminal Saratan peptide. As shown in Fig.
12, the antiserum was able to recognise not only the immunogen but also recombinant Saratan in Western blot analysis. The antiserum recognised the recombinant N-terminal Saratan as a band of ~12 kDa, as shown by Coomassie blue stained SDS-PAGE (Fig. 11), and the synthesized immunogen as a band of 6.5 kDa, as predicted. The antibodies recognised both synthesized and bacterially produced Saratan in Western blots, in amounts as low as 5 ng.
Endogenous expression of Saratan in MCF -7 cells.
The rabbit polyclonal antibodies raised against Saratan were used to examine the endogenous expression of Saratan in MCF-7 cells. MCF-7 cells were transiently transfected with pEGFP-Nl -hST expressing EGFP-tagged Saratan or pEGFP-Nl empty vector. EGFP-tagged Saratan or EGFP proteins were viewed as green fluorescence using UV- visible fluorescence microscopy. Consistent with the results shown hi Fig. 3, Saratan-EGFP fusion protein was localized to discrete cytoplasmic structures and also at the cell membrane (Fig. 13B), while EGFP alone was diffusely localized to both the cytoplasm and nucleus (Fig. 13A). As expected, a similar pattern of subcellular distribution as Saratan-EGFP fusion protein was observed using the rabbit polyclonal antibodies against Saratan in both transfected and non-transfected MCF-7 cells (Figs. 13C and D). Moreover, stronger Saratan signals were observed in pEGFP-Nl-hST transfected cells (Fig. 13D), but not in pEGFP-Nl transfected control cells (Fig. 13C). These results clearly demonstrated that the antibodies were able to recognise EGFP- tagged Saratan as well as endogenous Saratan.
Rabbit anti-Saratan polyclonal antibodies significantly inhibit MCF-7 cell proliferation. The MTT assay is based on the observation that only metabolically active cells are able to cleave MTT (yellow tetrazolium salt), to produce formazan (purple crystals), which can be solubilized and quantified by spectrophotometric means. The MTT assay has been accepted as one of the most sensitive and reliable cell biological approaches to quantitatively measure cellular proliferation, viability, and activation of a population in response to external factors.
As shown by RT-PCR (Figs. 1 and 2B) and by immunofluorescence staining (Figs. 13C and D), MCF-7 cells express Saratan at relative high levels. We used MTT assay to test the effect of rabbit anti-Saratan polyclonal antibodies on the proliferation of MCF-7 cells. As shown in Fig. 14, while the inclusion of the preimmune serum had little effect on MCF-7 cell proliferation as compared to the untreated PBS control, the Saratan antiserum strongly inhibited the MCF-7 cell proliferation. After 48 h of incubation, Saratan antiserum reduced the viability of MCF-7 cells by 56.1% compared with the preimmune control.
Rabbit anti-Saratan polyclonal antibodies significantly impair migration and invasion of mammalian carcinoma MCF-7 cells.
To demonstrate a physiological role of Saratan in cell migration/invasion, we assessed whether using antibodies to block Saratan function would impair motility/invasiveness. As shown in Figs. 15A and B, the number of cells that migrated through the non-coated (migration) or Matrigel-coated (invasion) porous filters of Transwell inserts was significantly reduced by addition of rabbit anti-Saratan polyclonal antibodies, as compared to the preimmune serum control. This was in marked contrast to forced overexpression of Saratan in MCF-7 cells. Using anti-Saratan antibodies, we observed a 54.9% decrease'Tn migration and 35.0% decrease in invasion.
Rabbit anti-Saratan polyclonal antibodies significantly impair migration and invasion of mammalian carcinoma MDA-231 cells. Further experiments were performed to confirm the inhibitory effects of Saratan antibodies on cell mobility. In an initial assay, mammalian carcinoma MDA-231 cells were screened for the expression of Saratan. As shown in Fig. 16, Saratan transcript was easily detected by RT-PCR. This expression was further demonstrated immunofluorescence staining with the rabbit polyclonal antibodies against Saratan. Only weak signals were observed by the preimmune serum (Fig. 17A) whereas enhanced signals from anti-Saratan antibodies were detected (Fig. 17B). Like in MCF-7 cells, Saratan was distributed in discrete cytoplasmic structures and at the cell membrane (Fig. 17DB).
To determine whether Saratan antibodies would inhibit MDA-231 cell migration/ invasion as in MCF-7 cells, MDA-231 cells were treated with the purified rabbit anti- Saratan antibodies or the preimmune serum as the control at a concentration of 600 μg/ml in migration and invasion assays. As shown in Figs. 18A and B, both migration and invasion of MDA-231 cells were markedly reduced by inclusion of the rabbit anti- Saratan polyclonal antibodies compared with the preimmune serum control. We observed a 41.0% decrease in migration and a 87.4% decrease in invasion.
Unlike MCF-7, which is estrogen-dependent and poorly invasive, MDA-231 is estrogen-independent and highly invasive (Hiraguri S, Godfrey T, Nakamura H, Graff J, Collins C, Shayesteh L, Doggett N, Johnson K, Wheelock M, Herman J, Baylin S, Pinkel D, Gray J. Mechanisms of inactivation of E-cadherin in breast cancer cell lines. Cancer Res. 1998 May l;58(9):1972-7; and Larkins TL, Nowell M, Singh S, Sanford GL. Inhibition of cyclooxygenase-2 decreases breast cancer cell motility, invasion and matrix metalloproteinase expression. BMC Cancer. 2006 JuI 10;6:181). Therefore, it was not surprising that a more dramatic decrease in cell invasion was observed (Fig. 18B).
From the sum of these observations, we concluded that inhibition of Saratan expression/function can be utilized to decrease cell proliferation, cell survival, and/or cell motility, and treat disorders that are associated with these cellular activities.
The invention has been described herein, with reference to certain preferred embodiments, in order to assist the reader in practising the invention without undue experimentation. However, a person having ordinary skill in the art will readily recognise that many of the components and parameters may be varied or modified to a certain extent without departing from the scope of the invention. Furthermore, titles, headings, or the like are provided to enhance the reader's comprehension of this document, and should not be read as limiting the scope of the present invention.
The entire disclosures of all patent applications, patents, and publications, cited above and below, if any, are hereby incorporated by reference in their entirety. Throughout this specification, and any description which follows, unless the context requires otherwise, the words "comprise," "comprising" and the like, are to be construed in an inclusive sense as opposed to an exclusive sense, that is to say, in the sense of "including, but not limited to".

