WO2007138236A1 - Sheddase enzymes for neuron growth - Google Patents
Sheddase enzymes for neuron growth Download PDFInfo
- Publication number
- WO2007138236A1 WO2007138236A1 PCT/GB2006/001904 GB2006001904W WO2007138236A1 WO 2007138236 A1 WO2007138236 A1 WO 2007138236A1 GB 2006001904 W GB2006001904 W GB 2006001904W WO 2007138236 A1 WO2007138236 A1 WO 2007138236A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- sheddase
- tace
- ntf
- analogue
- derivative
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/48—Hydrolases (3) acting on peptide bonds (3.4)
- A61K38/4886—Metalloendopeptidases (3.4.24), e.g. collagenase
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
- A61K38/1825—Fibroblast growth factor [FGF]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
- A61K38/185—Nerve growth factor [NGF]; Brain derived neurotrophic factor [BDNF]; Ciliary neurotrophic factor [CNTF]; Glial derived neurotrophic factor [GDNF]; Neurotrophins, e.g. NT-3
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
- C12Y304/24—Metalloendopeptidases (3.4.24)
- C12Y304/24081—ADAM10 endopeptidase (3.4.24.81)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
- C12Y304/24—Metalloendopeptidases (3.4.24)
- C12Y304/24086—ADAM 17 endopeptidase (3.4.24.86), i.e. TNF-alpha converting enyzme
Definitions
- the present invention relates to neuron growth, and particularly to the modulation of neural growth and regeneration in the central nervous system.
- the invention also provides medicaments, and in vivo and ex vivo methods of using such medicaments to modulate neuron and neurite growth.
- Nerve cells or neurons can be generally divided into three main functional parts, i.e. the cell body, the axon, and the dendrites.
- the cell body is where cellular metabolism occurs, and the dendrites are the part of the cell that receive signals and conducts these signals to the rest of the neuron.
- the axon is responsible for passing these signals between neighbouring neurons.
- the term neurites is used to define either axons or dendrites when the neuron is in cell culture, i.e. in vitro or ex vivo.
- Axons and dendrites elongate profusely during development both in the central nervous system (CNS) and peripheral nervous systems (PNS) of all animal species.
- CNS central nervous system
- PNS peripheral nervous systems
- axonal and dendritic regrowth in the CNS is increasingly lost with evolutionary progression.
- axons of all vertebrate species are able to regrow to some extent.
- axon regrowth following damage is limited to axon sprouting. Regrowth of neuronal processes is, however, possible in the CNS of lower vertebrate species.
- Glia are the decisive determinants for controlling axon regrowth.
- Mammalian glia are generally permissive for axon outgrowth in the CNS during development and in the adult PNS.
- glia of the adult mammalian PNS can re-express their earlier axon outgrowth-promoting potential and foster regeneration.
- the CNS glia of some lower vertebrates remain permissive for axon regrowth in adulthood.
- CNS glia of adult mammals do not re-express their developmental growth properties following lesions.
- repair and regrowth of neurons in the CNS following a lesion is at best very limited.
- Axon/neurite branching relates to the number of axons/neurites that are associated with a cell body of the neuron. Hence, branching is a measure of axon density, whether an axon either grows out from the cell body itself, or forms a sub-branch off another axon.
- Axon/neurite outgrowth relates to the lengths of the axons/neurites associated with the cell body.
- Neurotrophic factors are present during the normal development of the nervous system. During such development, neuronal target structures produce limited amounts of specific NTFs necessary for the survival, differentiation and growth of the neurons projecting into target structures. NTFs promote the survival and/or maintenance of mature neurons and are primary determinants of neuronal regeneration after CNS injury. Furthermore, peripheral nerve glia (i.e. Schwann Cells) produce neurotrophic factors (NTF) which are presumed, to be responsible for axon regeneration after injury in the adult PNS.
- NTF Neurotrophic factors
- TGF ⁇ j Transforming Growth Factor ⁇ l
- TGF ⁇ i participates in scar formation, which in turn restricts the growth of axonal projections in the injured CNS around the scarred region, probably by active axon growth inhibition via the inhibitory ligands like CSPG contained therein. They showed that blocking TGF ⁇ i activity did suppress scarring. However, there was little or no associated axon growth, suggesting that blocking scar formation and the production of some categories of inhibitory molecules does not lead to enhanced axon regeneration. Therefore, there is a distinct need to provide regenerative therapies that can promote neural growth in the CNS. Such therapies may be used to enable damaged or diseased nerves to survive, re-grow and function again following injury or lesion.
- CNS myelin is a rich source of axon growth inhibitors, including myelin associated glycoprotein (MAG), oligodendrocyte myelin glycoprotein (OMgp), Nogo and, chondroitin sulphate proteoglycans (CSPG), which arrest axon growth by binding to the Nogo-66 receptor (NgR).
- MAG myelin associated glycoprotein
- OMgp oligodendrocyte myelin glycoprotein
- Nogo chondroitin sulphate proteoglycans
- the Nogo receptor associates with LINGO- 1 (LRR and Ig domain-containing Nogo receptor interacting protein) and either the low affinity neurotrophin receptor (p75 NTR ), or TROY, to initiate growth cone collapse via the Rho-A inhibitory signalling pathway and/or Ca 2+ -dependent activation of epidermal growth factor receptor (EGFR) through an unknown signalling pathway.
- LINGO- 1 LRR and Ig domain-containing Nogo receptor interacting protein
- p75 NTR low affinity neurotrophin receptor
- TROY TROY
- NgR, p75 NTR , TROY, EGFR, and the RhoA inhibitory molecule collectively form key elements of the Rho-A axon growth inhibitory pathway. It will be appreciated that numerous other molecules, such as ROCK/LIM, cofilin and LINGO-I, are also involved in the pathway.
- the inventors decided to see if it is possible to find alternative therapeutic strategies for enhancing axon growth in vivo (or neurite growth ex vivo) based on their investigations of the Rho-A growth inhibitory pathway.
- the inventors investigated the use of enzymes known as sheddases, which proteolytically cleave membrane-bound proteins to release their Extracellular Domain (ECD) 5 as they thought that these could have an effect on neuron growth, and therefore may have a therapeutic use.
- ECD Extracellular Domain
- TACE tumor necrosis factor
- TNF tumor necrosis factor
- TACE tumor necrosis factor- ⁇ converting enzyme
- ADAMs metalloprotease-disintegrin family
- TACE is known to be produced by the glia in brain tissue in minute amounts but, up until now, the specific role and function of TACE in the brain has not been understood.
- CNS glia of adult mammals do not re-express their developmental growth properties, including production of TACE. Hence, up until now, any potential therapeutic effect of TACE has not been realised.
- the inventors therefore investigated disinhibition of axon outgrowth using an in vitro model in which addition of a pre-determined inhibitory concentration of CNS myelin ligands to dorsal root ganglion cell (DRG) cultures blocked FGF2-stimulated neurite outgrowth from DRG neurons (DRGN).
- DRG dorsal root ganglion cell
- TACE sheddase enzyme
- a sheddase enzyme or analogue, or derivative, or activator thereof, for use as a medicament.
- the inventors also believe that they are the first to demonstrate that the medicament of the first aspect, which cleaves the ectodomain of NgR and p75 NTR and TROY to thereby block Rho-A activation of the Rho-A inhibitory pathway, may be used for promoting axon and/or neurite branching and/or outgrowth.
- a sheddase enzyme or analogue, or derivative, or activator thereof, for the manufacture of a medicament for promoting axon and/or neurite branching and/or outgrowth.
- axons are responsible for passing the nerve signals between neighbouring neurons in vivo, and that the term "neurites" is used to define either axons or dendrites when in cell culture (i.e. ex vivo or in vitro).
- a significant advantage of the invention is that the number, the length, and also branches of axons or neurites increases when exposed to the medicament comprising the sheddase or analogue, derivative or activator thereof. Accordingly, as the number, length and extent of branching of axons/neurites increase upon exposure to the sheddase, so too does the likelihood of achieving a functional connection with adjacent axons/neurites either in the body or in culture. Hence, damaged or dis-connected circuits of axons or neurites may be effectively re-connected upon treatment with the medicament of the first or second aspect aspect, which is a significant surprising advantage.
- Rho-A inhibitory pathway we mean the axon growth inhibitory pathway, which includes the NgR, p75 NTR , TROY, EGFR, and RhoA inhibitory molecules, amongst others, which will be known to the skilled technician.
- promoting axon and/or neurite branching we mean the number of branches (or Off-shoots') from axons or neurites (ex vivo or in vitro) increases when in the presence of the medicament comprising a sheddase, or analogue, or derivative, or activator thereof, as compared to the number of axons or neurites when the medicament is absent.
- an axon/neurite must be at least 20 ⁇ m long for it to be counted as an axon/neurite (Bouquet et al, J.Neurosci. 24, 7204-7213, 2004).
- promoting axon and/or neurite outgrowth we mean the length of axons (in vivo), or neurites (ex vivo or in vitro) increases when in the presence of the medicament comprising a sheddase, or analogue, or derivative, or activator thereof, as compared to the length of axons or neurites when the medicament is absent.
- the skilled technician will know how to measure whether axon/neurite outgrowth has increased, and an example is given in the Examples section.
- the medicament is used to promote axon and/or neurite branching and/or outgrowth in the Central Nervous System (CNS) and/or the Peripheral Nervous System (PNS) in a subject being treated.
- the medicament is for the treatment of diseases resulting from neural injury, which may have resulted from surgery, trauma, compression, contusion, transection, neurotoxicity, or other physical injury, from vasculature pharmacologic or other insults including hemorrhagic or ischemic damage or from neurodegenerative or other neurological diseases.
- disorders such as spinal cord injury (SCI), glaucoma, and neurodegenerative disorders, such as MS, ALS, Alzheimer's, Parkinson's disease, diabetic neuropathy, and spinal muscular atrophy (SMA).
- SCI spinal cord injury
- glaucoma and neurodegenerative disorders, such as MS, ALS, Alzheimer's, Parkinson's disease, diabetic neuropathy, and spinal muscular atrophy (SMA).
- ailments, characterised by impaired or failing axon growth, which may be treated by the medicament are preferably characterised by neuronal injury.
- the ailment may be chronic or acute brain trauma, spinal cord injury, neurotoxicity, stroke, glaucoma, optic nerve damage, blindness, haemorrhage, facial nerve injury, caused by elective surgery, nerve compression, concussion, ischaemia, burns and the like.
- the inventors were also surprised to establish that use of a sheddase according to the invention may be used to treat conditions characterised by an increase in cell death.
- a sheddase enzyme or analogue, or derivative, or activator thereof, for the manufacture of a medicament for treating or inhibiting cell apoptosis.
- the medicament comprising the sheddase enzyme, or analogue, or derivative, or activator thereof may be used to treat conditions in subjects where neuron (axon or neurite) survival is a significant issue.
- the medicament may be used to treat neurodegenerative diseases such as dementia, Parkinson's Disease, Huntingdon's Disease, Alzheimers Disease, Motor Neuron Disease, CJD, diabetic neuropathy, and the like.
- neurodegenerative diseases such as dementia, Parkinson's Disease, Huntingdon's Disease, Alzheimers Disease, Motor Neuron Disease, CJD, diabetic neuropathy, and the like.
- the sheddase, or analogue, derivative or activator thereof may be used to stimulate neurite outgrowth and/or branching in cell culture, following which the neuronal culture may then be transferred to a subject in need of treatment to repair damaged areas.
- the sheddase, or analogue, derivative or activator thereof may be used to stimulate axon outgrowth and/or branching in vivo in a subject being treated with the medicament of the invention to treat any of the conditions described herein.
- sheddase we mean any one of the known specialized proteases, which are capable of cleaving an extracellular domain (ECD) of a membrane-bound protein.
- ECD extracellular domain
- this post-translational proteolysis step carried out by a sheddase releases a fragment of the membrane protein with a biologically active domain.
- Proteolysis may also control the surface expression of multiple integral membrane proteins, and may be used to down-regulate the protein at the cell surface.
- Sheddases are also referred to in the art as secretases, or membrane-protein- solubilizing proteases (MPSP).
- secretases include ⁇ -secretases.
- the sheddase used in the medicament of the invention may comprise a secretase, and preferably an ⁇ -secretase; or a membrane protein solubilising protease.
- Sheddases may be sub-classified into a number of different sub-categories, such as metalloproteases, cysteine proteases, aspartic proteases, and serine proteases (Blobel C. Nat Rev MoI Cell Biol 2005, 32-43).
- the sheddase. used in the medicament of the invention may comprise an enzyme independently selected from a group consisting of a metalloprotease; a cysteine protease; an aspartic protease; or a serine protease, or any combination thereof.
- each of " these categories of sheddase will comprise many members, and each of the inventors believe that any of these would make effective examples of sheddase for use in the medicament according to the invention.
- cysteine proteases require a cysteine residue for activity, examples of which include caspases and cathepsins.
- the sheddase used in the medicament may comprise a caspase or cathepsin.
- the sheddase used in the medicament may comprise a pepsin.
- the sheddase used in the medicament may comprise a kallikrein.
- the sheddase used comprises a metalloprotease.
- Metalloproteases which require a metal ion, include ACEs, MMPs, NEPs and ADAMs.
- the sheddase used in the medicament preferably comprises a metalloprotease independently selected from a group consisting of angiotensin converting enzyme (ACE), matrix metalloproteinase (MMP), NEP, and a disintegrin and metalloproteinase (ADAM).
- ACE angiotensin converting enzyme
- MMP matrix metalloproteinase
- ADAM disintegrin and metalloproteinase
- the metal ion is zinc in most cases and so the enzymes are referred to as zinc metalloproteinases.
- the sheddase used in the medicament comprises a metalloproteinase, and more preferably, a zinc metalloproteinease.
- a metalloproteinase and more preferably, a zinc metalloproteinease.
- metalloproteases are those, which are characterised by a disintegrin and a metalloproteinase domain, which are known in the art as ADAMs.
- ADAMs There are at least 30 ADAMs (ADAM 1 to ADAM 30), which are typically 700-800 amino acids in length and are composed of, from the N-terminus, a pro-peptide region, a reprolysin-type Zn- metalloproteinase domain, a disintegrin domain, a cysteine-rich region, a transmembrane region and a cytoplasmic tail.
- the removal of the pro-peptide domain is required for activation of the metalloproteinase.
- the sheddase used in the medicament comprises an ADAM enzyme.
- the sheddase used in accordance with the invention comprises at least one enzyme selected from the group consisting of ADAMl to ADAM 30, i.e. ADAM 1, ADAM 2, ADAM 3, and so on to ADAM 30.
- a preferred sheddase comprises ADAM 10.
- a more preferred ADAM which may be used in accordance with the invention, comprises ADAM 17.
- ADAM 17 is also known in the art as Tumor Necrosis Factor- ⁇ Converting Enzyme (i.e. TACE), or CD156q.
- TACE Tumor Necrosis Factor- ⁇ Converting Enzyme
- CD156q CD156q.
- TACE sheddase
- the mRNA transcript for TACE has accession code NM_003183, and comprises substantiallythe following sequence:-
- protein sequence of human TACE has accession code NP_003174, and comprises substantially the following sequence:-
- Examples 1 and 2 describe a test paradigm delivering the sheddase, TACE, against p75 NTR mRNA in cultured Dorsal Root Ganglion Cells (DRGC), which have been treated with FGF-2 in the presence of inhibitory CNS myelin extract.
- DRGC Dorsal Root Ganglion Cells
- the inventors found to their surprise that the addition of exogenous TACE on its own induced neurite outgrowth and branching in the DRGC neurons in the presence of inhibitory CNS myelin extract, both in the presence and also the absence of a neurotrophic factor, such as FGF-2.
- TACE Neurotrophic Factor
- Suitable growth stimulators may include any Neurotrophic Factor (NTF).
- NTF Neurotrophic Factor
- the medicament of the first aspect or the use of the second or third aspect comprises combining the sheddase, or analogue, derivative or activator thereof, with a neurotrophic factor (NTF), for the manufacture of the medicament.
- NTF neurotrophic factor
- the inventors believe that use of these two components results in the manufacture of a very effective medicament for treating disease conditions characterised by damaged or impaired nerves.
- the NTF may be either TRK- dependent or TRK-independent.
- An example of a preferred NTF includes Ciliary Neurotrophic Factor (CNTF) or Fibroblast Growth Factor 2 (FGF2).
- CNTF Ciliary Neurotrophic Factor
- FGF2 Fibroblast Growth Factor 2
- NTFs that may be used in conjunction with a sheddase include but are not limited to:- NGF, NT-3, NT-4, BDNF, GDNF, FGF-I, FGF-5, CT-I, CDF, insulin, IGF-I, IGF-2, IL-6, LIF, NPF, PDGF, PN-I, S-IOO, TGF- ⁇ , and VIP (Oppenheim, 1996, Neuron 17:195-197).
- CSPG chondroitin sulphate proteoglycans
- the medicament of the invention comprises a sheddase, or analogue, derivative or activator thereof, and an axon/neurite growth stimulating molecule.
- axon/neurite growth stimulatory molecule examples include myelin-related molecules, chondroitin sulphate proteoglycans (CSPG), ephrins and semaphorins.
- the use of the sheddase not only reverses inhibition of the NTF-stimulated axonal growth caused by myelin-derived neurite growth inhibitor molecules such as the myelin-related molecules indicated, but also surprisingly stimulates axon outgrowth and branching to a greater extent than seen in the absence of the myelin-derived inhibitor molecules.
- the effect is greater than found in control experiments in which neurites are stimulated with an NTF in the absence of myelin-derived • neurite growth inhibitor molecules. Again, the inventors believe that this effect was totally unexpected.
- the medicament of the invention comprises a sheddase, or analogue, derivative or activator thereof, and a neurotrophic factor (NTF).
- NTF neurotrophic factor
- activator of a sheddase enzyme we mean a positive modulator, or an agonist of a sheddase enzyme, which may be present in a subject to be treated.
- Suitable activators may comprise:- (i) compounds, which increase the expression, transcription, or translation and therefore concentration of sheddase; and (ii) compounds, which decrease the rate of degradation of the sheddase, or analogue or derivative thereof.
- the sheddase activator may comprise a sheddase expression system adapted to increase the expression level and, hence, concentration of the sheddase or analogue or derivative thereof in a target cell, preferably in a subject to be treated.
- the expression system may be administered to target cells in the CNS. It is preferred that the expression system may be administered directly to the site requiring promotion of axon/neurite outgrowth and branching.
- the expression system comprises a nucleic acid sequence encoding a sheddase enzyme or analogue or derivative thereof, and preferably comprises elements capable of controlling and/or enhancing expression of the nucleic acid.
- the nucleic acid sequence may be a DNA sequence, which is preferably derived from the same source as the subject, which is to be treated, for example, human.
