WO2007148065A2 - Antibody for anthrax - Google Patents

Antibody for anthrax Download PDF

Info

Publication number
WO2007148065A2
WO2007148065A2 PCT/GB2007/002271 GB2007002271W WO2007148065A2 WO 2007148065 A2 WO2007148065 A2 WO 2007148065A2 GB 2007002271 W GB2007002271 W GB 2007002271W WO 2007148065 A2 WO2007148065 A2 WO 2007148065A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
antibody
anthracis
cdr
antibody according
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/GB2007/002271
Other languages
French (fr)
Other versions
WO2007148065A3 (en
Inventor
Carl Nicholas Mayers
Tracey Elizabeth Love
Vikesh Patel
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
UK Secretary of State for Defence
Original Assignee
UK Secretary of State for Defence
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by UK Secretary of State for Defence filed Critical UK Secretary of State for Defence
Publication of WO2007148065A2 publication Critical patent/WO2007148065A2/en
Publication of WO2007148065A3 publication Critical patent/WO2007148065A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/12Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
    • C07K16/1267Gram-positive bacteria
    • C07K16/1278Bacillus (G)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/195Assays involving biological materials from specific organisms or of a specific nature from bacteria
    • G01N2333/32Assays involving biological materials from specific organisms or of a specific nature from bacteria from Bacillus (G)

