WO2008017483A2 - Spore surface displays of bioactive molecules - Google Patents

Spore surface displays of bioactive molecules Download PDF

Info

Publication number
WO2008017483A2
WO2008017483A2 PCT/EP2007/007052 EP2007007052W WO2008017483A2 WO 2008017483 A2 WO2008017483 A2 WO 2008017483A2 EP 2007007052 W EP2007007052 W EP 2007007052W WO 2008017483 A2 WO2008017483 A2 WO 2008017483A2
Authority
WO
WIPO (PCT)
Prior art keywords
spore
encoding
protein
coat protein
enzymes
Prior art date
Application number
PCT/EP2007/007052
Other languages
French (fr)
Other versions
WO2008017483A3 (en
Inventor
Adriano Henriques
Ghislain Schyns
Thibaut José WENZEL
Sebastian Potot
Original Assignee
Dsm Ip Assets B.V.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Dsm Ip Assets B.V. filed Critical Dsm Ip Assets B.V.
Priority to US12/375,976 priority Critical patent/US20100055244A1/en
Priority to EP07801574A priority patent/EP2049669A2/en
Publication of WO2008017483A2 publication Critical patent/WO2008017483A2/en
Publication of WO2008017483A3 publication Critical patent/WO2008017483A3/en
Priority to US14/225,787 priority patent/US20140315278A1/en

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/74Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
    • C12N15/75Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora for Bacillus
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/32Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Bacillus (G)
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23KFODDER
    • A23K10/00Animal feeding-stuffs
    • A23K10/10Animal feeding-stuffs obtained by microbiological or biochemical processes
    • A23K10/16Addition of microorganisms or extracts thereof, e.g. single-cell proteins, to feeding-stuff compositions
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23KFODDER
    • A23K10/00Animal feeding-stuffs
    • A23K10/10Animal feeding-stuffs obtained by microbiological or biochemical processes
    • A23K10/16Addition of microorganisms or extracts thereof, e.g. single-cell proteins, to feeding-stuff compositions
    • A23K10/18Addition of microorganisms or extracts thereof, e.g. single-cell proteins, to feeding-stuff compositions of live microorganisms
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23KFODDER
    • A23K20/00Accessory food factors for animal feeding-stuffs
    • A23K20/10Organic substances
    • A23K20/189Enzymes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/33Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Clostridium (G)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/37Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from fungi
    • C07K14/38Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from fungi from Aspergillus
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y301/00Hydrolases acting on ester bonds (3.1)
    • C12Y301/03Phosphoric monoester hydrolases (3.1.3)
    • C12Y301/03001Alkaline phosphatase (3.1.3.1)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y301/00Hydrolases acting on ester bonds (3.1)
    • C12Y301/03Phosphoric monoester hydrolases (3.1.3)
    • C12Y301/030083-Phytase (3.1.3.8)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y301/00Hydrolases acting on ester bonds (3.1)
    • C12Y301/03Phosphoric monoester hydrolases (3.1.3)
    • C12Y301/030264-Phytase (3.1.3.26), i.e. 6-phytase
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y302/00Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
    • C12Y302/01Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
    • C12Y302/01031Beta-glucuronidase (3.2.1.31)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides

Definitions

  • the present invention relates to the display of bioactive molecules at the surface of spores for both in vitro and in vivo applications.
  • microbial surface display (part of the bio-nanotechnology field) has increasingly become a tool of choice to display peptides or proteins of biotechnological interest on natural nanostructures for a commercial purpose.
  • Biological applications include the development of bio-adsorbents, the presentation of antigens for vaccines, or the preparation of combinatorial epitope libraries.
  • Surface display requires only the synthesis of a hybrid protein that consists of a passenger protein of commercial interest fused to a carrier protein, which anchors it onto the biological surface (cell wall or membrane).
  • a good carrier protein requires the following characteristics: i) a targeting signal that directs it to the biological surface; ii) a strong anchoring motif; iii) resistance to proteases; and iv) compatibility to foreign sequences to be fused.
  • the carrier protein was chosen amongst surface or membrane proteins, e.g. OmpA for Gram-negative bacteria or the Protein A for Gram-positive bacteria.
  • OmpA for Gram-negative bacteria
  • Protein A for Gram-positive bacteria.
  • the disadvantages of these display systems are that these proteins were not very stable and tended to be inactivated under conditions that are regularly used in biotechnological and chemical processes.
  • spore coat from Bacillus subtilis and other related genera.
  • Bacilli and Clostridia have the ability to undergo a complex differentiation process under nutrient deprivation or hostile conditions. This process, called sporulation, ends with the formation of an extremely resistant structure named the spore.
  • sporulation ends with the formation of an extremely resistant structure named the spore.
  • Spore consists of a central compartment, the spore core, which contains a copy of the chromosome.
  • the spore core is surrounded by a thin inner layer membrane of peptidoglycan that creates the germ cell, itself surrounded by a thicker layer of peptidoglycan, called the cortex.
  • Oustide of the cortex a multilayered protein shell, the coat, provides unique resistance characteristics.
  • B. subtilis coat is formed by the ordered assembly of over 40 polypeptides. Some of these have enzymatic activity, like oxdD, which encodes an oxalate decarboxylase, cotA which encodes a laccase, yvdO which encodes a phospholipase, cotQ which encodes a reticuline-oxidase or tgl which encodes a transglutaminase.
  • the spore coat proteins allow spores to be very resistant to harsh chemicals, desiccation, strong pressure, or high temperatures.
  • B. subtilis spore An example of B. subtilis spore is disclosed in WO 2005/028556.
  • Known spores which show synthetic enzymatic activity displayed at the spore surfaces are very limited and refer to the use as diagnostic system or pharmaceutical drug, e.g. vaccine delivery systems.
  • Examples reported are displays of ⁇ -galactosidases, which were fused to part of CotC, to CotD, CotE, CotG or InhA (WO 1996/23063; US2004/0171065; WO2005/028654), and displays of lipases, which were inserted in frame within CotC or fused to part of CotC (US2002/0150594) or displays of carboxymethylcellulases, which were fused to the exosporium protein InhA.
  • spore systems can be used in the food and feed industry, preferably in animal feeding. More precisely, applicant has found the following: genetically modified or genetically engineered viable spore systems expressing bioactive polypeptides, for example bacteriocins and/or enzymatically active feed enzymes, at the spore surface, have a great potential use in animal feeding. Further, it has been found that genetically modified or "genetically engineered” inert spore systems expressing affinity ligands or immobilized enzymes at the surface have a great potential use in biocatalysis and in downstream purification processes.
  • bioactive polypeptides for example bacteriocins and/or enzymatically active feed enzymes
  • spores Especially the resistance to harsh chemicals, desiccation, strong pressure, or high temperatures allows the spores to be a potentially valuable tool for the display of bioactive molecules, like biocatalytic enzymes or bioactive feed enzymes that must survive harsh reaction conditions to deliver their full potential.
  • passenger bioactive polypeptides as for example enzymes, bacteriocins, affinity ligands, can also be fused to spore-specific enzymes, for example to surface enzymes as mentioned herein above.
  • spore and "spore system” as used herein are equivalent expressions and denote differentiated resistant structures that come from differentiation of microbial vegetative cells under hostile physical or chemical conditions such as, but not limited to, extreme pH, heat, pressure, desiccation or an extract/mixture containing said structures, wherein the spore is derived from a parent spore-forming organisms.
  • the spore which can be used in the present invention may be publicly available from different sources, e.g., Deutsche Sammlung von Mikroorganismen und Zellkulturen (DSMZ), Mascheroder Weg IB, D-38124 Braunschweig, Germany, American Type Culture Collection (ATCC), P.O.
  • DSMZ Deutsche Sammlung von Mikroorganismen und Zellkulturen
  • ATCC American Type Culture Collection
  • genetically modified or “genetically engineered” means the scientific alteration of the structure of genetic material in a living organism. It involves the production and use of recombinant DNA. More in particular it is used to delineate the genetically engineered or modified organism from the naturally occurring organism by forming a genetic DNA construct, wherein the genetic DNA construct comprises a first DNA portion encoding the desired target protein (including but not limited to affinity ligand, bioactive polypeptide, or enzyme) and a second DNA portion encoding a carrier herein also called spore coat protein, which construct, when transcribed and translated, expresses a fusion protein between the carrier and the target protein or peptide.
  • desired target protein including but not limited to affinity ligand, bioactive polypeptide, or enzyme
  • Genetic engineering may be done by a number of techniques known in the art, such as gene replacement, gene amplification, gene disruption, transfection, transformation using plasmids, viruses, or other vectors.
  • a genetically modified organism e.g. genetically modified microorganism, is also often referred to as a recombinant organism, e.g. recombinant microorganism.
  • the DNA encoding portion of the construct encoding the carrier may be selected from: a) the group of spore structural genes comprising cotC (encoding spore inner coat protein CotC), cotD (encoding spore inner coat protein CotD), cotB (encoding spore outer coat protein CotB), cotE (encoding spore outer coat protein CotE), cotF (encoding spore coat protein CotF), cotG (encoding spore coat protein CotG), cotN (encoding spore protein CotN), cotS (encoding spore coat protein CotS), cotT (encoding spore inner coat protein CotT), cot V (encoding spore coat protein Cot V), cot W (encoding spore coat protein Cot W), cotX (encoding spore coat protein CotX), cotY (encoding spore coat protein CotY), cotZ (encoding spore coat protein CotZ), cotH (encoding spor
  • the DNA encoding portion of the construct encoding the target may be selected from but not limited to affinity ligands, bioactive polypeptides, biocatalysis enzymes or any other enzymes.
  • biocatalysis denotes a chemical reaction mediated by a biological molecule, called biocatalyst, and which is able to initiate or modify the rate of the reaction in vivo (within a living system) or in vitro (within a reconstituted system). Enzymes are examples of biocatalysts.
  • Soluble enzymes can be immobilized following different procedures mainly in order to reuse and to stabilize them.
  • immobilized enzymes are Candida rugosa lipase (CRL) encapsulated without carrier, trypsin, Candida Antarctica lipase (CaIB) or penicillin G acylase cross-linked to macromolecule (e.g. polyethylene glycol or dextran sulfate) or alkylsulfatase on anionic exchangers.
  • PTS-I is a C-terminal tri-peptide extension of a protein promoting peroxisomal localization of the protein.
  • the C-terminal tri-peptide PTS-I can be a variant of [PAS]-[HKR]-[L] as described in Emanuelsson et al., J. MoI. Biol. (2003) 330, 443-456.
  • PTS-I is -SKL or -PRL.
  • affinity ligand denotes not only molecules that have biological relationship in vivo with the target protein but also a variety of other ligand such as fusion proteins or affinity tags.
  • affinity tags or fusion proteins are the maltose binding protein (MBP) that interacts with cross-linked amylose and is eluted with maltose, polyhistidine tags that consists of 6 His residues binding to chelated Ni 2+ or FLAG tag that is a eight amino acid hydrophilic peptide that binds to a specific antibody linked onto a column.
  • MBP maltose binding protein
  • polyhistidine tags that consists of 6 His residues binding to chelated Ni 2+
  • FLAG tag that is a eight amino acid hydrophilic peptide that binds to a specific antibody linked onto a column.
  • Inert spore are spores which are unable to germinate and recreate vegetative life. Methods to generate Bacillus subtilis non-germinating strain are well known from people skilled in the art. Inert spores according to this aspect of the invention are for example used "in vitro" and allow for example an alternative option to expensive classical systems of immobilized enzymes. They primarily have the advantage of spore resistance to harsh chemical conditions.
  • the invention relates to the use of inert spore systems expressing at their surface affinity ligands and/or bicocatalysts in biocatalysis and for the production of bioactive materials comprising such spore systems.
  • the PTS-I tagged proteins are preferably produced by the method described in WO2006/040340A2.
  • enzymes which can be used in such a system are enzymes for the food industry and feed enzymes.
  • Preferred feed enzymes are selected from amongst phytase (EC 3.1.3.8 or 3.1.3.26), xylanase (EC 3.2.1.8); galactanase (EC 3.2.1.89); alpha-galactosidase (EC 3.2.1.22); protease (EC 3.4.), phospholipase Al (EC 3.1.1.32); phospholipase A2 (EC 3.1.1.4); lysophospholipase (EC 3.1.1.5); phospholipase C (EC 3.1.4.3); phospholipase D (EC 3.1.4.4); amylase such as, for example, alpha-amylase (EC 3.2.1.1); and/or beta- glucanase (EC 3.2.1.4 or EC 3.2.1.6).
  • Bioactive polypeptides which can be used for the fusion according to the invention are antimicrobial and antifungal polypeptides.
  • antimicrobial peptides are CAP 18, Leucocin A, Tritrpticin, Protegrin-1, Thanatin, Defensin, Lactoferrin, Lactoferricin, and Ovispirin such as Novispirin, Plectasins, and Statins, including the compounds and polypeptides disclosed in WO 03/044049 and WO 03/048148, as well as variants or fragments of the above that retain antimicrobial activity.
  • AFP antifungal polypeptides
  • Aspergillus giganteus and Aspergillus niger peptides, as well as variants and fragments thereof which retain antifungal activity, as disclosed in WO 94/01459 and WO 02/090384.
  • the genetic modification is accomplished by transformation of a precursor cell using a vector containing the chimeric gene, using standard methods known to persons skilled in the art and then inducing the precursor cell to produce spores according to the invention.
  • the system may be constructed as such, that the gene construct may be under the control of one or more inducible promoter.
  • the gene construct may have one or more enhancer elements or upstream activator sequences and the like associated with it.
  • the gene construct may also comprise an inducible expression system.
  • the inducible expression system is such that when said spore germinates into a vegetative cell, the active polypeptide or enzyme is not expressed unless exposed to an external stimulus e. g. pH.
  • the spore system according to the invention expresses a feed enzyme on the spore surface, the spore germinates in the intestinal tract. More preferably the spore germinates in the duodenum and/or the jejunum of the intestinal tract.
  • the viable spore can be constructed as such that it displays a combination of both feed enzyme and bioactive polypeptide.
  • the composition comprises spores of the invention which express a feed enzyme as for example phytase (EC 3.1.3.8 or 3.1.3.26).
  • a feed enzyme as for example phytase (EC 3.1.3.8 or 3.1.3.26).
  • compositions of the invention are the following: - an animal feed additive comprising (a) a spore expressing a feed enzyme according to the invention; and (b) at least one fat-soluble vitamin, (c) at least one water-soluble vitamin, (d) at least one trace mineral, and/or (e) at least one macro mineral; and - an animal feed composition having a crude protein content of 50 to 800 g/kg and comprising a spore expressing a feed enzyme according to the invention.
  • premixes are examples of animal feed additives of the invention.
  • a premix designates a preferably uniform mixture of one or more micro-ingredients with diluent and/or carrier. Premixes are used to facilitate uniform dispersion of micro-ingredients in a larger mix.
  • the term animal includes all animals. Examples of animals are non-ruminants, and ruminants. Ruminant animals include, for example, animals such as sheep, goat, and cattle, e.g. cow such as beef cattle and dairy cows. In a particular embodiment, the animal is a non-ruminant animal.
  • Non-ruminant animals include mono-gastric animals, e.g. pig or swine (including, but not limited to, piglets, growing pigs, and sows); poultry such as turkeys, ducks and chickens (including but not limited to broiler chicks, layers); fish (including but not limited to salmon, trout, tilapia, catfish and carp); and crustaceans (including but not limited to shrimp and prawn).
  • feed or feed composition means any compound, preparation, mixture, or composition suitable for, or intended for intake by an animal.
  • feed-additive ingredients are colouring agents, e.g. carotenoids such as beta-carotene, astaxanthin, and lutein; aroma compounds; stabilisers; antimicrobial peptides; polyunsaturated fatty acids and/or reactive oxygen generating species.
  • the animal feed additive of the invention is intended for being included (or prescribed as having to be included) in animal diets or feed at levels of 0.01 to 10.0%; more particularly 0.05 to 5.0%; or 0.2 to 1.0% (% meaning g additive per 100 g feed). This is so in particular for premixes.
  • Animal feed compositions or diets have a relatively high content of protein.
  • Poultry and pig diets can be characterised as indicated in Table B of WO 01/58275, columns 2-3.
  • Fish diets can be characterised as indicated in column 4 of this Table B.
  • Furthermore such fish diets usually have a crude fat content of 200-310 g/kg.
  • WO 01/58275 corresponds to US 09/779334 which is hereby incorporated by reference.
  • An animal feed composition according to the invention has a crude protein content of 50- 800 g/kg, and furthermore comprises at least one spore strain as described and/or claimed herein.
  • the animal feed composition of the invention has a content of metabolisable energy of 10-30 MJ/kg; and/or a content of calcium of 0.1-200 g/kg; and/or a content of available phosphorus of 0.1-200 g/kg; and/or a content of methionine of 0.1-100 g/kg; and/or a content of methionine plus cysteine of 0.1 - 150 g/kg; and/or a content of lysine of 0.5-50 g/kg.
  • the content of metabolisable energy, crude protein, calcium, phosphorus, methionine, methionine plus cysteine, and/or lysine is within any one of ranges 2, 3, 4 or 5 in Table B of WO 01/58275 (R. 2-5).
  • the nitrogen content is determined by the Kjeldahl method
  • Metabolisable energy can be calculated on the basis of the NRC publication Nutrient requirements in swine, ninth revised edition 1988, subcommittee on swine nutrition, committee on animal nutrition, board of agriculture, national research council. National Academy Press, Washington, D. C, pp. 2-6, and the European Table of Energy Values for Poultry Feed-stuffs, Spelderholt centre for poultry research and extension, 7361 DA Beekbergen, The Netherlands. Grafisch bedrijf Ponsen & looijen bv, Wageningen. ISBN 90-71463-12-5.
  • the dietary content of calcium, available phosphorus and amino acids in complete animal diets is calculated on the basis of feed tables such as Veevoedertabel 1997, gegevens over chemische samenstelling, verteerbaarheid en voederwaarde van voedermiddelen, Central Veevoederbureau, Runderweg 6, 8219 pk Lelystad. ISBN 90-72839-13-7.
  • the animal feed composition of the invention contains at least one vegetable protein or protein source. It may also contain animal protein, such as Meat and Bone Meal, and/or Fish Meal, typically in an amount of 0-25%.
  • vegetable proteins refers to any compound, composition, preparation or mixture that includes at least one protein derived from or originating from a vegetable, including modified proteins and protein-derivatives.
  • the protein content of the vegetable proteins is at least 10, 20, 30, 40, 50, or 60% (w/w).
  • Vegetable proteins may be derived from vegetable protein sources, such as legumes and cereals, for example materials from plants of the families Fabaceae (Leguminosae), Cruciferaceae, Chenopodiaceae, and Poaceae, such as soy bean meal, lupin meal and rapeseed meal.
  • Fabaceae Leguminosae
  • Cruciferaceae Chenopodiaceae
  • Poaceae such as soy bean meal, lupin meal and rapeseed meal.
  • the vegetable protein source is material from one or more plants of the family Fabaceae, e.g. soybean, lupine, pea, or bean.
  • the vegetable protein source is material from one or more plants of the family Chenopodiaceae, e.g. beet, sugar beet, spinach or quinoa.
  • vegetable protein sources are rapeseed, sunflower seed, cotton seed, cabbage and cereals such as barley, wheat, rye, oat, maize (corn), rice, triticale, and sorghum.
  • the animal feed composition of the invention contains 0-80% maize; and/or 0-80% sorghum; and/or 0-70% wheat; and/or 0-70% Barley; and/or 0-30% oats; and/or 0-30% rye; and/or 0-40% soybean meal; and/or 0-25% fish meal; and/or 0-25% meat and bone meal; and/or 0-20% whey.
  • Animal diets can e.g. be manufactured as mash feed (non pelleted) or pelleted feed.
  • the milled feed-stuffs are mixed and sufficient amounts of essential vitamins and minerals are added according to the specifications for the species in question.
  • the spore strain can be added as solid or liquid formulation. It is at present contemplated that the Bacillus strain is administered in one or more of the following amounts (dosage ranges): 10 E2-14, 10 E4-12, 10 E6-10, 10 E7-9, preferably 10 E8 CFU/g of feed (the designation E meaning exponent, viz., e.g., 10 E2-14 means 102-1014).
  • the present invention provides B.subtilis strains transformed according to the inventions as defined above.
  • B.subtilis strains are SD39, SD48, SD50; SD60, SD 130, SD 140 and SD 150 which derive form B.subtilis parent strain deposited under Bacillus Genetic Stock Center 1 AlAl.
  • Figure 1 shows a map of the B. subtilis vector pDG364,
  • Figures 2 and 3 show intensity histograms of strains engineered according to example 5 and 6 compared to the wild type strains
  • Figures 4 to 6 show specific enzyme activities of strains engineered according to example 7, 8 or 9 compared to the wild type strains.
  • Applicant describes in the examples below the construction of a system aimed at the display of an enzymatic activity on the spore surface. Applicant has used the entire wild- type CotG protein as carrier and fused it, in frame, at the carboxyl-terminus end, with the gene encoding the phosphatase activity (Example 1). Significant phosphatase activity was found associated with engineered purified spore compared to non-engineered spores (Example 7). Equivalent constructions (translational C-terminus fusion to CotG), which have been designed to display phytase activity at the spore surface (B. subtilis endogenous phy activity) (Example 2), have also demonstrated specific enzymatic activity (Example 8).
  • passenger bioactive molecules can also be fused to spore-specific enzymes like oxdD or cotQ.
  • spore-specific enzymes like oxdD or cotQ.
  • oxdD oxalate decarboxylase encoded by oxdD
  • uidA uidA gene encoding ⁇ -glucuronidase is fused to the carboxyl-terminal of oxdD .
  • Specific display and corresponding enzymatic activities have been observed (examples 6 and 9 for oxdD-uidA).
  • Example 5 Display was also specifically demonstrated for cotG- phy and oxdD-phy fusions (example 5).
  • Other example could use other enzyme-encoding genes like cotQ (encoding a reticuline oxidase-like protein) or cotA (encoding a laccase) as carriers.
  • cotQ encoding a reticuline oxidase-like protein
  • cotA encoding a laccase
  • the main advantage of passenger fusions to carrier enzymes resides in the easy detection of the engineered fusion proteins, by straight- forward assaying the carrier enzymatic activity to demonstrate display, instead of time-consuming immuno-detection experiments that also requires expensive specific equipment.
  • Another advantage of the enzymes can possibly be their easier amenability to overexpression than structural protein where stoiechiometric unbalance could lead to fragile spores.
  • Bacillus subtilis strains of the present invention are derived from strain 1 A747 ⁇ Bacillus Genetic Stock Center, The Ohio State University, Columbus, Ohio 43210 USA), which is a prototrophic derivative of B. subtilis 168 (trpC2) (GenBank AL009126).
  • the chloramphenicol-resistance gene (cat) cassette was obtained from plasmid pC194 (GeneBank M19465, Cat# IEM Bacillus Genetic Stock Center, The Ohio State University, Columbus, Ohio 43210 USA). Plasmid for integration Cassette for LFH-PCR
  • Standard minimal medium (MM) for B. subtilis contains IX Spizizen salts, 0.04% sodium glutamate, and 0.5% glucose.
  • Standard solid complete medium is Tryptone Blood Agar Broth (TBAB, Difco).
  • Standard liquid complete medium is Veal Infusion- Yeast Extract broth (VY). The compositions of these media are described below: TBAB medium: 33g Difco Tryptone Blood Agar Base (Catalog # 0232), 1 L water. Autoclave.
  • VY medium 25g Difco Veal Infusion Broth (Catalog # 0344), 5g Difco Yeast Extract (Catalog #0127), IL water. Autoclave.
  • MM Minimal Medium
  • 1OX Spizizen salts 10 ml 50% glucose; 1 ml 40% sodium glutamate, qsp 1 L water.
  • IPX Spizizen salts 14Og K 2 HPO 4 ; 2Og (NH 4 ) 2 SO 4 ; 6Og KH 2 PO 4 ; 1 Og Na 3 citrate.2H 2 O; 2g MgSO 4 .7H 2 O; qsp IL with water.
  • IPX VFB minimal medium ClOX VFB MM 2.5g Na-glutamate; 15.7g KH 2 PO 4 ; 15.7g K 2 HPO 4 ; 27.4 g Na 2 HPO 4 .12H 2 O; 4Og NH 4 Cl; 1 g citric acid; 68 g (NH 4 ) 2 SO 4 ; qsp 1 L water.
  • Trace elements solution 1.4g MnSO 4 H 2 O; 0.4g CoCl 2 -OH 2 O; 0.15g (NH 4 ) 6 Mo 7 O 24 -4H 2 O; 0. Ig AlCl 3 -OH 2 O; 0.075g CuCl 2 -2H 2 O; qsp 200 ml water.
  • Fe solution 0.2 Ig FeSO 4 .7H 2 O; qsp 10 ml water.
  • CaCl 7 solution 15.6g CaCl 2 .2H 2 O; qsp 500 ml water.
  • Mg/Zn solution lOOg MgSO 4 JH 2 O; 0.4g ZnSO 4 JH 2 O; qsp 200 ml water.
  • VFB MM medium 100 ml 1OX VFB MM; 10 ml 50% glucose; 2 ml Trace elements solution; 2 ml Fe solution; 2 ml CaCl 2 solution; 2 ml Mg/Zn solution; 882 ml sterile distilled water.
  • Schaeffer sporulating medium Bacto-nutrient broth 8 g; 10 ml 10% (w/v) KCl; 10 ml 1.2% (w/v) MgSO 4 JH 2 O; 0.5 ml IM NaOH; qsp 1 L. Add 1 ml IM Ca(NO 3 ) 4 ; 1 ml 0.01 MnCl 2 ; 1 ml ImM FeSO 4 .
  • Standard genetic and molecular biology techniques are generally known in the art and have been previously described.
  • DNA transformation, and other standard B. subtilis genetic techniques are also generally known in the art and have been described previously (Harwood and Cutting, 1992).
  • Custom anti-phytase rabbit-IgG (Eurogentec) was generated by immunizing rabbits with a mix of 2 synthetic phytase-specific peptides CAEPGGGSKGQVVDRA and CHKQVNPRKLKDRSDG) and used as primary antibody (AbI).
  • Goat anti rabbit-IgG coupled with FITC (Eurogentec) was used as secondary antibody (Ab2).
  • Pictures are taken with Visitron Coolsnap camera and analysed with Metamorph software (Molecular Devices GmbH).
  • 2uL AbI (1 : 1000) were added to the 50OuL suspensions, and incubated o/n, 4 0 C, on a rotating tube holder. The next day, spores were washed 3 times with 50OuL PBS-BSA2% 5min, 8000rpm and resuspended in 50OuL. 2uL Ab2 (1 : 1000) were then added to the 50OuL, for 1 hour at RT, on a rotating tube holder (protected form light). Spores were finally washed in 50OuL PBS alone (4 times, 5min, 8000rpm).
  • Fluorescent detection of ⁇ -glucuronidase In situ detection of ⁇ -glucuronidase activity was performed using a fluorogenic substrate ImaGene Green C 12FDGIcU (Molecular Probes). This substrate was used on purified spores according to the indications of the manufacturer (Molecular Probes). Absorption and emission of the reaction product were respectively 495 and 518 nm. The fluorescence signal was assessed by measuring the pixel intensity using Metamorph 7.1.0.0 software (Molecular Devices).
  • ⁇ -glucuronidase (GUS) assay Spores or cultures were first re-suspended in 80OuL of Z buffer (6OmM Na2HPO4.7H20, 4OmM NaH2PO4, 1OmM KCl, ImM MgSO4.7H2O, 5OmM ⁇ -mercaptoethanol, pH7). Solutions were then equilibrated 3min at 3O 0 C before addition of 20OuL of pNPG (p-nitrophenyl- ⁇ -D-glucuronide 4mg/ml). Incubation was performed at 30°C until development of a yellow color. Reaction was then stopped with 50OuL Na2CO3 (IM), while reaction time (T) was recorded.
  • IM reaction time
  • alkaline phosphatase assay Based on the method described by Bessey, Lowry and Brock. (1967), B. subtilis alkaline phosphatase activity was colorimetrically measured using pNPP as substrate (para-nitrophenol phosphate, Fluka 71768). Specific conditions were an optimal pH at 9-10 and requirements for Mg and Zn. Measurements were made at 405 nm after incubation at 37 0 C. Activity unit were defined as amount of enzyme that catalyze the release of 1 micromole of para-nitrophenol per minute at 37 0 C.
  • phytase assay The assay was run at pH7.4 and 37 0 C which are optimal for B. subtilis phytase.
  • inorganic orthophosphate was liberated from phytase activity. This reaction was stopped after 30min, before a second reaction was performed to measure the released Pi at 820 nm.
  • Activity assay 300 ⁇ L f buffer B (Tris-HCl 10OmM pH 7.4, CaC12 ImM, sodium phytate 2mM pH 7.4) were pre-warmed at 37 0 C for 5 min. 75 ⁇ L of sample to assay (or controls) were then added before incubation for 30min at 55 0 C. Reaction was stopped by adding 375uL of TCA 15%. Samples underwent then a centrifugation HOOOrpm, 5min, in order to harvest the spores, which would interfere with the Abs820nm measurement (next step).
  • Photometric measurement of the released Pi (Alko method). 50 ⁇ L of the previous supernatants were diluted with water (total volume 50OuL). Then 50OuL of reagent C (1 vol. 10% ascorbic acid, 1 vol. 2.5% ammonium molybdate, 3 vol. IM H2SO4) were added. Incubation was performed at 50°C during 20min. Absorbance of cooled samples was then read at 820n and compared to a standard curve which was made by measuring the Pi of dilutions 1000, 2000 and 4000 of a 9OmM KH2PO4 solution. Abs820nm was read after 30min incubation, 37°C with 50OuL reagent C (added to 50OuL KH2PO4 dilutions).
  • This example describes the construction of B. subtilis strain SD39 designed to display alkaline phosphatase (PhoA) activity at the spore surface through fusion with the spore structural protein CotG.
  • RhoA alkaline phosphatase
  • B. subtilis alkaline phosphatase (PhoA) was engineered without its signal peptide (1 to 41 AA). The absence of signal peptide is further denominated as"SPfree".
  • the 549-bp long carrier fragment of cotG (including 455-bp upstream of the ATG) was amplified from B. subtilis 1 A747 chromosomal (wild type B.
  • subtilis strain PY79 DNA in a 50 ⁇ l reaction volume containing 1 ⁇ l of 40 mM dNTP's, 5 ⁇ l of 1OX buffer and 0.75 ⁇ l PCR enzyme (Herculase, Stratagene), 0.1 ug of template and primers cotG/for/BamHI and cotG/rev listed in Table 1.
  • the PCR reaction was performed for 30 cycles using an annealing temperature of 53°C. Then, the 1356-bp long passenger phoA fragment was amplified from B.
  • subtilis 1A747 chromosomal DNA in a 50 ⁇ l reaction volume containing 1 ⁇ l of 40 mM dNTP's, 5 ⁇ l of 1OX buffer and 0.75 ⁇ l PCR enzyme (Herculase, Stratagene), 0.1 ug of template and primers cotG3'-alal5-phoA and phoA/rev/Hindlll listed in Table 1.
  • the PCR reaction was performed for 30 cycles using an annealing temperature of 53°C.
  • the resulting plasmid was named pSD16. Subsequent sequencing of the translational fusion revealed that the ala spacer was made only of 14 residues.
  • Plasmid pSD16 was transformed into strain PY79, resulting by double-crossover recombination at the nonessential amyE locus, to B. subtilis spore display strain SD39.
  • This example describes the construction of B. subtilis strain SD48 designed to display phytase (phy) activity at the spore surface through fusion with the spore structural protein CotG.
  • the cotG-alal 5-phy-S?free synthetic translational fusion was cloned between the BamHl and HmdIII sites into a B. subtilis suicide vector (pDG364; BGSC-46; Karmazyn-Campelli et al., 1989; Figure 1) for subsequent ectopic integration within the non-essential amyE locus.
  • the resulting plasmid was named pSD21.
  • Plasmid pSD21 was transformed into strain PY79, leading, by double-crossover recombination at the nonessential amyE locus, to B. subtilis spore display strain SD48.
  • This example describes the construction of B. subtilis strain SD50 designed to display endogenous phytase activity (phy) at the spore surface through fusion with the spore coat enzyme OxdD.
  • subtilis suicide vector (pDG364; BGSC-46; Karmazyn- Campelli et al., 1989; Figure 1) for subsequent ectopic integration within the non-essential ⁇ myE locus.
  • the resulting plasmid was named pSD22.
  • Plasmid pSD22 was transformed into strain PY79, leading, by double-crossover recombination at the nonessential ⁇ myE locus, to B. subtilis spore display strain SD50.
  • This example describes the construction of B. subtilis strain SD60 designed to display ⁇ - glucuronidase (GUS encoded by uidA E. coli gene) activity at the spore surface through fusion with the spore enzyme protein OxdD.
  • GUS encoded by uidA E. coli gene
  • the uidA gene was inserted between Nhel and HmdIII sites of vector pSD22 at the 3 '-end of the oxdD open reading frame, generating a oxdD-a ⁇ a ⁇ 0-uid ⁇ translational fusion for subsequent ectopic integration within the non-essential ⁇ myE locus.
  • the resulting plasmid was named pSD27.
  • Plasmid pSD27 was transformed into strain PY79, leading, by double-crossover recombination at the nonessential ⁇ myE locus, to B. subtilis spore display strain SD60.
  • EXAMPLE 5 Specific display of phytase enzyme associated to spores surface using two kinds of carriers.
  • Fig. 2 Fluorescence intensity histograms of strain SD48 and SD50 compared to wild type strain PY79. Empty bars represent fluorescence of spores that have not undergone trypsin treatment. Black bars represent fluorescence activities of spore treated with protease. The fluorescence signal is an average of the pixel intensity in spores, measured by Metamorph software. SD48 contains a cotG-( ⁇ l ⁇ ) 15-p/?y-SPfree translational fusion; SD50 contains a oxdD-a ⁇ a ⁇ 0(Nhel)-phy-S? free translational fusion.
  • EXAMPLE 6 Display of ⁇ -glucuronidase associated to spores from oxdD- engineered strain SD60.
  • ⁇ -glucuronidase enzyme is associated with spores from ⁇ xJD-engineered strain SD60 and displayed at its surface.
  • Fig. 3 Fluorescence intensity histograms of strain SD60 compared to wild type strain PY79. Empty bars represent fluorescence of spores that have not undergone trypsin treatment. Black bars represent fluorescence activities of spore treated with protease. The fluorescence signal is an average of the pixel intensity in spores, measured by Metamorph software. SD60 contains a oxdD-a ⁇ a ⁇ 0-uidA translational fusion.
  • trypsin treatment demonstrated the specific display of the ⁇ -glucuronidase at the spore surface using a spore associated enzyme, like OxdD, as carrier.
  • EXAMPLE 7 Phosphatase activity associated to spores from cofG-engineered strain SD39.
  • This example demonstrates that phosphatase enzymatic activity is associated with spores from cctfG-engineered strain SD39.
  • Alkaline phospahatase enzymatic activity was measured on pure spore engineered to display the passenger enzyme with the core structural protein CotG (Fig. 4).
  • Fig. 4 Alkaline phosphatase activity associated to SD39 pure spore solution using colorimetric assay. Control strain was wild type strain PY79. Activities are in mUnits. EXAMPLE 8 - Phytase activity associated to spores from c ⁇ rt7-engineered strain SD48
  • Fig. 5 Phytase phosphatase activity associated to SD48 pure spore solution using colorimetric assay.
  • Control strain was wild type strain PY79. Specific activities are in Units/ Optical Density 580nm.
  • EXAMPLE 9 - ⁇ -glucuronidase activity associated to spores from ⁇ xdD-engineered strain SD60.
  • ⁇ - glucuronidase activity was assessed in triplicate on SD60 pure spores prepared as described earlier (Fig. 6). Heat treatment was performed to denature enzymes and demonstrate specificity of the reported activity.
  • Fig. 6 ⁇ -glucuronidase activity of SD60 pure spore using colorimetric assay based on pNPG.
  • Strain SD60 was tested in triplicates a, b, c. Empty bars represent enzymatic activity on pure spores. Black bars represent activities of pure spores heated during 15 min at 6O 0 C before performing the colorimetric enzymatic assay.
  • SD60 contains an oxdD-a ⁇ a ⁇ 0- uidA translational fusion. Control strain was wild type strain PY79. Activities are in Miller units.
  • this example demonstrates specific reporter enzymatic activity at the spore surface of a strain engineered to display enzyme through translational fusion to spore associated enzymes.
  • the Aspergillus niger pex5 gene encodes for a protein which is recognizing specifically PTS-I motifs [e.g. SKL (serine-lysine-leucine) motifs or PRL (proline-arginine-leucine)].
  • PTS-I motif can be engineered at the carboxyl-terminal of protein for specific tagging and subsequent capture of the tagged protein.
  • B. subtilis strain SDl 30 designed to display ⁇ . niger Pex5 PTS-1-aff ⁇ ne protein at the spore surface through fusion with the spore coat protein CotC.
  • Table 6 Sequence of the cotC-a ⁇ a ⁇ 0-pex5 translational fusion (SEQ ID NO: 9). B ⁇ mHl and HmdIII cloning sites are in bold underlined. cotC gene coding sequence is in bold. pex5 gene coding sequence is underlined. Spacer region is in lower case font.
  • the cotC-a ⁇ a ⁇ 0-pex5 translational fusion was then cloned between the B ⁇ mRl and HmdIII sites into a B. subtilis suicide vector (pDG364; BGSC-46; Karmazyn-Campelli et al., 1989; Figure 1) for subsequent ectopic integration within the non-essential ⁇ myE locus.
  • the resulting plasmid was named pSD130.
  • plasmid pSD130 was transformed into B. subtilis wild typre strain PY79, generating, by double-crossover recombination at the non-essential ⁇ myE locus, B. subtilis spore display strain SDl 30.
  • This example describes the construction of B, subtilis strain SD140 designed to display A niger PTS-I -aff ⁇ ne pex5 protein at the spore surface through fusion with the spore coat enzyme OxdD.
  • Table 7 Sequence of the oxdD-a ⁇ a ⁇ 0(Nhe ⁇ )-pex5 synthetic translational fusion (SEQ ID NO: 10). B ⁇ mHl and Hindlll cloning sites are in bold underlined. oxdD gene coding sequence is in bold. pex5 gene coding sequence is underlined. Spacer region is in lower case font. Nhel restriction site in the spacer is in lower case underlined fonts.
  • the oxdD-a ⁇ a ⁇ 0(Nhe ⁇ )-pex5 synthetic translational fusion was then cloned between the B ⁇ mHl and HmdIII sites into a B. subtilis suicide vector (pDG364; BGSC-46; Karmazyn- Campelli et al., 1989; Figure 1) for subsequent ectopic integration within the non-essential ⁇ myE locus.
  • the resulting plasmid was named pSD140.
  • plasmid pSD140 was transformed into wild type B. subtilis strain PY79, generating, by double-crossover recombination at the non-essential ⁇ myE locus, to B. subtilis spore display strain SD 140.
  • the A.niger pex5 coding sequence (passenger sequence, underlined in Table 7) was codon-adapted for expression in B.subtilis.
  • the relevant optimized passenger sequence which was designed to be free of BamHl, HindlU and MeI sites, is detailed in Table 8 and strictly encodes the same protein that the passenger sequence of Table 7 (Table 9).
  • the oxdD-a ⁇ a ⁇ 0(Nhel)-optipex5 synthetic translational fusion was subsequently cloned between the B ⁇ m ⁇ l and HmdIII sites into the B. subtilis suicide vector pDG364 (BGSC-46; Karmazyn-Campelli et al, 1989; Figure 1) for ectopic integration within the non-essential ⁇ myE locus.
  • the resulting plasmid was named pSDl 50.
  • the recombinant strain obtained after transformation into PY79 was named SD 150.
  • Table 8 Sequence of A.niger pex5 coding sequence (underlined in Table 7), codon- adapted for expression in B.subtilis. Underlined TAATAA are stop codons: (SEQ ID NO: 1 1)
  • Table 9 Amino acid sequence of the A. niger Pex5 protein (SEQ ID NO: 12).