- sequences for suitable sheddase enzymes which may be used according to the invention will be known to the skilled technician, and may be readily obtainable from publicly available databases.
- the DNA sequence for human TACE comprises SEQ ID NO.l, which is publicly available, and the mRNA and protein sequences for human TACE are given as SEQ ID No.2 and SEQ ID No.3, respectively, which are also publicly available. Therefore, by way of example, the sequence of the nucleic acid in the expression system may be a nucleotide sequence such as SEQ ID No.l, which may be transcribed into the mRNA of SEQ ID No.2, which may be translated into the sheddase enzyme, TACE, for example, as identified as SEQ ID No.3.
- the nucleic acid may be contained within a suitable vector to form a recombinant vector.
- the vector may be derived from a plasmid, cosmid, phage, or virus.
- a suitable virus include a retrovirus, herpes virus, pox virus, vaccina virus, adenovirus, lentivirus and the like).
- Such recombinant vectors are highly useful for transforming target cells (e.g. cells of the CNS) with the nucleic acid molecule encoding the sheddase.
- Recombinant vectors may also comprise other functional elements.
- recombinant vectors may be designed such that the vector may autonomously replicate in the target cell, hi this case, elements that induce nucleic acid replication may be required in the recombinant vector.
- the recombinant vector may be designed such that the vector and recombinant nucleic acid molecule integrates into the genome of a target cell.
- the vector comprises nucleic acid sequences, which favour targeted integration (e.g. by homologous recombination).
- Recombinant vectors may also comprise DNA coding for genes that may be used as selectable markers in the cloning process, which will be known to the skilled technician.
- the recombinant vector may comprise a promoter or regulator for controlling expression of the gene, as required.
- the nucleic acid molecule may (but not necessarily) be one, which becomes incorporated in the DNA of cells of the subject being treated. Undifferentiated cells may be stably transformed leading to the production of genetically modified daughter cells (in which case regulation of expression in the subject may be required e.g. with specific transcription factors or gene activators).
- the expression system may be designed to favour unstable or transient transformation of differentiated cells in the subject being treated. When this is the case, regulation of expression may be less important because expression of the DNA molecule will stop when the transformed cells die or stop expressing the protein (ideally when the required therapeutic effect has been achieved).
- the expression system may provide the nucleic acid molecule encoding the sheddase, or analogue or derivative thereof to the subject without it being incorporated in a vector.
- the nucleic acid molecule may be incorporated within a liposome or a virus particle.
- a "naked" nucleic acid molecule may be inserted into a subject's cells by a suitable means e.g. direct endocytotic uptake.
- the nucleic acid molecule may be transferred to the cells of a subject to be treated by transfection, infection, microinjection, cell fusion, protoplast fusion or ballistic bombardment.
- transfer may be by ballistic transfection with coated gold particles, liposomes containing the nucleic acid molecule, viral vectors (e.g. adenovirus) and means of providing direct nucleic acid uptake (e.g. endocytosis) by application of the nucleic acid molecule directly.
- the expression system defined herein may be used in a gene therapy technique for the treatment of diseases characterised by damaged or impaired nerves.
- a delivery system for use in a gene therapy technique comprising a nucleic acid molecule encoding a protein which directly or indirectly modulates activity of a sheddase, or analogue or derivative thereof, wherein said nucleic acid molecule is capable of being transcribed to allow the expression of the protein, which is effective for treating a disease condition characterised by a damaged or impaired nerves.
- the delivery system of the fourth aspect is highly suitable for achieving sustained levels of a protein, which is therapeutically active for combating diseases as described herein over a longer period of time than is possible for most conventional therapeutic regimes.
- the delivery system may be used to induce continuous protein expression in cells in a target tissue to be treated, for example, the CNS or PNS, that have been transformed with the DNA molecule. Therefore, even if the protein has a very short half-life as agent in vivo, therapeutically effective amounts of the protein may be continuously expressed in the treated tissue.
- the delivery system of the fourth aspect preferably comprises the expression system as described herein.
- the nucleic acid molecule may be a DNA molecule, which may be derived from human, and may encode a sheddase, or analogue or derivative thereof.
- the nucleic acid molecule may comprise SEQ ID No.l, which may encode the sheddase shown as SEQ ID No.3.
- the delivery system of the invention may be used to provide the nucleic acid molecule (and thereby the protein which is the active therapeutic agent) without the need to use conventional pharmaceutical vehicles such as those required in tablets, capsules or liquids.
- the delivery system of the invention is such that the nucleic acid molecule is capable of being expressed (when the delivery system is administered to a patient) to produce a protein that directly or indirectly has activity for modulating activity of a sheddase.
- directly we mean that the product of gene expression per se has the required activity.
- the product of gene expression is itself a sheddase enzyme, or analogue, or derivative thereof.
- indirectly we mean that the product of gene expression undergoes or mediates (e.g. as an enzyme) at least one further reaction to provide an agent effective for modulating the sheddase activity.
- the delivery system may further comprise a nucleic acid sequence (which is preferably DNA), which encodes a neurotrophic factor (NTF).
- NTF neurotrophic factor
- the skilled technician will appreciate that there are many types of NTF, which may be used to increase the effect of the sheddase. Examples include FGF-2 (NM_002006) and CNTF (NM__000614), the DNA and amino acid sequences of which are readily available to the skilled technician.
- the mRNA sequence (spliced transcipt) for FGF-2 is set out as:- i cggccccaga aaacccgagc gagtaggggg cggcgcgcag gagggaggag aactgggggc
- the gene therapy technique comprises administering the delivery system to the subject being treated such that the nucleic acid molecule (and where applicable the further nucleic acid sequence(s)) is expressed in the subject.
- Expression of the protein(s) causes direct or indirect modulation of the activity of the sheddase enzyme, or analogue or derivative thereof, thereby promoting axon and/or neurite outgrowth and branching in the subject, thereby treating the disease characterised by damaged or impaired nerves.
- Derivatives or analogues of the sheddase enzyme used in the medicament according to the invention may include derivatives or analogues that increase or decrease the enzyme's half-life in vivo or ex vivo. It is preferred that the derivative or analogue exhibits enhanced resistance to hydrolysis, by for example, peptidases. It will also be appreciated that the invention extends to the amino acid sequence of a sheddase enzyme, or a nucleic acid encoding a sheddase enzyme, or a derivative, or an analogue thereof, which comprises substantially the amino acid or nucleic acid sequences of any of the sequences referred to herein, including functional variants or functional fragments thereof.
- analogue of a sheddase enzyme or “derivative of a sheddase enzyme”, or “substantially the amino acid/polynucleotide/polypeptide sequence”, “functional variant” and “functional fragment”, we mean that the sequence has at least 30% sequence identity with the amino acid/polynucleotide/polypeptide sequences of any one of the sequences referred to herein.
- a derivative or analogue of sheddase may comprise 30% identity with the sheddase gene identified as SEQ ID No.l, or 30% identity with the sheddase polypeptide identified as SEQ ID No.3.
- amino acid/polynucleotide/polypeptide sequences with a sequence identity which is greater than 65%, more preferably, greater than 70%, even more preferably, greater than 75%, and still more preferably, greater than 80% sequence identity to any of the sequences referred to is also envisaged.
- the amino acid/polynucleotide/polypeptide sequence has 85% identity with any of the sequences referred to, more preferably 90% identity, even more preferably 92% identity, even more preferably 95% identity, even more preferably 97% identity, even more preferably 98% identity and, most preferably, 99% identity with any of the referred to sequences.
- the percentage identity for two sequences may take different values depending on:- (i) the method used to align the sequences, for example, ClustalW, BLAST, FASTA, Smith- Waterman (implemented in different programs), or structural alignment from 3D comparison; and (ii) the parameters used by the alignment method, for example, local vs global alignment, the pair-score matrix used (e.g. BLOSUM62, PAM250, Gonnet etc.), and gap-penalty, e.g. functional form and constants.
- the method used to align the sequences for example, ClustalW, BLAST, FASTA, Smith- Waterman (implemented in different programs), or structural alignment from 3D comparison
- the parameters used by the alignment method for example, local vs global alignment, the pair-score matrix used (e.g. BLOSUM62, PAM250, Gonnet etc.), and gap-penalty, e.g. functional form and constants.
- percentage identity between the two sequences. For example, one may divide the number of identities by: (i) the length of shortest sequence; (ii) the length of alignment; (iii) the mean length of sequence; (iv) the number of non-gap positions; or (iv) the number of equivalenced positions excluding overhangs. Furthermore, it will be appreciated that percentage identity is also strongly length dependent. Therefore, the shorter a pair of sequences is, the higher the sequence identity one may expect to occur by chance.
- GAPDIST 4. Those skilled in the art will be aware that it may be necessary to vary these and other parameters for optimal sequence alignment.
- Alternative methods for identifying similar sequences will be known to those skilled in the art.
- a substantially similar nucleotide sequence will be encoded by a sequence which hybridizes to the sequences shown in SEQ ID No.l or their complements under stringent conditions.
- stringent conditions we mean the nucleotide hybridises to filter-bound DNA or RNA in 3x sodium chloride/sodium citrate (SSC) at approxmiately 45 0 C followed by at least one wash in 0.2x SSC/0.1% SDS at approximately 20-65 0 C.
- a substantially similar polypeptide may differ by at least 1, but less than 5, 10, 20, 50 or 100 amino acids from the sequences shown in SEQ ID No.3.
- nucleic acid sequence could be varied or changed without substantially affecting the sequence of the protein encoded thereby, to provide a functional variant thereof.
- Suitable nucleotide variants are those having a sequence altered by the substitution of different codons that encode the same amino acid within the sequence, thus producing a silent change.
- Other suitable variants are those having homologous nucleotide sequences but comprising all, or portions of, sequence, which are altered by the substitution of different codons that encode an amino acid with a side chain of similar biophysical properties to the amino acid it substitutes, to produce a conservative change.
- small non-polar, hydrophobic amino acids include glycine, alanine, leucine, isoleucine, valine, proline, and methionine.
- Large non-polar, hydrophobic amino acids iriclude phenylalanine, tryptophan and tyrosine.
- the polar neutral amino acids include serine, threonine, cysteine, asparagine and glutamine.
- the positively charged (basic) amino acids include lysine, arginine and histidine.
- the negatively charged (acidic) amino acids include aspartic acid and glutamic acid. It will therefore be appreciated which amino acids may be replaced with an amino acid having similar biophysical properties, and the skilled technician will known the nucleotide sequences encoding these amino acids.
- sheddase enzyme or analogue, derivative or activator thereof may be used in a monotherapy (e.g. use of a sheddases per se, or analogue or derivative or activator thereof (e.g. an expression or delivery system according to the invention to promote axon and/or neurite outgrowth and/or branching).
- a monotherapy e.g. use of a sheddases per se, or analogue or derivative or activator thereof (e.g. an expression or delivery system according to the invention to promote axon and/or neurite outgrowth and/or branching.
- the sheddase is used as an adjunct, or in combination with, any other therapies, which may be used to promote axon/neurite branching/outgrowth (for example, the addition of an NTF).
- combination therapy comprises a sheddase, or analogue or derivative thereof, or an expression system therefor, and a Neurotrophic Factor (e.g FGF2 or CNTF etc).
- the sheddase or analogue, derivative or activator thereof may be combined in a composition having a number of different forms depending, in particular on the manner in which the composition is to be used.
- the composition may be in the form of a capsule, liquid, ointment, cream, gel, hydrogel, aerosol, spray, micelle, transdermal patch, liposome or any other suitable form that may be administered to a person or animal suffering from a disease state characterised by impaired neuron (axon) growth.
- the vehicle of the composition of the invention should be one which is well tolerated by the subject to whom it is given, and preferably enables delivery of the molecule to the target site requiring axon growth and/or improved neuron survival.
- compositions comprising a sheddase or analogue, derivative or activator thereof may be used in a number of ways.
- systemic administration may be required in which case the compound may be contained within a composition that may, for example, be administered by injection into the blood stream.
- Injections may be intravenous (bolus or infusion), subcutaneous (bolus or infusion), intraventricular or subarachnoidal.
- the injection is intraneural.
- the composition may be administered by inhalation (e.g. intranasally or via the mouth).
- the sheddase or analogue, derivative or activator thereof may also be incorporated within a slow or delayed release device.
- Such devices may, for example, be inserted at the site of a CNS or PNS lesion, and the sheddase may be released over weeks or months.
- Such devices may be particularly advantageous when long-term treatment with a sheddase according to the invention is required and which would normally require frequent administration (e.g. at least daily injection).
- the amount of sheddase or analogue, derivative or activator thereof that is required is determined by the type of sheddase itself, its biological activity and its bioavailability, which in turn depends on the mode of administration, the physicochemical properties of the sheddase employed, and whether it is being used as a monotherapy or in a combined therapy, for example, with an NTF.
- the frequency of administration will also be influenced by the above-mentioned factors and particularly the half-life of the sheddase within the subject being treated.
- Optimal dosages to be administered may be determined by those skilled in the art, and will vary with the particular sheddase or analogue, derivative or activator thereof in use, the strength of the preparation, the mode of administration, and the advancement or severity of the disease condition, and the urgency of the requirement for axon growth. Additional factors depending on the particular subject being treated will result in a need to adjust dosages, including subject age, weight, gender, diet, and time of administration.
- a daily dose of between 0.01 ⁇ g/kg of body weight and 0.5 g/kg of body weight of a sheddase according to the invention may be used for the stimulation of axon growth (i.e. promoting axon outgrowth/branching), depending upon which specific sheddase enzyme is used. More preferably, the daily dose is between 0.01 mg/kg of body weight and 200 mg/kg of body weight, and more preferably, between approximately 0.1 mg/kg and 100 mg/kg, and even more preferably, between about lmg/kg and 10mg/kg sheddase.
- daily doses may be given as a single administration (e.g. a single daily injection).
- a therapeutically effective dosage should provide about Ing to lOO ⁇ g/kg of the sheddase per single dose, and preferably, 2ng to
- the sheddase may require administration twice or more times during a day.
- sheddases according to the invention may be admim ' stered as two (or more depending upon the severity of the condition) daily doses of between 0.1 mg/kg and lOmg/kg (i.e. assuming a body weight of 70kg).
- a patient receiving treatment may take a first dose upon waking and then a second dose in the evening (if on a two dose regime) or at 3 or 4 hourly intervals thereafter.
- a slow release device may be used to provide optimal doses to a patient without the need to administer repeated doses.
- composition comprising a therapeutically effective amount of a sheddase or analogue, derivative or activator thereof, and a pharmaceutically acceptable excipient.
- the composition according to the fifth aspect of the invention may comprise about 0.01 ⁇ g and 0.5 g of the sheddase or analogue, derivative or activator thereof. More preferably, the composition comprises between about 0.01 mg and 200 mg, and more preferably, between approximately 0.1 mg and 100 mg, and even more preferably, between about lmg and lOmg of the sheddase or analogue, derivative or activator thereof. Most preferably, the composition comprises between approximately 2mg and 5mg of the sheddase. It will also be appreciated that the invention is not limited to using just one type of sheddase enzyme, and it is envisaged that more than one sheddase may be used in the medicament according to the invention, and the composition of the fifth aspect.
- the composition comprises approximately 0.1% (w/w) to 90% (w/w) of the sheddase, and more preferably, 1% (w/w) to 10% (w/w) of the sheddase or analogue, derivative or activator thereof.
- the rest of the composition may comprise the excipient.
- This invention further provides in a sixth aspect, a process for making a pharmaceutical composition
- a process for making a pharmaceutical composition comprising combining a therapeutically effective amount of a sheddase or analogue, derivative or activator thereof, and a pharmaceutically acceptable excipient.
- a “therapeutically effective amount” is any amount of a sheddase enzyme or analogue, derivative or activator thereof which, when administered to a subject promotes axon or neurite outgrowth or branching.
- a “subject” may be a vertebrate, mammal, domestic animal or human being.
- a “pharmaceutically acceptable excipient” as referred to herein is any physiological carrier vehicle known to those of ordinary skill in the art useful in formulating pharmaceutical compositions.
- the excipient comprises liquid and the pharmaceutical composition is in the form of a solution.
- the pharmaceutical vehicle is a gel and the composition is in the form of a cream or the like.
- Liquid pharmaceutical compositions which are sterile solutions or suspensions can be utilized by for example, intramuscular, intraneural, intrathecal, epidural, intraperitoneal, intravenous and particularly subcutaneous, intracerebral or intracerebro ventricular injection.
- the sheddase may be a sterile composition that may be dissolved or suspended at the time of administration using sterile water, saline, or other appropriate sterile injectable medium.
- Vehicles are intended to include necessary and inert binders, suspending agents, lubricants, flavourants, sweeteners, preservatives, dyes, and coatings.
- NTF neurotrophic factor
- composition of the fifth aspect comprises a therapeutically effective amount of an NTF.
- suitable NTF include FGF-2 and CNTF.
- composition of the fifth aspect may be used as a medicament.
- composition according to the fifth aspect for use as a medicament.
- the medicament may be used to treat individuals suffering from various diseases characterised by damaged or inappropriate nerve growth, such as CNS or PNS injury.
- a method of promoting axon outgrowth and/or branching and/or for inhibiting cell apoptosis in a subject comprising administering to a subject in need of such treatment a composition comprising a sheddase enzyme, or analogue, or derivative, or activator thereof.
- the method according to the eighth aspect comprises administering to the subject in need of treatment the composition according to the fifth aspect.
- composition used in the method according to the eighth aspect further comprises a neurotrophic factor (NTF) in addition to the sheddase, or analogue, derivative or activator thereof. It is most preferred that the composition used in the method of the eighth aspect comprises (i) a sheddase, or analogue, or derivative, or activator thereof; and (ii) a neurotrophic factor (NTF).
- NNF neurotrophic factor
- the invention has many uses in both in vitro and in vivo applications.
- the sheddase, or analogue, derivative or activator thereof may be used to stimulate axon outgrowth and/or branching in vivo in a subject being treated.
- the sheddase, or analogue, derivative or activator thereof may be used to stimulate neurite outgrowth and/or branching in cell culture, following which the neuronal culture may then be transferred to a subject in need of treatment to repair damaged areas.
- a method of promoting neurite outgrowth and/or branching in culture comprising administering a composition comprising a sheddase, or analogue or derivative or activator thereof, to a culture of neurons.
- the composition used in the method of the ninth aspect comprises a neurotrophic factor.
- suitable neurotrophic growth factors may include iCNTF, FGF2, NGF, NT-3, NT-4, BDNF, GDNF, FGF-I, FGF-5, CT-I, CDF, insulin, IGF-I, IGF-2, IL-6, LIF, NPF, PDGF, PN-I, S-IOO, TGF- ⁇ , and VIP and the like (Oppenheim, 1996, Neuron 17:195-197).
- the amount of NTF may be between approximately 0.01 ⁇ g/kg of body weight and 0.5 g/kg of body weight, more preferably, about 0.1mg/kg and 10mg/kg.