Claims

WHAT IS CLAIMED IS:
1. Au isolated Saratan RNA molecule comprising a nucleic acid sequence selected from the group consisting of SEQ ID NOrIOl and 120-122, or a sequence complementary thereto.
2. An isolated Saratan RNA molecule comprising the nucleic acid sequence of SEQ ID NO:74, or a sequence complementary thereto.
3. An isolated Saratan RNA molecule comprising a nucleic acid sequence selected from the group consisting of SEQ ID NO: 75-77, or a sequence complementary thereto.
4. An isolated Saratan RNA molecule comprising a nucleic acid sequence selected from the group consisting of SEQ ID NO:68-73, 78-89, and 96-98, or a sequence complementary thereto.
,
5. An isolated Saratan RNA molecule comprising a nucleic acid sequence selected from the group consisting of SEQ ID NO: 90-95, and 99-100, or a sequence complementary thereto.
6. An isolated Saratan RNA molecule comprising a nucleic acid sequence having at least 95% identity to any one of SEQ ID NO:101 and 120-122, or a sequence complementary thereto.
7. An isolated Saratan RNA molecule comprising a nucleic acid sequence having at least 95% identity to SEQ ID NO:74, or a sequence complementary thereto.
8. An antisense RNA molecule which binds to the nucleic acid sequence of any one of claims 1 to 3.
9. An antisense RNA molecule comprising the nucleic acid sequence of claim 4 or claim S.
10. A small interfering RNA molecule which inhibits translation of the nucleic acid sequence of any one of claims 1 to 3.
11. A small interfering RNA molecule comprising the nucleic acid sequence of claim 4 or claim 5.
12. An RNA oligonucleotide comprising the nucleic acid sequence of any one of claims 3 to 5.
13. A vector which expresses the nucleic acid sequence of any one of claims 1 to 7.
14. A host cell which comprises the vector of claim 13.
15. An isolated Saratan polypeptide comprising the amino acid sequence selected from the group consisting of SEQ ID NO:1 and 102-104, or a functional fragment thereof.
16. An isolated Saratan polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO:8-10.
17. An isolated Saratan polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO:49-64, and 115.
18. An isolated Saratan polypeptide comprising an amino acid sequence having at least 97% identity to SEQ JD NO:1.
19. An isolated Saratan RNA molecule which encodes the amino acid sequence of any one of claims 15 to 18.
19. A Saratan antibody or antibody fragment which binds to the amino acid sequence of claim 15.
20. A Saratan antibody or antibody fragment which binds to the amino acid sequence of claim 16 or claim 17.
21. The Saratan antibody of claim 19 or claim 20 which is monoclonal.
22. A composition comprising the isolated Saratan RNA molecule of any one of claims 1 to 7.
23. A composition comprising the antisense RNA molecule of claim 8 or claim 9, or the small interfering RNA molecule of claim 10 or claim 11.
24. A composition comprising the vector of claim 13 or the host cell of claim 14.
25. A composition comprising the isolated Saratan polypeptide of any one of claims 15 to 18.
26. A composition comprising the Saratan antibody of any one of claims 19 to 21.
27. A pharmaceutical composition comprising the composition of any one of claims 23,
24. or 26, and a physiologically acceptable carrier.
28. Use of the composition of any one of claims 23, 24, or 26, in the preparation of a medicament for the treatment of cancer in an individual, wherein the cancer is selected from the group consisting of breast cancer, colon cancer, lung cancer, prostate cancer, endometrial cancer, and stomach cancer.
29. The use of claim 28, wherein the cancer is metastatic cancer.
30. A method for treating cancer in an individual comprising administering the pharmaceutical composition of claim 27 to the individual, thereby treating the cancer, wherein the cancer is selected from the group consisting of breast cancer, colon cancer, lung cancer, prostate cancer, endometrial cancer, and stomach cancer.
31. The method of claim 30, wherein the cancer is metastatic cancer.
PCT/NZ2008/000069 2007-03-29 2008-03-29 Novel saratan polypeptides and polynucleotides and methods of use thereof Ceased WO2008121007A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US90896707P 2007-03-29 2007-03-29
US60/908,967 2007-03-29