Landscapes

  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Zoology (AREA)
  • General Health & Medical Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Molecular Biology (AREA)
  • Microbiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Polymers & Plastics (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Medicinal Chemistry (AREA)
  • Biophysics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Animal Husbandry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Food Science & Technology (AREA)
  • Physiology (AREA)
  • Mycology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Fodder In General (AREA)

Abstract

This invention discloses novel bacterial spore systems. It has now been found surprisingly that under certain conditions bacterial spore systems can be used in the food and feed industry, preferably in animal feeding and as biohybrid material. More precisely applicant has found the following: Genetically modified or genetically engineered viable spore systems expressing bioactive polypeptides, for example bacteriocins and/or enzymatically active feed enzymes, at the spore surface, have a great potential use in animal feeding. Further, it has been found that genetically modified or 'genetically engineered inert spore systems expressing affinity ligands or immobilized enzymes at the surface have a great potential use in biocatalysis and in the construction of biocatalytic films. Especially the resistance to harsh chemicals, desiccation, strong pressure, or high temperatures allows the spores to be a potentially valuable tool for the display of bioactive molecules, like biocatalytic enzymes or bioactive feed enzymes that must survive harsh conditions to deliver their full potential. Finally, applicant has found that instead of translational fusions to spore structural genes as it is known from the prior art described above, passenger bioactive polypeptides, as for example enzymes, bacteriocins, affinity ligands, can also be fused to spore-specific surface enzymes, for example to spore specific enzymes as mentioned herein above.