- Neuron cultures prepared using the method of the ninth aspect may be used either for in vitro experiments, or may be introduced into a subject into a target cell to repair damaged or impaired nerves.
- Figure 1 shows TACE-induced RIP of p75 NTR and suppression of Rho activation in the presence of CNS myelin ligands.
- A Mean number of DRGN and glia with and without treatment with the mitotic inhibitor 5-fluro-2'-deoxyuridine (5 -FDU).
- B Representative
- Control DRG cultures without NTF and CNS myelin.
- C Mean integrated optical density of protein bands from lysates and media in
- FIG. 2 shows TACE-induced fragmentation of NgR.
- A and (B) Addition of TACE induces fragmentation of NgR and fragmented NgR is present in the media.
- C and (D) TROY did not appear to be fragmented by TACE.
- ⁇ -actin was used as a loading control. ***P ⁇ 0.0001;
- Figure 3 shows TACE-induced RIP of p75 NTR enhanced DRGN neurite outgrowth in the presence of CNS myelin ligands.
- A Representative ⁇ lll-tubulin immunocytochemistry in control DRG cultures, and after DRGN exposure to FGF2, FGF2 + CNS myelin, TACE + CNS myelin, and FGF2 + TACE + CNS myelin.
- B Quantification of mean longest neurite lengths to demonstrate significantly enhanced FGF2-stimulated DRGN neurite outgrowth after addition of TACE + FGF + CNS myelin. Once again, addition of TIMP3 blocked TACE-mediated DRGN neurite outgrowth. ***P ⁇ 0.0001 ;
- FIG. 4 shows TACE-induced RIP of p75 NTR enhanced neuritic branching in DRGN in the presence of CNS myelin ligands.
- A The number of primary DRGN neurites and (B) branches, after 3 days in culture in controls, and after the exposure to FGF2, FGF2 + myelin, TACE + CNS myelin, and FGF2 + TACE + CNS myelin, increased significantly.
- Treatment with TIMP3 restored the inhibitory potential of CNS myelin ligands and blocked DRGN neurite outgrowth.
- FIG. 5 shows TACE-induced RIP of p75 NTR correlated with enhanced MAPlB levels in the presence of CNS myelin.
- Exposure to TACE + FGF2 in the presence of CNS myelin enhanced MAPlB levels significantly compared to other treatments, while addition of TIMP3 restored MAPlB levels to those observed in controls, ⁇ -actin was used as a loading control. ***P ⁇ 0.0001;
- Figure 6 shows upregulation of TACE activity and presinilin-1 (PSl) levels in retinae and ON in the RM.
- C Western blot of inactive (*) and active (arrow) TACE, PSl and ⁇ -actin in ON samples from intact Od controls, and from RM and NRM at 6, 8, and 20dpi, taken from retinal samples;
- Figure 7 shows NTF activated TACE, while addition of TACE to RGC cultures fragments p75 NTR and blocks Rho-A activation.
- ⁇ - actin acted as a loading control in the same Western blot.
- Figure 8 shows addition of TACE promotes RGC neurite outgrowth in the presence of inhibitory CNS myelin extract.
- A Representative immunocytochemistry for ⁇ lll-tubulin in retinal cultures to demonstrate RGC neurite outgrowth in the presence and absence of NTF, TACE, CNS myelin extract and the TACE activator, PMA.
- B Quantification of the number of RGC with neurites after treatment with NTF no CNS myelin extract, NTF plus CNS myelin extract, TACE no CNS myelin extract, TACE plus CNS myelin extract, NTF plus TACE plus CNS myelin extract, NTF plus TACE plus TIMP3 plus CNS myelin extract, NTF plus ⁇ -secretase inhibitor, and NTF plus TACE plus ⁇ -secretase inhibitor. ***P ⁇ 0.0001.
- C Quantification of mean neurite length after various treatments with/without NTF in the presence/absence of CNS myelin extracts.
- Figure 9 shows a proposed mechanism of NTF-stimulated disinhibition of RGC axon growth by TACE-mediated p75 NTR shedding.
- Intravitreally-delivered NTF stimulate RGC to release TACE at the somata and at the growth cone, which cleaves P75E C D from p75 NTR while ⁇ - secretase cleaves p75ico by RIP.
- full length p75 NTR is not available at the growth cone to associate with NgR so that there is no transduction of inhibitory signalling after ligand/NgR binding, and downstream Rho-A activation is suppressed, favouring actin polymerisation in the growth cone.
- Growth cone integrity and mobility are preserved and, hence, unimpeded regeneration through the putative inhibitory environment of the distal ON stump is promoted.
- Examples 1 and 2 The inventors conducted a series of experiments (summarised in Examples 1 and 2 below) to investigate the efficacy of exogenously added sheddases on the growth of neurons. As a model, they used the sheddase, TACE.
- Dissociated adult rat (6-8 week-old) DRGN were cultured in 4-well plates at a density of 1500/well, as described elsewhere (Ahmed, 2005, MoLCeIl Neurosci. 28, 509-523.), on glass coverslips pre-coated with 100 ⁇ g/ml poly-o-lysine followed by 20 ⁇ g/ml Laminin-I (both from Sigma, Dorset, UK) in Neurobasal-A containing B27 supplement (Invitrogen, Paisley, UK). To limit glial proliferation, the mixed DRG cultures were treated with 30 ⁇ M 5-fluoro-2-deoxyuridine (Sigma) for 3 d (Russell, 2002, FASEB J. 16, 1738-1748). DRGN were cultured either in the presence, or absence of adult rat CNS myelin extracts for a further 3 d at 37 0 C in a humidified atmosphere containing 5% CO 2 .
- CNS myelin was prepared according to our earlier published method (Ahmed supra, 2005). Briefly, adult Sprague-Dawley rat brains were homogenised in 0.32M sucrose, ImM EDTA, pH 7.0 at 4 0 C and centrifuged. The supernatant was resuspended in 0.9M sucrose, overlayed with 1-2 ml of 0.32 M sucrose, and centrifuged at 20,00Og for 60 min. The CNS myelin at the interface of the two sucrose layers was collected, dispersed in 20 volumes of 0.32 M sucrose, and centrifuged at 13,000g for 25 min.
- CNS myelin extract was then diluted in 25 volumes of water and centrifuged at 20,00Og for 25 min. The final white pellet was resuspended in a small volume of water, freeze dried overnight and the protein content determined using the Pierce BCA assay (BioRad, Hercules, CA, USA). Western blotting of the CNS myelin extracts confirmed the presence of Nogo-A, MAG, OMgp and chondroitin sulphate proteoglycan (CSPG) (Ahmed supra, 2005). The myelin extract was added to DRG cultures at a protein concentration of 200 ⁇ g/ml, previously determined to be optimally inhibitory to DRGN neurite outgrowth.
- CSPG chondroitin sulphate proteoglycan
- FGF2 (Peprotech, London, UK) was added at 10 ng/ml (pre-determined to cause optimal DRGN neurite outgrowth) and active TACE (R & D Systems, Abingdon, UK) was added at 10 ng/ml (pre-determined to cause optimal p75 NTR peptide cleavage) to DRGN culture plates in triplicates.
- DRGN were also treated with either 25 ng/ml phorbol 12- myristate 13-acetate (PMA; Sigma) to upregulate TACE production (Weskamp et al., J.Biol.Chem. 279, 4241-4249, 2004; Kanning et al., J.Neurosci.
- TIMP3 50 nM, Chemicon, Hampshire, UK
- TIMP3 50 nM, Chemicon, Hampshire, UK
- a specific inhibitor of TACE activity Black, NatGenet. 36, 934-935, 2004; Karan et al., Int.J.Oncol. 23, 1365-1371, 2003; Lee et al., BiochemJ. 364, 227-234, 2002.
- Cells were treated for 72 hr before harvesting for Western blotting and subsequent quantitative assessment of proteins by densitometry as described below.
- Monoclonal ⁇ -III tubulin antibody (Sigma) was used at 1:100 to label DRGN neurites by immunocytochemistry (ICC).
- Polyclonal anti-p75 NTR antibody was used to identify and localise p75 NTR , p75c ⁇ F, p75tcD and P75E CD (Promega, 1:500 dilution for both Western blots and ICC).
- Microtubule associated protein-IB MAlB
- Anti-mouse NgR Autogen Bioclear, Wiltshire, UK was used at 1:500 dilution for Western blots.
- a second NgR antibody goat anti-human NgR (Santa Cruz Biotechnology, San Diego, USA) was used at 1:500 dilution to confirm the results obtained with anti-mouse NgR.
- a polyclonal anti-human TROY antibody was used to detect TROY in Western blots (1:500, Santa Cruz Biotechnology).
- PBS phosphate buffered saline
- BSA bovine serum albumin
- Triton X-100 Triton X-100
- Cells were then washed X3 in PBS and incubated with either AlexaFluor 488 (Green), or Texas Red (Red) (both from Invitrogen), diluted 1:100 in PBS-T-BSA for 1 hr at room temperature.
- coverslips were mounted in FluorSave (Calbiochem, San Diego, USA) and viewed under a fluorescent microscope (Carl Zeiss, Welwyn-Garden City, UK).
- Photomicrographs of ⁇ III-tubulin + immunostained DRGN neurites were captured using Axiovision Software (Carl Zeiss, Hertfordshire, UK) from 30 randomly selected DRGN/coverslip and neurite lengths measured using Axiovision (Carl Zeiss) and represented as means ⁇ SD.
- DRGN somata were counted and from each neuritic tree, the total number of branches exceeding 20 ⁇ m in length (Bouquet et al., J.Neurosci. 24, 7204-7213, 2004) recorded using Axiovision software (Carl Zeiss).
- DRG cultures were washed X2 with PBS and incubated for 15 min " at 37 0 C with ⁇ .25 % trypsin/EDTA (Invitrogen), followed by trituration and centrifugation at 1300 rpm for 5 min.
- the cell pellets were re-suspended in ice-cold lysis buffer containing 20 niM Tris-HCl (pH 7.4), 1 mM EDTA, 0.5 mM EGTA, 150 mM NaCl, 1 % NP-40 (Sigma) and PI cocktail (Sigma) and incubated on ice for 30 min, centrifuged at 13,000 rpm at 4 0 C and cell lysates normalised for protein concentration using a colorimetric protein assay (Bio- Rad). To determine the levels of shed NgR and P75 EC D, cell culture media were collected and concentrated using microconcentrators (Millipore, Bedford, MA, USA).
- ECL enhanced chemiluminescence
- HRP-conjugated secondary antibody (1 :1,000; Amersham
- Rho activation assay GTP-bound Rho was assayed from DRG cell culture lysates using a commercially available Rho activation assay kit, following the manufacturers instructions (Upstate Biotechnology, Milton Keynes, UK).
- Densitometry Western blots were scanned into Adobe Photoshop, keeping all scanning parameters the same for each blot. Captured images were used to quantify the integrated optical density of each band using the built-in gel plotting macros in Scionlmage software (Scion Corporation/NIH Image, Maryland, CA, USA).
- Sample means were calculated and differences analysed for significance using GraphPad Prism (GraphPad Software Inc., Version 4.0, San Diego, USA) by one-way analysis of variance (ANOVA) followed by post-hoc testing with Dunnett's method to identify statistically significant groups.
- n TACE-induced RIP of p75 NTR in DRG cultures Since glia produce minute amounts of TACE in the brain, the inventors first determined the relative proportions of DRGN and glia (satellite and Schwann cells) in FGF2- stimulated cultures. The number of ⁇ III-tubulin + DRGN was determined as 1,500 at 0 d and their number remained constant over the 6 d culture period (Fig. IA). The initial number of glia (-7,500) increased significantly to 20,000 at 6 d. Treatment of FGF2-stimulated cultures with the mitotic inhibitor, 5-fiuoro-2'-deoxyuridine (5-FDU), halted glia proliferation to a level equivalent to that at 0 d.
- the mitotic inhibitor 5-fiuoro-2'-deoxyuridine
- TACE-induced RIP of p75 NTR coincided with a significant reduction in the levels of Rho-GTP within DRG cultures in the presence of CNS myelin, while total Rho levels did not change (Fig. IB and C).
- the further addition of TIMP3 blocked TACE- mediated fragmentation of p75 NTR in the presence of FGF2, and restored the levels of Rho- GTP to those seen in FGF-2 treated cultures with CNS myelin extracts (Fig. IB and C). Similar levels of fragmentation were observed in the absence of CNS myelin. However, Rho- GTP was not detected, confirming that there was no activation of Rho (Fig. IB and C).
- FGF2 promoted significant DRGN neurite outgrowth while addition of either FGF2 plus PMA, or FGF2 plus TACE plus TIMP3 did not affect neurite outgrowth.
- TIMP3 restored the inhibitory potential of CNS myelin extracts in the presence of TACE and blocked neurite outgrowth and branching in FGF2- stimulated cultured DRGN (Fig. 4A and B). 1.5) TACE-mediated branching of DRGN was correlated with upregulation of MAPlB
- Microtubule associated protein- IB a member of the MAP family is expressed in regenerating axons and their growth cones, and promotes branching of DRGN neurites.
- MAPlB Microtubule associated protein- IB
- NgR and p75 NTR fragmentation was blocked by the addition of TIMP3, a specific inhibitor of TACE activation, re-instating inhibition of DRGN neurites in the presence of CNS myelin.
- TACE-induced RIP of NgR and p75 NTR suppresses Rho activation, paralyses the signalling cascade mediating growth cone collapse and disinhibits NTF-stimulated neurite outgrowth and branching in the presence of inhibitory myelin ligands.
- the inventors therefore suggest that TACE-mediated receptor shedding may be used a therapeutic strategy to block the function of receptor in the axon growth inhibitory cascade.
- AU animal procedures were licensed by the UK Home Office.
- Adult, female 200- 25Og Fischer rats were anaesthetised with Hypnorm/Hypnovel anaesthetic (Janssen Pharmaceuticals, Oxford, UK).
- the experimental groups comprised a regenerating ON model (RM) in which the ON was crushed (ONC) intraorbital ⁇ and a freshly teased sciatic nerve (PN, sciatic nerve) segment immediately transplanted intravitreally and held in place with Sterispon gelatine sponge (Sterispon, Allen and Hanbury, London, UK), and a non- regenerating ON model (NRM) in which the ON was crushed (ONC) without intravitreal PN implantation.
- RM regenerating ON model
- PN sciatic nerve
- ON and retinae were processed for RNAse protection assay, Western blotting, and immunohistochemistry at 6, 8, and 20 days post injury (dpi), as described below.
- CNS myelin was prepared according to (Cuzner et al., J Neurochem 12: 469-481, 1965). Briefly, adult rat brains were homogenised in 0.32 M sucrose, 1 mM EDTA, pH 7.0 at 4 0 C, centrifuged at 800 g for 10 min and the supernatant collected. The cell pellet was diluted to the original volume in 0.32 M sucrose, 1 mM EDTA, pH 7.0 and centrifuged, supernatant collected and the combined supernatants centrifuged at 13,000 g for 20 min.
- the pellet was resuspended in 0.9 M sucrose, distributed equally amongst a set of tubes, carefully overlayed with 1-2 ml of 0.32 M sucrose and centrifuged at 20,000 g for 60 min.
- the white material at the interface of the two sucrose layers was collected in the minimum volume possible, dispersed in 20 volumes of 0.32 M sucrose, and centrifuged at 13,000 g for 25 min.
- the white pellet containing the myelin was collected, diluted in 25 volumes of pure water, left on ice for 30 min before centrifuging at 20,000 g for 25 min.
- the final myelin pellet was resuspended in a small volume of water and freeze dried overnight.
- Protein content of the CNS myelin was determined using the Pierce BCA assay (BioRad, Hercules, CA, USA) by dissolving a small aliquot of myelin with 10% SDS which was diluted to ⁇ 1% SDS for the assay.
- the myelin extract contains various inhibitory molecules, including Nogo-A, OMgp, MAG and CSPG (Ahmed supra, 2005).
- ANOVA analysis of variance
- ISH In situ hybridisation
- Rho activation assay kit Upstate Biotechnology, Milton Keynes, UK
- Rho-GTP In situ localisation of Rho-GTP was determined according to a modified earlier published method (Dubreuil et al., 2003). Briefly, 10 ⁇ m thick post-fixed sections of retinae were incubated with either GST-RBD, or GST alone (both from Upstate Biotechnology) overnight at 4 0 C. Sections were then washed X3 in PBS and blocked in 3% bovine serum albumin for 1 hr at room temperature and incubated with an anti-GST antibody (New England Biolabs, Hertfordshire, UK) and ⁇ lll-tubulin antibody (Sigma), Overnight at 4 0 C. Sections were then washed in PBS, incubated with FITC or Texas red secondary antibodies (Molecular Probes), mounted in Fluorsave (Calbiochem) and viewed under an epi- fluorescent microscope (Zeiss, Hertfordshire, UK).
- Retinal cultures were also treated with either recombinant TACE enzyme (10 ng/ml) (R&D Systems, UK), or active human TIMP3 enzyme (5 ⁇ g/ml, Chemicon) to inhibit TACE production, or ⁇ -secretase inhibitor (30 ⁇ M) (S2188, Sigma) to block p75c ⁇ F fragmentation and the production of P75 JCD - Cells were treated for 48 hr before harvesting for Western blotting and subsequent quantitative assessment of proteins by densitometry as described below.
- TACE enzyme 10 ng/ml
- active human TIMP3 enzyme 5 ⁇ g/ml, Chemicon
- ⁇ -secretase inhibitor (30 ⁇ M) (S2188, Sigma)
- Cultures were prepared as above and comprised RGC which were either: (1), untreated; (2), treated with combined NTF; (3), treated with TACE and combined NTF; or (4), treated with TACE, combined NTF and TACE and ⁇ -secretase inhibitors either in the presence, or absence of CNS myelin.
- Monoclonal ⁇ -III tubulin (1:100) was from Sigma, Poole, UK.
- Polyclonal anti-p75 NTR (1:500 for Western blots and immunohisto/cyto-chemistry) which recognises intact p75 NTR , P75 ECD and P25 J C D was from Promega, Southampton, UK.
- Goat anti-human NgR (1:100 for Western blots) and TROY (1:500 for Western blots) both from Santa Cruz, C.A., USA) were used to detect NgR and TROY levels in Western blots.
- Sample means were calculated and analysed for significance using GraphPad Prism (GraphPad Software Inc., Version 4.0, San Diego, USA) by one-way analysis of variance (ANOVA) followed by post-hoc testing with Dunnett's method.
- TACE Whilst levels of TACE rose post-injury in both RM and NRM on, in RM ON, TACE was predominantly in the active-, rather than the pro-form, while in NRM ON, most TACE was in the pro-form (Fig. 6C). PSl levels also increased with time post-injury and were significantly higher in RM compared to NRM ON (Fig. 6C). TACE was similarly localised within RM and NRM ON and, in RM ON, TACE and GAP-43 were seen co-localised to occasional axons (not shown).