Definitions

  • the present invention is generally concerned with a method for the production of antibody which is specific for anthrax (B. anthracis).
  • the invention is particularly, although not exclusively, directed to a recombinant antibody specific for anthrax spore and uses thereof.
  • An immunoassay suitable for the detection of anthrax should preferably be based on an antibody which recognises the spore over the vegetative cell and other closely related, non-pathogenic species such as B. cereus.
  • the identification of such a specific antibody is, however, often difficult - especially when a unique antigen or epitope between species is not known or not immunodominant.
  • Optimal detection may, for example, require the use of additional reagents, optimisation of assay conditions or development of new technologies.
  • Recombinant antibody is more compatible with existing detection platforms.
  • recombinant libraries offer the advantage that they can be designed for specificity between very similar proteins.
  • the present invention generally aims to produce antibody with high specificity and high affinity (nanomolar or above) for anthrax.
  • the term "specific" in relation to antibody for anthrax will be understood to refer to antibody which preferably binds to anthrax in the presence of other Bacillus species.
  • the antibody may, however, bind to the live spore and/or the vegetative cell.
  • the present invention also aims to provide an antibody specific for anthrax which is suitable for use with existing detection platforms such as those based on surface plasmon resonance (SPR).
  • SPR surface plasmon resonance
  • the library is panned against a suspension of live spores of B. subtilis and positive scFv-phages selected against the immobilised spores by an enzyme-linked immunosorbent assay (ELISA). Whilst specificity for the live B. subtilis spore over the vegetative cell is shown, the selected phage are cross-reactive with other Bacillus species - even following construction of a chain-shuffled Fab library and subtractive bio-panning.
  • ELISA enzyme-linked immunosorbent assay
  • An immune mouse scFv phage-display library is panned against immobilised (S- layer) protein EAl .
  • Antibody specific for B. anthracis is not found - except when the library is first panned against immobilised protein EAl in the presence of S-layer protein extracts from competing Bacillus species (competitive bio-panning).
  • the present invention provides a method for the production of antibody specific for B. anthracis comprising the steps of i) generating an immune scFv phage-display library and ii) panning the library against immobilised B. anthracis spore in the presence of spore from one or more other Bacillus species.
  • the library is raised against whole spore (irradiated) B. anthracis.
  • the library may, in particular, comprise a library of positive scFv phage selected by ELISA against immobilised B. anthracis spore.
  • the one or more other species comprise B. cereus and/or B. thuringiensis. Most preferably, however, the one or more other species comprise B. cereus, particularly B. cereus 11143.
  • step ii) is performed using an amount of the one or more other Bacillus species which is in excess of the amount of immobilised spore.
  • the amount of the other Bacillus species may, in particular, comprise up to a 10-fold excess.
  • step ii) is the first panning step and is performed on the positive library.
  • subsequent rounds of non-competitive or competitive bio-panning may be used.
  • step ii) is repeated two or three times.
  • the present invention provides for an antibody specific for B. anthracis spore comprising at least one of the amino acid sequences SEQ ID 2, SEQ ID 3, SEQ ID 4, SEQ ID 15, SEQ ID 19, SEQ ID 20, SEQ ID 24, SEQ ID 30, SEQ ID 31, SEQ ID 32, SEQ ID 33, SEQ ID 34, SEQ ID 35, SEQ ID 36, SEQ ID 37, SEQ ID 38, SEQ ID 39 or a variant or a fragment thereof.
  • the antibody comprises any one of amino acid SEQ ID 1 to 45 or a variant or fragment thereof.
  • the hypervariable region of the antibody are characterised in that CDR-Ll comprises either SEQ ID 19, SEQ ID 31 or SEQ ID 32; CDR-L2 comprises either SEQ ID 2, SEQ ID 20 or SEQ ID 33; CDR-L3 comprises either SEQ ID 3, SEQ ID 15 or SEQ ID 34; CDR-Hl comprises either SEQ ID 4 or SEQ ID 35; CDR-H2 comprises SEQ ID 23, SEQ ID 36 or SEQ ID 37 and CDR-H3 comprises SEQ ID 24, SEQ ID 38 or SEQ ID 39.
  • the antibody comprises SEQ ID 1 to 6; or SEQ ID 7 to 12; or SEQ ID 13 to 18; or SEQ ID 19 to 24; or SEQ ID 2 to 4 and 25 to 27 or SEQ ID 2 to 5 and 28 to 30.
  • variants refers to sequences which differ from the original sequence from which they are derived in that one or more amino acids within the sequence are substituted for other amino acids but which retain the ability of the original sequence to bind to anthrax with affinities (K A ) of order of magnitude 10 9 or above.
  • Amino acid substitutions may be regarded as "conservative” where an amino acid is replaced with a different amino acid with broadly similarly properties. Non-conservative substitutions are where amino acids are replaced with amino acids of a different type. Generally, fewer non-conservative substitutions will be possible without altering the biological activity of the polypeptide.
  • variants will be at least 60% identical, preferably at least 70% identical, most preferably at least 90% identical to the original sequence.
  • Identity in this instance can be judged, for example, using the BLAST programme or the algorithm of Lipman and Pearson (1985), with ktuple: 2, gap penalty 4, gap length penalty 12, standard PAM scoring matrix.
  • fragment refers to any portion of the given amino acid sequence, which has the same activity as the complete amino acid sequence. Fragments will suitably comprise at least 5 and preferably at least 10 consecutive amino acids from the base sequence.
  • the present invention describes a polynucleotide encoding an antibody of the present invention.
  • the polynucleotide comprises any of SEQ ID 46 to 51 or a variant thereof.
  • variant in relation to a polynucleotide sequence means any substitution, variation, modification, replacement, deletion or addition of one or more nucleic acid(s) from or to a polynucleotide sequence providing the resultant protein sequence encoded by the polynucleotide exhibits the same properties as the protein encoded by the original sequence.
  • the term therefore includes allelic variants and also a polynucleotide which hybridises to the basic polynucleotide sequence. Preferably such hybridisation occurs at, or between low and high stringency conditions.
  • low stringency conditions can be defined as 3 x SSC at about ambient temperature to about 55 0 C and high stringency conditions can be defined as 0.1 x SSC at about 65 0 C.
  • SSC is the name of the buffer of 0.015M tri-sodium citrate and 0.15 M NaCl. 3 x SSC is three times as strong as SSC and so on.
  • variants have 60% or more of the nucleotides in common with the polynucleotide sequence of the present invention, more typically 65%, preferably 70%, even more preferably 80% or 85% and, especially preferred are 90%, 95%, 98% or 99% or more identity.
  • GCG Computer Group
  • the present invention provides a method for detection of anthrax comprising the step of determining the binding of an antibody according to the invention to the spore.