Description

Spore Surface Displays of Bioactive Molecules
The present invention relates to the display of bioactive molecules at the surface of spores for both in vitro and in vivo applications.
During the last ten years microbial surface display (part of the bio-nanotechnology field) has increasingly become a tool of choice to display peptides or proteins of biotechnological interest on natural nanostructures for a commercial purpose. Biological applications include the development of bio-adsorbents, the presentation of antigens for vaccines, or the preparation of combinatorial epitope libraries. Surface display requires only the synthesis of a hybrid protein that consists of a passenger protein of commercial interest fused to a carrier protein, which anchors it onto the biological surface (cell wall or membrane). A good carrier protein requires the following characteristics: i) a targeting signal that directs it to the biological surface; ii) a strong anchoring motif; iii) resistance to proteases; and iv) compatibility to foreign sequences to be fused. Originally, the carrier protein was chosen amongst surface or membrane proteins, e.g. OmpA for Gram-negative bacteria or the Protein A for Gram-positive bacteria. The disadvantages of these display systems are that these proteins were not very stable and tended to be inactivated under conditions that are regularly used in biotechnological and chemical processes.
Recently, another nanostructure has emerged as a novel surface of choice for display: the spore coat from Bacillus subtilis and other related genera. Bacilli and Clostridia have the ability to undergo a complex differentiation process under nutrient deprivation or hostile conditions. This process, called sporulation, ends with the formation of an extremely resistant structure named the spore. When conditions become conductive for growth, the spores germinate to re-generate vegetative cells which follow a classical growth and division cyclic pattern. Spore consists of a central compartment, the spore core, which contains a copy of the chromosome. The spore core is surrounded by a thin inner layer membrane of peptidoglycan that creates the germ cell, itself surrounded by a thicker layer of peptidoglycan, called the cortex. Oustide of the cortex, a multilayered protein shell, the coat, provides unique resistance characteristics. B. subtilis coat is formed by the ordered assembly of over 40 polypeptides. Some of these have enzymatic activity, like oxdD, which encodes an oxalate decarboxylase, cotA which encodes a laccase, yvdO which encodes a phospholipase, cotQ which encodes a reticuline-oxidase or tgl which encodes a transglutaminase. In contrast to vegetative cells, the spore coat proteins allow spores to be very resistant to harsh chemicals, desiccation, strong pressure, or high temperatures.
An example of B. subtilis spore is disclosed in WO 2005/028556. Known spores which show synthetic enzymatic activity displayed at the spore surfaces are very limited and refer to the use as diagnostic system or pharmaceutical drug, e.g. vaccine delivery systems. Examples reported are displays of β-galactosidases, which were fused to part of CotC, to CotD, CotE, CotG or InhA (WO 1996/23063; US2004/0171065; WO2005/028654), and displays of lipases, which were inserted in frame within CotC or fused to part of CotC (US2002/0150594) or displays of carboxymethylcellulases, which were fused to the exosporium protein InhA.
It has now been found surprisingly that under certain conditions spore systems, as described in general herein above, can be used in the food and feed industry, preferably in animal feeding. More precisely, applicant has found the following: genetically modified or genetically engineered viable spore systems expressing bioactive polypeptides, for example bacteriocins and/or enzymatically active feed enzymes, at the spore surface, have a great potential use in animal feeding. Further, it has been found that genetically modified or "genetically engineered" inert spore systems expressing affinity ligands or immobilized enzymes at the surface have a great potential use in biocatalysis and in downstream purification processes. Especially the resistance to harsh chemicals, desiccation, strong pressure, or high temperatures allows the spores to be a potentially valuable tool for the display of bioactive molecules, like biocatalytic enzymes or bioactive feed enzymes that must survive harsh reaction conditions to deliver their full potential. Finally, applicant has found that instead of translational fusions to spore structural genes as it is known from the prior art described above, passenger bioactive polypeptides, as for example enzymes, bacteriocins, affinity ligands, can also be fused to spore-specific enzymes, for example to surface enzymes as mentioned herein above.
The terms "spore" and "spore system" as used herein are equivalent expressions and denote differentiated resistant structures that come from differentiation of microbial vegetative cells under hostile physical or chemical conditions such as, but not limited to, extreme pH, heat, pressure, desiccation or an extract/mixture containing said structures, wherein the spore is derived from a parent spore-forming organisms.
The spore which can be used in the present invention may be publicly available from different sources, e.g., Deutsche Sammlung von Mikroorganismen und Zellkulturen (DSMZ), Mascheroder Weg IB, D-38124 Braunschweig, Germany, American Type Culture Collection (ATCC), P.O. Box 1549, Manassas, VA 20108 USA or Culture Collection Division, NITE Biological Resource Center, 2-5-8, Kazusakamatari, Kisarazu- shi, Chiba, 292-0818, Japan (formerly: Institute for Fermentation, Osaka (IFO), 17-85, Juso-honmachi 2-chome,Yodogawa-ku, Osaka 532-8686, Japan), or alternatively from well characterized (wild) isolates, which sporulate with higher efficiency that laboratory strains. Examples of preferred spores are spores of Bacilli, Sporolactobacilli and Clostridia, for example bacterial spores of B. subtilis.
It is a first object of the present invention to provide a new genetically modified, inert spore which is unable to germinate wherein said spore is genetically modified to expose at its surface affinity ligands and/or biocatalysts, for example immobilized enzymes.
The term "genetically modified" or "genetically engineered" means the scientific alteration of the structure of genetic material in a living organism. It involves the production and use of recombinant DNA. More in particular it is used to delineate the genetically engineered or modified organism from the naturally occurring organism by forming a genetic DNA construct, wherein the genetic DNA construct comprises a first DNA portion encoding the desired target protein (including but not limited to affinity ligand, bioactive polypeptide, or enzyme) and a second DNA portion encoding a carrier herein also called spore coat protein, which construct, when transcribed and translated, expresses a fusion protein between the carrier and the target protein or peptide. Genetic engineering may be done by a number of techniques known in the art, such as gene replacement, gene amplification, gene disruption, transfection, transformation using plasmids, viruses, or other vectors. A genetically modified organism, e.g. genetically modified microorganism, is also often referred to as a recombinant organism, e.g. recombinant microorganism.
The DNA encoding portion of the construct encoding the carrier may be selected from: a) the group of spore structural genes comprising cotC (encoding spore inner coat protein CotC), cotD (encoding spore inner coat protein CotD), cotB (encoding spore outer coat protein CotB), cotE (encoding spore outer coat protein CotE), cotF (encoding spore coat protein CotF), cotG (encoding spore coat protein CotG), cotN (encoding spore protein CotN), cotS (encoding spore coat protein CotS), cotT (encoding spore inner coat protein CotT), cot V (encoding spore coat protein Cot V), cot W (encoding spore coat protein Cot W), cotX (encoding spore coat protein CotX), cotY (encoding spore coat protein CotY), cotZ (encoding spore coat protein CotZ), cotH (encoding spore inner coat protein CotH), coϋA (encoding spore coat protein CoUA), cot JC (encoding spore coat protein CotJC), cotK (encoding spore protein CotK), cotL (encoding spore protein protein CotL), cotM (encoding spore outer coat protein CotM), spoIVA (encoding spore assembly protein SpoFVA ), spo VID (encoding spore assembly protein Spo VID), or any other gene coding for a protein whose assembly at the surface of the developing spore has been shown to be dependent on spoIVA, spo VID, safA or cotE. b) the group of spore specific enzymes comprising cotA (encoding a laccase), oxdD
(encoding an oxalate decarboxylase), cotQ (encoding a reticuline oxidase-like protein), tgl (encoding a transglutaminase), or the product of any other gene which resembles a known enzymes, and whose assembly at the surface of the developing spore has been shown to be dependent on spoIVA, spoVID, safA or cotE.
The DNA encoding portion of the construct encoding the target may be selected from but not limited to affinity ligands, bioactive polypeptides, biocatalysis enzymes or any other enzymes.
The term "biocatalysis" as used herein denotes a chemical reaction mediated by a biological molecule, called biocatalyst, and which is able to initiate or modify the rate of the reaction in vivo (within a living system) or in vitro (within a reconstituted system). Enzymes are examples of biocatalysts.
Soluble enzymes can be immobilized following different procedures mainly in order to reuse and to stabilize them. Examples of immobilized enzymes are Candida rugosa lipase (CRL) encapsulated without carrier, trypsin, Candida Antarctica lipase (CaIB) or penicillin G acylase cross-linked to macromolecule (e.g. polyethylene glycol or dextran sulfate) or alkylsulfatase on anionic exchangers.
An example of an affinity ligand with in vivo biological relationship with the target protein is the A.niger PTS-I affine Pex5 protein. Pex5 is the receptor of PTS-I [McCollum et al., J. Cell Biol. 121, 761-774 (1993)]. PTS-I is a C-terminal tri-peptide extension of a protein promoting peroxisomal localization of the protein. The C-terminal tri-peptide PTS-I can be a variant of [PAS]-[HKR]-[L] as described in Emanuelsson et al., J. MoI. Biol. (2003) 330, 443-456. Preferably PTS-I is -SKL or -PRL. The term "affinity ligand" as used here denotes not only molecules that have biological relationship in vivo with the target protein but also a variety of other ligand such as fusion proteins or affinity tags. Examples of affinity tags or fusion proteins are the maltose binding protein (MBP) that interacts with cross-linked amylose and is eluted with maltose, polyhistidine tags that consists of 6 His residues binding to chelated Ni2+ or FLAG tag that is a eight amino acid hydrophilic peptide that binds to a specific antibody linked onto a column.
Inert spore are spores which are unable to germinate and recreate vegetative life. Methods to generate Bacillus subtilis non-germinating strain are well known from people skilled in the art. Inert spores according to this aspect of the invention are for example used "in vitro" and allow for example an alternative option to expensive classical systems of immobilized enzymes. They primarily have the advantage of spore resistance to harsh chemical conditions.
In a further aspect the invention relates to the use of inert spore systems expressing at their surface affinity ligands and/or bicocatalysts in biocatalysis and for the production of bioactive materials comprising such spore systems. An example of use of an inert spore system expressing at the surface the affinity ligand A.niger Pex5 protein, is affinity purification of proteins comprising a C-terminal PTS-I tag. The PTS-I tagged proteins are preferably produced by the method described in WO2006/040340A2.
It is another object of the present invention to provide a genetically modified, viable spore which is able to germinate wherein said spore is genetically modified to produce an enzyme or a bioactive polypeptide upon germination into a vegetative cell.
Examples of enzymes which can be used in such a system are enzymes for the food industry and feed enzymes. Preferred feed enzymes are selected from amongst phytase (EC 3.1.3.8 or 3.1.3.26), xylanase (EC 3.2.1.8); galactanase (EC 3.2.1.89); alpha-galactosidase (EC 3.2.1.22); protease (EC 3.4.), phospholipase Al (EC 3.1.1.32); phospholipase A2 (EC 3.1.1.4); lysophospholipase (EC 3.1.1.5); phospholipase C (EC 3.1.4.3); phospholipase D (EC 3.1.4.4); amylase such as, for example, alpha-amylase (EC 3.2.1.1); and/or beta- glucanase (EC 3.2.1.4 or EC 3.2.1.6).
Bioactive polypeptides which can be used for the fusion according to the invention are antimicrobial and antifungal polypeptides. Examples of antimicrobial peptides (AMP's) are CAP 18, Leucocin A, Tritrpticin, Protegrin-1, Thanatin, Defensin, Lactoferrin, Lactoferricin, and Ovispirin such as Novispirin, Plectasins, and Statins, including the compounds and polypeptides disclosed in WO 03/044049 and WO 03/048148, as well as variants or fragments of the above that retain antimicrobial activity. Examples of antifungal polypeptides (AFP 's) are the Aspergillus giganteus, and Aspergillus niger peptides, as well as variants and fragments thereof which retain antifungal activity, as disclosed in WO 94/01459 and WO 02/090384.
Display on viable/live spores allows amplification of spore population in situ through the sporulation-germination-vegetative growth cycle. Therefore, such a spore system according to the invention allows a continuously deliver of fresh enzymes. It is a further advantage of such systems that the spores are resistant to difficult conditions of digestive tracts and that they are easy to produce and can be made at low costs.
In a preferred embodiment of the invention, the genetic modification is accomplished by transformation of a precursor cell using a vector containing the chimeric gene, using standard methods known to persons skilled in the art and then inducing the precursor cell to produce spores according to the invention. Further, the system may be constructed as such, that the gene construct may be under the control of one or more inducible promoter. The gene construct may have one or more enhancer elements or upstream activator sequences and the like associated with it. The gene construct may also comprise an inducible expression system. The inducible expression system is such that when said spore germinates into a vegetative cell, the active polypeptide or enzyme is not expressed unless exposed to an external stimulus e. g. pH.
If the spore system according to the invention expresses a feed enzyme on the spore surface, the spore germinates in the intestinal tract. More preferably the spore germinates in the duodenum and/or the jejunum of the intestinal tract.
In a further aspect of the invention the viable spore can be constructed as such that it displays a combination of both feed enzyme and bioactive polypeptide.
It is a further object of the invention to provide a composition comprising spores which express bioactive peptides and/or enzymes on their surface.
In a preferred embodiment of the invention, the composition comprises spores of the invention which express a feed enzyme as for example phytase (EC 3.1.3.8 or 3.1.3.26). Particular examples of compositions of the invention are the following: - an animal feed additive comprising (a) a spore expressing a feed enzyme according to the invention; and (b) at least one fat-soluble vitamin, (c) at least one water-soluble vitamin, (d) at least one trace mineral, and/or (e) at least one macro mineral; and - an animal feed composition having a crude protein content of 50 to 800 g/kg and comprising a spore expressing a feed enzyme according to the invention.
The so-called premixes are examples of animal feed additives of the invention. A premix designates a preferably uniform mixture of one or more micro-ingredients with diluent and/or carrier. Premixes are used to facilitate uniform dispersion of micro-ingredients in a larger mix.
The term animal includes all animals. Examples of animals are non-ruminants, and ruminants. Ruminant animals include, for example, animals such as sheep, goat, and cattle, e.g. cow such as beef cattle and dairy cows. In a particular embodiment, the animal is a non-ruminant animal. Non-ruminant animals include mono-gastric animals, e.g. pig or swine (including, but not limited to, piglets, growing pigs, and sows); poultry such as turkeys, ducks and chickens (including but not limited to broiler chicks, layers); fish (including but not limited to salmon, trout, tilapia, catfish and carp); and crustaceans (including but not limited to shrimp and prawn).
The term feed or feed composition means any compound, preparation, mixture, or composition suitable for, or intended for intake by an animal.