- TACE was upregulated by NTF stimulation of retinal cultures, while exogenous addition of TACE induced RIP of ⁇ 75 NTR and disinhibited NTF-stimulated RGC neurite outgrowth in the presence of CNS myelin
- NTF increased TACE activation by 43% over that observed with PMA (phorbol 12-myristate 13-acetate, a known activator of TACE) treatment (PO.0001).
- PMA phorbol 12-myristate 13-acetate, a known activator of TACE
- Densitometry of Western blots confirmed the presence of significantly higher amounts of active TACE in response to NTF when compared with those produced in the presence of PMA (Fig. 7A).
- TIMP3 (a TACE inhibitor) blockade of NTF-induced RJP of p75 NTR (Fig. 7C) re-established the levels of active Rho and inhibition of RGC neurite outgrowth in the presence of CNS myelin extracts (Fig. 8A-C).
- Rho-GDI Rho-GDP dissociation inhibitor
- GEF guanine nucleotide exchange factors
- RIP of p75 NTR activated by TACE is a key factor in NTF-stimulated RGC axon/neurite outgrowth through inhibitory CNS myelin ligand-rich environments.
- RIP of p75 NTR blocks Rho-A activation and inhibitory signalling, thereby stabilising growth cone morphology and allowing NTF -stimulated axons to regenerate in the presence of inhibitory ligands.
- examples 1 and 2 both illustrate that TACE-mediated receptor shedding may be used a therapeutic strategy to block the function of receptor in the axon growth inhibitory cascade.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Zoology (AREA)
- Animal Behavior & Ethology (AREA)
- Immunology (AREA)
- Neurosurgery (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Genetics & Genomics (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Hospice & Palliative Care (AREA)
- Psychiatry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Psychology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
The invention provides a method of promoting axon and/or or neurite branching and/or outgrowth and/or for inhibiting cell apoptosis in a subject, the method comprising administering to a subject in need of such treatment a composition comprising a sheddase enzyme, or analogue, or derivative, or activator thereof. The invention also provides a delivery system for use in a gene therapy technique, and compositions for use in treating disease conditions characterised by damaged or impaired nerves.
Description
SHEDDASE ENZYMES FOR NEURON GROWTH
The present invention relates to neuron growth, and particularly to the modulation of neural growth and regeneration in the central nervous system. The invention also provides medicaments, and in vivo and ex vivo methods of using such medicaments to modulate neuron and neurite growth.
Nerve cells or neurons can be generally divided into three main functional parts, i.e. the cell body, the axon, and the dendrites. The cell body is where cellular metabolism occurs, and the dendrites are the part of the cell that receive signals and conducts these signals to the rest of the neuron. The axon is responsible for passing these signals between neighbouring neurons. The term neurites is used to define either axons or dendrites when the neuron is in cell culture, i.e. in vitro or ex vivo.
Axons and dendrites elongate profusely during development both in the central nervous system (CNS) and peripheral nervous systems (PNS) of all animal species. However, in adults, axonal and dendritic regrowth in the CNS is increasingly lost with evolutionary progression. In the PNS, after infliction of a lesion, axons of all vertebrate species are able to regrow to some extent. However, in the CNS of mammals, axon regrowth following damage is limited to axon sprouting. Regrowth of neuronal processes is, however, possible in the CNS of lower vertebrate species.
Glia are the decisive determinants for controlling axon regrowth. Mammalian glia are generally permissive for axon outgrowth in the CNS during development and in the adult PNS. Thus, upon infliction of a lesion, glia of the adult mammalian PNS can re-express their earlier axon outgrowth-promoting potential and foster regeneration. The CNS glia of some lower vertebrates remain permissive for axon regrowth in adulthood. However, in contrast, CNS glia of adult mammals do not re-express their developmental growth properties following lesions. Hence, repair and regrowth of neurons in the CNS following a lesion is at best very limited.
The extent of growth of axons (or neurites in culture) may be measured by essentially two parameters, i.e. the level of branching, and the level of outgrowth. Axon/neurite
branching relates to the number of axons/neurites that are associated with a cell body of the neuron. Hence, branching is a measure of axon density, whether an axon either grows out from the cell body itself, or forms a sub-branch off another axon. Axon/neurite outgrowth relates to the lengths of the axons/neurites associated with the cell body. It will be appreciated that if it were possible to increase the number (branching) and length (outgrowth) of axons/neurites in a patient, then it would in turn increase the likelihood of achieving a functional connection between adjacent neurons in the patient. Hence, damaged or disconnected axons could be re-connected.
Neurotrophic factors (NTF) are present during the normal development of the nervous system. During such development, neuronal target structures produce limited amounts of specific NTFs necessary for the survival, differentiation and growth of the neurons projecting into target structures. NTFs promote the survival and/or maintenance of mature neurons and are primary determinants of neuronal regeneration after CNS injury. Furthermore, peripheral nerve glia (i.e. Schwann Cells) produce neurotrophic factors (NTF) which are presumed, to be responsible for axon regeneration after injury in the adult PNS. However, long term experiments demonstrate that peripheral nerve implants grafted into the CNS do not maintain CNS axon regeneration beyond 30 days post lesion (dpi) and by 100 dpi most axons degenerate, presumably because Schwann cells in the peripheral nerve implants stop producing NTFs at about 20 days post-implantation,' possibly due to a lack of axonal contact.
Despite numerous efforts spanning many years, neural regeneration in the CNS has never been achieved therapeutically. For instance, Logan et. al. (Eur. J. Neurosci. 1994 1 6(3) 355-63) investigated the effects of modulating levels of Transforming Growth Factor βl (TGFβj) in the injured CNS to see if neuron regeneration could be induced. TGFβi is a neurotrophic factor in some circumstances and is also a potent fibrogenic factor, stimulating the production of matrix molecules including CSPG (an axon growth inhibitory ligand), thereby potentially modulating the axon growth inhibitory pathway. They demonstrated that TGFβi participates in scar formation, which in turn restricts the growth of axonal projections in the injured CNS around the scarred region, probably by active axon growth inhibition via the inhibitory ligands like CSPG contained therein. They showed that blocking TGFβi activity did suppress scarring. However, there was little or no associated axon growth,
suggesting that blocking scar formation and the production of some categories of inhibitory molecules does not lead to enhanced axon regeneration. Therefore, there is a distinct need to provide regenerative therapies that can promote neural growth in the CNS. Such therapies may be used to enable damaged or diseased nerves to survive, re-grow and function again following injury or lesion.
The inventors of the present invention have previously focussed their research on the Rho-A inhibitory pathway in attempt to see if modulation of this pathway could enhance NTF-stimulated neuron survival and axon outgrowth. CNS myelin is a rich source of axon growth inhibitors, including myelin associated glycoprotein (MAG), oligodendrocyte myelin glycoprotein (OMgp), Nogo and, chondroitin sulphate proteoglycans (CSPG), which arrest axon growth by binding to the Nogo-66 receptor (NgR). The Nogo receptor associates with LINGO- 1 (LRR and Ig domain-containing Nogo receptor interacting protein) and either the low affinity neurotrophin receptor (p75NTR), or TROY, to initiate growth cone collapse via the Rho-A inhibitory signalling pathway and/or Ca2+-dependent activation of epidermal growth factor receptor (EGFR) through an unknown signalling pathway. Hence, inhibitory signals are transduced by activating downstream Rho-A, leading to sequential ROCK/LIM kinase/cofilin-mediated actin filament depolymerisation and growth cone collapse. Accordingly, NgR, p75NTR, TROY, EGFR, and the RhoA inhibitory molecule collectively form key elements of the Rho-A axon growth inhibitory pathway. It will be appreciated that numerous other molecules, such as ROCK/LIM, cofilin and LINGO-I, are also involved in the pathway.
In their previous experiments, the inventors successfully demonstrated that it is possible to cause disinhibition of neurotrophin-induced dorsal root ganglion cell neurite outgrowth on CNS myelin by siRNA-mediated knockdown of NgR, p75NTR and Rho-A. Hence, they have demonstrated the efficacy of using siRNA knockdown of p75N R, NgR and Rho-A as a potential therapeutic strategy for enhancing CNS axon regeneration in vivo (Ahmed, 2005, Mol.Cell Neurosci. 28, 509-523). '
Following on from these experiments, the inventors decided to see if it is possible to find alternative therapeutic strategies for enhancing axon growth in vivo (or neurite growth ex vivo) based on their investigations of the Rho-A growth inhibitory pathway. In particular, the
inventors investigated the use of enzymes known as sheddases, which proteolytically cleave membrane-bound proteins to release their Extracellular Domain (ECD)5 as they thought that these could have an effect on neuron growth, and therefore may have a therapeutic use.
One example of a sheddase, which the inventors thought may have potential therapeutic activity includes the enzyme, tumor necrosis factor (TNF)-α converting enzyme (TACE). TACE is a member of the metalloprotease-disintegrin family (i.e. ADAMs) causing the release of TNF-α from cells by liberating the ECD of membrane-bound pro-TNF. TACE is known to be produced by the glia in brain tissue in minute amounts but, up until now, the specific role and function of TACE in the brain has not been understood. Furthermore, it is known that following a lesion, CNS glia of adult mammals do not re-express their developmental growth properties, including production of TACE. Hence, up until now, any potential therapeutic effect of TACE has not been realised.
The inventors therefore investigated disinhibition of axon outgrowth using an in vitro model in which addition of a pre-determined inhibitory concentration of CNS myelin ligands to dorsal root ganglion cell (DRG) cultures blocked FGF2-stimulated neurite outgrowth from DRG neurons (DRGN). Upon addition of the sheddase enzyme, TACE, to these DRG cultures, the inventors were surprised to find:- (i) cleavage of the ectodomain of NgR and p75NTR, and (ii) blockade of Rho-A activation. Furthermore, the inventors were very surprised to find that the addition of the sheddase to the neurites resulted in the significant promotion of FGF2-stimulated neurite outgrowth and also branching, in the presence of the inhibitory CNS myelin ligands. Thus, while the inventors do not wish to be bound by any hypothesis, they believe that sheddase-induced cleavage of NgR and p75N R abrogates axon growth inhibitory signalling, and results in effective disinhibition of CNS axon/neurite growth. Hence, the inventors believe that they have found the first use of a sheddase enzyme as a medicament.
Therefore, according to a first aspect of the present invention, there is provided a sheddase enzyme, or analogue, or derivative, or activator thereof, for use as a medicament.
The inventors also believe that they are the first to demonstrate that the medicament of the first aspect, which cleaves the ectodomain of NgR and p75NTR and TROY to thereby
block Rho-A activation of the Rho-A inhibitory pathway, may be used for promoting axon and/or neurite branching and/or outgrowth.
Hence, in a second aspect, there is provided use of a sheddase enzyme, or analogue, or derivative, or activator thereof, for the manufacture of a medicament for promoting axon and/or neurite branching and/or outgrowth.
It will be appreciated that axons are responsible for passing the nerve signals between neighbouring neurons in vivo, and that the term "neurites" is used to define either axons or dendrites when in cell culture (i.e. ex vivo or in vitro). It should be appreciated therefore that a significant advantage of the invention is that the number, the length, and also branches of axons or neurites increases when exposed to the medicament comprising the sheddase or analogue, derivative or activator thereof. Accordingly, as the number, length and extent of branching of axons/neurites increase upon exposure to the sheddase, so too does the likelihood of achieving a functional connection with adjacent axons/neurites either in the body or in culture. Hence, damaged or dis-connected circuits of axons or neurites may be effectively re-connected upon treatment with the medicament of the first or second aspect aspect, which is a significant surprising advantage.
By the expression "Rho-A inhibitory pathway", we mean the axon growth inhibitory pathway, which includes the NgR, p75NTR, TROY, EGFR, and RhoA inhibitory molecules, amongst others, which will be known to the skilled technician.
By the term "promoting axon and/or neurite branching", we mean the number of branches (or Off-shoots') from axons or neurites (ex vivo or in vitro) increases when in the presence of the medicament comprising a sheddase, or analogue, or derivative, or activator thereof, as compared to the number of axons or neurites when the medicament is absent. As described in the Examples section, an axon/neurite must be at least 20μm long for it to be counted as an axon/neurite (Bouquet et al, J.Neurosci. 24, 7204-7213, 2004).
By the term "promoting axon and/or neurite outgrowth", we mean the length of axons (in vivo), or neurites (ex vivo or in vitro) increases when in the presence of the medicament comprising a sheddase, or analogue, or derivative, or activator thereof, as compared to the
length of axons or neurites when the medicament is absent. The skilled technician will know how to measure whether axon/neurite outgrowth has increased, and an example is given in the Examples section.
Preferably, the medicament is used to promote axon and/or neurite branching and/or outgrowth in the Central Nervous System (CNS) and/or the Peripheral Nervous System (PNS) in a subject being treated. Preferably, the medicament is for the treatment of diseases resulting from neural injury, which may have resulted from surgery, trauma, compression, contusion, transection, neurotoxicity, or other physical injury, from vasculature pharmacologic or other insults including hemorrhagic or ischemic damage or from neurodegenerative or other neurological diseases. Examples of such diseases, which may be treated include spinal cord injury (SCI), glaucoma, and neurodegenerative disorders, such as MS, ALS, Alzheimer's, Parkinson's disease, diabetic neuropathy, and spinal muscular atrophy (SMA). Furthermore, ailments, characterised by impaired or failing axon growth, which may be treated by the medicament, are preferably characterised by neuronal injury. For instance, the ailment may be chronic or acute brain trauma, spinal cord injury, neurotoxicity, stroke, glaucoma, optic nerve damage, blindness, haemorrhage, facial nerve injury, caused by elective surgery, nerve compression, concussion, ischaemia, burns and the like.
The inventors were also surprised to establish that use of a sheddase according to the invention may be used to treat conditions characterised by an increase in cell death.
Therefore, according to a third aspect of the present invention, there is provided use of a sheddase enzyme, or analogue, or derivative, or activator thereof, for the manufacture of a medicament for treating or inhibiting cell apoptosis.
By the term "apoptosis", we mean programmed cell death. Hence, the medicament comprising the sheddase enzyme, or analogue, or derivative, or activator thereof may be used to treat conditions in subjects where neuron (axon or neurite) survival is a significant issue. For instance, the medicament may be used to treat neurodegenerative diseases such as dementia, Parkinson's Disease, Huntingdon's Disease, Alzheimers Disease, Motor Neuron Disease, CJD, diabetic neuropathy, and the like.
Hence, it will be appreciated from the foregoing that the invention has many uses in both in vitro and in vivo applications. For example, the sheddase, or analogue, derivative or activator thereof, may be used to stimulate neurite outgrowth and/or branching in cell culture, following which the neuronal culture may then be transferred to a subject in need of treatment to repair damaged areas. Alternatively, or additionally, the sheddase, or analogue, derivative or activator thereof, may be used to stimulate axon outgrowth and/or branching in vivo in a subject being treated with the medicament of the invention to treat any of the conditions described herein.
By the term "sheddase", we mean any one of the known specialized proteases, which are capable of cleaving an extracellular domain (ECD) of a membrane-bound protein. Hence, this post-translational proteolysis step carried out by a sheddase releases a fragment of the membrane protein with a biologically active domain. Proteolysis may also control the surface expression of multiple integral membrane proteins, and may be used to down-regulate the protein at the cell surface.
Sheddases are also referred to in the art as secretases, or membrane-protein- solubilizing proteases (MPSP). Examples of secretases include α-secretases. Accordingly, the sheddase used in the medicament of the invention may comprise a secretase, and preferably an α-secretase; or a membrane protein solubilising protease.
Sheddases may be sub-classified into a number of different sub-categories, such as metalloproteases, cysteine proteases, aspartic proteases, and serine proteases (Blobel C. Nat Rev MoI Cell Biol 2005, 32-43). Hence, the sheddase. used in the medicament of the invention may comprise an enzyme independently selected from a group consisting of a metalloprotease; a cysteine protease; an aspartic protease; or a serine protease, or any combination thereof.
The skilled technician will appreciate that each of "these categories of sheddase will comprise many members, and each of the inventors believe that any of these would make effective examples of sheddase for use in the medicament according to the invention. For example, cysteine proteases require a cysteine residue for activity, examples of which include
caspases and cathepsins. Hence, the sheddase used in the medicament may comprise a caspase or cathepsin.
In addition, aspartic proteases require an aspartate residue for activity, examples of which include pepsins. Hence, the sheddase used in the medicament may comprise a pepsin.
Furthermore, serine proteases require a serine residue for activity, examples of which include kallikreins. Hence, the sheddase used in the medicament may comprise a kallikrein.
In a preferred embodiment, it is preferred that the sheddase used comprises a metalloprotease. Metalloproteases, which require a metal ion, include ACEs, MMPs, NEPs and ADAMs. Hence, the sheddase used in the medicament preferably comprises a metalloprotease independently selected from a group consisting of angiotensin converting enzyme (ACE), matrix metalloproteinase (MMP), NEP, and a disintegrin and metalloproteinase (ADAM). The metal ion is zinc in most cases and so the enzymes are referred to as zinc metalloproteinases. Therefore, it is preferred that the sheddase used in the medicament comprises a metalloproteinase, and more preferably, a zinc metalloproteinease. The skilled technician will appreciate the various types of metalloproteases. However, an example of a zinc metalloproteinase, are those, which are characterised by a disintegrin and a metalloproteinase domain, which are known in the art as ADAMs. There are at least 30 ADAMs (ADAM 1 to ADAM 30), which are typically 700-800 amino acids in length and are composed of, from the N-terminus, a pro-peptide region, a reprolysin-type Zn- metalloproteinase domain, a disintegrin domain, a cysteine-rich region, a transmembrane region and a cytoplasmic tail. The removal of the pro-peptide domain is required for activation of the metalloproteinase. Hence, it is preferred that the sheddase used in the medicament comprises an ADAM enzyme.
It is preferred that the sheddase used in accordance with the invention comprises at least one enzyme selected from the group consisting of ADAMl to ADAM 30, i.e. ADAM 1, ADAM 2, ADAM 3, and so on to ADAM 30. A preferred sheddase comprises ADAM 10. However, a more preferred ADAM, which may be used in accordance with the invention, comprises ADAM 17. ADAM 17 is also known in the art as Tumor Necrosis Factor-α Converting Enzyme (i.e. TACE), or CD156q. When used herein, the terms TACE,
ADAM17, and CD156q are all interchangeable, and are intended to refer to TumorNecrosis Factor-α Converting Enzyme (Black, 2002, Int. J. Biochem & Cell Biol, 34, 1-5). TACE releases TNF-α from cells by liberating the Extracellular Domain ofmembrane-bound pro- TNF.