  • the present invention also contemplates the vaccination and/or treatment against anthrax by a humanised antibody according to the invention as well as the manufacture of medicaments therefor.
  • the scFv antibodies of the present invention may be used to produce an anti-idiotypic antibody ("surrogate antigen") according to conventional techniques which may produce a protective immune response in humans and/or animals.
  • surrogate antigen an anti-idiotypic antibody
  • the administration of humanised form of scFv antibody as described by Zhou, B., (2002) may prevent or enhance protection against anthrax infection in humans and/or animals.
  • Figure 1 is a graph showing a polyclonal ELISA of a vpap library binding to B. anthracis UM23CL2, B. cereus 11143 and EAl following competitive biopanning;
  • Figure 2 is a phylogenetic tree showing the relationship between the specific antibodies of the present invention and a range of other non-specific antibodies.
  • NCTC 10342 megaterium
  • B. pasteuri NCTC 4822
  • B. polymyxa NCTC 10343 B. sphaericus
  • NCTC 103308 B. subtilis
  • NCTC 3610 B. subtilis (10073)
  • B. subtilis var. niger NCTC 10073
  • B thuringiensis var. kurstaki B. thuringiensis var. israelensis were obtained from NCTC (PHLS, 61 Colindale Avenue, London).
  • Plasmids p AKl 00 (for phage display) and pAK300 (for production of soluble scFv) were a kind gift from Dr A. Pl ⁇ ckthun (University of Zurich, Switzerland) and were used as described by Krebber et al. (1997). Spore production
  • mice Six 12 week old female Balb/c mice were immunised with irradiated B. anthracis Ames spores. Each immunisation consisted of 1 x 10 7 spores in Freunds incomplete adjuvant. Mice were immunised 4 times at intervals of three weeks, and killed by cervical dislocation once they showed a sufficiently high titre (>l:100 000) to the spores by endpoint ELISA. Spleens were removed from the killed mice and splenic mRNA isolated using Trizol reagent (Invitrogen, Fountain Road, Inchinnan Business Park, Paisley, UK.).
  • RNA from the immunised mice was used to produce the immune scFv library: PCR amplification of antibody sequences, overlap extension PCR, cloning of the assembled scFv sequence into pAKlOO and production of phage-displayed scFv was carried out as described by Krebber et al. (1997). Biopanning
  • the scFv sequences from selected clones were amplified by PCR primers surrounding the scFv sequence (scfor and scback) by the method of Krebber et al. (1997) and subjected to BstNl digestion to determine the diversity of the original library and each consecutive round of selection. Restriction digest products were resolved on 4% E- gels (Invitrogen) using 25bp markers. PCR and DNA fingerprinting were carried out on 10 randomly selected scFv from rounds 1 and 2 and 50 scFv clones from round three.
  • PEG-purified phage-displayed scFv were diluted with MPBS, and an anti-M13 HRP conjugated antibody (Sigma, Fancy Road, Poole, UK) used to detect bound phage.
  • Bound phage was quantified by measuring the conversion of ABTS substrate to coloured product based on A405 readings in an automated ELISA reader (Anthos 2001, Anthos Labtec Instruments, Salzburg, Austria).
  • Antibodies were immobilised to resonant mirror (T70, Thermo Labsystems, Saxon Way, Bar Hill, Cambridge, UK) low molecular weight carboxymethylated dextran (CMD) cuvette surface by standard EDC/NHS coupling.
  • CMD carboxymethylated dextran
  • a polyclonal ELISA shows the specificity of a the vpap fraction of the sc-Fv phage library against B. anthracis UM23CL2, B. cereus and surface antigen protein EAl following (three) successive rounds of competitive bio- panning (sample/MPBS dilution 50% (v/v) for EAl).
  • An anti-ovalbumin sc-Fv was used as a -VE control and bound phage detected using anti-M13 HRP conjugated antibody.
  • Assays were performed in triplicate; error bars show tow standard deviations from the means. A positive result is defined as higher than the average of the background signal plus three standard deviations of the mean background sample.
  • the vpap library is highly specific for B. anthracis after three (3) rounds of competitive bio-panning compared to other parts of the library (mvov, cman).
  • SEQ ID 7 and 13 each of which represents the CDR-Ll region of an antibody include the common sequence kasqnv va (SEQ ID 32).
  • SEQ ID 8 and 14 each of which represents the CDR-L2 region of an antibody included the common sequence as-r- (SEQ ID 33).
  • SEQ ID 9 and 21 each of which represents the CDR-L3 region of an antibody include the common sequence qq — ppt (SEQ ID 34).
  • SEQ ID 10, 16 and 22 each of which represents the CDR-Hl region of an antibody include the common sequence sy-m- (SEQ ID 35).
  • SEQ ID 5, 26 and 29 each of which represents the CDR-H2 region of an antibody include the common sequence sitsgg-ityyp-s- (SEQ ID 36).
  • SEQ ID 11 and 17 each of which represents the CDR-H2 region of an antibody include the common sequence yinp — t-yn-kf (SEQ ID 37)
  • SEQ ID 6, and 27 each of which represent the CDR-H3 region of an antibody include the common sequence g-fayw (SEQ ID 38).
  • SEQ ID 12 and 18 each of which represent the CDR-H3 region of an antibody include the common sequence amdyw (SEQ ID 39).
  • each of the antibodies may be described as CDR-Ll comprising either SEQ ID 19, SEQ ID 31 or SEQ ID 32; CDR-L2 comprising either SEQ ID 2, SEQ ID 20 or SEQ ID 33; CDR-L3 comprising either SEQ ID 3, SEQ ID 15 or SEQ ID 34; CDR- Hl comprising either SEQ ID 4 or SEQ ID 35; CDR-H2 comprising SEQ ID 23, SEQ ID 36 or SEQ ID 37 and CDR-H3 comprising SEQ ID 24, SEQ ID 38 or SEQ ID 39.
  • vpaplO (1 linker) divmtqsplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrfsgvpdrfsgsgsgtdftlkisr veaedlgvyycfqgshvpwtfgggtkleikrggggsgggggsdvkwesggglvkpggslklscaasgftfsnsams wgrqtpekrlewvasitsggityypdsvkgrftisrddarnilylqmsslrsedtamyycargdyryaegafaywgqgt lvtvsa (SEQ ID 40)
  • vpap34 (4 linkers) divmtqsqkfinstsvgdrvsvtckasqnvgtnvawyqqkpgqspkaliysasyrysgvpdrftgsgsgteftftissv qaedlavyycqqhysipptfgggtkleikrggggsggggsggggsggggggsevqlqqsgaelarpgasvkmsckasg ytftsytmhwvkqrpgqglewigyinpnagythynqkfkekatltadkssstvymqlssltsedsavyycarwsdra mdywgqgtsvtvss (SEQ ID 41)
  • ypap37 (2 linkers) diqmnqsqkfiiisasvgdrvsitckasqnvrsavawyqqkpgqspkaliylasnrhtgvpdrftgsgsgtdftltisnvq sedladyfclqhwnyplafgagtkleikrggggsggggsgggsggggsqvqlkesgpelvkpgasvknisckasgyt ftsyvmhwvkqkpgqglewigyinpyndgtkynekfkgkatltsdkssstaymelssltsedsavyycargllrlqya mdywgqgtsvtvss (SEQ ID 42)
  • vpap47 (2 linkers) dilmtqtplslpvslgdqasiscrssqsialsngntylewylqkpgqspklliykvsnrfsgvpdrfsgsgsgtdftlkisrv eaedlgvyycfqgshvpwtfgggtkleikrggggsggggsevqlvesggglvkpggslklscaasgftfsnsamswa rqipekrlewvasitsggityypgsakgrftisrddarnilylqmnslrsedtahvflckrgl (SEQ ID 45)
  • each sc-Fv antibody showed high specificity for B. anthracis viz., no cross-reactivity.
  • Results are expressed as the % of the maximum signal seen in the assay. +++ indicates 60-100% of the maximum, ++ indicates 20-59% of the maximum and + indicates a signal greater than the detection threshold (defined as the background signal plus 3 standard deviations from the mean background signal). - indicates a signal below the detection threshold.
  • FIG. 2 there is shown a phylogenetic tree describing the relationship between the entire sequence of the selected antibodies (marked by dot) and a range of other non-specific antibodies.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