Further, optional, feed-additive ingredients are colouring agents, e.g. carotenoids such as beta-carotene, astaxanthin, and lutein; aroma compounds; stabilisers; antimicrobial peptides; polyunsaturated fatty acids and/or reactive oxygen generating species.
In a particular embodiment, the animal feed additive of the invention is intended for being included (or prescribed as having to be included) in animal diets or feed at levels of 0.01 to 10.0%; more particularly 0.05 to 5.0%; or 0.2 to 1.0% (% meaning g additive per 100 g feed). This is so in particular for premixes.
Animal feed compositions or diets have a relatively high content of protein. Poultry and pig diets can be characterised as indicated in Table B of WO 01/58275, columns 2-3. Fish diets can be characterised as indicated in column 4 of this Table B. Furthermore such fish diets usually have a crude fat content of 200-310 g/kg. WO 01/58275 corresponds to US 09/779334 which is hereby incorporated by reference.
An animal feed composition according to the invention has a crude protein content of 50- 800 g/kg, and furthermore comprises at least one spore strain as described and/or claimed herein.
Furthermore, or as an alternative to the crude protein content indicated above, the animal feed composition of the invention has a content of metabolisable energy of 10-30 MJ/kg; and/or a content of calcium of 0.1-200 g/kg; and/or a content of available phosphorus of 0.1-200 g/kg; and/or a content of methionine of 0.1-100 g/kg; and/or a content of methionine plus cysteine of 0.1 - 150 g/kg; and/or a content of lysine of 0.5-50 g/kg.
In particular embodiments, the content of metabolisable energy, crude protein, calcium, phosphorus, methionine, methionine plus cysteine, and/or lysine is within any one of ranges 2, 3, 4 or 5 in Table B of WO 01/58275 (R. 2-5).
Crude protein is calculated as nitrogen (N) multiplied by a factor 6.25, i.e. Crude protein (g/kg)= N (g/kg) x 6.25. The nitrogen content is determined by the Kjeldahl method
(A. O. A. C, 1984, Official Methods of Analysis 14th ed., Association of Official Analytical Chemists, Washington DC).
Metabolisable energy can be calculated on the basis of the NRC publication Nutrient requirements in swine, ninth revised edition 1988, subcommittee on swine nutrition, committee on animal nutrition, board of agriculture, national research council. National Academy Press, Washington, D. C, pp. 2-6, and the European Table of Energy Values for Poultry Feed-stuffs, Spelderholt centre for poultry research and extension, 7361 DA Beekbergen, The Netherlands. Grafisch bedrijf Ponsen & looijen bv, Wageningen. ISBN 90-71463-12-5.
The dietary content of calcium, available phosphorus and amino acids in complete animal diets is calculated on the basis of feed tables such as Veevoedertabel 1997, gegevens over chemische samenstelling, verteerbaarheid en voederwaarde van voedermiddelen, Central Veevoederbureau, Runderweg 6, 8219 pk Lelystad. ISBN 90-72839-13-7.
In a particular embodiment, the animal feed composition of the invention contains at least one vegetable protein or protein source. It may also contain animal protein, such as Meat and Bone Meal, and/or Fish Meal, typically in an amount of 0-25%. The term vegetable proteins as used herein refers to any compound, composition, preparation or mixture that includes at least one protein derived from or originating from a vegetable, including modified proteins and protein-derivatives. In particular embodiments, the protein content of the vegetable proteins is at least 10, 20, 30, 40, 50, or 60% (w/w).
Vegetable proteins may be derived from vegetable protein sources, such as legumes and cereals, for example materials from plants of the families Fabaceae (Leguminosae), Cruciferaceae, Chenopodiaceae, and Poaceae, such as soy bean meal, lupin meal and rapeseed meal.
In a particular embodiment, the vegetable protein source is material from one or more plants of the family Fabaceae, e.g. soybean, lupine, pea, or bean. In another particular embodiment, the vegetable protein source is material from one or more plants of the family Chenopodiaceae, e.g. beet, sugar beet, spinach or quinoa.
Other examples of vegetable protein sources are rapeseed, sunflower seed, cotton seed, cabbage and cereals such as barley, wheat, rye, oat, maize (corn), rice, triticale, and sorghum.
In still further particular embodiments, the animal feed composition of the invention contains 0-80% maize; and/or 0-80% sorghum; and/or 0-70% wheat; and/or 0-70% Barley; and/or 0-30% oats; and/or 0-30% rye; and/or 0-40% soybean meal; and/or 0-25% fish meal; and/or 0-25% meat and bone meal; and/or 0-20% whey.
Animal diets can e.g. be manufactured as mash feed (non pelleted) or pelleted feed.
Typically, the milled feed-stuffs are mixed and sufficient amounts of essential vitamins and minerals are added according to the specifications for the species in question. The spore strain can be added as solid or liquid formulation. It is at present contemplated that the Bacillus strain is administered in one or more of the following amounts (dosage ranges): 10 E2-14, 10 E4-12, 10 E6-10, 10 E7-9, preferably 10 E8 CFU/g of feed (the designation E meaning exponent, viz., e.g., 10 E2-14 means 102-1014).
It is further an object of the invention to provide a viable or inert spore, wherein said spore is genetically modified with a genetic code comprising at least one genetic construct encoding an enzymatically active enzyme, a bioactive polypeptide, an affinity ligand or a immobilized protein as specified herein above and a genetic construct encoding a amino acid sequence of a spore-specific surface-enzyme. According to a further aspect, the present invention provides B.subtilis strains transformed according to the inventions as defined above. B.subtilis strains are SD39, SD48, SD50; SD60, SD 130, SD 140 and SD 150 which derive form B.subtilis parent strain deposited under Bacillus Genetic Stock Center 1 AlAl.
The present invention will now be illustrated in more detail by the following examples, which are not meant to limit the scope of the invention. These examples are described with reference to the drawing. In the drawing
Figure 1 shows a map of the B. subtilis vector pDG364,
Figures 2 and 3 show intensity histograms of strains engineered according to example 5 and 6 compared to the wild type strains, and
Figures 4 to 6 show specific enzyme activities of strains engineered according to example 7, 8 or 9 compared to the wild type strains.
Applicant describes in the examples below the construction of a system aimed at the display of an enzymatic activity on the spore surface. Applicant has used the entire wild- type CotG protein as carrier and fused it, in frame, at the carboxyl-terminus end, with the gene encoding the phosphatase activity (Example 1). Significant phosphatase activity was found associated with engineered purified spore compared to non-engineered spores (Example 7). Equivalent constructions (translational C-terminus fusion to CotG), which have been designed to display phytase activity at the spore surface (B. subtilis endogenous phy activity) (Example 2), have also demonstrated specific enzymatic activity (Example 8). Instead of translational fusions to spore structural genes, passenger bioactive molecules (enzymes, bacteriocins, affinity ligands), can also be fused to spore-specific enzymes like oxdD or cotQ. Such a design is described in examples 3, where the phy gene is fused to the carboxyl-terminus of the oxalate decarboxylase encoded by oxdD (example 3) or in example 4 where the uidA gene encoding β-glucuronidase is fused to the carboxyl-terminal of oxdD . Specific display and corresponding enzymatic activities have been observed (examples 6 and 9 for oxdD-uidA). Display was also specifically demonstrated for cotG- phy and oxdD-phy fusions (example 5). Other example could use other enzyme-encoding genes like cotQ (encoding a reticuline oxidase-like protein) or cotA (encoding a laccase) as carriers. The main advantage of passenger fusions to carrier enzymes resides in the easy detection of the engineered fusion proteins, by straight- forward assaying the carrier enzymatic activity to demonstrate display, instead of time-consuming immuno-detection experiments that also requires expensive specific equipment. Another advantage of the enzymes can possibly be their easier amenability to overexpression than structural protein where stoiechiometric unbalance could lead to fragile spores.
EXAMPLES
General Methodology
In the first paragraphs the general methodology is summarized:
Strains and plasmids. Bacillus subtilis strains of the present invention are derived from strain 1 A747 {Bacillus Genetic Stock Center, The Ohio State University, Columbus, Ohio 43210 USA), which is a prototrophic derivative of B. subtilis 168 (trpC2) (GenBank AL009126). The chloramphenicol-resistance gene (cat) cassette was obtained from plasmid pC194 (GeneBank M19465, Cat# IEM Bacillus Genetic Stock Center, The Ohio State University, Columbus, Ohio 43210 USA). Plasmid for integration Cassette for LFH-PCR
Media. Standard minimal medium (MM) for B. subtilis contains IX Spizizen salts, 0.04% sodium glutamate, and 0.5% glucose. Standard solid complete medium is Tryptone Blood Agar Broth (TBAB, Difco). Standard liquid complete medium is Veal Infusion- Yeast Extract broth (VY). The compositions of these media are described below: TBAB medium: 33g Difco Tryptone Blood Agar Base (Catalog # 0232), 1 L water. Autoclave.
VY medium: 25g Difco Veal Infusion Broth (Catalog # 0344), 5g Difco Yeast Extract (Catalog #0127), IL water. Autoclave.
Minimal Medium (MM): 100ml 1OX Spizizen salts; 10 ml 50% glucose; 1 ml 40% sodium glutamate, qsp 1 L water. IPX Spizizen salts: 14Og K2HPO4; 2Og (NH4)2SO4; 6Og KH2PO4; 1 Og Na3 citrate.2H2O; 2g MgSO4.7H2O; qsp IL with water.
IPX VFB minimal medium ClOX VFB MM): 2.5g Na-glutamate; 15.7g KH2PO4; 15.7g K2HPO4; 27.4 g Na2HPO4.12H2O; 4Og NH4Cl; 1 g citric acid; 68 g (NH4)2SO4; qsp 1 L water. Trace elements solution: 1.4g MnSO4 H2O; 0.4g CoCl2-OH2O; 0.15g (NH4)6Mo7O24-4H2O; 0. Ig AlCl3-OH2O; 0.075g CuCl2-2H2O; qsp 200 ml water. Fe solution: 0.2 Ig FeSO4.7H2O; qsp 10 ml water. CaCl7 solution: 15.6g CaCl2.2H2O; qsp 500 ml water. Mg/Zn solution: lOOg MgSO4JH2O; 0.4g ZnSO4JH2O; qsp 200 ml water. VFB MM medium: 100 ml 1OX VFB MM; 10 ml 50% glucose; 2 ml Trace elements solution; 2 ml Fe solution; 2 ml CaCl2 solution; 2 ml Mg/Zn solution; 882 ml sterile distilled water.
Schaeffer sporulating medium: Bacto-nutrient broth 8 g; 10 ml 10% (w/v) KCl; 10 ml 1.2% (w/v) MgSO4JH2O; 0.5 ml IM NaOH; qsp 1 L. Add 1 ml IM Ca(NO3)4; 1 ml 0.01 MnCl2; 1 ml ImM FeSO4.
Molecular and genetic techniques. Standard genetic and molecular biology techniques are generally known in the art and have been previously described. DNA transformation, and other standard B. subtilis genetic techniques are also generally known in the art and have been described previously (Harwood and Cutting, 1992).
Spore purification. Following incubation at 370C for 24h, cultures were centrifuged at 7000 rpm for 10 min. After careful removal of the supernatant, pellets were re-suspended into cold H2O and left 48h at 40C to allow lysis of the remaining vegetative cells. The spores were then collected by another centrifugation of 10 min at 7000 rpm and re- suspended into 1 ml of 20% Gastrograffin (Schering). This solution was layered on top of 25 ml of 50% Gastrograffin and centrifuge for 20 min at 7000 rpm at 40C. After careful removal of the layers of the Gastrograffin gradient, the pellet contains free spores. The pellets were subsequently washed twice in cold water to eliminate trace of Gastrograffin. Purified spores were re-suspended in cold water and kept frozen at -8O0C when needed.
Immunofluorescence detection. Custom anti-phytase rabbit-IgG (Eurogentec) was generated by immunizing rabbits with a mix of 2 synthetic phytase-specific peptides CAEPGGGSKGQVVDRA and CHKQVNPRKLKDRSDG) and used as primary antibody (AbI). Goat anti rabbit-IgG coupled with FITC (Eurogentec) was used as secondary antibody (Ab2). Pictures are taken with Visitron Coolsnap camera and analysed with Metamorph software (Molecular Devices GmbH).
Practically, 2OuL of spore suspensions were resuspended in 50OuL PBS (no trypsin treatment) or in 40OuL PBS + lOOuL Trypsin 0.5% solution (Amimed, Trypsin-EDTA PBS 0.5% 5-51 KOO-H), for a 0.1 % final concentration (trypsin treatment was used to demonstrate specificity of display). Incubation was performed at 37°C for Ih with gentle agitation. Spores were then washed with 50OuL PBS-BSA 2% (3 times, 5min, 8000rpm), then incubated on ice for 30min (blocking) in 50OuL PBS-BSA 2%. 2uL AbI (1 : 1000) were added to the 50OuL suspensions, and incubated o/n, 40C, on a rotating tube holder. The next day, spores were washed 3 times with 50OuL PBS-BSA2% 5min, 8000rpm and resuspended in 50OuL. 2uL Ab2 (1 : 1000) were then added to the 50OuL, for 1 hour at RT, on a rotating tube holder (protected form light). Spores were finally washed in 50OuL PBS alone (4 times, 5min, 8000rpm). Spores were then resuspended in 3OuL PBS and 3uL were mounted on a 2% agar layer slide, for microscopic observations (lens xlOO). Pictures were taken for white light (brightfield) and for green fluorescence (Ex=490nm, Em=520nm). Exposure time was 2100ms for the fluorescent pictures. The green background was reduced (scale = 50% low) on an identical way for all fluorescent pictures. The fluorescence signal was assessed by measuring the pixel intensity using Metamorph 7.1.0.0 software (Molecular Devices GmbH).
Fluorescent detection of β-glucuronidase. In situ detection of β-glucuronidase activity was performed using a fluorogenic substrate ImaGene Green C 12FDGIcU (Molecular Probes). This substrate was used on purified spores according to the indications of the manufacturer (Molecular Probes). Absorption and emission of the reaction product were respectively 495 and 518 nm. The fluorescence signal was assessed by measuring the pixel intensity using Metamorph 7.1.0.0 software (Molecular Devices).
β-glucuronidase (GUS) assay. Spores or cultures were first re-suspended in 80OuL of Z buffer (6OmM Na2HPO4.7H20, 4OmM NaH2PO4, 1OmM KCl, ImM MgSO4.7H2O, 5OmM β-mercaptoethanol, pH7). Solutions were then equilibrated 3min at 3O0C before addition of 20OuL of pNPG (p-nitrophenyl-β-D-glucuronide 4mg/ml). Incubation was performed at 30°C until development of a yellow color. Reaction was then stopped with 50OuL Na2CO3 (IM), while reaction time (T) was recorded. Samples were then centrifuged for 3min at 14000rpm, and spectrophotometer measurement of the supernatants was performed at 420nm. β-glucuronidase activity (Miller Units) was defined as (1000 x AbS420) / T(min) x Abs spOres x V(ml) . Act = in Miller unit / ml spore suspension; V=ImI (0.02ml (spore suspension).
alkaline phosphatase assay. Based on the method described by Bessey, Lowry and Brock. (1967), B. subtilis alkaline phosphatase activity was colorimetrically measured using pNPP as substrate (para-nitrophenol phosphate, Fluka 71768). Specific conditions were an optimal pH at 9-10 and requirements for Mg and Zn. Measurements were made at 405 nm after incubation at 370C. Activity unit were defined as amount of enzyme that catalyze the release of 1 micromole of para-nitrophenol per minute at 370C.
phytase assay. The assay was run at pH7.4 and 370C which are optimal for B. subtilis phytase. In a first reaction, inorganic orthophosphate was liberated from phytase activity. This reaction was stopped after 30min, before a second reaction was performed to measure the released Pi at 820 nm.
Activity assay: 300 μL f buffer B (Tris-HCl 10OmM pH 7.4, CaC12 ImM, sodium phytate 2mM pH 7.4) were pre-warmed at 370C for 5 min. 75 μL of sample to assay (or controls) were then added before incubation for 30min at 550C. Reaction was stopped by adding 375uL of TCA 15%. Samples underwent then a centrifugation HOOOrpm, 5min, in order to harvest the spores, which would interfere with the Abs820nm measurement (next step).
Photometric measurement of the released Pi (Alko method). 50 μL of the previous supernatants were diluted with water (total volume 50OuL). Then 50OuL of reagent C (1 vol. 10% ascorbic acid, 1 vol. 2.5% ammonium molybdate, 3 vol. IM H2SO4) were added. Incubation was performed at 50°C during 20min. Absorbance of cooled samples was then read at 820n and compared to a standard curve which was made by measuring the Pi of dilutions 1000, 2000 and 4000 of a 9OmM KH2PO4 solution. Abs820nm was read after 30min incubation, 37°C with 50OuL reagent C (added to 50OuL KH2PO4 dilutions).
EXAMPLE 1 - Construction of B. subtilis strain SD39 designed to display alkaline phosphatase activity
This example describes the construction of B. subtilis strain SD39 designed to display alkaline phosphatase (PhoA) activity at the spore surface through fusion with the spore structural protein CotG.