It will be appreciated that full characterising details ofthe sheddase, TACE, may be found in the publicly available database, http://www.ncbi.nlm.nih.gov. For example, the DNA sequence for TACE is publicly available under accession code, AC073195, and is incorporatedherein byreference, and is referredto as SEQ ID No.l.
The mRNA transcript for TACE has accession code NM_003183, and comprises substantiallythe following sequence:-
i acctgcactt ctgggggcgt cgagcctggc ggtagaatct tcccagtagg cggcgcggga
61 gggaaaagag gattgagggg ctaggccggg cggatcccgt cctcccccga tgtgagcagt
121 tttccgaaac cccgtcaggc gaaggctgcc cagagaggtg gagtcggtag cggggccggg
181 aacatgaggc agtctctcct attcctgacc agcgtggttc ctttcgtgct ggcgccgcga
241 cctccggatg acccgggctt cggcccccac cagagactcg agaagcttga ttctttgctc
301 tcagactacg atattctctc tttatctaat atccagcagc attcggtaag aaaaagagat
361 ctacagactt caacacatgt agaaacacta ctaacttttt cagctttgaa aaggcatttt
421 aaattatacc tgacatcaag tactgaacgt ttttcacaaa atttcaaggt cgtggtggtg
481 gatggtaaaa acgaaagcga gtacactgta aaatggcagg acttcttcac tggacacgtg
541 gttggtgagc ctgactctag ggttctagcc cacataagag atgatgatgt tataatcaga
601 atcaacacag atggggccga atataacata gagccacttt ggagatttgt taatgatacc
661 aaagacaaaa gaatgttagt ttataaatct gaagatatca agaatgtttc acgtttgcag
721 tctccaaaag tgtgtggtta tttaaaagtg gataatgaag agttgctccc aaaagggtta
781 gtagacagag aaccacctga agagcttgtt catcgagtga aaagaagagc tgacccagat
841 cccatgaaga acacgtgtaa attattggtg gtagcagatc atcgcttcta cagatacatg
901 ggcagagggg aagagagtac aactacaaat tacttaatag agctaattga cagagttgat
961 gacatctatc ggaacacttc atgggataat gcaggtttta aaggctatgg aatacagata
1021 gagcagattc gcattctcaa gtctccacaa gaggtaaaac ctggtgaaaa gcactacaac
1081 atggcaaaaa gttacccaaa tgaagaaaag gatgcttggg atgtgaagat gttgctagag
1141 caatttagct ttgatatagc tgaggaagca tctaaagttt gcttggcaca ccttttcaca
1201 taccaagatt ttgatatggg aactcttgga ttagcttatg ttggctctcc cagagcaaac
1261 agccatggag gtgtttgtcc aaaggcttat tatagcccag ttgggaagaa aaatatctat
1321 ttgaatagtg gtttgacgag cacaaagaat tatggtaaaa ccatccttac aaaggaagct
1381 gacctggtta caactcatga attgggacat aattttggag cagaacatga tccggatggt
1441 ctagcagaat gtgccccgaa tgaggaccag ggagggaaat atgtcatgta tcccatagct
1501 gtgagtggcg atcacgagaa caataagatg ttttcaaact gcagtaaaca atcaatctat
1561 aagaccattg aaagtaaggc ccaggagtgt tttcaagaac gcagcaataa agtttgtggg
1621 aactcgaggg tggatgaagg agaagagtgt gatcctggca tcatgtatct gaacaacgac
1681 acctgctgca acagcgactg cacgttgaag gaaggtgtcc agtgcagtga caggaacagt
1741 ccttgctgta aaaactgtca gtttgagact gcccagaaga agtgccagga ggcgattaat
1801 gctacttgca aaggcgtgtc ctactgcaca ggtaatagca gtgagtgccc gcctccagga
1861 aatgctgaag atgacactgt ttgcttggat cttggcaagt gtaaggatgg gaaatgcatc
1921 ccthtctgcg agagggaaca gcagctggag tcctgtgcat gtaatgaaac tgacaactcc
1981 tgcaaggtgt gctgcaggga cctttctggc cgctgtgtgc cctatgtcga tgctgaacaa
2041 aagaacttat ttttgaggaa aggaaagccc tgtacagtag gattttgtga catgaatggc
2101 aaatgtgaga aacgagtaca ggatgtaatt gaacgatttt gggatttcat tgaccagctg
2161 agcatcaata cttttggaaa gtttttagca gacaacatcg ttgggtctgt cctggttttc
2221 tccttgatat tttggattcc tttcagcatt cttgtccatt gtgtggataa gaaattggat 2281 aaacagtatg aatctctgtc tctgtttcac cccagtaacg tcgaaatgct gagcagcatg 2341 gattctgcat cggttcgcat tatcaaaccc tttcctgcgc cccagactcc aggccgcctg 2401 cagcctgccc ctgtgatccc ttcggcgcca gcagctccaa aactggacca ccagagaatg 2461 gacaccatcc aggaagaccc cagcacagac tcacatatgg acgaggatgg gtttgagaag 2521 gaccccttcc caaatagcag cacagctgcc aagtcatttg aggatctcac ggaccatccg 2581 gtcaccagaa gtgaaaaggc tgcctccttt aaactgcagc gtcagaatcg tgttgacagc 2641 aaagaaacag agtgctaatt tagttctcag ctcttctgac ttaagtgtgc aaaatatttt 2701 tatagatttg acctacaaat caatcacagc ttgtattttg tgaagactgg gaagtgactt 2761 agcagatgct ggtcatgtgt ttgaacttcc tgcaggtaaa cagttcttgt gtggtttggc 2821 ccttctcctt ttgaaaaggt aaggtgaagg tgaalzctagc ttattttgag gctttcaggt 2881 tttagttttt aaaatatctt ttgacctgtg gtgcaaaagc agaaaataca gctggattgg 2941 gttatgaata tttacgtttt tgtaaattaa tcttttatat tgataacagc actgactagg 3001 gaaatgatca gttttttttt atacactgta atgaaccgct gaatatgagg catttggcat 3061 ttatttgtga tgacaactgg aatagttttt tttttttttt tttttttttg ccfctcaacta 3121 aaaacaaagg agataaatct agtatacatt gtctctaaat tgtgggtcta tttctagtta 3181 ttacccagag tttttatgta gcagggaaaa tatatatcta aatttagaaa tcatttgggt 3241 taatatggct cttcataatt ctaagactaa tgctctctag aaacctaacc acctacctta 3301 cagtgagggc tatacatggt agccagttga atttatggaa tctaccaact gtttagggcc 3361 ctgatttgct gggcagtttt tctgtatttt ataagtatct tcatgtatcc ctgttactga 3421 tagggataca tgctcttaga aaattcacta ttggctggga gtggtggctc atgcctgtaa 3481 tcccagcact tggagaggct gaggttgcgc cactacactc cagcctgggt gacagagtga 3541 gactctgcct caaaaaaaaa aaaaaaaaaa aa
[SEQ ID No.2]
In addition, the protein sequence of human TACE has accession code NP_003174, and comprises substantially the following sequence:-
MRQSLLFLTSWPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDLQTSTHVETLLTFSA LKRHFKLYLTSSTERFSQNFKVVWDGKNESEYTVKWQDFFTGHWGEPDSRVLAHIRDDDVIIRINTDGAEYN IEPLWRFWDTKDKRMLWKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDRΞPPEELVHRVKRRADPDPMK NTCKLL WADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEK HYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYY SPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNEDQGGKYVMYPIAVSGDH ENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGNSRVDEGEECDPGIMYLNNDTCCNSDCTLKEGVQCSDRN SPCCKNCQFETAQKKCQEAINATCKGVSYCTGNSSECPPPGNAEDDTVCLDLGKCKDGKCIPFCEREQQLESCA CNETDNSCKVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLSINTFGK FLADNIVGSVL VFSLIFWIPFSILVHCVDKKLDKQYESLSLFHPSNVEMLSSMDSASVRI IKPFPAPQTPGRLQ PAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQ
NRVDSKETΞC
[SEQ ID No.3]
Examples 1 and 2 describe a test paradigm delivering the sheddase, TACE, against p75NTR mRNA in cultured Dorsal Root Ganglion Cells (DRGC), which have been treated with FGF-2 in the presence of inhibitory CNS myelin extract. As shown in Figures 3B, 4A and 4B, the inventors found to their surprise that the addition of exogenous TACE on its own induced neurite outgrowth and branching in the DRGC neurons in the presence of inhibitory CNS myelin extract, both in the presence and also the absence of a neurotrophic factor, such as FGF-2. The inventors believe that the addition of TACE cleaved p75NTR, and thereby
caused a significant increase in (a) the number of DRGCs with neurites, (b) the number of bracnlies/neurite, and (b) the mean neurite length. The inventors therefore realized that an important feature of the present invention is that a sheddase enzyme or analogue, derivative or activator thereof, may be used in combination with a molecule, which stimulates growth of axons/neuritis, such as a Neurotrophic Factor (NTF).
The inventors have shown that such a combination has a surprising synergistic effect on axon/neurite outgrowth and branching, and neuron survival. When used separately, these agents have either modest or minimal effects, whereas in combination the agents can dramatically improve neural regeneration, and this could not have been predicted. Examples of suitable growth stimulators may include any Neurotrophic Factor (NTF).
Hence, it is especially preferred that the medicament of the first aspect or the use of the second or third aspect comprises combining the sheddase, or analogue, derivative or activator thereof, with a neurotrophic factor (NTF), for the manufacture of the medicament.
The inventors believe that use of these two components (i.e. the sheddase and an NTF) results in the manufacture of a very effective medicament for treating disease conditions characterised by damaged or impaired nerves. The NTF may be either TRK- dependent or TRK-independent. An example of a preferred NTF includes Ciliary Neurotrophic Factor (CNTF) or Fibroblast Growth Factor 2 (FGF2). It will be appreciated that CNTF is an effective growth stimulator of neurites in Retinal Ganglion Cells (RGC), and FGF2 is an effective growth stimulator of neurites in Dorsal Root Ganglia Neurons (DRGN). Other NTFs that may be used in conjunction with a sheddase include but are not limited to:- NGF, NT-3, NT-4, BDNF, GDNF, FGF-I, FGF-5, CT-I, CDF, insulin, IGF-I, IGF-2, IL-6, LIF, NPF, PDGF, PN-I, S-IOO, TGF-β, and VIP (Oppenheim, 1996, Neuron 17:195-197).
Furthermore, as shown in Figures 3B5 4A and 4B, even more surprisingly was the observation that not only did the TACE cause dis-inhibition of the Rho-A inhibitory pathway, it was also capable of inducing much greater neural growth (i.e. both outgrowth and branching) than would be stimulated in the absence of inhibitory myelin derived ligands. This was particularly surprising, as due to some unknown mechanism, TACE was able to stimulate growth over and above that seen in the absence of myelin extract. While the
inventors do not wish to be bound by any theory, they believe that this may be because the enzyme was disinhibiting inhibitors other than those that are myelin derived, for example, ephrins, semaphorins, and chondroitin sulphate proteoglycans (CSPG).
Hence, it is especially preferred that the medicament of the invention comprises a sheddase, or analogue, derivative or activator thereof, and an axon/neurite growth stimulating molecule.
The inventors believe that use of these two components (i.e. the sheddase and an axon/neurite growth stimulatory molecule) results in the manufacture of a surprisingly effective medicament for treating disease conditions characterised by damaged or impaired nerves, and that this effect was totally unexpected. Examples of axon/neurite growth inhibitor molecules include myelin-related molecules, chondroitin sulphate proteoglycans (CSPG), ephrins and semaphorins. In this embodiment, the use of the sheddase, not only reverses inhibition of the NTF-stimulated axonal growth caused by myelin-derived neurite growth inhibitor molecules such as the myelin-related molecules indicated, but also surprisingly stimulates axon outgrowth and branching to a greater extent than seen in the absence of the myelin-derived inhibitor molecules. For instance, the effect is greater than found in control experiments in which neurites are stimulated with an NTF in the absence of myelin-derived • neurite growth inhibitor molecules. Again, the inventors believe that this effect was totally unexpected.
Hence, it is especially preferred that the medicament of the invention comprises a sheddase, or analogue, derivative or activator thereof, and a neurotrophic factor (NTF). The inventors believe that use of these two components (ie. the sheddase, and the NTF) results in the manufacture of a surprisingly effective medicament for treating disease conditions characterised by damaged or impaired nerves.
By the teπn "activator of a sheddase enzyme", we mean a positive modulator, or an agonist of a sheddase enzyme, which may be present in a subject to be treated. Suitable activators may comprise:- (i) compounds, which increase the expression, transcription, or translation and therefore concentration of sheddase; and (ii) compounds, which decrease the rate of degradation of the sheddase, or analogue or derivative thereof.
Alternatively, in another embodiment, the sheddase activator may comprise a sheddase expression system adapted to increase the expression level and, hence, concentration of the sheddase or analogue or derivative thereof in a target cell, preferably in a subject to be treated. For example, if the medicament of the invention is to be administered to the CNS of a subject, then the expression system may be administered to target cells in the CNS. It is preferred that the expression system may be administered directly to the site requiring promotion of axon/neurite outgrowth and branching. Preferably, the expression system comprises a nucleic acid sequence encoding a sheddase enzyme or analogue or derivative thereof, and preferably comprises elements capable of controlling and/or enhancing expression of the nucleic acid. The nucleic acid sequence may be a DNA sequence, which is preferably derived from the same source as the subject, which is to be treated, for example, human.
Sequences for suitable sheddase enzymes, which may be used according to the invention will be known to the skilled technician, and may be readily obtainable from publicly available databases. The DNA sequence for human TACE comprises SEQ ID NO.l, which is publicly available, and the mRNA and protein sequences for human TACE are given as SEQ ID No.2 and SEQ ID No.3, respectively, which are also publicly available. Therefore, by way of example, the sequence of the nucleic acid in the expression system may be a nucleotide sequence such as SEQ ID No.l, which may be transcribed into the mRNA of SEQ ID No.2, which may be translated into the sheddase enzyme, TACE, for example, as identified as SEQ ID No.3.
The nucleic acid may be contained within a suitable vector to form a recombinant vector. For example, the vector may be derived from a plasmid, cosmid, phage, or virus. Examples of a suitable virus include a retrovirus, herpes virus, pox virus, vaccina virus, adenovirus, lentivirus and the like). Such recombinant vectors are highly useful for transforming target cells (e.g. cells of the CNS) with the nucleic acid molecule encoding the sheddase. Recombinant vectors may also comprise other functional elements. For instance, recombinant vectors may be designed such that the vector may autonomously replicate in the target cell, hi this case, elements that induce nucleic acid replication may be required in the recombinant vector.
Alternatively, the recombinant vector may be designed such that the vector and recombinant nucleic acid molecule integrates into the genome of a target cell. In this case, it is preferred that the vector comprises nucleic acid sequences, which favour targeted integration (e.g. by homologous recombination). Recombinant vectors may also comprise DNA coding for genes that may be used as selectable markers in the cloning process, which will be known to the skilled technician.
The recombinant vector may comprise a promoter or regulator for controlling expression of the gene, as required. The nucleic acid molecule may (but not necessarily) be one, which becomes incorporated in the DNA of cells of the subject being treated. Undifferentiated cells may be stably transformed leading to the production of genetically modified daughter cells (in which case regulation of expression in the subject may be required e.g. with specific transcription factors or gene activators). Alternatively, the expression system may be designed to favour unstable or transient transformation of differentiated cells in the subject being treated. When this is the case, regulation of expression may be less important because expression of the DNA molecule will stop when the transformed cells die or stop expressing the protein (ideally when the required therapeutic effect has been achieved).
In another embodiment, the expression system may provide the nucleic acid molecule encoding the sheddase, or analogue or derivative thereof to the subject without it being incorporated in a vector. For instance, the nucleic acid molecule may be incorporated within a liposome or a virus particle. Alternatively, a "naked" nucleic acid molecule may be inserted into a subject's cells by a suitable means e.g. direct endocytotic uptake.
The nucleic acid molecule may be transferred to the cells of a subject to be treated by transfection, infection, microinjection, cell fusion, protoplast fusion or ballistic bombardment. For example, transfer may be by ballistic transfection with coated gold particles, liposomes containing the nucleic acid molecule, viral vectors (e.g. adenovirus) and means of providing direct nucleic acid uptake (e.g. endocytosis) by application of the nucleic acid molecule directly.
It is envisaged that the expression system defined herein may be used in a gene therapy technique for the treatment of diseases characterised by damaged or impaired nerves.
Hence, in a fourth aspect, there is provided a delivery system for use in a gene therapy technique, the delivery system comprising a nucleic acid molecule encoding a protein which directly or indirectly modulates activity of a sheddase, or analogue or derivative thereof, wherein said nucleic acid molecule is capable of being transcribed to allow the expression of the protein, which is effective for treating a disease condition characterised by a damaged or impaired nerves.
Advantageously, the delivery system of the fourth aspect is highly suitable for achieving sustained levels of a protein, which is therapeutically active for combating diseases as described herein over a longer period of time than is possible for most conventional therapeutic regimes. The delivery system may be used to induce continuous protein expression in cells in a target tissue to be treated, for example, the CNS or PNS, that have been transformed with the DNA molecule. Therefore, even if the protein has a very short half-life as agent in vivo, therapeutically effective amounts of the protein may be continuously expressed in the treated tissue.
The delivery system of the fourth aspect preferably comprises the expression system as described herein. The nucleic acid molecule may be a DNA molecule, which may be derived from human, and may encode a sheddase, or analogue or derivative thereof. For example, the nucleic acid molecule may comprise SEQ ID No.l, which may encode the sheddase shown as SEQ ID No.3.
Furthermore, advantageously, the delivery system of the invention may be used to provide the nucleic acid molecule (and thereby the protein which is the active therapeutic agent) without the need to use conventional pharmaceutical vehicles such as those required in tablets, capsules or liquids. The delivery system of the invention is such that the nucleic acid molecule is capable of being expressed (when the delivery system is administered to a patient) to produce a protein that directly or indirectly has activity for modulating activity of a sheddase. By "directly", we mean that the product of gene expression per se has the required activity. Hence, the product of gene expression is itself a sheddase enzyme, or analogue, or derivative thereof. By "indirectly", we mean that the product of gene expression
undergoes or mediates (e.g. as an enzyme) at least one further reaction to provide an agent effective for modulating the sheddase activity.
The delivery system may further comprise a nucleic acid sequence (which is preferably DNA), which encodes a neurotrophic factor (NTF). The skilled technician will appreciate that there are many types of NTF, which may be used to increase the effect of the sheddase. Examples include FGF-2 (NM_002006) and CNTF (NM__000614), the DNA and amino acid sequences of which are readily available to the skilled technician.