A method for the production of antibody specific for B. anthracis comprising the steps of i) generating an immune scFv phage-display library and ii) panning the library against immobilised B. anthracis spore in the presence of spore from one or more other Bacillus species.

Description

ANTIBODY FOR ANTHRAX
The present invention is generally concerned with a method for the production of antibody which is specific for anthrax (B. anthracis). The invention is particularly, although not exclusively, directed to a recombinant antibody specific for anthrax spore and uses thereof.
An immunoassay suitable for the detection of anthrax should preferably be based on an antibody which recognises the spore over the vegetative cell and other closely related, non-pathogenic species such as B. cereus. The identification of such a specific antibody is, however, often difficult - especially when a unique antigen or epitope between species is not known or not immunodominant.
Traditional methods for the isolation of specific antibody are often based on screening of polyclonal antibody raised against whole cell or spores. These methods, although sometimes successful, often require detailed knowledge of suitable target proteins and are time-consuming and expensive.
The use of whole antibody for detection often requires significant modification or development of existing detection platforms. Optimal detection may, for example, require the use of additional reagents, optimisation of assay conditions or development of new technologies. Recombinant antibody is more compatible with existing detection platforms. In addition, recombinant libraries offer the advantage that they can be designed for specificity between very similar proteins.
Methods for the production of recombinant antibody are well known to the art - see for example, Krebber, A., et al., (1997).
The present invention generally aims to produce antibody with high specificity and high affinity (nanomolar or above) for anthrax. As used herein, the term "specific" in relation to antibody for anthrax will be understood to refer to antibody which preferably binds to anthrax in the presence of other Bacillus species. The antibody may, however, bind to the live spore and/or the vegetative cell.
The present invention also aims to provide an antibody specific for anthrax which is suitable for use with existing detection platforms such as those based on surface plasmon resonance (SPR).
Zhou, B., et al. (2002) suggest an approach for the identification of human antibody specific to B. anthracis. The approach is based on a naϊve, human single-chain Fv (scFv) phage-display library.
The library is panned against a suspension of live spores of B. subtilis and positive scFv-phages selected against the immobilised spores by an enzyme-linked immunosorbent assay (ELISA). Whilst specificity for the live B. subtilis spore over the vegetative cell is shown, the selected phage are cross-reactive with other Bacillus species - even following construction of a chain-shuffled Fab library and subtractive bio-panning.
UK patent application GB 0514319.3, incorporated herein by reference in its entirety, discloses an alternative approach for the production of recombinant antibody specific to B. anthracis.
An immune mouse scFv phage-display library is panned against immobilised (S- layer) protein EAl . Antibody specific for B. anthracis is not found - except when the library is first panned against immobilised protein EAl in the presence of S-layer protein extracts from competing Bacillus species (competitive bio-panning).
It is believed that competitive bio-panning of more complex mixtures of antibody eliminates the majority of non-specific antibody from the library in a single, first (-VE selection) step and reveals antibody specific to EAl B. anthracis which is lost in ordinary bio-panning.
Competitive bio-panning (also known as pre-adsorption or subtractive screening) has been used for isolating other targets. However, it normally follows conventional bio- panning.
Krebs, B. et al., (2004) describe a method for the identification of specific sc-Fv antibody in which pre- and post-adsorption steps are utilised to screen out antibody that bind to cross reacting species. The preparation of anti-melanoma antibodies by pre-adsorption to melanocytes has been reported by Cai, X. and Garen, A. (1995).
Surprisingly, it has now been found that antibody of high specificity and high affinity for anthrax can be produced by panning an immune library against immobilised B. anthracis spore in the presence of spore from competing Bacillus species.
Accordingly, in a first aspect, the present invention provides a method for the production of antibody specific for B. anthracis comprising the steps of i) generating an immune scFv phage-display library and ii) panning the library against immobilised B. anthracis spore in the presence of spore from one or more other Bacillus species.
In a preferred embodiment, the library is raised against whole spore (irradiated) B. anthracis. The library may, in particular, comprise a library of positive scFv phage selected by ELISA against immobilised B. anthracis spore.
In one embodiment, the one or more other species comprise B. cereus and/or B. thuringiensis. Most preferably, however, the one or more other species comprise B. cereus, particularly B. cereus 11143.
Other cross-reacting species which may be used in the invention comprise B. alvei, B. pumilus, B. brevis, B. circulans, B. licheniformis, B. megaterium, B. polymyxa, B. sphaericus and B. subtilis. In a preferred embodiment, step ii) is performed using an amount of the one or more other Bacillus species which is in excess of the amount of immobilised spore. The amount of the other Bacillus species may, in particular, comprise up to a 10-fold excess.
In a highly preferred embodiment, step ii) is the first panning step and is performed on the positive library. In this embodiment, subsequent rounds of non-competitive or competitive bio-panning may be used. Most preferably, step ii) is repeated two or three times.
In a second aspect, the present invention provides for an antibody specific for B. anthracis spore comprising at least one of the amino acid sequences SEQ ID 2, SEQ ID 3, SEQ ID 4, SEQ ID 15, SEQ ID 19, SEQ ID 20, SEQ ID 24, SEQ ID 30, SEQ ID 31, SEQ ID 32, SEQ ID 33, SEQ ID 34, SEQ ID 35, SEQ ID 36, SEQ ID 37, SEQ ID 38, SEQ ID 39 or a variant or a fragment thereof.
In a preferred embodiment, the antibody comprises any one of amino acid SEQ ID 1 to 45 or a variant or fragment thereof.
In another preferred embodiment, the hypervariable region of the antibody are characterised in that CDR-Ll comprises either SEQ ID 19, SEQ ID 31 or SEQ ID 32; CDR-L2 comprises either SEQ ID 2, SEQ ID 20 or SEQ ID 33; CDR-L3 comprises either SEQ ID 3, SEQ ID 15 or SEQ ID 34; CDR-Hl comprises either SEQ ID 4 or SEQ ID 35; CDR-H2 comprises SEQ ID 23, SEQ ID 36 or SEQ ID 37 and CDR-H3 comprises SEQ ID 24, SEQ ID 38 or SEQ ID 39. Most preferably, however, the antibody comprises SEQ ID 1 to 6; or SEQ ID 7 to 12; or SEQ ID 13 to 18; or SEQ ID 19 to 24; or SEQ ID 2 to 4 and 25 to 27 or SEQ ID 2 to 5 and 28 to 30.