Construction of the gene fusions were started by independent PCR amplifications of carrier and passenger fragments, subsequently combined by overlapping PCR to generate the. translational fusions B. subtilis alkaline phosphatase (PhoA) was engineered without its signal peptide (1 to 41 AA). The absence of signal peptide is further denominated as"SPfree". First, the 549-bp long carrier fragment of cotG (including 455-bp upstream of the ATG) was amplified from B. subtilis 1 A747 chromosomal (wild type B. subtilis strain PY79) DNA in a 50 μl reaction volume containing 1 μl of 40 mM dNTP's, 5 μl of 1OX buffer and 0.75 μl PCR enzyme (Herculase, Stratagene), 0.1 ug of template and primers cotG/for/BamHI and cotG/rev listed in Table 1. The PCR reaction was performed for 30 cycles using an annealing temperature of 53°C. Then, the 1356-bp long passenger phoA fragment was amplified from B. subtilis 1A747 chromosomal DNA in a 50 μl reaction volume containing 1 μl of 40 mM dNTP's, 5 μl of 1OX buffer and 0.75 μl PCR enzyme (Herculase, Stratagene), 0.1 ug of template and primers cotG3'-alal5-phoA and phoA/rev/Hindlll listed in Table 1. The PCR reaction was performed for 30 cycles using an annealing temperature of 53°C.
Table 1. Primers used to generate a cotG-alal5-phoA translational fusion
Name Nucleotide sequence (5'>3') SEQ ID
NO: cotG/for/BamHI ATGCGGATCCCAGTGTCCCTAGCTCCGAG 1
cotG/rev TTTGTATTTCTTTTTGACTACCCAGC 2 cotG3'-alal5- AAGAATACTGGAAAGACGGCAATTGCTGGGTAGTCA 3 phoA AAAAGAAATACAAGCAGCAGCAGCAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCAGCAATGAAAAAAATG
AGTTTGTT phoA/rev/Hindffl ATGCAAGCTTTTAAGAAAGTGCTTCCTTATTTATTC 4
Underlined sequences were overlapping sequences Finally, assembly of the overlapping carrier and passenger fragments was made by a two- step PCR in which the first step used 0.1 μg of each purified overlapping fragments in a in a 50 μl reaction volume containing 1 μl of 40 mM dNTP's, 5 μl of 1OX buffer and 0.75 μl PCR enzyme (Herculase, Stratagene). PCR reaction was performed for 30 cycles using an annealing temperature of 53°C. The second step was performed with the same conditions using 1 μl of the first reaction and cotG/for/BamHI and phoA/rev/Hindlll as primers (Table 1).
The cotG-phoA translational fusion (Table 2) was then cloned between the BamWl and HinάlW sites into a B. subtilis suicide vector (pDG364; BGSC-46; Karmazyn-Campelli et al., 1989; Figure 1) for subsequent ectopic integration within the non-essential amyE locus.
Table 2. Sequence of the coG-(ala)l 5-phoA-S?free translational fusion (SEQ ID NO: 5 ). BamUl and HmdIII cloning sites are in bold underlined. cotG gene coding sequence is in bold, phy gene coding sequence is underlined. Spacer region is in upper case font.
GGATCCCAGTGTCCCTAGCTCCGAGAAAAAATCCAGAGACAATTTGTTTCTC ATCAAGGAAGGGTCTTTATACTCCGCATTTAAGTGAATCTCTCGCGCGCCGC GGAATGTTTTCGGCTGATAAAAGGAAATATGGTATGACTTCTTTTTGAAGTC TCTGATATGTGATCCCCGATAAGCGATATCAATATCCAGCCTTTTTTGATTT ACCTTCATCACAGCTGGCACCGGATCATCGTCCCATATATCCTTTTTTAATT CACGCAAGTCTTTTGGATGAACAAACAGCTGATAAAGCGGTAAATTGGATTG ATTCTTCATCCATAATCCTCCTTACAAATTTTAGGCTTTTATTTTTATAAGA TCTCAGCGGAACACTTATACACTTTTTAAAACCGCGCGTACTATGAGGGTAG TAAGGATCTTCATCCTTAACATATTTTTAAAAGGAGGATTTCAAATTGGGCC ACTATTCCCATTCTGACATCGAAGAAGCGGTGAAATCCGCAAAAAAAGAAGG TTTAAAGGATTATTTATACCAAGAGCCTCATGGAAAAAAACGCAGTCATAAA AAGTCGCACCGCACTCACAAAAAATCTCGCAGCCATAAAAAATCATACTGCT CTCACAAAAAATCTCGCAGTCACAAAAAATCATTCTGTTCTCACAAAAAATC TCGCAGCCACAAAAAATCATACTGCTCTCACAAGAAATCTCGCAGCCACAAA AAATCGTACCGTTCTCACAAAAAATCTCGCAGCTATAAAAAATCTTACCGTT CTTACAAAAAATCTCGTAGCTATAAAAAATCTTGCCGTTCTTACAAAAAATC TCGCAGCTACAAAAAGTCTTACTGTTCTCACAAGAAAAAATCTCGCAGCTAT AAGAAGTCATGCCGCACACACAAAAAATCTTATCGTTCCCATAAGAAATACT ACAAAAAACCGCACCACCACTGCGACGACTACAAAAGACACGATGATTATGA CAGCAAAAAAGAATACTGGAAAGACGGCAATTGCTGGGTAGTCAAAAAGAAA TACAAAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAATGA AAAAAATGAGTTTGTTTCAAAATATGAAATCAAAACTTCTGCCAATCGCCGC TGTTTCTGTCCTTACAGCTGGAATCTTTGCCGGAGCTGAGCTTCAGCAAACA GAAAAGGCCAGCGCCAAAAAACAAGACAAAGCTGAGATCAGAAATGTCATTG TGATGATAGGCGACGGCATGGGGACGCCTTACATAAGAGCCTACCGTTCCAT GAAAAATAACGGTGACACACCGAATAACCCGAAGTTAACAGAATTTGACCGG AACCTGACAGGCATGATGATGACGCATCCGGATGACCCTGACTATAATATTA CAGATTCAGCAGCAGCCGGAACAGCATTAGCGACAGGCGTTAAGACATATAA CAATGCAATTGGCGTCGATAAAAACGGAAAAAAAGTGAAATCTGTACTTGAA GAGGCCAAACAGCAAGGCAAGTCAACAGGGCTTGTCGCCACGTCTGAAATTA ACCACGCCACTCCAGCCGCATATGGCGCCCACAATGAATCACGGAAAAACAT GGACCAAATCGCCAACAGCTATATGGATGACAAGATAAAAGGCAAACATAAA ATAGACGTGCTGCTCGGCGGCGGAAAATCTTATTTTAACCGCAAGAACAGAA ACTTGACAAAGGAATTCAAACAAGCCGGCTACAGCTATGTGACAACTAAACA AGCATTGAAAAAAAATAAAGATCAGCAGGTGCTCGGGCTTTTCGCAGATGGA GGGCTTGCTAAAGCGCTCGACCGTGACAGTAAAACACCGTCTCTCAAAGACA TGACGGTTTCAGCAATTGATCGCCTGAACCAAAATAAAAAAGGATTTTTCTT GATGGTCGAAGGGAGCCAGATTGACTGGGCGGCCCATGACAATGATACAGTA GGAGCCATGAGCGAGGTTAAAGATTTTGAGCAGGCCTATAAAGCCGCGATTG AATTTGCGAAAAAAGACAAACATACACTTGTGATTGCAACTGCTGACCATAC AACCGGCGGCTTTACCATTGGCGCAAACGGGGAAAAGAATTGGCACGCAGAA CCGATTCTCTCCGCTAAGAAAACACCTGAATTCATGGCCAAAAAAATCAGTG AAGGCAAGCCGGTTAAAGATGTGCTCGCCCGCTATGCCAATCTGAAAGTCAC ATCTGAAGAAATCAAAAGCGTTGAAGCAGCTGCACAGGCTGACAAAAGCAAA GGGGCCTCCAAAGCCATCATCAAGATTTTTAATACCCGCTCCAACAGCGGAT GGACGAGTACCGATCATACCGGCGAAGAAGTACCGGTATACGCGTACGGCCC CGGAAAAGAAAAATTCCGCGGATTGATTAACAATACGGACCAGGCAAACATC ATATTTAAGATTTTAAAAACTGGAAAATAAAAGCTT
The resulting plasmid was named pSD16. Subsequent sequencing of the translational fusion revealed that the ala spacer was made only of 14 residues.
Following linearization with Xhol restriction endonuclease, plasmid pSD16 was transformed into strain PY79, resulting by double-crossover recombination at the nonessential amyE locus, to B. subtilis spore display strain SD39.
EXAMPLE 2 - Construction of B. subtilis train SD48 designed to display phytase activity
This example describes the construction of B. subtilis strain SD48 designed to display phytase (phy) activity at the spore surface through fusion with the spore structural protein CotG.
Table 3. Sequence of the cotG-(ala)! 5-phy-S? free translational fusion (SEQ ID NO: 6 ). BamHl and HmdIII cloning sites are in bold underlined. cotG gene coding sequence is in bold, phy gene coding sequence is underlined. Spacer region is in upper case font.
GGATCCCAGTGTCCCTAGCTCCGAGAAAAAATCCAGAGACAATTTGTTTCTCA
TCAAGGAAGGGTCTTTATACTCCGCATTTAAGTGAATCTCTCGCGCGCCGCGG AATGTTTTCGGCTGATAAAAGGAAATATGGTATGACTTCTTTTTGAAGTCTCT
GATATGTGATCCCCGATAAGCGATATCAATATCCAGCCTTTTTTGATTTACCT TCATCACAGCTGGCACCGGATCATCGTCCCATATATCCTTTTTTAATTCACGC AAGTCTTTTGGATGAACAAACAGCTGATAAAGCGGTAAATTGGATTGATTCTT CATCCATAATCCTCCTTACAAATTTTAGGCTTTTATTTTTATAAGATCTCAGC GGAACACTTATACACTTTTTAAAACCGCGCGTACTATGAGGGTAGTAAGGATC TTCATCCTTAACATATTTTTAAAAGGAGGATTTCAAATTGGGCCACTATTCCC ATTCTGACATCGAAGAAGCGGTGAAATCCGCAAAAAAAGAAGGTTTAAAGGAT TATTTATACCAAGAGCCTCATGGAAAAAAACGCAGTCATAAAAAGTCGCACCG CACTCACAAAAAATCTCGCAGCCATAAAAAATCATACTGCTCTCACAAAAAAT CTCGCAGTCACAAAAAATCATTCTGTTCTCACAAAAAATCTCGCAGCCACAAA AAATCATACTGCTCTCACAAGAAATCTCGCAGCCACAAAAAATCGTACCGTTC TCACAAAAAATCTCGCAGCTATAAAAAATCTTACCGTTCTTACAAAAAATCTC GTAGCTATAAAAAATCTTGCCGTTCTTACAAAAAATCTCGCAGCTACAAAAAG TCTTACTGTTCTCACAAGAAAAAATCTCGCAGCTATAAGAAGTCATGCCGCAC ACACAAAAAATCTTATCGTTCCCATAAGAAATACTACAAAAAACCGCACCACC ACTGCGACGACTACAAAAGACACGATGATTATGACAGCAAAAAAGAATACTGG AAAGACGGCAATTGCTGGGTAGTCAAAAAGAAATACAAAGCAGCAGCAGCAGC AGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGTGAATGAGGAACATCATTTCA AAGTGACTGCACACACGGAGACAGATCCGGTCGCATCTGGCGATGATGCAGCA GATGACCCGGCCATTTGGGTTCATGAAAAACACCCGGAAAAAAGCAAGTTGAT TACAACAAATAAGAAGTCAGGGCTCGTTGTGTATGATTTAGACGGAAAACAGC TTCATTCTTATGAGTTTGGCAAGCTCAATAATGTCGATCTGCGCTATGATTTT CCATTGAACGGCGAAAAAATTGATATTGCTGCCGCATCCAACCGGTCCGAAGG AAAAAATACAATTGAAGTATATGCAATAGACGGGGATAAAGGAAAATTGAAAA GCATTACAGATCCGAACCATCCTATTTCCACCAATATTTCTGAGGTTTATGGA TTCAGCTTGTATCACAGCCAGAAAACAGGAGCATTTTACGCATTAGTGACAGG CAAACAAGGGGAATTTGAGCAGTATGAAATTGTTGATGGTGGAAAGGGTTATG TAACAGGGAAAAAGGTGCGTGAATTTAAGTTGAATTCTCAGACCGAAGGCCTT GTTGCGGATGATGAGTACGGAAACCTATACATAGCAGAGGAAGATGAGGCCAT CTGGAAATTTAACGCTGAGCCCGGCGGAGGGTCAAAGGGGCAGGTTGTTGACC GTGCGACAGGAGATCATTTGACAGCTGATATTGAAGGACTGACAATCTATTAT GCACCAAATGGCAAAGGATATCTCATGGCTTCAAGTCAAGGAAATAACAGCTA TGCAATGTATGAACGGCAGGGGAAAAATCGCTATGTAGCCAACTTTGAGATTA CAGATGGCGAGAAGATAGACGGTACTAGTGACACGGATGGTATTGATGTTCTC GGTTTCGGACTTGGCCCAAAATATCCGTACGGGATTTTTGTGGCGCAGGACGG CGAAAATATTGATAACGGACAAGCCGTCAATCAAAATTTCAAAATTGTATCG TGGGAACAAATTGCACAGCATCTCGGCGAAATGCCTGATCTTCATAAACAGG TAAATCCGAGGAAGCTGAAAGACCGTTCTGACGGCTAGTAAAAGCTT
The cotG-alal 5-phy-S?free synthetic translational fusion was cloned between the BamHl and HmdIII sites into a B. subtilis suicide vector (pDG364; BGSC-46; Karmazyn-Campelli et al., 1989; Figure 1) for subsequent ectopic integration within the non-essential amyE locus. The resulting plasmid was named pSD21.
Following linearization withXhol restriction endonuclease, plasmid pSD21 was transformed into strain PY79, leading, by double-crossover recombination at the nonessential amyE locus, to B. subtilis spore display strain SD48.
EXAMPLE 3 - Construction of B. subtilis train SD50 designed to display phytase activity
This example describes the construction of B. subtilis strain SD50 designed to display endogenous phytase activity (phy) at the spore surface through fusion with the spore coat enzyme OxdD.
Table 4. Sequence of the oxdD-ala\0(Nheϊ)-phy synthetic translational fusion (SEQ ID NO: 7). BαmHl and Hzndlll cloning sites are in bold underlined. oxdD gene coding sequence is in bold, phy gene coding sequence is underlined. Spacer region is in lower case font. Nhel restriction site in the spacer is in lower case underlined fonts.
GGATCCCACAGGTGATGAAATGCCGGGTGGGGGACGCATGGAGGACCATATTT CCACCTTTGATTATATGCCTGAAGATGAAGTGATAGGTCATGATGTATTAGTA AAAGTGGAGTGGAGGACAGGCCAGAAAAAACAGACAGAAGCAATCAAATTACA TAAGAAGCCATGGTATAAAAAATAGTTTATTTGATGTATTTGTGATCACATTG GTGGTCACTTTTTTATTTGCGGATTCCTAGGCACAGCAATCTAAGATTCTGCA TAGGCTGAAATAAAATCTTGTTCATTTCTAAAACGAGGTGCATGCTGTTGGAA CAACAACCAATCAATCATGAAGACAGAAACGTGCCGCAGCCTATTCGAAGTGA TGGAGCTGGAGCTATTGATACAGGCCCGCGAAATATAATACGGGATATTCAAA ATCCGAATATATTTGTTCCGCCTGTTACAGATGAGGGTATGATTCCTAACTTG AGATTTTCATTCTCAGACGCTCCCATGAAATTAGATCACGGCGGCTGGTCAAG AGAAATCACCGTAAGACAGCTTCCGATTTCGACTGCGATTGCAGGTGTAAACA TGAGCTTAACTGCGGGAGGCGTCCGCGAGCTTCATTGGCATAAGCAAGCGGAG TGGGCTTATATGCTTTTGGGACGGGCACGTATCACCGCTGTTGACCAAGACGG ACGAAATTTCATTGCTGATGTTGGTCCCGGCGACCTTTGGTACTTCCCGGCAG GAATTCCGCATTCCATACAGGGATTGGAACACTGCGAGTTTCTGCTCGTTTTC GATGATGGGAACTTTTCTGAGTTTTCAACGTTAACCATTTCAGATTGGCTTGC ACACACACCAAAAGATGTTCTGTCTGCAAATTTCGGTGTCCCGGAGAATGCTT TCAACTCTCTTCCGTCTGAGCAAGTCTATATCTACCAAGGGAATGTGCCGGGA TCAGTCGCCAGTGAAGACATTCAGTCACCATATGGAAAAGTCCCCATGACCTT TAAACACGAGCTGTTAAATCAACCCCCAATTCAAATGCCAGGGGGGAGTGTAC GTTCAGATTGAGCCTGGCGCGATGAGAGAGCTTCATTGGCATCCCAATAGCGA TGAGTGGCAATATTATCTAACAGGACAGGGACGAATGACGGTATTTATCGGAA ATGGGACTGCCCGCACATTTGATTATAGAGCAGGCGACGTTGGATACGTGCCT TCTAATGCCGGACACTATATACAAAACACTGGTACAGAAACATTATGGTTTTT AGAAATGTTCAAAAGTAACCGCTATGCAGATGTGTCACTCAATCAGTGGATGG CATTGACGCCTAAAGAATTAGTACAAAGCAACTTGAATGCTGGATCAGTCATG CTTGATTCTCTGCGCAAGAAGAAAGTGCCTGTTGTGAAATATCCCGGTACGgc agcagcagcagctagcgcagcagcagcaGTGAATGAGGAACATCATTTCAAAG TGACTGCACACACGGAGACAGATCCGGTCGCATCTGGCGATGATGCAGCAGAT GACCCGGCCATTTGGGTTCATGAAAAACACCCGGAAAAAAGCAAGTTGATTAC AACAAATAAGAAGTCAGGGCTCGTTGTGTATGATTTAGACGGAAAACAGCTTC ATTCTTATGAGTTTGGCAAGCTCAATAATGTCGATCTGCGCTATGATTTTCCA TTGAACGGCGAAAAAATTGATATTGCTGCCGCATCCAACCGGTCCGAAGGAAA AAATACAATTGAAGTATATGCAATAGACGGGGATAAAGGAAAATTGAAAAGCA TTACAGATCCGAACCATCCTATTTCCACCAATATTTCTGAGGTTTATGGATTC AGCTTGTATCACAGCCAGAAAACAGGAGCATTTTACGCATTAGTGACAGGCAA ACAAGGGGAATTTGAGCAGTATGAAATTGTTGATGGTGGAAAGGGTTATGTAA CAGGGAAAAAGGTGCGTGAATTTAAGTTGAATTCTCAGACCGAAGGCCTTGTT GCGGATGATGAGTACGGAAACCTATACATAGCAGAGGAAGATGAGGCCATCTG GAAATTTAACGCTGAGCCCGGCGGAGGGTCAAAGGGGCAGGTTGTTGACCGTG CGACAGGAGATCATTTGACAGCTGATATTGAAGGACTGACAATCTATTATGCA CCAAATGGCAAAGGATATCTCATGGCTTCAAGTCAAGGAAATAACAGCTATGC AATGTATGAACGGCAGGGGAAAAATCGCTATGTAGCCAACTTTGAGATTACAG ATGGCGAGAAGATAGACGGTACTAGTGACACGGATGGTATTGATGTTCTCGGT TTCGGACTTGGCCCAAAATATCCGTACGGGATTTTTGTGGCGCAGGACGGCGA AAATATTGATAACGGACAAGCCGTCAATCAAAATTTCAAAATTGTATCGTGGG AACAAATTGCACAGCATCTCGGCGAAATGCCTGATCTTCATAAACAGGTAAAT CCGAGGAAGCTGAAAGACCGTTCTGACGGCTAGTAAAAGCTT The oxdD-a\a\0(Nhel)-phy synthetic translational fusion was then cloned between the BαmHl and Hinάlll sites into a B. subtilis suicide vector (pDG364; BGSC-46; Karmazyn- Campelli et al., 1989; Figure 1) for subsequent ectopic integration within the non-essential αmyE locus. The resulting plasmid was named pSD22.
Following linearization with Xho\ restriction endonuclease, plasmid pSD22 was transformed into strain PY79, leading, by double-crossover recombination at the nonessential αmyE locus, to B. subtilis spore display strain SD50.
EXAMPLE 4 - Construction of B. subtilis strain SD60 designed to display β- glucuronidase activity
This example describes the construction of B. subtilis strain SD60 designed to display β- glucuronidase (GUS encoded by uidA E. coli gene) activity at the spore surface through fusion with the spore enzyme protein OxdD.
Table 5. Sequence of the oxdD-a\a\0(Nheϊ)-uidA synthetic translational fusion (SEQ ID NO: 8). BαmRl and HmdIII cloning sites are in bold underlined. oxdD gene coding sequence is in bold. uidA gene coding sequence is underlined. Spacer region is in lower case font. Nhel restriction site in the spacer is in lower case underlined fonts.
GGATCCCACAGGTGATGAAATGCCGGGTGGGGGACGCATGGAGGACCATATTT CCACCTTTGATTATATGCCTGAAGATGAAGTGATAGGTCATGATGTATTAGTA AAAGTGGAGTGGAGGACAGGCCAGAAAAAACAGACAGAAGCAATCAAATTACA TAAGAAGCCATGGTATAAAAAATAGTTTATTTGATGTATTTGTGATCACATTG GTGGTCACTTTTTTATTTGCGGATTCCTAGGCACAGCAATCTAAGATTCTGCA TAGGCTGAAATAAAATCTTGTTCATTTCTAAAACGAGGTGCATGCTGTTGGAA CAACAACCAATCAATCATGAAGACAGAAACGTGCCGCAGCCTATTCGAAGTGA TGGAGCTGGAGCTATTGATACAGGCCCGCGAAATATAATACGGGATATTCAAA ATCCGAATATATTTGTTCCGCCTGTTACAGATGAGGGTATGATTCCTAACTTG AGATTTTCATTCTCAGACGCTCCCATGAAATTAGATCACGGCGGCTGGTCAAG AGAAATCACCGTAAGACAGCTTCCGATTTCGACTGCGATTGCAGGTGTAAACA TGAGCTTAACTGCGGGAGGCGTCCGCGAGCTTCATTGGCATAAGCAAGCGGAG TGGGCTTATATGCTTTTGGGACGGGCACGTATCACCGCTGTTGACCAAGACGG ACGAAATTTCATTGCTGATGTTGGTCCCGGCGACCTTTGGTACTTCCCGGCAG GAATTCCGCATTCCATACAGGGATTGGAACACTGCGAGTTTCTGCTCGTTTTC GATGATGGGAACTTTTCTGAGTTTTCAACGTTAACCATTTCAGATTGGCTTGC ACACACACCAAAAGATGTTCTGTCTGCAiVATTTCGGTGTCCCGGAGAATGCTT TCAACTCTCTTCCGTCTGAGCAAGTCTATATCTACCAAGGGAATGTGCCGGGA TCAGTCGCCAGTGAAGACATTCAGTCACCATATGGAAAAGTCCCCATGACCTT TAAACACGAGCTGTTAAATCAACCCCCAATTCAAATGCCAGGGGGGAGTGTAC GAATTGTGGATTCTTCTAACTTCCCAATTTCAAAAACGATAGCCGCTGCACTT GTTCAGATTGAGCCTGGCGCGATGAGAGAGCTTCATTGGCATCCCAATAGCGA TGAGTGGCAATATTATCTAACAGGACAGGGACGAATGACGGTATTTATCGGAA ATGGGACTGCCCGCACATTTGATTATAGAGCAGGCGACGTTGGATACGTGCCT TCTAATGCCGGACACTATATACAAAACACTGGTACAGAAACATTATGGTTTTT AGAAATGTTCAAAAGTAACCGCTATGCAGATGTGTCACTCAATCAGTGGATGG CATTGACGCCTAAAGAATTAGTACAAAGCAACTTGAATGCTGGATCAGTCATG CTTGATTCTCTGCGCAAGAAGAAAGTGCCTGTTGTGAAATATCCCGGTACGgc agcagcagctagcgcagcagcagcagcaATGTTACGTCCTGTAGAAACCCCAA CCCGTGAAATCAAAAAACTCGACGGCCTGTGGGCATTCAGTCTGGATCGCGAA AACTGTGGAATTGATCAGCGTTGGTGGGAAAGCGCGTTACAAGAAAGCCGGGC AATTGCTGTGCCAGGCAGTTTTAACGATCAGTTCGCCGATGCAGATATTCGTA ATTATGCGGGCAACGTCTGGTATCAGCGCGAAGTCTTTATACCGAAAGGTTGG GCAGGCCAGCGTATCGTGCTGCGTTTCGATGCGGTCACTCATTACGGCAAAGT GTGGGTCAATAATCAGGAAGTGATGGAGCATCAGGGCGGCTATACGCCATTTG AAGCCGATGTCACGCCGTATGTTATTGCCGGGAAAAGTGTACGTATCACCGTT TGTGTGAACAACGAACTGAACTGGCAGACTATCCCGCCGGGAATGGTGATTAC CGACGAAAACGGCAAGAAAAAGCAGTCTTACTTCCATGATTTCTTTAACTATG CCGGGATCCATCGCAGCGTAATGCTCTACACCACGCCGAACACCTGGGTGGAC GATATCACCGTGGTGACGCATGTCGCGCAAGACTGTAACCACGCGTCTGTTGA CTGGCAGGTGGTGGCCAATGGTGATGTCAGCGTTGAACTGCGTGATGCGGATC AACAGGTGGTTGCAACTGGACAAGGCACTAGCGGGACTTTGCAAGTGGTGAAT CCGCACCTCTGGCAACCGGGTGAAGGTTATCTCTATGAACTGTGCGTCACAGC CAAAAGCCAGACAGAGTGTGATATCTACCCGCTTCGCGTCGGCATCCGGTCAG TGGCAGTGAAGGGCGAACAGTTCCTGATTAACCACAAACCGTTCTACTTTACT GGCTTTGGTCGTCATGAAGATGCGGACTTGCGTGGCAAAGGATTCGATAACGT GCTGATGGTGCACGACCACGCATTAATGGACTGGATTGGGGCCAACTCCTACC GTACCTCGCATTACCCTTACGCTGAAGAGATGCTCGACTGGGCAGATGAACAT GGCATCGTGGTGATTGATGAAACTGCTGCTGTCGGCTTTAACCTCTCTTTAGG CATTGGTTTCGAAGCGGGCAACAAGCCGAAAGAACTGTACAGCGAAGAGGCAG TCAACGGGGAAACTCAGCAAGCGCACTTACAGGCGATTAAAGAGCTGATAGCG CGTGACAAAAACCACCCAAGCGTGGTGATGTGGAGTATTGCCAACGAACCGGA TACCCGTCCGCAAGGTGCACGGGAATATTTCGCGCCACTGGCGGAAGCAACGC GTAAACTCGACCCGACGCGTCCGATCACCTGCGTCAATGTAATGTTCTGCGAC GCTCACACCGATACCATCAGCGATCTCTTTGATGTGCTGTGCCTGAACCGTTA TTACGGATGGTATGTCCAAAGCGGCGATTTGGAAACGGCAGAGAAGGTACTGG AAAAAGAACTTCTGGCCTGGCAGGAGAAACTGCATCAGCCGATTATCATCACC GAATACGGCGTGGATACGTTAGCCGGGCTGCACTCAATGTACACCGACATGTG GAGTGAAGAGTATCAGTGTGCATGGCTGGATATGTATCACCGCGTCTTTGATC GCGTCAGCGCCGTCGTCGGTGAACAGGTATGGAATTTCGCCGATTTTGCGACC TCGCAAGGCATATTGCGCGTTGGCGGTAACAAGAAAGGGATCTTCACTCGCGA CCGCAAACCGAAGTCGGCGGCTTTTCTGCTGCAAAAACGCTGGACTGGCATGA ACTTCGGTGAAAAACCGCAGCAGGGAGGCAAACAATGAtaaAAGCTT
After PCR amplification the uidA gene was inserted between Nhel and HmdIII sites of vector pSD22 at the 3 '-end of the oxdD open reading frame, generating a oxdD-a\a\0-uidΛ translational fusion for subsequent ectopic integration within the non-essential αmyE locus. The resulting plasmid was named pSD27.
Following linearization with Xhol restriction endonuclease, plasmid pSD27 was transformed into strain PY79, leading, by double-crossover recombination at the nonessential αmyE locus, to B. subtilis spore display strain SD60.