For example, the mRNA sequence (spliced transcipt) for FGF-2 is set out as:- i cggccccaga aaacccgagc gagtaggggg cggcgcgcag gagggaggag aactgggggc
61 gcgggaggct ggtgggtgtc gggggtggag atgtagaaga tgtgacgccg cggcccggcg
121 ggtgccagat tagcggacgc gctgcccgcg gttgcaacgg gatcccgggc gctgcagctt
181 gggaggcggc tctccccagg cggcgtccgc ggagacaccc atccgtgaac cccaggtccc
241 gggccgccgg ctcgccgcgc accaggggcc ggcggacaga agagcggccg agcggctcga
301 ggctggggga ccgcgggcgc ggccgcgcgc tgccgggcgg gaggctgggg ggccggggcc
361 ggggccgtgc cccggagcgg gtcggaggcc ggggccgggg ccgggggacg gcggctcccc
421 gcgcggctcc agcggctcgg ggatcccggc cgggccccgc agggaccatg gcagccggga
481 gcatcaccac gctgcccgcc ttgcccgagg atggcggcag cggcgccttc ccgcccggcc
541 acttcaagga ccccaagcgg ctgtactgca aaaacggggg cttcttcctg cgcatccacc
601 ccgacggccg agttgacggg gtccgggaga agagcgaccc tcacatcaag ctacaacttc
661 aagcagaaga gagaggagtt gtgtctatca aaggagtgtg tgctaaccgt tacctggcta
721 tgaaggaaga tggaagatta ctggcttcta aahgtgttac ggafcgagtgt ttcttttttg
781 aacgattgga atctaataac tacaatactt accggtcaag gaaatacacc agttggtatg
841 tggcactgaa acgaactggg cagtataaac ttggatccaa aacaggacct gggcagaaag
901 ctatactttt tcttccaatg tctgctaaga gctgatttta atggccacat ctaatctcat
961 ttcacatgaa agaagaagta tattttagaa atttgttaat gagagtaaaa gaaaataaat
1021 gtgtatagct cagtttggat aattggtcaa acaatttttt atccagtagt aaaatatgta
1081 accattgtcc cagtaaagaa aaataacaaa agttgtaaaa tgtatattct cccttttata
1141- tfcgcatctgc tgttacccag tgaagcttac ctagagcaat gatctttttc acgcatttgc
1201 tttattcgaa aagaggcttt taaaatgtgc atgtttagaa acaaaatttc ttcatggaaa
1261 tcatatacat tagaaaatca cagtcagatg tttaatcaat ccaaaatgtc cactatttct
1321 tatgtcattc gttagtctac atgtttctaa acatataaat gtgaatttaa tcaattcctt
1381 tcatagtttt ataattctct ggcagttcct tatgatagag tttataaaac agtcctgtgt
1441 aaactgctgg aagttcttcc acagtcaggt caattttgtc aaacccttct ctgtacccat
1501 acagcagcag cctagcaact ctgctggtga tgggagttgt attttcagtc ttcgccaggt
1561 cattgagatc catccactca catcttaagc attcttcctg gcaaaaattt atggtgaatg
1621 aatatggctt taggcggcag atgatataca tatctgactt cccaaaagct ccaggatttg
1681 tgtgctgttg ccgaatactc aggacggacc tgaattctga ttttatacca gtctcttcaa
1741 aaacttctcg aaccgctgtg tctcctacgt aaaaaaagag atgtacaaat caataataat
1801 tacactthta gaaactgtat catcaaagat tttcagttaa agtagcatta tgtaaaggct
1861 caaaacatta ccctaacaaa gtaaagtttt caatacaaat tctttgcctt gtggatatca
1921 agaaatccca aaatattttc ttaccactgt aaattcaaga agcttttgaa atgctgaata
1981 tttctttggc tgctacttgg aggcttatct acctgtacat ttttggggtc agctcttttt
2041 aacttcttgc tgctcttttt cccaaaaggt aaaaahatag attgaaaagt taaaacattt
2101 tgcatggctg cagttccttt gtttcttgag ataagattcc aaagaactta gattcatttc
2161 ttcaacaccg aaatgctgga ggtgtttgat cagttttcaa gaaacttgga atataaataa
2221 ttttataatt caacaaaggt tttcacattt tataaggttg atttttcaat taaatgcaaa
2281 tttgtgtggc aggattttta ttgccattaa catatttttg tggctgcttt ttctacacat
2341 ccagatggtc cctctaactg ggctttctct aattttgtga tgttctgtca ttgtctccca
2401 aagtatttag gagaagccct ttaaaaagct gccttcctct accacttfcgc tggaaagctt
2461 cacaattgtc acagacaaag atttttgttc caatactcgt tttgcctcta tttttcttgt
2521 ttgtcaaata gtaaatgata tttgcccttg cagtaattct actggtgaaa aacatgcaaa
2581 gaagaggaag tcacagaaac atgtctcaat tcccatgtgc tgtgactgta gactgtctta
2641 ccatagactg tcttacccat cccctggata tgctcttgtt ttttccctct aatagctatg
2701 gaaagatgca tagaaagagt ataatgtttt aaaacataag gcattcatct gccatttttc
2761 aattacatgc tgacttccct tacaattgag atttgcccat aggttaaaca tggttagaaa
2821 caactgaaag cataaaagaa aaatctaggc cgggtgcagt ggctcatgcc tatattccct
2881 gcactttggg aggccaaagc aggaggatcg cttgagccca ggagttcaag accaacctgg
2941 tgaaaccccg tctctacaaa aaaacacaaa aaatagccag gcatggtggc gtgtacatgt
3001 ggtctcagat acttgggagg ctgaggtggg agggttgatc acttgaggct gagaggtcaa
3061 ggttgcagtg agccataatc gtgccactgc agtccagcct aggcaacaga gtgagacttt
3121 gtctcaaaaa aagagaaatt ttccttaata agaaaagtaa tttttactct gatgtgcaat
3181 acatttgtta ttaaatttat tatttaagat ggtagcacta gtcttaaatt gtataaaata
3241 tcccctaaca tgtttaaatg tccattttta ttcattatgc tttgaaaaat aattatgggg
3301 aaatacatgt ttgttattaa atttattafct aaagatagta gcactagtct taaatttgat
3361 ataacatctc ctaacttgtt taaatgtcca tttttattct ttatgcttga aaataaatta
3421 tggggatcct atttagctct tagtaccact aatcaaaagt tcggcatgta gctcatgatc
3481 tatgctgttt ctatgtcgtg gaagcaccgg atgggggtag tgagcaaatc tgccctgctc
3541 agcagtcacc atagcagctg actgaaaatc agcactgcct gagtagtttt gatcagttta
3601 acttgaatca ctaactgact gaaaattgaa tgggcaaata agtgcttttg tctccagagt
3661 atgcgggaga cccttccacc tcaagatgga tatttcttcc ccaaggattt caagatgaat
3721 tgaaattttt aatcaagata gtgtgcttta ttctgttgta ttttttatta ttttaatata
3781 ctgtaagcca aactgaaata acatttgctg ttttataggt ttgaagaaca taggaaaaac
3841 taagaggttt tgtttttatt tttgctgatg aagagatatg tttaaatatg ttgtattgtt
3901 ttgtttagtt acaggacaat aatgaaatgg agtttatatt tgttatttct attttgttat ,
3961 atttaataat agaattagat tgaaataaaa tataatggga aataatctgc agaatgtggg
4021 tttcctggtg ttfccctctga ctctagtgca ctgatgatct ctgataaggc tcagctgctt
4081 tatagttctc tggctaatgc agcagatact cttcctgcca gtggtaatac gattttttaa
4141 gaaggcagtt tgtcaatttt aatcttgtgg atacctttat actcttaggg tattatttta
4201 tacaaaagcc ttgaggattg cattctattt tctatatgac cctcttgata tttaaaaaac
4261 actatggata acaattcttc atttacctag tattatgaaa gaatgaagga gttcaaacaa
4321 atgtgtttcc cagttaacta gggtttactg tttgagccaa tataaatgtt taactgtttg
4381 tgatggcagt attcctaaag tacattgcat gttttcctaa atacagagtt taaataattt
4441 cagtaattct tagatgattc agcttcatca ttaagaatat cttttgtttt atgttgagtt
4501 agaaatgcct tcatatagac atagtctttc agacctctac tgtcagtttt catttctagc
4561 tgctttcagg gttttatgaa ttttcaggca aagctttaat ttatactaag cttaggaagt
4621 atggctaatg ccaacggcag tttttttctt cttaattcca catgactgag gcatatatga
4681 tctctgggta ggtgagttgt tgtgacaacc acaagcactt tttttttttt taaagaaaaa
4741 aaggtagtga atttttaatc atctggactt taagaaggat tctggagtat acttaggcct
4801 gaaattatat atatttggct tggaaatgtg tttttcttca attacatcta caagtaagta
4861 cagctgaaat tcagaggacc cataagagtt cacatgaaaa aaatcaattc atttgaaaag
4921 gcaagatgca ggagagagga agccttgcaa acctgcagac tgctttttgc ccaatataga
4981 ttgggtaagg ctgcaaaaca taagcttaat tagctcacat gctctgctct cacgtggcac
5041 cagtggatag tgtgagagaa ttaggctgta gaacaaatgg ccttctcttt cagcattcac
5101 accactacaa aatcatcttt tatatcaaca gaagaataag cataaactaa gcaaaaggtc
5161 aataagtacc tgaaaccaag attggctaga gatatatctt aatgcaatcc attttctgat
5221 ggafctgttac gagttggcta tataatgtat gtatggtatt ttgatttgtg taaaagtttt
5281 aaaaatcaag ctttaagtac atggacattt ttaaataaaa tatttaaaga ■ caatttagaa
5341 aattgcctta atatcahtgt tggctaaata gaatagggga catgcatatt aaggaaaagg
5401 tcatggagaa ataatattgg tatcaaacaa atacattgat ttgtcatgat acacattgaa
5461 tttgatccaa tagtttaagg aataggtagg aaaatttggt ttctattttt cgatttcctg
5521 taaatcagtg acataaataa ttcttagctt attttatatt tccttgtctt aaatactgag
5581 ctcagtaagt tgtgttaggg gattatttct cagttgagac tttcttatat gacattttac
5641 tatgttttga cttcctgact attaaaaata aatagtagaa acaattttca taaagtg"aag
5701 aattatataa tcactgcttt ataactgact ttattatatt tatttcaaag ttcatttaaa
5761 ggctactatt catcctctgt gatggaatgg tcaggaattt gttttctcat agtttaattc
5821 caacaacaat attagtcgta tccaaaataa cctttaatgc taaactttac tgatgtatat
5881 ccaaagcttc tccttttcag acagattaat ccagaagcag tcataaacag aagaataggt
5941 ggtatgttcc taatgatatt atttctacta atggaataaa ctgtaatatt agaaattatg
6001 ctgctaatta tatcagctct gaggfcaattt ctgaaatgtt cagactcagt cggaacaaat
6061 tggaaaattt aaatttttat tcttagctat aaagcaagaa agtaaacaca ttaatttcct
6121 caacattttt aagccaatta aaaatataaa agatacacac caatatcttc ttcaggctct
6181 gacaggcctc ctggaaactt ccacatattt ttcaactgca gtataaagtc agaaaataaa 6241 gttaacataa ctttcactaa cacacacata tgtagatttc acaaaatcca cctataattg 6301 gtcaaagtgg ttgagaatat attttttagt aattgcatgc aaaatttttc tagcttccat 6361 cctttctccc tcgtttcttc tttttttggg ggagctggta actgatgaaa tcttttccca 6421 ccttttctct tcaggaaata taagtggttt tgtttggtta acgtgataca ttctgtatga 6481 atgaaacatt ggagggaaac atctactgaa tttctgtaat ttaaaatatt ttgctgctag 6541 ttaactatga acagatagaa gaatcttaca gatgctgcta taaataagta gaaaatataa 6601 atttcatcac taaaatatgc tattttaaaa tctatttcct atattgtatt tctaatcaga 6661 tgtattactc ttattatttc tattgtatgt gttaatgatt ttatgtaaaa atgtaattgc 6721 ttttcatgag tagtatgaat aaaattgatt agtttgtgtt ttcttgtctc ccgaaaaaaa 6781 aaaaaaaaaa aaaaaaaaaa aaa
[SEQ ID No.4] For example, themRNA sequence (splicedtranscipt) forCNTF is setout as:-
i gagagtcaca tctcttattt ggaccagtat agacagaagt aaacccagct gacttgtttc
61 ctgggacagt tgagttaagg gatggctttc acagagcatt caccgctgac ccctcaccgt
121 cgggacctct gtagccgctc tatctggcta gcaaggaaga ttcgttcaga cctgactgct
181 cttacggaat cctatgtgaa gcatcagggc ctgaacaaga acatcaacct ggactctgcg
241 gatgggatgc cagtggcaag cactgatcag tggagtgagc tgaccgaggc agagcgactc
301 caagagaacc ttcaagctta tcgtaccttc catgttttgt tggccaggct cttagaagac
361 cagcaggtgc attttacccc aaccgaaggt gacttccatc aagctataca tacccttctt
421 ctccaagtcg ctgcctttgc ataccagata gaggagttaa tgatactcct ggaatacaag
481 atcccccgca atgaggctga tgggatgcct attaatgttg gagatggtgg tctctttgag
541 aagaagctgt ggggcctaaa ggtgctgcag gagctttcac agtggacagt aaggtccatc
601 catgaccttc gtttcatttc ttctcatcag actgggatcc cagcacgtgg gagccattat
661 attgctaaca acaagaaaat gtagcagtta gtcccttctc tcttccttgc tttctcttct
721 aatggaatat gcgtagttcc ctggggcctc gctttcccat cttaaatttc taaaaacagt
781 taagacaaca ggcattttct ttcttttttc tctgaccacc tgcagcctgt tgaaggacta
841 caggtatttt catcaagtag cgttggagac atacacaaat gggcatacaa gtttagcctg
901 gggggtgtga tttgtgtgcg tgcttgcatg tgctgcaggt gtaagagagt gggagcaggg
961 acaacgtcct tccacttcag ggttctaacc tttctaaccc actaagtaac ctctacaggc
1021 atttaactgc cttacagaca gaatatacat atgttaattc tagtcctgga tgactcggtc
1081 tgagaagatt caatttaaaa tcagactctt tagttgattt aaactcttag agaataagaa
1141 taataatggc taacttttat tatcttctat attaaggcag tatgccaagg gtctttatgt
1201 atattatgta cagcgtttac aaccttgtga gcaaggtggt gttactccca ttaggtagat
1261 gagaaaacag gctcacagag atttggttaa gctcacacag ctaacaagta gcacactgag
1321 tttgaacaca gatcattctc cttgtaaaag cctatgtgcc tttcacttta gaggcttgat
1381 catgaatcac tgcacctctt tgtcacaggg tgttggaaga tgcatccatg taatctattc
1441 ccatcgctgg aaaacagctg ctgttagatg tcctcagaag tcagttgcaa attttagcgt
1501 taaagtcagg atttattgtt catacttggc ggtgaggagg gcagctggag atcttaagat
1561 tccattttgg aaaatgatta ggcccgccaa acttctgaac tttggaagct ggggatgttt
1621 agtaatacag cctggttttc aagtactcac taaaagttct caaatattgg gttgggcacg
1681 gcttatacca ggttacctca cttttaatta gtgatgcagg cagtgtaacc caagcatttg
1741 tggacaatga gtggaatact aaagttaaaa agtcaaactt tcacctcaga ttttctggac
1801 ttagtcatga ggagagggtg aggcccactc tgttcctact ggagatacca gagactctga
1861 aactatagaa taaagcctct gtgctgcaca
[SEQ ID No.5]
It is envisaged that the gene therapy technique comprises administering the delivery system to the subject being treated such that the nucleic acid molecule (and where applicable the further nucleic acid sequence(s)) is expressed in the subject. Expression of the protein(s)
causes direct or indirect modulation of the activity of the sheddase enzyme, or analogue or derivative thereof, thereby promoting axon and/or neurite outgrowth and branching in the subject, thereby treating the disease characterised by damaged or impaired nerves.
Derivatives or analogues of the sheddase enzyme used in the medicament according to the invention may include derivatives or analogues that increase or decrease the enzyme's half-life in vivo or ex vivo. It is preferred that the derivative or analogue exhibits enhanced resistance to hydrolysis, by for example, peptidases. It will also be appreciated that the invention extends to the amino acid sequence of a sheddase enzyme, or a nucleic acid encoding a sheddase enzyme, or a derivative, or an analogue thereof, which comprises substantially the amino acid or nucleic acid sequences of any of the sequences referred to herein, including functional variants or functional fragments thereof.
Hence, by the terms "analogue of a sheddase enzyme" or "derivative of a sheddase enzyme", or "substantially the amino acid/polynucleotide/polypeptide sequence", "functional variant" and "functional fragment", we mean that the sequence has at least 30% sequence identity with the amino acid/polynucleotide/polypeptide sequences of any one of the sequences referred to herein. For example, a derivative or analogue of sheddase may comprise 30% identity with the sheddase gene identified as SEQ ID No.l, or 30% identity with the sheddase polypeptide identified as SEQ ID No.3. Amino acid/polynucleotide/polypeptide sequences with a sequence identity which is greater than 65%, more preferably, greater than 70%, even more preferably, greater than 75%, and still more preferably, greater than 80% sequence identity to any of the sequences referred to is also envisaged. Preferably, the amino acid/polynucleotide/polypeptide sequence has 85% identity with any of the sequences referred to, more preferably 90% identity, even more preferably 92% identity, even more preferably 95% identity, even more preferably 97% identity, even more preferably 98% identity and, most preferably, 99% identity with any of the referred to sequences.
The skilled technician will appreciate how to calculate the percentage identity between two amino acid/polynucleotide/polypeptrde sequences, for example, as described in http://wikiomics.org/wiki/Percentage_identity. In order to calculate the percentage identity between two amino acid/polynucleotide/polypeptide sequences, an alignment of the two sequences must first be prepared, followed by calculation of the sequence identity value.
The percentage identity for two sequences may take different values depending on:- (i) the method used to align the sequences, for example, ClustalW, BLAST, FASTA, Smith- Waterman (implemented in different programs), or structural alignment from 3D comparison; and (ii) the parameters used by the alignment method, for example, local vs global alignment, the pair-score matrix used (e.g. BLOSUM62, PAM250, Gonnet etc.), and gap-penalty, e.g. functional form and constants.
Having made the alignment, there are many different ways of calculating percentage identity between the two sequences. For example, one may divide the number of identities by: (i) the length of shortest sequence; (ii) the length of alignment; (iii) the mean length of sequence; (iv) the number of non-gap positions; or (iv) the number of equivalenced positions excluding overhangs. Furthermore, it will be appreciated that percentage identity is also strongly length dependent. Therefore, the shorter a pair of sequences is, the higher the sequence identity one may expect to occur by chance.