The term "variant" as used in relation to amino acid sequences refers to sequences which differ from the original sequence from which they are derived in that one or more amino acids within the sequence are substituted for other amino acids but which retain the ability of the original sequence to bind to anthrax with affinities (KA) of order of magnitude 109 or above. Amino acid substitutions may be regarded as "conservative" where an amino acid is replaced with a different amino acid with broadly similarly properties. Non-conservative substitutions are where amino acids are replaced with amino acids of a different type. Generally, fewer non-conservative substitutions will be possible without altering the biological activity of the polypeptide. Suitably, variants will be at least 60% identical, preferably at least 70% identical, most preferably at least 90% identical to the original sequence.
Identity in this instance can be judged, for example, using the BLAST programme or the algorithm of Lipman and Pearson (1985), with ktuple: 2, gap penalty 4, gap length penalty 12, standard PAM scoring matrix.
The term "fragment" refers to any portion of the given amino acid sequence, which has the same activity as the complete amino acid sequence. Fragments will suitably comprise at least 5 and preferably at least 10 consecutive amino acids from the base sequence. In a third aspect, the present invention describes a polynucleotide encoding an antibody of the present invention. Preferably, the polynucleotide comprises any of SEQ ID 46 to 51 or a variant thereof.
The term variant in relation to a polynucleotide sequence means any substitution, variation, modification, replacement, deletion or addition of one or more nucleic acid(s) from or to a polynucleotide sequence providing the resultant protein sequence encoded by the polynucleotide exhibits the same properties as the protein encoded by the original sequence. The term therefore includes allelic variants and also a polynucleotide which hybridises to the basic polynucleotide sequence. Preferably such hybridisation occurs at, or between low and high stringency conditions. In general terms, low stringency conditions can be defined as 3 x SSC at about ambient temperature to about 550C and high stringency conditions can be defined as 0.1 x SSC at about 650C. SSC is the name of the buffer of 0.015M tri-sodium citrate and 0.15 M NaCl. 3 x SSC is three times as strong as SSC and so on.
Typically, variants have 60% or more of the nucleotides in common with the polynucleotide sequence of the present invention, more typically 65%, preferably 70%, even more preferably 80% or 85% and, especially preferred are 90%, 95%, 98% or 99% or more identity.
When comparing nucleic acid sequences for the purposes of determining the degree of identity, programs such as BESTFIT and GAP (both from Wisconsin Genetics
Computer Group (GCG) software package) can be used. BESTFIT, for example, compares two sequences and produces an optimal alignment of the most similar segments. GAP enables sequences to be aligned along their whole length and finds the optimal alignment by inserting spaces in either sequence as appropriate. Suitably, in the context of the present invention when discussing identity of nucleic acid sequences, the comparison is made by alignment of the sequences along their whole length.
In a fourth aspect, the present invention provides a method for detection of anthrax comprising the step of determining the binding of an antibody according to the invention to the spore.
The present invention also contemplates the vaccination and/or treatment against anthrax by a humanised antibody according to the invention as well as the manufacture of medicaments therefor.
In particular, the scFv antibodies of the present invention may be used to produce an anti-idiotypic antibody ("surrogate antigen") according to conventional techniques which may produce a protective immune response in humans and/or animals.
Alternatively, the administration of humanised form of scFv antibody as described by Zhou, B., (2002) may prevent or enhance protection against anthrax infection in humans and/or animals.
The present invention will now be described by reference to the following results and drawings in which Figure 1 is a graph showing a polyclonal ELISA of a vpap library binding to B. anthracis UM23CL2, B. cereus 11143 and EAl following competitive biopanning; and
Figure 2 is a phylogenetic tree showing the relationship between the specific antibodies of the present invention and a range of other non-specific antibodies.
Materials & Methods
Bacterial strains and plasmids
Strain RBA91 (PXOl", PXO2" B. anthracis Sap mutant) was provided by the Pasteur Institute (25,28 rue du Docteur Roux, Paris). B. alvei (NCTC 6352), B. cereus (NCTC 11143, NCTC 9946, NCTC 2559, NCTC 6474, NCTC 7464, NCTC 8035, NCTC 9939, NCTC 9945, NCTC 9946, NCTC 10320 and NCTC 11145), B. pumilus (NCTC 10337), B. brevis (NCTC 2611), B. coagulans (NCTC 10334), B. circular* (NCTC (2610), B. licheniformis (NCTC 10341), B. megaterium (NCTC 10342), B. pasteuri (NCTC 4822), B. polymyxa NCTC 10343, B. sphaericus (NCTC 10338) B. subtilis (NCTC 3610), B. subtilis (10073), B. subtilis var. niger (NCTC 10073), B thuringiensis var. kurstaki and B. thuringiensis var. israelensis were obtained from NCTC (PHLS, 61 Colindale Avenue, London).
Plasmids p AKl 00 (for phage display) and pAK300 (for production of soluble scFv) were a kind gift from Dr A. Plϋckthun (University of Zurich, Switzerland) and were used as described by Krebber et al. (1997). Spore production
Spores were prepared using New Sporulation agar (3.0 g/litre Difo Tryptone; 6.0 g/litre Oxoid bacteriological peptone; 3.0g/litre Oxoid yeast extract: 1.5 g/litre Oxoid
Lab Lemco; 1 ml 0.1% MnCl2.4H2O; 25 g/litre Difco Bacto agar) and incubated at 37°C until the cultures contained >95% phase bright spores. The spores were harvested by release from the solid media using ice cold sterile distilled water and subsequently centrifuged at lOOOOg for 10 minutes at 40C and then washed 10 times in ice cold sterile distilled water to remove vegetative cells and debris. Preparations were examined using phase contrast microscopy to confirm that they contained >95 % phase bright spores.
Construction and use of immune mouse scFv library
Six 12 week old female Balb/c mice were immunised with irradiated B. anthracis Ames spores. Each immunisation consisted of 1 x 107 spores in Freunds incomplete adjuvant. Mice were immunised 4 times at intervals of three weeks, and killed by cervical dislocation once they showed a sufficiently high titre (>l:100 000) to the spores by endpoint ELISA. Spleens were removed from the killed mice and splenic mRNA isolated using Trizol reagent (Invitrogen, Fountain Road, Inchinnan Business Park, Paisley, UK.).
The total RNA from the immunised mice was used to produce the immune scFv library: PCR amplification of antibody sequences, overlap extension PCR, cloning of the assembled scFv sequence into pAKlOO and production of phage-displayed scFv was carried out as described by Krebber et al. (1997). Biopanning
Immunotubes (Nunc, BRL, Life Technologies Ltd., Trident House, Washington Road,
Paisley, UK) were coated with ImI of purified γ-irradiated B. anthracis Ames spores at 1 x 108 cfu/ml in PBS overnight at 4 °C and blocked with 2 % (w/v) milk powder
PBS (MPBS). 100 μl of scFv-phage were mixed with 900 μl MPBS, incubated for