Publications (1)

Publication Number Publication Date
WO2008121007A1 true WO2008121007A1 (en) 2008-10-09

Family

ID=39808502

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/NZ2008/000069 Ceased WO2008121007A1 (en) 2007-03-29 2008-03-29 Novel saratan polypeptides and polynucleotides and methods of use thereof

Country Status (1)

Country Link
WO (1) WO2008121007A1 (en)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040253606A1 (en) * 2002-11-26 2004-12-16 Protein Design Labs, Inc. Methods of detecting soft tissue sarcoma, compositions and methods of screening for soft tissue sarcoma modulators
US20050196754A1 (en) * 2000-03-31 2005-09-08 Drmanac Radoje T. Novel nucleic acids and polypeptides
US20070032441A1 (en) * 2001-05-18 2007-02-08 Sirna Therapeutics, Inc. Rna interference mediated inhibition of gene expression using chemically modified short interfering nucleic acid (sina)

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20050196754A1 (en) * 2000-03-31 2005-09-08 Drmanac Radoje T. Novel nucleic acids and polypeptides
US20070032441A1 (en) * 2001-05-18 2007-02-08 Sirna Therapeutics, Inc. Rna interference mediated inhibition of gene expression using chemically modified short interfering nucleic acid (sina)
US20040253606A1 (en) * 2002-11-26 2004-12-16 Protein Design Labs, Inc. Methods of detecting soft tissue sarcoma, compositions and methods of screening for soft tissue sarcoma modulators

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
DATABASE GenBank [O] 17 February 2011 (2011-02-17), "Homo sapiens cDNA clone BRAMY3003467 5', mRNA sequence", XP055354890, retrieved from NCBI Database accession no. DA 184725 *
DATABASE GenBank [O] 30 January 2008 (2008-01-30), "Homo sapiens chromosome 14 open reading frame 132, mRNA", XP055354878, retrieved from NCBI Database accession no. BC043593 *
DATABASE GenBank [O] 4 September 2003 (2003-09-04), "DKFZp547H184_r1 547 (synonym: hfbrl) Homo sapiens cDNA clone DKFZp547H184 5', mRNA sequence", XP055354884, retrieved from NCBI Database accession no. AL134275 *

Similar Documents

Publication Publication Date Title
US20100203060A1 (en) Inhibitors for growth hormone and related hormones, and methods of use thereof
EP2164870B1 (en) Polypeptides and polynucleotides for artemin and related ligands, and methods of use thereof
JP6196338B2 (en) Identification of tumor-associated antigens for diagnosis and treatment
BR112020026386A2 (en) COMPOSITIONS AND METHODS FOR MODULATION OF INFLAMMATORY PHENOTYPES WITH MONOCYTES AND MACROPHAGES AND IMMUNOTHERAPY USES OF THE SAME
KR100927261B1 (en) Binding Domain-Immune Globulin Fusion Proteins
US20070092529A1 (en) Compositions and methods for diagnosing and treating cancers
JP2011172588A (en) Dna encoding dp-75 and process for its use
KR20210043623A (en) Chimeric antigen receptor and CAR-T cells that bind to HLA-DR
WO2010011952A2 (en) Highly potent peptides to control cancer and neurodegenerative diseases
US20070298445A1 (en) Cancer Therapeutic
JP2008525479A (en) Trefoil factor and method for treating proliferative disease using the same
US20130316958A1 (en) Highly potent peptides to control cancer and neurodegenerative diseases
JPWO2007018316A1 (en) Cancer preventive / therapeutic agent
JP2006502697A (en) FALP protein
JP2009523409A (en) Compositions and methods for cancer treatment and diagnosis
EP2311477B1 (en) Use of ip3 receptor-binding protein for controlling phosphatidylinositol metabolism
JP2009523412A (en) Catecholamine regulatory protein
MX2008003464A (en) Identification of tumor-associated antigens for diagnosis and therapy
WO2004076480A1 (en) Tumour marker and its use

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 08741762

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 08741762

Country of ref document: EP

Kind code of ref document: A1