Hence, it will be appreciated that the accurate alignment of protein or DNA sequences is a complex process. The popular multiple alignment program ClustalW (Thompson et al.,
1994, Nucleic Acids Research, 22, 4673-4680; Thompson et al., 1997, Nucleic Acids
Research, 24, 4876-4882) is a preferred way for generating multiple alignments of proteins or DNA in accordance with the invention. Suitable parameters for ClustalW may be as follows: For DNA alignments: Gap Open Penalty = 15.0, Gap Extension Penalty = 6.66, and Matrix = Identity. For protein alignments: Gap Open Penalty = 10.0, Gap Extension Penalty
= 0.2, and Matrix = Gonnet. For DNA and Protein alignments: ENDGAP = -1, and
GAPDIST = 4. Those skilled in the art will be aware that it may be necessary to vary these and other parameters for optimal sequence alignment.
Preferably, calculation of percentage identities between two amino acid/polynucleotide/polypeptide sequences is then calcluated from such an alignment as (N/T)*100, where N is the number of positions at which the sequences share an identical residue, and T is the total number of positions compared including gaps but excluding • overhangs. Hence, a most preferred method for calculating percentage identity between two sequences defined herein comprises (i) preparing a sequence alignment using the ClustalW program using a suitable set of parameters, for example, as set out above; and (ii) inserting the values of N and T into the following formula:- Sequence Identity = (N/T)*100.
Alternative methods for identifying similar sequences will be known to those skilled in the art. For example, a substantially similar nucleotide sequence will be encoded by a sequence which hybridizes to the sequences shown in SEQ ID No.l or their complements under stringent conditions. By stringent conditions, we mean the nucleotide hybridises to filter-bound DNA or RNA in 3x sodium chloride/sodium citrate (SSC) at approxmiately 450C followed by at least one wash in 0.2x SSC/0.1% SDS at approximately 20-650C. Alternatively, a substantially similar polypeptide may differ by at least 1, but less than 5, 10, 20, 50 or 100 amino acids from the sequences shown in SEQ ID No.3.
Due to the degeneracy of the genetic code, it is clear that any nucleic acid sequence could be varied or changed without substantially affecting the sequence of the protein encoded thereby, to provide a functional variant thereof. Suitable nucleotide variants are those having a sequence altered by the substitution of different codons that encode the same amino acid within the sequence, thus producing a silent change. Other suitable variants are those having homologous nucleotide sequences but comprising all, or portions of, sequence, which are altered by the substitution of different codons that encode an amino acid with a side chain of similar biophysical properties to the amino acid it substitutes, to produce a conservative change. For example small non-polar, hydrophobic amino acids include glycine, alanine, leucine, isoleucine, valine, proline, and methionine. Large non-polar, hydrophobic amino acids iriclude phenylalanine, tryptophan and tyrosine. The polar neutral amino acids include serine, threonine, cysteine, asparagine and glutamine. The positively charged (basic) amino acids include lysine, arginine and histidine. The negatively charged (acidic) amino acids include aspartic acid and glutamic acid. It will therefore be appreciated which amino acids may be replaced with an amino acid having similar biophysical properties, and the skilled technician will known the nucleotide sequences encoding these amino acids.
It will be appreciated that use of the sheddase enzyme or analogue, derivative or activator thereof according to the present invention may be used in a monotherapy (e.g. use of a sheddases per se, or analogue or derivative or activator thereof (e.g. an expression or delivery system according to the invention to promote axon and/or neurite outgrowth and/or branching). However, it is preferred that the sheddase is used as an adjunct, or in combination with, any other therapies, which may be used to promote axon/neurite branching/outgrowth (for example, the addition of an NTF). It is therefore particularly
preferred that combination therapy comprises a sheddase, or analogue or derivative thereof, or an expression system therefor, and a Neurotrophic Factor (e.g FGF2 or CNTF etc).
The sheddase or analogue, derivative or activator thereof, may be combined in a composition having a number of different forms depending, in particular on the manner in which the composition is to be used. Thus, for example, the composition may be in the form of a capsule, liquid, ointment, cream, gel, hydrogel, aerosol, spray, micelle, transdermal patch, liposome or any other suitable form that may be administered to a person or animal suffering from a disease state characterised by impaired neuron (axon) growth. It will be appreciated that the vehicle of the composition of the invention should be one which is well tolerated by the subject to whom it is given, and preferably enables delivery of the molecule to the target site requiring axon growth and/or improved neuron survival.
Compositions comprising a sheddase or analogue, derivative or activator thereof may be used in a number of ways. For instance, systemic administration may be required in which case the compound may be contained within a composition that may, for example, be administered by injection into the blood stream. Injections may be intravenous (bolus or infusion), subcutaneous (bolus or infusion), intraventricular or subarachnoidal. Preferably, the injection is intraneural. Alternatively, the composition may be administered by inhalation (e.g. intranasally or via the mouth).
The sheddase or analogue, derivative or activator thereof may also be incorporated within a slow or delayed release device. Such devices may, for example, be inserted at the site of a CNS or PNS lesion, and the sheddase may be released over weeks or months. Such devices may be particularly advantageous when long-term treatment with a sheddase according to the invention is required and which would normally require frequent administration (e.g. at least daily injection).
It will be appreciated that the amount of sheddase or analogue, derivative or activator thereof that is required is determined by the type of sheddase itself, its biological activity and its bioavailability, which in turn depends on the mode of administration, the physicochemical properties of the sheddase employed, and whether it is being used as a monotherapy or in a combined therapy, for example, with an NTF. The frequency of administration will also be
influenced by the above-mentioned factors and particularly the half-life of the sheddase within the subject being treated.
Optimal dosages to be administered may be determined by those skilled in the art, and will vary with the particular sheddase or analogue, derivative or activator thereof in use, the strength of the preparation, the mode of administration, and the advancement or severity of the disease condition, and the urgency of the requirement for axon growth. Additional factors depending on the particular subject being treated will result in a need to adjust dosages, including subject age, weight, gender, diet, and time of administration.
Known procedures, such as those conventionally employed by the pharmaceutical industry (e.g. in vivo' experimentation, clinical trials, etc.), may be used to establish specific formulations of the medicament for use according to the invention and precise therapeutic regimes (such as daily doses of the sheddase and the frequency of administration).
Generally, a daily dose of between 0.01 μg/kg of body weight and 0.5 g/kg of body weight of a sheddase according to the invention may be used for the stimulation of axon growth (i.e. promoting axon outgrowth/branching), depending upon which specific sheddase enzyme is used. More preferably, the daily dose is between 0.01 mg/kg of body weight and 200 mg/kg of body weight, and more preferably, between approximately 0.1 mg/kg and 100 mg/kg, and even more preferably, between about lmg/kg and 10mg/kg sheddase.
When the sheddase or analogue, derivative or activator thereof is delivered to a cell
(and de novo synthesis is not required in the target cell), daily doses may be given as a single administration (e.g. a single daily injection). Typically, a therapeutically effective dosage should provide about Ing to lOOμg/kg of the sheddase per single dose, and preferably, 2ng to
50ng per dose.
Alternatively, the sheddase may require administration twice or more times during a day. As an example, sheddases according to the invention may be admim'stered as two (or more depending upon the severity of the condition) daily doses of between 0.1 mg/kg and lOmg/kg (i.e. assuming a body weight of 70kg). A patient receiving treatment may take a first dose upon waking and then a second dose in the evening (if on a two dose regime) or at
3 or 4 hourly intervals thereafter. Alternatively, a slow release device may be used to provide optimal doses to a patient without the need to administer repeated doses.
According to a fifth aspect, there is provided a composition comprising a therapeutically effective amount of a sheddase or analogue, derivative or activator thereof, and a pharmaceutically acceptable excipient.
In one embodiment, the composition according to the fifth aspect of the invention may comprise about 0.01 μg and 0.5 g of the sheddase or analogue, derivative or activator thereof. More preferably, the composition comprises between about 0.01 mg and 200 mg, and more preferably, between approximately 0.1 mg and 100 mg, and even more preferably, between about lmg and lOmg of the sheddase or analogue, derivative or activator thereof. Most preferably, the composition comprises between approximately 2mg and 5mg of the sheddase. It will also be appreciated that the invention is not limited to using just one type of sheddase enzyme, and it is envisaged that more than one sheddase may be used in the medicament according to the invention, and the composition of the fifth aspect.
Preferably, the composition comprises approximately 0.1% (w/w) to 90% (w/w) of the sheddase, and more preferably, 1% (w/w) to 10% (w/w) of the sheddase or analogue, derivative or activator thereof. The rest of the composition may comprise the excipient.
This invention further provides in a sixth aspect, a process for making a pharmaceutical composition comprising combining a therapeutically effective amount of a sheddase or analogue, derivative or activator thereof, and a pharmaceutically acceptable excipient.
A "therapeutically effective amount" is any amount of a sheddase enzyme or analogue, derivative or activator thereof which, when administered to a subject promotes axon or neurite outgrowth or branching.
A "subject" may be a vertebrate, mammal, domestic animal or human being.
A "pharmaceutically acceptable excipient" as referred to herein is any physiological carrier vehicle known to those of ordinary skill in the art useful in formulating pharmaceutical compositions.
In a preferred embodiment, the excipient comprises liquid and the pharmaceutical composition is in the form of a solution. In another embodiment, the pharmaceutical vehicle is a gel and the composition is in the form of a cream or the like. Liquid pharmaceutical compositions which are sterile solutions or suspensions can be utilized by for example, intramuscular, intraneural, intrathecal, epidural, intraperitoneal, intravenous and particularly subcutaneous, intracerebral or intracerebro ventricular injection. The sheddase may be a sterile composition that may be dissolved or suspended at the time of administration using sterile water, saline, or other appropriate sterile injectable medium. Vehicles are intended to include necessary and inert binders, suspending agents, lubricants, flavourants, sweeteners, preservatives, dyes, and coatings.
The combination of a sheddase or analogue, derivative or activator thereof, and a neurotrophic factor (NTF) represents an important feature of the present invention. The inventors have therefore found that the simultaneous combination of these two active ingredients is particularly beneficial for promoting axon/neurite outgrowth/branching (inducing neuron growth and promoting cell survival) in culture and in injured tissues in a subject.
Therefore, it is preferred that the composition of the fifth aspect comprises a therapeutically effective amount of an NTF. Examples of suitable NTF include FGF-2 and CNTF.
It will be appreciated that the composition of the fifth aspect may be used as a medicament. Hence, according to a seventh aspect, there is provided the composition according to the fifth aspect, for use as a medicament.
The medicament may be used to treat individuals suffering from various diseases characterised by damaged or inappropriate nerve growth, such as CNS or PNS injury.
Hence, according to an eighth aspect, there is provided a method of promoting axon outgrowth and/or branching and/or for inhibiting cell apoptosis in a subject, the method comprising administering to a subject in need of such treatment a composition comprising a sheddase enzyme, or analogue, or derivative, or activator thereof.
Preferably, the method according to the eighth aspect comprises administering to the subject in need of treatment the composition according to the fifth aspect.
It is preferred that the composition used in the method according to the eighth aspect further comprises a neurotrophic factor (NTF) in addition to the sheddase, or analogue, derivative or activator thereof. It is most preferred that the composition used in the method of the eighth aspect comprises (i) a sheddase, or analogue, or derivative, or activator thereof; and (ii) a neurotrophic factor (NTF).
It will be appreciated that the invention has many uses in both in vitro and in vivo applications. For example, the sheddase, or analogue, derivative or activator thereof, may be used to stimulate axon outgrowth and/or branching in vivo in a subject being treated. Alternatively, or additionally, the sheddase, or analogue, derivative or activator thereof, may be used to stimulate neurite outgrowth and/or branching in cell culture, following which the neuronal culture may then be transferred to a subject in need of treatment to repair damaged areas.
Hence, in a ninth aspect there is provided a method of promoting neurite outgrowth and/or branching in culture, the method comprising administering a composition comprising a sheddase, or analogue or derivative or activator thereof, to a culture of neurons.
Preferably, the composition used in the method of the ninth aspect comprises a neurotrophic factor. Examples of suitable neurotrophic growth factors (NTF) may include iCNTF, FGF2, NGF, NT-3, NT-4, BDNF, GDNF, FGF-I, FGF-5, CT-I, CDF, insulin, IGF-I, IGF-2, IL-6, LIF, NPF, PDGF, PN-I, S-IOO, TGF-β, and VIP and the like (Oppenheim, 1996, Neuron 17:195-197). The amount of NTF may be between approximately 0.01 μg/kg of body weight and 0.5 g/kg of body weight, more preferably, about 0.1mg/kg and 10mg/kg.
Neuron cultures prepared using the method of the ninth aspect may be used either for in vitro experiments, or may be introduced into a subject into a target cell to repair damaged or impaired nerves.
All of the features described herein (including any accompanying claims, abstract and drawings), and/or all of the steps of any method or process so disclosed, may be combined with any of the above aspects in any combination, except combinations where at least some of such features and/or steps are mutually exclusive.
For a better understanding of the invention, and to show how embodiments of the same may be carried into effect, reference will now be made, by way of example, to the accompanying diagrammatic drawings, in which:-
Figure 1 shows TACE-induced RIP of p75NTR and suppression of Rho activation in the presence of CNS myelin ligands. (A) Mean number of DRGN and glia with and without treatment with the mitotic inhibitor 5-fluro-2'-deoxyuridine (5 -FDU). (B) Representative
Western blot/Rho immunoprecipitation in cell lysates and media of p75NTR, p75cτF, p75rcD, p75EcD, Rho-GTP, total Rho and β-actin in DRG cultures after FGF2, TACE, PMA and
TIMP3 treatments singly, and in combination. Control = DRG cultures without NTF and CNS myelin. (C) Mean integrated optical density of protein bands from lysates and media in
A (mean integrated density) and % reduction in Rho-GTP compared to control for treatments of DRG cultures with TACE, TACE + FGF2, PMA + FGF2 and TACE + FGF2 + TIMP3.
The figure demonstrates that p75NTR fragmentation into P75ECD and P75ICD suppressed Rho activation after the addition of TACE. TIMP3 blocked fragmentation of p75NTR by TACE but had no affect on Rho activation, β-actin was used as a loading control. ***P<0.0001;
Figure 2 shows TACE-induced fragmentation of NgR. (A) and (B) Addition of TACE induces fragmentation of NgR and fragmented NgR is present in the media. (C) and (D) TROY did not appear to be fragmented by TACE. β-actin was used as a loading control. ***P<0.0001;
Figure 3 shows TACE-induced RIP of p75NTR enhanced DRGN neurite outgrowth in the presence of CNS myelin ligands. (A) Representative βlll-tubulin immunocytochemistry in
control DRG cultures, and after DRGN exposure to FGF2, FGF2 + CNS myelin, TACE + CNS myelin, and FGF2 + TACE + CNS myelin. (B) Quantification of mean longest neurite lengths to demonstrate significantly enhanced FGF2-stimulated DRGN neurite outgrowth after addition of TACE + FGF + CNS myelin. Once again, addition of TIMP3 blocked TACE-mediated DRGN neurite outgrowth. ***P<0.0001 ;
Figure 4 shows TACE-induced RIP of p75NTR enhanced neuritic branching in DRGN in the presence of CNS myelin ligands. (A) The number of primary DRGN neurites and (B) branches, after 3 days in culture in controls, and after the exposure to FGF2, FGF2 + myelin, TACE + CNS myelin, and FGF2 + TACE + CNS myelin, increased significantly. Treatment with TIMP3 restored the inhibitory potential of CNS myelin ligands and blocked DRGN neurite outgrowth. (C-E) Representative βlll-tubulin immunocytochemistry of DRGN in 3 day-old cultures to demonstrate branching after exposure to FGF2 with no myelin, TACE + FGF2 + CNS myelin, and PMA + FGF2 + CNS myelin. DRGN have >5 primary neurites with >10 branches. After exposure to TACE + FGF2 in the presence of CNS myelin. ***P<0.0001;
Figure 5 shows TACE-induced RIP of p75NTR correlated with enhanced MAPlB levels in the presence of CNS myelin. Representative Western blots and subsequent densitometry of MAPlB levels in lysates of cells from control cultures and cultures exposed to FGF2 and TACE alone, and to combinations of TACE + FGF2, PMA + FGF2, and TACE + FGF2 + TIMP3. Exposure to TACE + FGF2 in the presence of CNS myelin enhanced MAPlB levels significantly compared to other treatments, while addition of TIMP3 restored MAPlB levels to those observed in controls, β-actin was used as a loading control. ***P<0.0001;
Figure 6 shows upregulation of TACE activity and presinilin-1 (PSl) levels in retinae and ON in the RM. A, Reprobed representative Western blot' (n=3) of the same retinal samples shown in Figure 2 shows inactive (*) and active (arrow) TACE, PSl and β-actin taken from intact Od controls, and from RM and NRM at 6, 8 and 20dpi. B, Representative double immunolocalisation (n=3) of TACE (green) with βlll-tubulin (red) in the ganglion cell layer of the retinae of intact Od controls, and of retinae from RM and NRM at 20dpi (scale bar=10μm ). C, Western blot of inactive (*) and active (arrow) TACE, PSl and β-actin in ON
samples from intact Od controls, and from RM and NRM at 6, 8, and 20dpi, taken from retinal samples;
Figure 7 shows NTF activated TACE, while addition of TACE to RGC cultures fragments p75NTR and blocks Rho-A activation. A, Representative Western blot and corresponding densitometry (n= 3) of inactive (*) and active (arrow) TACE in control cultures grown in the presence of myelin extract without NTF and from cultures grown in the presence of the
TACE activator, PMA, NTF, and NTF plus the TACE inhibitor, TIMP3 (***= PO.0001). β- actin acted as a loading control in the same Western blot. B, Representative Western blot/immunoprecipitation of Rho-GTP and corresponding densitometry (n=3) of p75NTR, p75icD from cell lysates and p75ecD from supernatant of dissociated retinal cultures grown with CNS myelin extracts in the presence of NTF, NTF plus TIMP3, active TACE, NTF plus
• active TACE or NTF plus PMA. β-actin acted as a loading control;
Figure 8 shows addition of TACE promotes RGC neurite outgrowth in the presence of inhibitory CNS myelin extract. A, Representative immunocytochemistry for βlll-tubulin in retinal cultures to demonstrate RGC neurite outgrowth in the presence and absence of NTF, TACE, CNS myelin extract and the TACE activator, PMA. B, Quantification of the number of RGC with neurites after treatment with NTF no CNS myelin extract, NTF plus CNS myelin extract, TACE no CNS myelin extract, TACE plus CNS myelin extract, NTF plus TACE plus CNS myelin extract, NTF plus TACE plus TIMP3 plus CNS myelin extract, NTF plus γ-secretase inhibitor, and NTF plus TACE plus γ-secretase inhibitor. ***P<0.0001. C, Quantification of mean neurite length after various treatments with/without NTF in the presence/absence of CNS myelin extracts.