one hour at room temperature, and added to the coated immunotubes. After incubation at room temperature (2 h), the immunotubes were washed 10 times with PBS 0.1 % (v/v) Tween 20. Bound phage was eluted with 10OmM triethylamine and neutralised with 500μl 1 M Tris HCl pH 7.5. Eluted phage was infected into log phase XLl-Blue E. coli, plated on a 24 cm square 2 x YT 1% (w/v) glucose 30 μg/ml chloramphenicol agar plate and incubated overnight at 30 °C. The procedure was repeated for each round of panning carried out.
Competitive panning was carried out in an identical fashion, adding B. cereus 11143 spores to the scFv-phage MPBS solution for 1 hour before panning. The concentrations of antigen used for competitive panning was up to a 10 fold excess of the B. anthracis spores, that was 1 x 109 cfu/ml.
DNA fingerprinting of scFv clones
The scFv sequences from selected clones were amplified by PCR primers surrounding the scFv sequence (scfor and scback) by the method of Krebber et al. (1997) and subjected to BstNl digestion to determine the diversity of the original library and each consecutive round of selection. Restriction digest products were resolved on 4% E- gels (Invitrogen) using 25bp markers. PCR and DNA fingerprinting were carried out on 10 randomly selected scFv from rounds 1 and 2 and 50 scFv clones from round three.
DNA sequencing
DNA sequencing was undertaken by MWG (Sweden) the DNA sequences were translated using the ExpAsy translation tool. From this the CDR regions were determined using the Kabat definition as described by Martin (2001).
ELISA
50 μl of Bacillus species spore (1 x 10 cfu/ml) were coated onto Immunlon2 plates
(Nunc) and incubated overnight at 370C, appropriate control antigens were coated
onto Immulon2 plates (Nunc). PEG-purified phage-displayed scFv were diluted with MPBS, and an anti-M13 HRP conjugated antibody (Sigma, Fancy Road, Poole, UK) used to detect bound phage. Bound phage was quantified by measuring the conversion of ABTS substrate to coloured product based on A405 readings in an automated ELISA reader (Anthos 2001, Anthos Labtec Instruments, Salzburg, Austria).
Detection of whole spore
Antibodies were immobilised to resonant mirror (T70, Thermo Labsystems, Saxon Way, Bar Hill, Cambridge, UK) low molecular weight carboxymethylated dextran (CMD) cuvette surface by standard EDC/NHS coupling. The binding of anthrax spore passed at various concentrations during 10 mins. was detected by a shift in the angle of incident light for resonance. The surface could be regenerated by exposure to 20 mM KOH during 3 mins. Results
Referring now to Figure 1 , a polyclonal ELISA shows the specificity of a the vpap fraction of the sc-Fv phage library against B. anthracis UM23CL2, B. cereus and surface antigen protein EAl following (three) successive rounds of competitive bio- panning (sample/MPBS dilution 50% (v/v) for EAl). An anti-ovalbumin sc-Fv was used as a -VE control and bound phage detected using anti-M13 HRP conjugated antibody. Assays were performed in triplicate; error bars show tow standard deviations from the means. A positive result is defined as higher than the average of the background signal plus three standard deviations of the mean background sample.
As may be seen, the vpap library is highly specific for B. anthracis after three (3) rounds of competitive bio-panning compared to other parts of the library (mvov, cman).
The specificity of individual scFv phage determined using a monoclonal ELISA against B. anthracis spore led to the selection of 50 individual clones. The clones were isolated and their cross reactivity to B. cereus 11143, identified as a competing species by non-competitive panning, was determined.
Figure imgf000014_0001
Figure imgf000015_0001
Figure imgf000016_0001
Table I
Subsequent DNA fingerprinting and DNA sequencing identified 6 unique clones referred to vpaplO, vpap34, vpap37, vpap43, vpap44 and vpap47. Table I shows the amino-acid sequences (- = unknown amino acid).
Review of table reveals that sequences for particular CDRs may be grouped together according to common features:
For example SEQ ID 1, 25 and 28 each of which represents the CDR-Ll region of an antibody include the common sequence rssq — sngntyle (SEQ ID 31), where - = any amino acid. Alternatively, SEQ ID 7 and 13 each of which represents the CDR-Ll region of an antibody include the common sequence kasqnv va (SEQ ID 32).
Similarly, SEQ ID 8 and 14 each of which represents the CDR-L2 region of an antibody included the common sequence as-r- (SEQ ID 33). Further, SEQ ID 9 and 21 each of which represents the CDR-L3 region of an antibody include the common sequence qq — ppt (SEQ ID 34).
Similarly, SEQ ID 10, 16 and 22 each of which represents the CDR-Hl region of an antibody include the common sequence sy-m- (SEQ ID 35).
Again, SEQ ID 5, 26 and 29 each of which represents the CDR-H2 region of an antibody include the common sequence sitsgg-ityyp-s- (SEQ ID 36). Alternatively, SEQ ID 11 and 17 each of which represents the CDR-H2 region of an antibody include the common sequence yinp — t-yn-kf (SEQ ID 37)
Again, SEQ ID 6, and 27 each of which represent the CDR-H3 region of an antibody include the common sequence g-fayw (SEQ ID 38). Alternatively, SEQ ID 12 and 18 each of which represent the CDR-H3 region of an antibody include the common sequence amdyw (SEQ ID 39).
Thus each of the antibodies may be described as CDR-Ll comprising either SEQ ID 19, SEQ ID 31 or SEQ ID 32; CDR-L2 comprising either SEQ ID 2, SEQ ID 20 or SEQ ID 33; CDR-L3 comprising either SEQ ID 3, SEQ ID 15 or SEQ ID 34; CDR- Hl comprising either SEQ ID 4 or SEQ ID 35; CDR-H2 comprising SEQ ID 23, SEQ ID 36 or SEQ ID 37 and CDR-H3 comprising SEQ ID 24, SEQ ID 38 or SEQ ID 39.
The full amino acid sequences of the selected sc-Fv antibody-phage are as follows (linker sub-unit GGGGS): vpaplO (1 linker) divmtqsplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrfsgvpdrfsgsgsgtdftlkisr veaedlgvyycfqgshvpwtfgggtkleikrggggsgggggsdvkwesggglvkpggslklscaasgftfsnsams wgrqtpekrlewvasitsggityypdsvkgrftisrddarnilylqmsslrsedtamyycargdyryaegafaywgqgt lvtvsa (SEQ ID 40)
vpap34 (4 linkers) divmtqsqkfinstsvgdrvsvtckasqnvgtnvawyqqkpgqspkaliysasyrysgvpdrftgsgsgteftftissv qaedlavyycqqhysipptfgggtkleikrggggsggggsggggsggggsevqlqqsgaelarpgasvkmsckasg ytftsytmhwvkqrpgqglewigyinpnagythynqkfkekatltadkssstvymqlssltsedsavyycarwsdra mdywgqgtsvtvss (SEQ ID 41)
ypap37 (2 linkers) diqmnqsqkfiiisasvgdrvsitckasqnvrsavawyqqkpgqspkaliylasnrhtgvpdrftgsgsgtdftltisnvq sedladyfclqhwnyplafgagtkleikrggggsggggsgggsggggsqvqlkesgpelvkpgasvknisckasgyt ftsyvmhwvkqkpgqglewigyinpyndgtkynekfkgkatltsdkssstaymelssltsedsavyycargllrlqya mdywgqgtsvtvss (SEQ ID 42)
vpap43 (1 linker)
divltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiyatsklasgvparfsgsgsgtsysltissvea edaatyycqqwssnpptfgggtkleikrggggsevkwekkeglvkpggslklscaasgftfssyamswvrqtpekrl ewvatissggsytyypdsvkgrftisrdnakntlylqmsslrsedtahvUcktgvttrwhgllgssnlsqrllglgeg (SEQ ID 43) vpap44 (3 linkers) divmtqtplslpvslgdqasiscrssqiialsngntylewylqkpgqspklliykvsnrfsgvpdrfsgsgsgtdftlkitrv eaedlgvyycfqshvpwtfgggtklelkrggggsggggsggggsggggpevkwesggglvkpggslklscaasgft fsnsamswarqtpekrlewqvasitsggityypdsakgrftisrddarnilylamnslrsedtalyycargdhrvqqggf aywgqgtlgtgfagfgaqiqpkliseenl (SEQ ID 44)
vpap47 (2 linkers) dilmtqtplslpvslgdqasiscrssqsialsngntylewylqkpgqspklliykvsnrfsgvpdrfsgsgsgtdftlkisrv eaedlgvyycfqgshvpwtfgggtkleikrggggsggggsevqlvesggglvkpggslklscaasgftfsnsamswa rqipekrlewvasitsggityypgsakgrftisrddarnilylqmnslrsedtahvflckrgl (SEQ ID 45)