EXAMPLE 5 - Specific display of phytase enzyme associated to spores surface using two kinds of carriers.
This example demonstrates that phytase enzyme is specifically displayed at the spore surface of cσtG-engineered strain SD48 and oxJZ)-engineered strain SD50.
Using the immuno-detection procedure described in the general methodology section, phytase-specific higher fluorescence intensity was observed for spores of strains SD48 and SD50, than with PY79 spores (Fig. 2). Fluorescence signals of these two strains dropped significantly when the spores underwent a trypsin digestion of the displayed fusions.
Fig. 2: Fluorescence intensity histograms of strain SD48 and SD50 compared to wild type strain PY79. Empty bars represent fluorescence of spores that have not undergone trypsin treatment. Black bars represent fluorescence activities of spore treated with protease. The fluorescence signal is an average of the pixel intensity in spores, measured by Metamorph software. SD48 contains a cotG-(αlα) 15-p/?y-SPfree translational fusion; SD50 contains a oxdD-a\a\ 0(Nhel)-phy-S? free translational fusion. In conclusion, immuno-detection by microscopy demonstrated evidence that two kinds of carriers can successfully display B.subtilis phytase at the spore surface, coat structural proteins (like CotG) and but also spore associated enzymes, like OxdD.
EXAMPLE 6 - Display of β-glucuronidase associated to spores from oxdD- engineered strain SD60.
This example demonstrates that β-glucuronidase enzyme is associated with spores from αxJD-engineered strain SD60 and displayed at its surface.
A different technology based on specific modification of the fluorogenic substrate ImaGene Green C 12FDGIcU (Molecular Probes) has been used in this experiment to demonstrate the display of an active enzyme using spore specific enzyme carrier OxdD (Fig. 3).
Fig. 3: Fluorescence intensity histograms of strain SD60 compared to wild type strain PY79. Empty bars represent fluorescence of spores that have not undergone trypsin treatment. Black bars represent fluorescence activities of spore treated with protease. The fluorescence signal is an average of the pixel intensity in spores, measured by Metamorph software. SD60 contains a oxdD-a\a\0-uidA translational fusion.
In conclusion, trypsin treatment demonstrated the specific display of the β-glucuronidase at the spore surface using a spore associated enzyme, like OxdD, as carrier.
EXAMPLE 7 - Phosphatase activity associated to spores from cofG-engineered strain SD39.
This example demonstrates that phosphatase enzymatic activity is associated with spores from cctfG-engineered strain SD39.
Alkaline phospahatase enzymatic activity was measured on pure spore engineered to display the passenger enzyme with the core structural protein CotG (Fig. 4).
Fig. 4: Alkaline phosphatase activity associated to SD39 pure spore solution using colorimetric assay. Control strain was wild type strain PY79. Activities are in mUnits. EXAMPLE 8 - Phytase activity associated to spores from cørt7-engineered strain SD48
This example demonstrates that phytase enzymatic activity is associated with spores from co?G-engineered strain SD48 (Fig. 5).
Fig. 5: Phytase phosphatase activity associated to SD48 pure spore solution using colorimetric assay. Control strain was wild type strain PY79. Specific activities are in Units/ Optical Density 580nm.
EXAMPLE 9 - β-glucuronidase activity associated to spores from αxdD-engineered strain SD60.
This example demonstrates that β-glucuronidase enzymatic activity is associated with spores from <m/Z)-engineered strain SD60 and specifically displayed at its surface.
Based on classical colorimetric assay using pNPG as substrate (reading at 420 nm), β- glucuronidase activity was assessed in triplicate on SD60 pure spores prepared as described earlier (Fig. 6). Heat treatment was performed to denature enzymes and demonstrate specificity of the reported activity.
Fig. 6: β-glucuronidase activity of SD60 pure spore using colorimetric assay based on pNPG. Strain SD60 was tested in triplicates a, b, c. Empty bars represent enzymatic activity on pure spores. Black bars represent activities of pure spores heated during 15 min at 6O0C before performing the colorimetric enzymatic assay. SD60 contains an oxdD-a\a\0- uidA translational fusion. Control strain was wild type strain PY79. Activities are in Miller units.
In conclusion, this example demonstrates specific reporter enzymatic activity at the spore surface of a strain engineered to display enzyme through translational fusion to spore associated enzymes.
EXAMPLE 10 - Display of affinity ligands
Display of affinity ligands at the spore surface in order to capture biomolecules is described in this example. The Aspergillus niger pex5 gene encodes for a protein which is recognizing specifically PTS-I motifs [e.g. SKL (serine-lysine-leucine) motifs or PRL (proline-arginine-leucine)]. The PTS-I motif can be engineered at the carboxyl-terminal of protein for specific tagging and subsequent capture of the tagged protein. This example describes the construction of B. subtilis strain SDl 30 designed to display Λ. niger Pex5 PTS-1-affϊne protein at the spore surface through fusion with the spore coat protein CotC.
Table 6: Sequence of the cotC-a\a\0-pex5 translational fusion (SEQ ID NO: 9). BαmHl and HmdIII cloning sites are in bold underlined. cotC gene coding sequence is in bold. pex5 gene coding sequence is underlined. Spacer region is in lower case font.
GGATCCTTATTTTGTTTGTGGGTTTTTTAGTATTTGGGCCTGATAAACTGCC GGCGCTTGGCCGTGCAGCAGGAAAAGCCTTATCAGAATTTAAACAAGCAACA AGCGGACTGACTCAGGATATCAGAAAAAATGACTCAGAAAACAAAGAAGACA AACAAATGTAGGATAAATCGTTTGGGCCGATGAAAAATCGGCTCTTTATTTT GATTTGTTTTTGTGTCATCTGTCTTTTTCTATCATTTGGACAGCCCTTTTTT CCTTCTATGATTTTAACTGTCCAAGCCGCAAAATCTACTCGCCGTATAATAA AGCGTAGTAAAAATAAAGGAGGAGTATATATGGGTTATTACAAAAAATACAA AGAAGAGTATTATACGGTCAAAAAAACGTATTATAAGAAGTATTACGAATAT GATAAAAAAGATTATGACTGTGATTACGACAAAAAATATGATGACTATGATA AAAAATATTATGATCACGATAAAAAAGACTATGATTATGTTGTAGAGTATAA AAAGCATAAAAAACACTACgcagcageageageagcagcagcageageaATG TCCTTCCTTGGTGGCGCCGAGTGCTCGACGGCGGGCAATCCGTTGACTCAGT TCACCAAGCACGTCCAAGATGATAAGTCCCTACAGAGAGATCGCCTCGTGGG GCGAGGCCCAGGAGGCATGCAAGAAGGCATGCGGTCCCGGGGTATGATGGGA GGACAAGATCAGATGATGGACGAATTCGCCCAACAACCCGGCCAGATCCCCG GTGCTCCCCCGCAACCGTTCGCTATGGAACAGCTGCGACGCGAGCTAGATCA GTTCCAAACCACACCTCCGAGGACGGGCTCCCCCGGCTGGGCGGCCGAGTTC GATGCGGGCGAGCATGCCCGGATGGAGGCTGCGTTTGCCGGGCCCCAGGGCC CCATGATGAATAATGCGTCGGGATTTACGCCCGCGGAGTTTGCCCGGTTCCA GCAGCAGAGTCGGGCTGGCATGCCTCAGACGGCTAACCATGTGGCGTCTGCC CCGTCGCCGATGATGGCTGGGTACCAGCGGCCCATGGGTATGGGAGGGTATA TGGGCATGGGTGGAATGGGGATGATGCCGCAGACATTTAACCCGATGGCGAT GCAGCAGCAGCCGGCAGAGGCGACTACGCAGGACAAGGGCAAGGGACGCATG GTGGAGCTGGACGACGAGAACTGGGAGGCACAGTTTGCCGAGATGGAGACGG CGGATACCCAGAAATTGGACGATGAGGCCAACGCAGCTGTGGAGGCAGAGCT GAATGATCTGGATAGGTCAGTCCCCCAAGATTCGGGCGATAGTGCCTTTGAA AGCGTGTGGCAACGGGTCCAAGCTGAGACCGCAACAAACAGGAAACTGGCCG AGGGCGAGACCGACTTTAACATTGACGACAATCTGCATATGGGTGAGATGGG CGAATGGGACGGATTCGATACGCTTAACACGCGCTTCCGGAACCCTCAACTA GGCGATTATATGTTCGAAGAAGATAACGTGTTCCGGAGCGTGAGCAATCCTT TCGAAGAGGGAGTGAAGATCATGCGCGAGGGTGGAAACCTCTCCCTGGCTGC CTTGGCTTTCGAGGCGGCAGTCCAGAAAGATCCTCAACATGTCCAGGCCTGG ACCATGCTGGGATCGGCTCAGGCGCAGAACGAGAAGGAGCTTCCCGCCATCA GAGCGCTGGAGCAGGCACTTAAGATTGATGCTAACAATCTGGATGCGCTGAT GGGACTGGCTGTTTCCTACACCAACGAGGGCTATGACTCGACATCGTACCGC ACTTTGGAGCGTTGGCTGTCAGTCAAGTACCCCCAGATTATCAACCCTAATG ATGTTTCATCGGAAGCCGACTTGGGCTTTACGGACCGCCAGCTCCTGCACGA CCGTGTCACCGATCTCTTCATCCAGGCTGCTCAGCTGTCGCCATCTGGCGAG CAAATGGACCCGGACGTCCAGGTCGGTCTTGGCGTTCTCTTCTACTGCGCAG AGGAGTATGACAAGGCGGTCGATTGCTTCTCTGCTGCGTTGGCGTCCACGGA ATCCGGAACGTCGAACCAACAGGAGCAGCTCCACCTGCTGTGGAACCGTCTG GGTGCTACGCTTGCCAACTCGGGTCGCTCCGAGGAGGCGATCGAGGCCTACG AGCAGGCGCTGAACATCAATCCCAACTTCGTCCGGGCACGGTACAACCTGGG TGTGTCGTGCATCAACATCGGCTGCTACCCAGAAGCCGCGCAACACCTGCTG GGAGCGCTATCGATGCACCGGGTGGTTGAGCAGGAAGGTCGAGAGCGGGCAC GTGAGATTGTTGGGGGCGAGGGTGGCATTGACGACGAGCAGCTGGATCGCAT GATTCATGTCAGCCAGAATCAGAGTACCAACCTGTACGACACGTTGCGGCGA GTATTTAGCCAGATGGGACGACGCGATCTGGCTGATCAGGTGGTGGCGGGGA TGGATGTCAATGTGTTCCGACGGGAGTTTGAGTTCTAATAAAAGCTT
The cotC-a\a\0-pex5 translational fusion was then cloned between the BαmRl and HmdIII sites into a B. subtilis suicide vector (pDG364; BGSC-46; Karmazyn-Campelli et al., 1989; Figure 1) for subsequent ectopic integration within the non-essential αmyE locus. The resulting plasmid was named pSD130.
Following linearization with Xho\ restriction endonuclease, plasmid pSD130 was transformed into B. subtilis wild typre strain PY79, generating, by double-crossover recombination at the non-essential αmyE locus, B. subtilis spore display strain SDl 30.
EXAMPLE 11 - Construction of B. subtilis strain SD140 designed to display /!, niger PTS-1-affine Pex5 protein
This example describes the construction of B, subtilis strain SD140 designed to display A niger PTS-I -affϊne pex5 protein at the spore surface through fusion with the spore coat enzyme OxdD.
Table 7: Sequence of the oxdD-a\a\0(Nheϊ)-pex5 synthetic translational fusion (SEQ ID NO: 10). BαmHl and Hindlll cloning sites are in bold underlined. oxdD gene coding sequence is in bold. pex5 gene coding sequence is underlined. Spacer region is in lower case font. Nhel restriction site in the spacer is in lower case underlined fonts.
GGATCCCACAGGTGATGAAATGCCGGGTGGGGGACGCATGGAGGACCATATTT CCACCTTTGATTATATGCCTGAAGATGAAGTGATAGGTCATGATGTATTAGTA AAAGTGGAGTGGAGGACAGGCCAGAAAAAACAGACAGAAGCAATCAAATTACA TAAGAAGCCATGGTATAAAAAATAGTTTATTTGATGTATTTGTGATCACATTG GTGGTCACTTTTTTATTTGCGGATTCCTAGGCACAGCAATCTAAGATTCTGCA TAGGCTGAAATAAAATCTTGTTCATTTCTAAAACGAGGTGCATGCTGTTGGAA CAACAACCAATCAATCATGAAGACAGAAACGTGCCGCAGCCTATTCGAAGTGA TGGAGCTGGAGCTATTGATACAGGCCCGCGAAATATAATACGGGATATTCAAA ATCCGAATATATTTGTTCCGCCTGTTACAGATGAGGGTATGATTCCTAACTTG AGATTTTCATTCTCAGACGCTCCCATGAAATTAGATCACGGCGGCTGGTCAAG AGAAATCACCGTAAGACAGCTTCCGATTTCGACTGCGATTGCAGGTGTAAACA TGAGCTTAACTGCGGGAGGCGTCCGCGAGCTTCATTGGCATAAGCAAGCGGAG TGGGCTTATATGCTTTTGGGACGGGCACGTATCACCGCTGTTGACCAAGACGG ACGAAATTTCATTGCTGATGTTGGTCCCGGCGACCTTTGGTACTTCCCGGCAG GAATTCCGC-ATTCCΛTACAGGGATTGGAACACTGCGAGTTTCTGCTCGTTTTC GATGATGGGAACTTTTCTGAGTTTTCAACGTTAACCATTTCAGATTGGCTTGC ACACACACCAAAAGATGTTCTGTCTGCAAATTTCGGTGTCCCGGAGAATGCTT TCAACTCTCTTCCGTCTGAGCAAGTCTATATCTACCAAGGGAATGTGCCGGGA TCAGTCGCCAGTGAAGACATTCAGTCACCATATGGAAAAGTCCCCATGACCTT TAAACACGAGCTGTTAAATCAACCCCCAATTCAAATGCCAGGGGGGAGTGTAC GTTCAGATTGAGCCTGGCGCGATGAGAGAGCTTCATTGGCATCCCAATAGCGA TGAGTGGCAATATTATCTAACAGGACAGGGACGAATGACGGTATTTATCGGAA ATGGGACTGCCCGCACATTTGATTATAGAGCAGGCGACGTTGGATACGTGCCT TCTAATGCCGGACACTATATACAAAACACTGGTACAGAAACATTATGGTTTTT AGAAATGTTCAAAAGTAACCGCTATGCAGATGTGTCACTCAATCAGTGGATGG CATTGACGCCTAAAGAATTAGTACAAAGCAACTTGAATGCTGGATCAGTCATG CTTGATTCTCTGCGCAAGAAGAAAGTGCCTGTTGTGAAATATCCCGGTACGgc agcagcagcagctagcgcagcagcagcaATGTCCTTCCTTGGTGGCGCCGAGT GCTCGACGGCGGGCAATCCGTTGACTCAGTTCACCAAGCACGTCCAAGATGAT AAGTCCCTACAGAGAGATCGCCTCGTGGGGCGAGGCCCAGGAGGCATGCAAGA AGGCATGCGGTCCCGGGGTATGATGGGAGGACAAGATCAGATGATGGACGAAT TCGCCCAACAACCCGGCCAGATCCCCGGTGCTCCCCCGCAACCGTTCGCTATG GAACAGCTGCGACGCGAGCTAGATCAGTTCCAAACCACACCTCCGAGGACGGG CTCCCCCGGCTGGGCGGCCGAGTTCGATGCGGGCGAGCATGCCCGGATGGAGG CTGCGTTTGCCGGGCCCCAGGGCCCCATGATGAATAATGCGTCGGGATTTACG CCCGCGGAGTTTGCCCGGTTCCAGCAGCAGAGTCGGGCTGGCATGCCTCAGAC GGCTAACCATGTGGCGTCTGCCCCGTCGCCGATGATGGCTGGGTACCAGCGGC CCATGGGTATGGGAGGGTATATGGGCATGGGTGGAATGGGGATGATGCCGCAG ACATTTAACCCGATGGCGATGCAGCAGCAGCCGGCAGAGGCGACTACGCAGGA CAAGGGCAAGGGACGCATGGTGGAGCTGGACGACGAGAACTGGGAGGCACAGT TTGCCGAGATGGAGACGGCGGATACCCAGAAATTGGACGATGAGGCCAACGCA GCTGTGGAGGCAGAGCTGAATGATCTGGATAGGTCAGTCCCCCAAGATTCGGG CGATAGTGCCTTTGAAAGCGTGTGGCAACGGGTCCAAGCTGAGACCGCAACAA ACAGGAAACTGGCCGAGGGCGAGACCGACTTTAACATTGACGACAATCTGCAT ATGGGTGAGATGGGCGAATGGGACGGATTCGATACGCTTAACACGCGCTTCCG GAACCCTCAACTAGGCGATTATATGTTCGAAGAAGATAACGTGTTCCGGAGCG TGAGCAATCCTTTCGAAGAGGGAGTGAAGATCATGCGCGAGGGTGGAAACCTC TCCCTGGCTGCCTTGGCTTTCGAGGCGGCAGTCCAGAAAGATCCTCAACATGT CCAGGCCTGGACCATGCTGGGATCGGCTCAGGCGCAGAACGAGAAGGAGCTTC CCGCCATCAGAGCGCTGGAGCAGGCACTTAAGATTGATGCTAACAATCTGGAT GCGCTGATGGGACTGGCTGTTTCCTACACCAACGAGGGCTATGACTCGACATC GTACCGCACTTTGGAGCGTTGGCTGTCAGTCAAGTACCCCCAGATTATCAACC CTAATGATGTTTCATCGGAAGCCGACTTGGGCTTTACGGACCGCCAGCTCCTG CACGACCGTGTCACCGATCTCTTCATCCAGGCTGCTCAGCTGTCGCCATCTGG CGAGCAAATGGACCCGGACGTCCAGGTCGGTCTTGGCGTTCTCTTCTACTGCG CAGAGGAGTATGACAAGGCGGTCGATTGCTTCTCTGCTGCGTTGGCGTCCACG GAATCCGGAACGTCGAACCAACAGGAGCAGCTCCACCTGCTGTGGAACCGTCT GGGTGCTACGCTTGCCAACTCGGGTCGCTCCGAGGAGGCGATCGAGGCCTACG AGCAGGCGCTGAACATCAATCCCAACTTCGTCCGGGCACGGTACAACCTGGGT GTGTCGTGCATCAACATCGGCTGCTACCCAGAAGCCGCGCAACACCTGCTGGG AGCGCTATCGATGCACCGGGTGGTTGAGCAGGAAGGTCGAGAGCGGGCACGTG AGATTGTTGGGGGCGAGGGTGGCATTGACGACGAGCAGCTGGATCGCATGATT CATGTCAGCCAGAATCAGAGTACCAACCTGTACGACACGTTGCGGCGAGTATT TAGCCAGATGGGACGACGCGATCTGGCTGATCAGGTGGTGGCGGGGATGGATG TCAATGTGTTCCGACGGGAGTTTGAGTTCTAATAAAAGCTT
The oxdD-a\a\0(Nhe\)-pex5 synthetic translational fusion was then cloned between the BαmHl and HmdIII sites into a B. subtilis suicide vector (pDG364; BGSC-46; Karmazyn- Campelli et al., 1989; Figure 1) for subsequent ectopic integration within the non-essential αmyE locus. The resulting plasmid was named pSD140.
Following linearization with Xhol restriction endonuclease, plasmid pSD140 was transformed into wild type B. subtilis strain PY79, generating, by double-crossover recombination at the non-essential αmyE locus, to B. subtilis spore display strain SD 140. In order to improve expression, and therefore the display of the heterologous passenger without modifying the amino acid sequence, the A.niger pex5 coding sequence (passenger sequence, underlined in Table 7) was codon-adapted for expression in B.subtilis. The relevant optimized passenger sequence, which was designed to be free of BamHl, HindlU and MeI sites, is detailed in Table 8 and strictly encodes the same protein that the passenger sequence of Table 7 (Table 9). The oxdD-a\a\0(Nhel)-optipex5 synthetic translational fusion was subsequently cloned between the Bαmϋl and HmdIII sites into the B. subtilis suicide vector pDG364 (BGSC-46; Karmazyn-Campelli et al, 1989; Figure 1) for ectopic integration within the non-essential αmyE locus. The resulting plasmid was named pSDl 50. The recombinant strain obtained after transformation into PY79 was named SD 150.
Table 8: Sequence of A.niger pex5 coding sequence (underlined in Table 7), codon- adapted for expression in B.subtilis. Underlined TAATAA are stop codons: (SEQ ID NO: 1 1)
ATGTCTTTCCTTGGCGGTGCTGAGTGCTCAACTGCCGGAAACCCGCTGACTCA ATTCACAAAGCACGTTCAGGATGACAAATCACTTCAGCGTGACCGTCTTGTCG GACGCGGACCGGGCGGTATGCAGGAAGGCATGCGTTCTCGCGGTATGATGGGC GGACAGGATCAAATGATGGATGAATTCGCACAGCAGCCAGGTCAAATCCCAGG TGCGCCGCCTCAGCCATTTGCGATGGAGCAGCTTCGCCGTGAGCTTGATCAAT TCCAAACAACTCCACCTCGTACTGGTTCTCCAGGCTGGGCAGCTGAATTCGAC GCTGGTGAGCACGCCCGTATGGAAGCTGCTTTCGCCGGACCGCAAGGTCCAAT GATGAACAACGCTTCAGGCTTCACTCCAGCTGAATTCGCCCGTTTCCAGCAGC AGTCTCGTGCGGGTATGCCTCAAACGGCAAACCACGTTGCAAGTGCTCCTTCT CCAATGATGGCTGGTTATCAGCGTCCGATGGGTATGGGCGGATACATGGGTAT GGGCGGTATGGGTATGATGCCTCAAACGTTCAACCCAATGGCGATGCAGCAGC AGCCTGCTGAAGCAACAACTCAAGACAAAGGTAAAGGCCGTATGGTTGAGCTT GATGACGAAAACTGGGAAGCTCAATTCGCTGAAATGGAAACTGCTGACACTCA AAAGCTAGATGATGAAGCAAACGCTGCTGTTGAAGCTGAGCTGAACGATCTTG ACCGTTCTGTTCCTCAGGATTCAGGTGACAGTGCGTTTGAATCTGTTTGGCAG CGTGTTCAGGCTGAAACTGCAACAAACCGCAAGCTGGCTGAAGGTGAAACTGA CTTCAACATCGATGACAACCTTCACATGGGTGAAATGGGTGAGTGGGACGGTT TCGACACTTTAAACACTCGTTTCCGCAACCCTCAGCTTGGTGATTACATGTTC GAAGAAGACAACGTATTCCGTTCTGTATCAAACCCATTTGAAGAAGGCGTAAA AATCATGCGTGAAGGCGGAAACCTTTCTCTTGCTGCGCTTGCGTTTGAAGCTG CTGTTCAAAAAGACCCTCAGCACGTTCAGGCTTGGACGATGCTTGGTTCTGCT CAAGCTCAAAACGAAAAAGAGCTTCCTGCCATCCGTGCGCTTGAGCAGGCTTT AAAAATCGATGCTAACAACCTTGATGCTTTAATGGGTCTTGCTGTCAGCTACA CAAATGAAGGCTATGACAGCACTTCTTACCGTACGCTTGAGCGCTGGCTTTCT GTAAAATACCCTCAAATCATCAACCCAAACGATGTATCAAGTGAAGCTGATCT TGGCTTCACTGACCGTCAATTGCTTCATGACCGTGTAACTGATTTGTTCATTC AAGCTGCACAGCTTTCTCCATCTGGTGAGCAAATGGACCCTGATGTTCAAGTA GGTCTTGGTGTACTATTCTACTGTGCTGAAGAATACGATAAAGCGGTTGACTG CTTCTCTGCTGCTCTTGCTTCAACTGAAAGCGGAACTTCAAACCAGCAAGAGC AGCTTCATTTGCTATGGAACCGTCTTGGTGCGACGCTTGCAAACAGCGGACGC AGTGAAGAAGCGATCGAAGCATATGAGCAGGCGCTGAACATCAACCCAAACTT CGTTCGTGCGCGTTACAACCTAGGTGTATCTTGTATCAACATCGGCTGTTATC CTGAAGCGGCACAGCATTTGCTTGGTGCTTTATCAATGCACCGTGTTGTTGAG CAGGAAGGCCGTGAGCGTGCGCGTGAAATCGTCGGCGGTGAAGGCGGTATCGA TGATGAGCAGCTTGACCGCATGATTCACGTTTCTCAAAACCAATCTACAAACC TATATGATACGCTTCGCCGTGTATTCTCTCAAATGGGCAGAAGAGATCTTGCT GATCAGGTTGTAGCGGGTATGGATGTAAACGTATTCCGTCGTGAGTTTGAATT CTAATAA
Table 9: Amino acid sequence of the A. niger Pex5 protein (SEQ ID NO: 12).
MSFLGGAECSTAGNPLTQFTKHVQDDKSLQRDRLVGRGPGGMQEGMRSRGMMG GQDQMMDEFAQQPGQIPGAPPQPFAMEQLRRELDQFQTTPPRTGSPGWAAEFD AGEHARMEAAFAGPQGPMMNNASGFTPAEFARFQQQSRAGMPQTANHVASAPS PMMAGYQRPMGMGGYMGMGGMGMMPQTFNPMAMQQQPAEATTQDKGKGRMVEL DDENWEAQFAEMETADTQKLDDEANAAVEAELNDLDRSVPQDSGDSAFESVWQ RVQAETATNRKLAEGETDFNIDDNLHMGEMGEWDGFDTLNTRFRNPQLGDYMF EEDNVFRSVSNPFEEGVKIMREGGNLSLAALAFEAAVQKDPQHVQAWTMLGSA QAQNEKELPAIRALEQALKIDANNLDALMGLAVSYTNEGYDSTSYRTLERWLS VKYPQIINPNDVSSEADLGFTDRQLLHDRVTDLFIQAAQLSPSGEQMDPDVQV GLGVLFYCAEEYDKAVDCFSAALASTESGTSNQQEQLHLLWNRLGATLANSGR
SEEAIEAYEQALNINPNFVRARYNLGVSCINIGCYPEAAQHLLGALSMHRWE QEGRERAREIVGGEGGIDDEQLDRMIHVSQNQSTNLYDTLRRVFSQMGRRDLA DQWAGMDVNVFRREFEF