The cross reactivity of each selected scFv antibody against closely related Bacillus species as determined by ELISA is reported in Table II.
Figure imgf000019_0001
Table II As may be seen, each sc-Fv antibody showed high specificity for B. anthracis viz., no cross-reactivity.
Results are expressed as the % of the maximum signal seen in the assay. +++ indicates 60-100% of the maximum, ++ indicates 20-59% of the maximum and + indicates a signal greater than the detection threshold (defined as the background signal plus 3 standard deviations from the mean background signal). - indicates a signal below the detection threshold.
The full DNA sequences encoding the vpap library were determined to be as follows:
vpaplO
GACTACAAAGACATTGTGATGACCCAGTCTCCACTCTCCCTGCCTGTCAGT CTTGGAGATCAAGCCTCCATCTCTTGCAGATCTAGTCAGAGCATTGTACAT AGTAATGGAAACACCTATTTAGAATGGTACCTGCAGAAACCAGGCCAGTC TCCAAAGCTCCTGATCTACAAAGTTTCCAACCGATTTTCTGGGGTCCCAGA CAGGTTCAGTGGCAGTGGATCAGGGACAGATTTCACACTCAAGATCAGCA GAGTGGAGGCTGAGGATCTGGGAGTTTATTACTGCTTTCAAGGTTCACAT GTTCCGTGGACGTTCGGTGGAGGCACCAAGCTGGAAATCAAACGTGGTGG TGGTGGTTCTGGTGGTGGTGGTTCTGGCGGCGGCGGCTCCGGTGGTGGTG GATCCGGCTTAGTGAAGCCTGGAGGGTCCCTGAAACTCTCCTGTGCAGCC TCTGGATTCACTTTCAGTAACTCTGCCATGTCTTGGGGTCGCCAGACTCCA GAGAAGAGGCTGGAGTGGGTCGCATCCTTACTAGTGGTGGTATCACCTAC TATCCAGACAGTGTGAAGGGCCGATTACCATCTCCAGAATGATGCCCGGA CATCCCTGTTTTGCAAAGAGCAGTCTGAGGTTTGAGGACACGGCCATGTTT TACTGTGCAAGAGGGGACTATTGGGTCCCCCAAGGGGGTTTTGTTTCCTGG GCCAAGGGACTCTGGTCACTGTTTCTCGG
vpap34
GACTACAAAGATATTGTAATGACCCAGTCTCAAAAATTCATGTCCACATC AGTAGGAGACAGGGTCAGCGTCACCTGCAAGGCCAGTCAGAATGTGGGT ACTAATGTAGCCTGGTATCAACAGAAACCAGGGCAATCTCCTAAAGCACT GATTTACTCGGCATCCTACCGGTACAGTGGGGTCCCTGATCGCTTCACTGG CAGTGGATCTGGGACGGAATTCACTTTCACCATCAGCAGTGTGCAGGCTG AAGACCTGGCAGTTTATTACTGTCAGCAACATTATAGTATTCCTCCGACGT TCGGTGGAGGCACCAAGCTGGAAATCAAACGTGGTGGTGGTGGTTCTGGT GGTGGTGGTTCTGGCGGCGGCGGCTCCGGTGGTGGTGGATCCGAGGTGCA GCTGCAGCAGTCTGGGGCTGAACTGGCAAGACCTGGGGCCTCAGTGAAGA TGTCCTGCAAGGCTTCTGGCTACACCTTCACTAGCTACACGATGCACTGGG TAAAACAGAGGCCTGGACAGGGTCTGGAATGGATTGGATACATTAATCCT AACGCTGGTTATACTCATTACAATCAGAAGTTCAAGGAGAAGGCCACATT GACTGCAGACAAATCCTCCAGCACAGTCTACATGCAACTGAGCAGCCTGA CATCTGAGGACTCTGCAGTCTATTACTGTGCTAGATGGTCCGACCGTGCTA TGGACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCG
vpap37
GACTACAAAGATATTCAGATGAACCAGTCTCAAAAATTCATGTCCGCATC AGTAGGAGACAGGGTCAGCATCACCTGCAAGGCCAGTCAGAATGTTCGTT CTGCTGTAGCCTGGTATCAACAGAAACCAGGGCAGTCTCCTAAAGCACTG ATTTACTTGGCATCCAACCGGCACACTGGAGTCCCTGATCGCTTCACAGGC AGTGGATCTGGGACAGATTTCACTCTCACCATTAGCAATGTTCAATCTGAG GACCTGGCAGATTATTTCTGTCTGCAACATTGGAATTATCCTCTCGCGTTC GGTGCTGGGACCAAGCTGGAAATAAAACGTGGTGGTGGTGGTTCTGGTGG TGGTGGTTCTGGCGGCGGCGGCTCCGGTGGTGGTGGATCCGAGCAGCTGC AGGAGTCTGGACCTGAGCTGGAAAAGCCTGGGGCTCTAATGAGAGAGCTC TGCAACAGTTTTTGGATACACAGTGGCTATGCTAAACAATACACTCTGCTA TGAAGAAGCCTGTGTTATGGCTTACCTGGAACTGACCTATTAACACTTACG AAACCTGTCCTGACACATTGATTAATGAATAGGCCAAGCCACAGTGAGAG GGACAAATCCTCCAGCACAGCCTACATGGAGCTCAGCAGCCTGACCTCTG AGGACTCTGCGGTCTATTACTGTGCAAGAGGGTTACTACTACAGTTTCAAN ATGCTGTCCACTCTGGGTTGCCCCAAACGGCAAAAACCTTTTTTATGGGCT GGAAGGGCAGGAATAACAAAAAC
vpap43
CGCGGCCAGATTATGAAATATCTGCTGCCGACCGCGGCGGCGGGCCTGCT GCTGCTGGCGGCGCAGCCGGCGATGGCGGATTATAAAGATATTGTGCTGA CCCAGAGCCCGGCGATTATGAGCGCGAGCCCGGGCGAAAAAGTGACCAT GACCTGCAGCGCGAGCAGCAGCGTGAGCTATATGCATTGGTATCAGCAGA AAAGCGGCACCAGCCCGAAACGCTGGATTTATGCGACCAGCAAACTGGCG AGCGGCGTGCCGGCGCGCTTTAGCGGCAGCGGCAGCGGCACCAGCTATAG CCTGACCATTAGCAGCGTGGAAGCGGAAGATGCGGCGACCTATTATTGCC AGCAGTGGAGCAGCAACCCGCCGACCTTTGGCGGCGGCACCAAACTGGA AATTAAACGCGGCGGCGGCGGCAGCGAAGTGAAAGTGGTGGAAAAAAAA GAAGGCCTGGTGAAACCGGGCGGCAGCCTGAAACTGAGCTGCGCGGCGA GCGGCTTTACCTTTAGCAGCTATGCGATGAGCTGGGTGCGCCAGACCCCG GAAAAACGCCTGGAATGGGTGGCGACCATTAGCAGCGGCGGCAGCTATA CCTATTATCCGGATAGCGTGAAAGGCCGCTTTACCATTAGCCGCGATAAC GCGAAAAACACCCTGTATCTGCAGATGAGCAGCCTGCGCAGCGAAGATAC CGCGCATGTGCTGCTGTGCAAAACCGGCGTGACCACCCGCTGGCATGGCC TGCTGGGCAGCAGCAACCTGAGCCAGCGCCTGCTGGGCCTGGGCGAAGGC
vpap44
GACTACAAAGATATTGTGATGACCCAAACTCCACTCTCCCTGCCTGTCAGT CTTGGAGATCAAGCCTCCATCTCTTGCAGATCTAGTCAGATCATTGCACTT AGTAATGGAAACACCTATTTAGAATGGTATTTGCAGAAACCAGGCCAGTC TCC AAAGCTCCTGATCTAC AAAGTTTCC AACCGATTTTCTGGGGTCCC AGA CAGGTTCAGTGGCAGTGGATCAGGGACAGATTTCACACTCAAGATCACCA GAGTGGAGGCTGAGGATCTGGGAGTTTATTACTGCTTTCAAGGTTCACAT GTTCCGTGGACGTTCGGTGGAGGCACCAAGCTGGAGCTGAAACGTGGTGG TGGTGGTTCTGGTGGTGGTGGTTCTGGCGGCGGCGGCTCCGGTGGTGGTG GACCCGAGGTGAAGGTGGTGGAGTCTGGGGGAGGCTTAGTGAAGCCTGG AGGGTCCCTGAAACTCTCCTGTGCAGCCTCTGGATTCACTTTCAGTAACTC TGCCATGTCTTGGGCTCGTCAGACTCCAGAGAAGAGGCTGGAATGGGTCG CATCCATTACTAGTGGGGGTATCACCTACTATCCAGACAGTGCGAAGGGC CGATTCACCATCTCCAGAGATGATGCCCGGAACATCCTGTACCTTGCAATG AACAGTCTGAGGTCTGAGGACACGGCCCTGTATTACTGTGCAAGAGGGGA CCATAGGGTCCAACAAGGGGGCTTTGCTTACTGGGGGCAAGGGACTCTTG GTACT vpap47
CGCGGCCAGATTATGAAATATCTGCTGCCGACCGCGGCGGCGGGCCTGCT GCTGCTGGCGGCGCAGCCGGCGATGGCGGATTATAAAGATATTCTGATGA CCCAGACCCCGCTGAGCCTGCCGGTGAGCCTGGGCGATCAGGCGAGCATT AGCTGCCGCAGCAGCCAGAGCATTGCGCTGAGCAACGGCAACACCTATCT GGAATGGTATCTGCAGAAACCGGGCCAGAGCCCGAAACTGCTGATTTATA AAGTGAGCAACCGCTTTAGCGGCGTGCCGGATCGCTTTAGCGGCAGCGGC AGCGGCACCGATTTTACCCTGAAAATTAGCCGCGTGGAAGCGGAAGATCT GGGCGTGTATTATTGCTTTCAGGGCAGCCATGTGCCGTGGACCTTTGGCGG CGGCACCAAACTGGAAATTAAACGCGGCGGCGGCGGCAGCGGCGGCGGC GGCAGCGAAGTGCAGCTGGTGGAAAGCGGCGGCGGCCTGGTGAAACCGG GCGGCAGCCTGAAACTGAGCTGCGCGGCGAGCGGCTTTACCTTTAGCAAC AGCGCGATGAGCTGGGCGCGCCAGACCCCGGAAAAACGCCTGGAATGGG TGGCGAGCATTACCAGCGGCGGCATTACCTATTATCCGGGCAGCGCGAAA GGCCGCTTTACCATTAGCCGCGATGATGCGCGCAACATTCTGTATCTGCAG ATGAACAGCCTGCGCAGCGAAGATACCGCGCATGTGTTTCTGTGCAAACG CGGCCTG
Referring now to Figure 2, there is shown a phylogenetic tree describing the relationship between the entire sequence of the selected antibodies (marked by dot) and a range of other non-specific antibodies.
As may be seen, many of these antibodies show significant similarity. Further examination of the CDR-H3 region in the closely related antibodies vpaplO and vpap 44 reveals that a 38% variation in a single CDR is tolerated without loss of specificity (gdyryaegafayw differs from gdhrvqqggfayw in 5 out of 13 amino acids).
References The following references, referred to throughout the specification, are incorporated by reference in their entirety herein.
1. Zhou B., Wirsching P. and Janda K.D. "Human Antibodies against Spores of the Genus Bacillus: A Model Study for Detection of and Protection against Anthrax and the Bioterrorist Threat", PNAS, 2002, 99, 5241-5246.
2. Krebber A., Bornhauser S., Burmester J., Honegger A., Willuda J., Bosshard H.R. and Pluckthun A., "Reliable Cloning of Functional Antibody Variable Domains from Hybridomas and Spleen Cell Repertoires Employing a Reengineered Phage Display System", Journal of Immunological Methods, 1997, 201, 35-55.
3. Krebs B., Rauchenberger, R., Reiffert, S., Rothe, C, Tesar, M., Thomassen, E., Cao, M., Dreier, T., Fischer, Hoss, A., "High-Throughput generation and Engineering of Recombinant Human Antibodies", J. Immunol. Methods, 2004, 254. 67-84.
4. Cai X. and Garen, A. "Anti-Melanoma Antibodies from Melanoma Patients Immunised with Genetically Autologous Tumour Cells: Selection of Specific Antibodies from Single-Chain Fv Fusion Phage Libraries", Proc. Natl. Acad. Sci. USA, 1995, 92, 6537-6541. 5. Lipman DJ. and Pearson, W.R., "Rapid and Sensitive Protein Similarity Searches", Science, 1985, 227, 1435-1441.
6. Martin, A.C.R. "Protein Sequence and Structure Analysis of Antibody Variable Domains, Antibody Engineering Laboratory Manual", Eds. Kontermann, R. and Dubel, S., Springer- Verlag, Heidelberg, pp 423-439.

Claims

1. A method for the production of antibody specific for B. anthracis comprising the steps of i) generating an immune scFv phage-display library and ii) panning the library against immobilised B. anthracis spore in the presence of spore from one or more other Bacillus species.
2. A method according to Claim 1, in which the scFv library is positive against immobilised B. anthracis spore.
3. A method according to Claim 2, in which the one or more other species comprise /?, cereus.
4. A method according to any preceding Claim, in which step ii) is the first panning step.
5. A method according to any preceding Claim, in which step ii) is repeated up to three times.
6. A B. anthracis specific antibody comprising at least one of SEQ ID 2, SEQ ID 3, SEQ ID 4, SEQ ID 15, SEQ ID 19, SEQ ID 20, SEQ ID 24, SEQ ID 30, SEQ ID 31, SEQ ID 32, SEQ ID 33, SEQ ID 34, SEQ ID 35, SEQ ID 36, SEQ ID SEQ ID 37, SEQ ID 38, SEQ ID 39 or a variant or a fragment thereof.
7. A B. anthracis specific antibody according to Claim 6, in which CDR-Ll comprises any one of SEQ ID 19, SEQ ID 31 and SEQ ID 32; CDR-L2 comprises any one of SEQ ID 2, SEQ ID 20 and SEQ ID 33; CDR-L3 comprises any one of SEQ ID 3, SEQ ID 15 and SEQ ID 34; CDR-Hl comprises any one of SEQ ID 4 or SEQ ID 35; CDR-H2 comprises any one of SEQ ID 23, SEQ ID 36 and SEQ ID 37; and CDR- H3 comprises any one of SEQ DD 24, SEQ ID 38 and SEQ ID 39.
8. A B. anthracis specific antibody according to Claim 6, comprising any one of SEQ ID 1 to 6 or SEQ ID 7 to 12, or SEQ ID 13 to 18 or SEQ ID 19 to 24 or SEQ ID 2 to 4 and 25 to 27 or SEQ ID 2 to 5 and 28 to 30.
9. A B. anthracis specific antibody according to Claim 6, comprising any one of SEQ ID 1 to 45 or a variant or a fragment thereof.
10. A method for detecting anthrax comprising detecting the binding of B. anthracis spores to an antibody according to any of Claims 6 to 9.
11. A biosensor comprising an antibody according to any of Claims 6 to 9.
12. A polynucleotide encoding an antibody according to any of Claims 6 to 9.
13. A pharmaceutical composition comprising a humanised antibody according to any of Claims 6 to 9.
14. A composition according to Claim 13, which composition comprises a vaccine.
15. An antibody according to any of Claims 6 to 9, for use in therapy.
16. Use of an antibody according to any of Claims 6 to 9 in the preparation of a medicament for the treatment of anthrax infection.
17. An anti-idiotypic antibody to an antibody according to any of Claims 6 to 9.
PCT/GB2007/002271 2006-06-23 2007-06-20 Antibody for anthrax Ceased WO2007148065A2 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GB0612456.4 2006-06-23
GB0612456A GB0612456D0 (en) 2006-06-23 2006-06-23 Antibody for anthrax

Publications (2)

Publication Number Publication Date
WO2007148065A2 true WO2007148065A2 (en) 2007-12-27
WO2007148065A3 WO2007148065A3 (en) 2008-03-20

Family

ID=37908557

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/GB2007/002271 Ceased WO2007148065A2 (en) 2006-06-23 2007-06-20 Antibody for anthrax

Country Status (2)

Country Link
GB (1) GB0612456D0 (en)
WO (1) WO2007148065A2 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010126670A3 (en) * 2009-03-27 2011-03-31 Gojo Industries, Inc. Compositions and methods for screening and using compounds antagonizing spore-surface interactions

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6913756B1 (en) * 1998-04-29 2005-07-05 The Uab Research Foundation Monoclonal antibodies specific for anthrax and peptides derived from the antibodies thereof
ES2376337T3 (en) * 2004-03-03 2012-03-13 Iq Therapeutics Bv NEUTRALIZING MONOCLONAL ANTIBODIES OF THE X? NTRAX HUMANS AND METHODS FOR USE.
US20070292390A1 (en) * 2004-10-29 2007-12-20 Dimitrov Dimiter S Broadly Cross-Reactive Hiv-1 Neutralizing Human Monoclonal Antibodies

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010126670A3 (en) * 2009-03-27 2011-03-31 Gojo Industries, Inc. Compositions and methods for screening and using compounds antagonizing spore-surface interactions
CN102388064A (en) * 2009-03-27 2012-03-21 高裘企业公司 Compositions and methods for screening and using compounds antagonizing spore-surface interactions

Also Published As

Publication number Publication date
WO2007148065A3 (en) 2008-03-20
GB0612456D0 (en) 2007-03-28

Similar Documents

Publication Publication Date Title
US12441813B2 (en) Antibodies for botulinum neurotoxins
Hayhurst et al. Isolation and expression of recombinant antibody fragments to the biological warfare pathogen Brucella melitensis
US20120264647A1 (en) Donor specific antibody libraries
US20080213224A1 (en) Immunoglobulin against helicobacter pylori
Abbady et al. Evaluation of a nanobody phage display library constructed from a Brucella-immunised camel
WO2009008916A2 (en) Therapeutic monoclonal antibodies that neutralize botulinum neurotoxins
KR101192130B1 (en) Antibodies to outer membrane proteins of Vibrio bacteria and methods for detecting the bacteria using the same
De Bolle et al. Antigenic properties of peptidic mimics for epitopes of the lipopolysaccharide from Brucella
Wang et al. Detection of B. anthracis spores and vegetative cells with the same monoclonal antibodies
CN120988117B (en) Antibodies against Staphylococcus aureus enterotoxin B and their applications
Sepulveda et al. Design and testing of PCR primers for the construction of scFv libraries representing the immunoglobulin repertoire of rats
Love et al. Real time detection of anthrax spores using highly specific anti-EA1 recombinant antibodies produced by competitive panning
CN119798427B (en) Nano antibody capable of specifically recognizing staphylococcus aureus as well as preparation method and application thereof
Saldarelli et al. Isolation of recombinant antibodies (scFvs) to grapevine virus B
Mersmann et al. Monitoring of scFv selected by phage display using detection of scFv–pIII fusion proteins in a microtiter scale assay
Ghadjari et al. Epitope mapping Candida albicans proteinase (SAP 2)
US20090215092A1 (en) Antibodies for Anthrax
WO2007148065A2 (en) Antibody for anthrax
Bhatia et al. Single-chain fragment variable antibody against the capsid protein of bovine immunodeficiency virus and its use in ELISA
Pokorny et al. Inhibition of Cryptosporidium parvum infection of a mammalian cell culture by recombinant scFv antibodies
EP4108672A1 (en) Antibody screening method
Boulter-Bitzer et al. Single-chain variable fragment antibodies selected by phage display against the sporozoite surface antigen P23 Of Cryptosporidium parvum
JPWO2004087764A1 (en) Recombinant antibody that recognizes dioxin and gene encoding the antibody
CN115057927B (en) Peanut allergen Ara h1 specific nano-antibody and application thereof
Ravn et al. Identification of phage antibodies toward the Werner protein by selection on Western blots

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 07733273

Country of ref document: EP

Kind code of ref document: A2

NENP Non-entry into the national phase

Ref country code: DE

NENP Non-entry into the national phase

Ref country code: RU

122 Ep: pct application non-entry in european phase

Ref document number: 07733273

Country of ref document: EP

Kind code of ref document: A2