Claims

1. A spore which is genetically modified or genetically engineered by a genetic DNA construct, wherein the genetic DNA construct comprises a first DNA portion encoding a target protein which is a bioactive polypeptide and/or an enzyme and/or an affinity ligand and a second DNA portion encoding a carrier, which construct, when transcribed and translated, expresses a fusion protein between the carrier and the target protein or peptide.
2. A spore according to claim 1 which is a spore of Bacillus or Clostridia or Sporolactobacillus.
3. A spore according to claim 2, which is derived from a strain of B. subtilis.
4. A spore according to claim 3 which is derived from B. Subtilis 1 A747 from the Bacillus Genetic Stock Center.
5. A spore according to any of the claims 1 to 4, wherein the second DNA portion of the construct encoding the carrier may be selected a) from the group of spore structural genes comprising cotC (encoding spore inner coat protein CotC), cotD (encoding spore inner coat protein CotD), cotB (encoding spore outer coat protein CotB), cotE (encoding spore outer coat protein CotE), cotF (encoding spore coat protein CotF), cotG (encoding spore coat protein CotG), cotN (encoding spore protein CotN), cotS (encoding spore coat protein CotS), cotT (encoding spore inner coat protein CotT), cotV (encoding spore coat protein CotV), cotW (encoding spore coat protein CotW), cotX (encoding spore coat protein CotX), cotY (encoding spore coat protein Cot Y), cotZ (encoding spore coat protein CotZ), cotH (encoding spore inner coat protein CotH), cotJA (encoding spore coat protein CotJA), cot JC (encoding spore coat protein CotJC), cotK (encoding spore protein CotK), cotL (encoding spore protein protein CotL), cotM (encoding spore outer coat protein CotM), spoIVA (encoding spore assembly protein SpoFVA ), spoVID (encoding spore assembly protein SpoVID) or any other gene coding for a protein whose assembly at the developing spore surface has been shown to be dependent on spoIVA, spoVID, safA or cotE. b) from the group of spore specific enzymes comprising cotA (encoding a laccase), oxdD (encoding an oxalate decarboxylase), cotQ (encoding a reticuline oxidase-like proetin), tgl (encoding a transglutaminase), or the product of any other gene which resembles a known enzyme, and whose assembly at the surface of the developing spore has been shown to be dependent on spoIVA, spoVID, safA or cotE.
6. A spore according to any of the claims 1 to 5, wherein the spore is a inert spore and unable to germinate wherein said spore is genetically modified to expose at their surface an affinity ligand and/or a biocatalyst.
7. A spore according to claim 6, wherein the biocatalyst is an immobilized enzyme.
8. A spore according to any of the claims 1 to 5, wherein the spore is a viable spore which is able to germinate wherein said spore is genetically modified to produce a feed enzyme and/or a bioactive polypeptide upon germination into a vegetative cell.
9. A spore according to claim 8, wherein the bioactive polypeptide is a bacteriocin.
10. A spore according to claim 8, wherein the enzyme is a feed enzyme.
11. A spore according to claim 10, wherein the enzyme is phytase.
12. A composition comprising spores according to any of the claims 8 - 11.
13. Use of a composition according to claim 12 as animal feed additive.
14. Use of a spore strain as defined in claim 1 in the preparation of a composition for use in animal feed.
15. A method for improving the feed conversion ratio (FCR), wherein a spore strain as defined in claim 10 or 11 is added to animal feed.
16. An animal feed additive comprising (a) a spore strain as defined in claim 10 or 11; and
(b) at least one fat-soluble vitamin,
(c) at least one water-soluble vitamin,
(d) at least one trace mineral, and/or
(e) at least one macro mineral.
17, An animal feed composition having a crude protein content of 50 to 800 g/kg and comprising a spore strain as defined in claim 10 or 11.
PCT/EP2007/007052 2006-08-09 2007-08-09 Spore surface displays of bioactive molecules WO2008017483A2 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
US12/375,976 US20100055244A1 (en) 2006-08-09 2007-08-09 Spore surface displays of bioactive molecules
EP07801574A EP2049669A2 (en) 2006-08-09 2007-08-09 Spore surface displays of bioactive molecules
US14/225,787 US20140315278A1 (en) 2006-08-09 2014-03-26 Spore surface displays of bioactive molecules

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP06016599 2006-08-09
EP06016599.0 2006-08-09

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US12/375,976 A-371-Of-International US20100055244A1 (en) 2006-08-09 2007-08-09 Spore surface displays of bioactive molecules
US14/225,787 Continuation US20140315278A1 (en) 2006-08-09 2014-03-26 Spore surface displays of bioactive molecules

Publications (2)

Publication Number Publication Date
WO2008017483A2 true WO2008017483A2 (en) 2008-02-14
WO2008017483A3 WO2008017483A3 (en) 2008-04-10

Family

ID=38686668

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2007/007052 WO2008017483A2 (en) 2006-08-09 2007-08-09 Spore surface displays of bioactive molecules

Country Status (3)

Country Link
US (2) US20100055244A1 (en)
EP (1) EP2049669A2 (en)
WO (1) WO2008017483A2 (en)

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012001000A1 (en) 2010-06-30 2012-01-05 Dsm Ip Assets B.V. Spore surface display of bioactive molecules
KR101244433B1 (en) * 2009-10-19 2013-03-18 한국생명공학연구원 Spore Surface-Immobilized Phytase and Preparation Methods thereof
EP2638145A1 (en) * 2010-11-11 2013-09-18 Imperial Innovations Limited Bacterial methods
EP2650304A1 (en) * 2010-12-06 2013-10-16 Korea Advanced Institute Of Science And Technology Antimicrobial peptide multiblock copolymer to be expressed on surface of cells
US9826743B2 (en) 2014-09-17 2017-11-28 Bayer Cropscience Lp Compositions comprising recombinant bacillus cells and another biological control agent
US9845342B2 (en) 2014-09-17 2017-12-19 Spogen Biotech Inc. Fusion proteins, recombinant bacteria, and methods for using recombinant bacteria
US9850289B2 (en) 2013-03-15 2017-12-26 Spogen Biotech Inc. Fusion proteins and methods for stimulating plant growth, protecting plants, and immobilizing bacillus spores on plants
US10448647B2 (en) 2014-09-17 2019-10-22 Basf Corporation Compositions comprising recombinant bacillus cells and an insecticide
US11044915B2 (en) 2014-09-17 2021-06-29 Bayer Cropscience Lp Compositions comprising recombinant Bacillus cells and a fungicide
US11044916B2 (en) 2014-09-17 2021-06-29 Bayer Cropscience Lp Compositions comprising recombinant Bacillus cells and an insecticide
US11124460B2 (en) 2016-03-16 2021-09-21 Spogen Biotech Inc. Methods for promoting plant health using free enzymes and microorganisms that overexpress enzymes
US11154064B2 (en) 2014-09-17 2021-10-26 Bayer Cropscience Lp Compositions comprising recombinant bacillus cells and another biological control agent
WO2022171904A1 (en) 2021-02-15 2022-08-18 Livingmed Biotech S.R.L. Genetically modified clostridium strains expressing recombinant antigens and uses thereof
US12031164B2 (en) 2017-09-20 2024-07-09 Spogen Biotech Inc. Fusion proteins, recombinant bacteria, and exosporium fragments for plant health

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2011160026A2 (en) * 2010-06-17 2011-12-22 Research Development Foundation Clostridium taeniosporum spores and spore appendages as surface display hosts, drug delivery devices, and nanobiotechnological structures
CA2848765A1 (en) 2011-09-15 2013-03-21 Los Angeles Biomedical Research Institute At Harbor-Ucla Medical Center Immunotherapy and diagnosis of mucormycosis using coth
BR112021024083A2 (en) * 2019-05-30 2022-04-26 Aanika Biosciences Inc Devices, system and methods for tracking products using biological barcodes and genetically modified organisms containing the same

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5766914A (en) * 1995-01-26 1998-06-16 Michigan State University Method of producing and purifying enzymes
US6461607B1 (en) * 1998-08-24 2002-10-08 Ganeden Biotech, Inc. Probiotic, lactic acid-producing bacteria and uses thereof
WO2002000232A2 (en) * 2000-06-26 2002-01-03 Maxygen, Inc. Methods and compositions for developing spore display systems for medicinal and industrial applications
KR20020045400A (en) * 2000-12-08 2002-06-19 반재구 Method for Expression of Proteins on Spore Surface
ATE490309T1 (en) * 2002-08-12 2010-12-15 Danisco Us Inc MUTANT E. COLI-APPA PHYTASE ZYMES AND NATURAL VARIANTS THEREOF, NUCLEIC ACIDS ENCODING SUCH PHYTASE ZYMES, VECTORS AND HOST CELLS CONTAINING THE SAME, AND METHODS FOR THE PRODUCTION AND USE THEREOF

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
None

Cited By (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101244433B1 (en) * 2009-10-19 2013-03-18 한국생명공학연구원 Spore Surface-Immobilized Phytase and Preparation Methods thereof
WO2012001000A1 (en) 2010-06-30 2012-01-05 Dsm Ip Assets B.V. Spore surface display of bioactive molecules
EP2638145A1 (en) * 2010-11-11 2013-09-18 Imperial Innovations Limited Bacterial methods
US10406204B2 (en) 2010-12-06 2019-09-10 Korea Advanced Institute Of Science And Technology Multimeric antimicrobial peptide complex which is displayed on cell surface
EP2650304A1 (en) * 2010-12-06 2013-10-16 Korea Advanced Institute Of Science And Technology Antimicrobial peptide multiblock copolymer to be expressed on surface of cells
JP2014502164A (en) * 2010-12-06 2014-01-30 コリア アドバンスト インスティテュート オブ サイエンス アンド テクノロジー Antimicrobial peptide polypolymer complex expressed on the cell surface
EP2650304A4 (en) * 2010-12-06 2014-05-21 Korea Advanced Inst Sci & Tech Antimicrobial peptide multiblock copolymer to be expressed on surface of cells
US11134681B2 (en) 2013-03-15 2021-10-05 Spogen Biotech Inc. Fusion proteins and methods for stimulating plant growth, protecting plants from pathogens, and immobilizing Bacillus spores on plant roots
US10555534B2 (en) 2013-03-15 2020-02-11 Spogen Biotech Inc. Fusion proteins and methods for stimulating plant growth, protecting plants from pathogens, and immobilizing Bacillus spores on plant roots
US10092009B2 (en) 2013-03-15 2018-10-09 Spogen Biotech Inc. Fusion proteins and methods for stimulating plant growth, protecting plants from pathogens, and immobilizing bacillus spores on plant roots
US10349660B2 (en) 2013-03-15 2019-07-16 Spogen Biotech Inc. Fusion proteins and methods for stimulating plant growth, protecting plants, and immobilizing bacillus spores on plants
US11882829B2 (en) 2013-03-15 2024-01-30 Spogen Biotech Inc. Fusion proteins and methods for stimulating plant growth, protecting plants, and immobilizing bacillus spores on plants
US9850289B2 (en) 2013-03-15 2017-12-26 Spogen Biotech Inc. Fusion proteins and methods for stimulating plant growth, protecting plants, and immobilizing bacillus spores on plants
US10779542B2 (en) 2013-03-15 2020-09-22 Spogen Biotech Inc. Fusion proteins and methods for stimulating plant growth, protecting plants, and immobilizing bacillus spores on plants
US11044915B2 (en) 2014-09-17 2021-06-29 Bayer Cropscience Lp Compositions comprising recombinant Bacillus cells and a fungicide
US11266150B2 (en) 2014-09-17 2022-03-08 Basf Corporation Compositions comprising recombinant bacillus cells and an insecticide
US10448647B2 (en) 2014-09-17 2019-10-22 Basf Corporation Compositions comprising recombinant bacillus cells and an insecticide
US10836800B2 (en) 2014-09-17 2020-11-17 Spogen Biotech Inc. Fusion proteins, recombinant bacteria, and methods for using recombinant bacteria
US10407472B2 (en) 2014-09-17 2019-09-10 Spogen Biotech Inc. Fusion proteins, recombinant bacteria, and methods for using recombinant bacteria
US11044916B2 (en) 2014-09-17 2021-06-29 Bayer Cropscience Lp Compositions comprising recombinant Bacillus cells and an insecticide
US11905315B2 (en) 2014-09-17 2024-02-20 Spogen Biotech Inc. Fusion proteins, recombinant bacteria, and methods for using recombinant bacteria
US9826743B2 (en) 2014-09-17 2017-11-28 Bayer Cropscience Lp Compositions comprising recombinant bacillus cells and another biological control agent
US11154064B2 (en) 2014-09-17 2021-10-26 Bayer Cropscience Lp Compositions comprising recombinant bacillus cells and another biological control agent
US10667522B2 (en) 2014-09-17 2020-06-02 Basf Se Compositions comprising recombinant Bacillus cells and another biological control agent
US11388903B2 (en) 2014-09-17 2022-07-19 Basf Corporation Compositions comprising recombinant Bacillus cells and another biological control agent
US9845342B2 (en) 2014-09-17 2017-12-19 Spogen Biotech Inc. Fusion proteins, recombinant bacteria, and methods for using recombinant bacteria
US11785949B2 (en) 2014-09-17 2023-10-17 Basf Corporation Compositions comprising recombinant bacillus cells and another biological control agent
US11856956B2 (en) 2014-09-17 2024-01-02 Basf Corporation Compositions comprising recombinant Bacillus cells and an insecticide
US11124460B2 (en) 2016-03-16 2021-09-21 Spogen Biotech Inc. Methods for promoting plant health using free enzymes and microorganisms that overexpress enzymes
US12031164B2 (en) 2017-09-20 2024-07-09 Spogen Biotech Inc. Fusion proteins, recombinant bacteria, and exosporium fragments for plant health
WO2022171904A1 (en) 2021-02-15 2022-08-18 Livingmed Biotech S.R.L. Genetically modified clostridium strains expressing recombinant antigens and uses thereof

Also Published As

Publication number Publication date
US20100055244A1 (en) 2010-03-04
WO2008017483A3 (en) 2008-04-10
EP2049669A2 (en) 2009-04-22
US20140315278A1 (en) 2014-10-23

Similar Documents

Publication Publication Date Title
US20140315278A1 (en) Spore surface displays of bioactive molecules
US20130216653A1 (en) Spore surface display of bioactive molecules
CN101035893B (en) Citrobacter freundii phytase and homologues
CN100406561C (en) Microbially expressed thermotolerant phytase for animal feed
RU2227159C2 (en) Phytase from bacillus subtilis, gene encoding this phytase, method for its preparing and application
AU2005290934C1 (en) Citrobacter freundii phytase and homologues
RU2421520C2 (en) Version phytase ferments
CN113301809B (en) Engineered robust high Tm phytase clade polypeptides and fragments thereof
US9631185B2 (en) Fusion of bioactive molecules
MXPA06006670A (en) Microbially expressed xylanases and their use as feed additives and other uses.
CN112654703A (en) Xylanase-containing feed additives for cereal-based animal feed
US20230380448A1 (en) Enzymatic Preservation of Probiotics in Animal Feed
US20200015499A1 (en) Trypsin-like serine proteases and uses thereof
Ricke et al. Bacillus probiotics and biologicals for improving animal and human health: current applications and future prospects
JP5091109B2 (en) Polypeptide and nucleic acid encoding the same
ZA200403981B (en) Phytases and method for producing these phytases.
JP2005512570A6 (en) Novel phytases and methods for producing these phytases
CN116113329A (en) Animal feed comprising insects or insect powders

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 07801574

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 2007801574

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

NENP Non-entry into the national phase

Ref country code: RU

WWE Wipo information: entry into national phase

Ref document number: 12375976

Country of ref document: US