Figure 9 shows a proposed mechanism of NTF-stimulated disinhibition of RGC axon growth by TACE-mediated p75NTR shedding. Intravitreally-delivered NTF stimulate RGC to release TACE at the somata and at the growth cone, which cleaves P75ECD from p75NTR while γ- secretase cleaves p75ico by RIP. Accordingly, full length p75NTR is not available at the growth cone to associate with NgR so that there is no transduction of inhibitory signalling after ligand/NgR binding, and downstream Rho-A activation is suppressed, favouring actin polymerisation in the growth cone. Growth cone integrity and mobility are preserved and,
hence, unimpeded regeneration through the putative inhibitory environment of the distal ON stump is promoted.
Examples The inventors conducted a series of experiments (summarised in Examples 1 and 2 below) to investigate the efficacy of exogenously added sheddases on the growth of neurons. As a model, they used the sheddase, TACE.
Example 1
Materials and Methods
Adult DRG cultures
Dissociated adult rat (6-8 week-old) DRGN were cultured in 4-well plates at a density of 1500/well, as described elsewhere (Ahmed, 2005, MoLCeIl Neurosci. 28, 509-523.), on glass coverslips pre-coated with 100 μg/ml poly-o-lysine followed by 20 μg/ml Laminin-I (both from Sigma, Dorset, UK) in Neurobasal-A containing B27 supplement (Invitrogen, Paisley, UK). To limit glial proliferation, the mixed DRG cultures were treated with 30 μM 5-fluoro-2-deoxyuridine (Sigma) for 3 d (Russell, 2002, FASEB J. 16, 1738-1748). DRGN were cultured either in the presence, or absence of adult rat CNS myelin extracts for a further 3 d at 370C in a humidified atmosphere containing 5% CO2.
Preparation of CNS myelin
CNS myelin was prepared according to our earlier published method (Ahmed supra, 2005). Briefly, adult Sprague-Dawley rat brains were homogenised in 0.32M sucrose, ImM EDTA, pH 7.0 at 40C and centrifuged. The supernatant was resuspended in 0.9M sucrose, overlayed with 1-2 ml of 0.32 M sucrose, and centrifuged at 20,00Og for 60 min. The CNS myelin at the interface of the two sucrose layers was collected, dispersed in 20 volumes of 0.32 M sucrose, and centrifuged at 13,000g for 25 min. CNS myelin extract was then diluted in 25 volumes of water and centrifuged at 20,00Og for 25 min. The final white pellet was resuspended in a small volume of water, freeze dried overnight and the protein content determined using the Pierce BCA assay (BioRad, Hercules, CA, USA). Western blotting of the CNS myelin extracts confirmed the presence of Nogo-A, MAG, OMgp and chondroitin
sulphate proteoglycan (CSPG) (Ahmed supra, 2005). The myelin extract was added to DRG cultures at a protein concentration of 200 μg/ml, previously determined to be optimally inhibitory to DRGN neurite outgrowth.
Treatment of DRGN with FGF2 and TACE
FGF2 (Peprotech, London, UK) was added at 10 ng/ml (pre-determined to cause optimal DRGN neurite outgrowth) and active TACE (R & D Systems, Abingdon, UK) was added at 10 ng/ml (pre-determined to cause optimal p75NTR peptide cleavage) to DRGN culture plates in triplicates. DRGN were also treated with either 25 ng/ml phorbol 12- myristate 13-acetate (PMA; Sigma) to upregulate TACE production (Weskamp et al., J.Biol.Chem. 279, 4241-4249, 2004; Kanning et al., J.Neurosci. 23, 5425-5436, 2003), or TIMP3 (50 nM, Chemicon, Hampshire, UK), a specific inhibitor of TACE activity (Black, NatGenet. 36, 934-935, 2004; Karan et al., Int.J.Oncol. 23, 1365-1371, 2003; Lee et al., BiochemJ. 364, 227-234, 2002). Cells were treated for 72 hr before harvesting for Western blotting and subsequent quantitative assessment of proteins by densitometry as described below.
Antibodies
Monoclonal β-III tubulin antibody (Sigma) was used at 1:100 to label DRGN neurites by immunocytochemistry (ICC). Polyclonal anti-p75NTR antibody was used to identify and localise p75NTR, p75cτF, p75tcD and P75ECD (Promega, 1:500 dilution for both Western blots and ICC). Microtubule associated protein-IB (MAPlB) (Abeam Ltd, Cambridge, UK) was used at 1:500 dilution for Western blots. Anti-mouse NgR (Autogen Bioclear, Wiltshire, UK) was used at 1:500 dilution for Western blots. A second NgR antibody, goat anti-human NgR (Santa Cruz Biotechnology, San Diego, USA) was used at 1:500 dilution to confirm the results obtained with anti-mouse NgR. A polyclonal anti-human TROY antibody was used to detect TROY in Western blots (1:500, Santa Cruz Biotechnology).
Immunocvtochemistry DRG cultures were fixed in 4% paraformaldehyde for 10 min (TAAB Laboratories,
Berkshire, UK) before washing x3 in phosphate buffered saline (PBS), blocked in PBS containing 0.5% bovine serum albumin (BSA, Sigma) and 1% Triton X-100 (Sigma), and incubated with the relevant primary antibody diluted 1 : 100 in PBS containing 0.5% BSA and
0.5% Tween-20 (Sigma) for 1 hr at room temperature in a humidified chamber. Cells were then washed X3 in PBS and incubated with either AlexaFluor 488 (Green), or Texas Red (Red) (both from Invitrogen), diluted 1:100 in PBS-T-BSA for 1 hr at room temperature. Following further washes in PBS, coverslips were mounted in FluorSave (Calbiochem, San Diego, USA) and viewed under a fluorescent microscope (Carl Zeiss, Welwyn-Garden City, UK).
Measurement of DRGN neurite outgrowth (neurite length)
Photomicrographs of βIII-tubulin+ immunostained DRGN neurites were captured using Axiovision Software (Carl Zeiss, Hertfordshire, UK) from 30 randomly selected DRGN/coverslip and neurite lengths measured using Axiovision (Carl Zeiss) and represented as means ± SD.
DRGN branching analysis (neurite number/density) The numbers of primary βlll tubulin DRGN neurites emerging directly from the
DRGN somata were counted and from each neuritic tree, the total number of branches exceeding 20 μm in length (Bouquet et al., J.Neurosci. 24, 7204-7213, 2004) recorded using Axiovision software (Carl Zeiss).
Counting of DRGN and glia
Each coverslip (n=3, 3 independent experiments) was partitioned into 9 equal quadrants and, in each, random photomicrographs of merged images from βIII-tubulm+ DRGN and DAPI stained nuclei were photographed in Axiovision, as described above, and the relative proportions of βIII-tubulin+ DRGN and glia (absent of βIII-tubulin+ staining) determined.
Protein extraction and Western blotting
To determine fragmentation of NgR and p75NTR into P75ECD, P75CTF and P75ICD after addition of TACE, DRG cultures were washed X2 with PBS and incubated for 15 min" at 370C with θ.25 % trypsin/EDTA (Invitrogen), followed by trituration and centrifugation at 1300 rpm for 5 min. The cell pellets were re-suspended in ice-cold lysis buffer containing 20 niM Tris-HCl (pH 7.4), 1 mM EDTA, 0.5 mM EGTA, 150 mM NaCl, 1 % NP-40 (Sigma) and PI cocktail (Sigma) and incubated on ice for 30 min, centrifuged at 13,000 rpm at 40C
and cell lysates normalised for protein concentration using a colorimetric protein assay (Bio- Rad). To determine the levels of shed NgR and P75ECD, cell culture media were collected and concentrated using microconcentrators (Millipore, Bedford, MA, USA). Each sample (40 μg total protein) was incubated with x2 Laemmeli loading buffer at 90 0C for 4 min and separated on a 12% SDS-polyacrylamide gel to probe for NgR and p75NTR (Invitrogen) and 6% SDS gels for MAPlB. Proteins were transferred to PVDF membranes (Millipore UK, Gloucestershire, UK), blocked for 1 hr at room temperature in Tris-buffered saline containing 0.1% Tween 20 and 5% non-fat milk. Membranes were blotted overnight with the relevant antibody. For detection of protein bands, an enhanced chemiluminescence (ECL) system (Amersham, Buckinghamshire, UK) and HRP-conjugated secondary antibody (1 :1,000; Amersham) were used. Each blot was stripped and re-probed with additional relevant antibodies thereafter. Each experiment was performed 6 times.
Rlio activation assay GTP-bound Rho was assayed from DRG cell culture lysates using a commercially available Rho activation assay kit, following the manufacturers instructions (Upstate Biotechnology, Milton Keynes, UK).
Densitometry Western blots were scanned into Adobe Photoshop, keeping all scanning parameters the same for each blot. Captured images were used to quantify the integrated optical density of each band using the built-in gel plotting macros in Scionlmage software (Scion Corporation/NIH Image, Maryland, CA, USA).
Statistical analysis
Sample means were calculated and differences analysed for significance using GraphPad Prism (GraphPad Software Inc., Version 4.0, San Diego, USA) by one-way analysis of variance (ANOVA) followed by post-hoc testing with Dunnett's method to identify statistically significant groups.
Results
1. n TACE-induced RIP of p75NTR in DRG cultures
Since glia produce minute amounts of TACE in the brain, the inventors first determined the relative proportions of DRGN and glia (satellite and Schwann cells) in FGF2- stimulated cultures. The number of βIII-tubulin+ DRGN was determined as 1,500 at 0 d and their number remained constant over the 6 d culture period (Fig. IA). The initial number of glia (-7,500) increased significantly to 20,000 at 6 d. Treatment of FGF2-stimulated cultures with the mitotic inhibitor, 5-fiuoro-2'-deoxyuridine (5-FDU), halted glia proliferation to a level equivalent to that at 0 d. When cells from both TACE- and FGF2 -treated cultures were lysed, only 7% more p75NTR fragments were observed in the presence/absence of mitotic inhibitor (not shown) (Fig. IA). Hence, in all subsequent experiments, the mitotic inhibitor was added to normalise the contribution of glia-derived TACE.
Addition of FGF2 to DRG cultures in the presence of inhibitory CNS myelin extracts induced limited fragmentation of p75NTR compared to untreated controls (Fig. IB and C), while addition of either active TACE alone, or active TACE plus FGF2, cleaved most of the p75NTR present, eliminating full length p75NTR protein (Fig. IB and C). PMA, which activates TACE, also cleaved p75NTR in FGF2-stimulated cultures, but fragmentation was less than that observed with the addition of active TACE. After p75NTR fragmentation, P75ECD accumulated in the culture medium and ρ75cτF and p75!CD, which appeared in the cell lysates (Fig. IB and C). TACE-induced RIP of p75NTR coincided with a significant reduction in the levels of Rho-GTP within DRG cultures in the presence of CNS myelin, while total Rho levels did not change (Fig. IB and C). The further addition of TIMP3 blocked TACE- mediated fragmentation of p75NTR in the presence of FGF2, and restored the levels of Rho- GTP to those seen in FGF-2 treated cultures with CNS myelin extracts (Fig. IB and C). Similar levels of fragmentation were observed in the absence of CNS myelin. However, Rho- GTP was not detected, confirming that there was no activation of Rho (Fig. IB and C).
1.2) TACE induced fragmentation of NgR but not of TROY
Addition of TACE to DRG cultures either in the presence or absence, of CNS myelin, also caused fragmentation of NgR, yielding a shed 48kDa band in the cell culture medium (Fig. 2). However, when the blots were reprobed, no fragmentation of TROY was detected (Fig. 2).
1.3) TACE-induced RIP of p75NTR promoted DRGN neurite outgrowth in the presence of inhibitory CNS myelin ligands
The effect of TACE on the length of neurites was investigated.
In the absence of CNS myelin, FGF2 promoted significant DRGN neurite outgrowth while addition of either FGF2 plus PMA, or FGF2 plus TACE plus TIMP3 did not affect neurite outgrowth. The addition of either TACE alone, or PMA alone did not promote neurite outgrowth (Fig. 3 A and B).
After the addition of a pre-determined concentration of CNS myelin protein extract, neurite outgrowth was completely blocked in the presence of FGF2 (Fig. 3A and B). With the addition of CNS myelin ligands to cultures, TACE significantly disinhibited FGF2- stimulated DRGN neurite outgrowth compared to that seen: (1), without CNS myelin; (2), with TACE alone; and (3), with PMA (PO.0001, Fig. 3 A and' B). Addition of TIMP3 blocked TACE activity in FGF-2-stimulated DRG cultures and restored the inhibition of DRGN neurite outgrowth mediated by CNS myelin (Fig. 3B).
1.4) Addition of TACE enhanced DRGN branching
The effect of TACE on the number/density of neurites was investigated.
TACE added to FGF2-stimulated DRGN, cultured in the presence of CNS myelin, increased the number of DRGN primary neurites and their branching frequency (Fig. 4A and B). After treatment with FGF2 without CNS myelin, the majority of DRGN had 3-4 primary neurites, each with 1-4 branches (Fig. 4 A, B and C). After the addition of TACE and FGF2 in the presence of CNS myelin, the majority of DRGN grew >5' primary neurites, each with >10 branches (Fig. 4A, B and D). Treatment of DRGN with PMA plus FGF2 similarly increased the numbers of primary neurites and their branches, compared to DRGN treated with PMA alone (Fig. 4A, B and E). TIMP3 restored the inhibitory potential of CNS myelin extracts in the presence of TACE and blocked neurite outgrowth and branching in FGF2- stimulated cultured DRGN (Fig. 4A and B).
1.5) TACE-mediated branching of DRGN was correlated with upregulation of MAPlB
The effect of TACE on MAPlB was then investigated.
Microtubule associated protein- IB (MAPlB), a member of the MAP family is expressed in regenerating axons and their growth cones, and promotes branching of DRGN neurites. When Iy sates of DRG cultures were probed for MAPlB, there was a significant upregulation of MAPlB protein after treatment with TACE plus FGF2 in both the presence and absence of CNS myelin (Fig. 5). MAPlB was also upregulated in DRGN treated with PMA plus FGF2 in the presence of CNS myelin compared to PMA alone, but MAPlB levels were significantly less than those observed with TACE plus FGF2 (PO.001 TACE + FGF2 vs PMA + FGF2, Fig. 5). In TIMP3 treated cultures, the levels of MAPlB were similar to those in control DRGN (Fig. 5).
Discussion
In this study, the inventors have shown that addition of TACE to DRG cultures induced fragmentation of both NgR and p75NTR, leading to blocked Rho-A activation and disinhibition of FGF2-stimulated DRGN neurite outgrowth and branching in the presence of inhibitory CNS myelin extracts. NgR and p75NTR fragmentation was blocked by the addition of TIMP3, a specific inhibitor of TACE activation, re-instating inhibition of DRGN neurites in the presence of CNS myelin. The results suggest that TACE-induced RIP of NgR and p75NTR suppresses Rho activation, paralyses the signalling cascade mediating growth cone collapse and disinhibits NTF-stimulated neurite outgrowth and branching in the presence of inhibitory myelin ligands. The inventors therefore suggest that TACE-mediated receptor shedding may be used a therapeutic strategy to block the function of receptor in the axon growth inhibitory cascade.
Example 2
Materials and Methods
Animals and treatment groups
AU animal procedures were licensed by the UK Home Office. Adult, female 200- 25Og Fischer rats were anaesthetised with Hypnorm/Hypnovel anaesthetic (Janssen Pharmaceuticals, Oxford, UK). The experimental groups comprised a regenerating ON model (RM) in which the ON was crushed (ONC) intraorbital^ and a freshly teased sciatic nerve (PN, sciatic nerve) segment immediately transplanted intravitreally and held in place with Sterispon gelatine sponge (Sterispon, Allen and Hanbury, London, UK), and a non- regenerating ON model (NRM) in which the ON was crushed (ONC) without intravitreal PN implantation. Five additional groups separately controlled for: (1) base line parameters, using untreated intact rats, i.e. Od intact controls; (2), effects of PN alone, by intravitreal PN implantation without ONC; (3), intravitreal inflammation and effects of scleral/vitreal injury without ONC, by intravitreal Sterispon implantation alone; (4), intravitreal inflammation and effects of scleral/vitreal injury with ONC, by Sterispon transplantation and ONC; and (5), presence of non-proteinaceous PN-derived growth factors, by intravitreal implantation of freeze/thawed PN to denature all proteins and kill all Schwann and other PN cells. The ON was exposed through a supraorbital approach and crushed using forceps as described previously (Berry et al, J Neurocytol 25: 147-170, 1996; Berry et al, J Neurocytol 28: 721- 741, 1999). ON and retinae were processed for RNAse protection assay, Western blotting, and immunohistochemistry at 6, 8, and 20 days post injury (dpi), as described below.
Preparation of CNS myelin extract
CNS myelin was prepared according to (Cuzner et al., J Neurochem 12: 469-481, 1965). Briefly, adult rat brains were homogenised in 0.32 M sucrose, 1 mM EDTA, pH 7.0 at 40C, centrifuged at 800 g for 10 min and the supernatant collected. The cell pellet was diluted to the original volume in 0.32 M sucrose, 1 mM EDTA, pH 7.0 and centrifuged, supernatant collected and the combined supernatants centrifuged at 13,000 g for 20 min. After removal of the supernatant, the pellet was resuspended in 0.9 M sucrose, distributed equally amongst a set of tubes, carefully overlayed with 1-2 ml of 0.32 M sucrose and centrifuged at 20,000 g for 60 min. The white material at the interface of the two sucrose layers was collected in the minimum volume possible, dispersed in 20 volumes of 0.32 M sucrose, and centrifuged at 13,000 g for 25 min. The white pellet containing the myelin, was collected, diluted in 25 volumes of pure water, left on ice for 30 min before centrifuging at 20,000 g for 25 min. The final myelin pellet was resuspended in a small volume of water and freeze dried overnight.
Protein content of the CNS myelin was determined using the Pierce BCA assay (BioRad, Hercules, CA, USA) by dissolving a small aliquot of myelin with 10% SDS which was diluted to <1% SDS for the assay. We have shown previously that the myelin extract contains various inhibitory molecules, including Nogo-A, OMgp, MAG and CSPG (Ahmed supra, 2005).
Ribonuclease protection assay
A 457-bp fragment (coding region) of the rat p75NTR cDNA (from Dr M. Knipper,
■ Tuebingen Hearing Research Centre, Tuebingen, Germany) cloned into the Pst Ϊ/Sac II site of pBluescript KS+ was used to detect p75NTR mRNA. Cyclophilin (peptidyl-propyl cis-trans- isomerase) cDNA, a housekeeping gene, was used as a reference DNA (from Dr J. Douglass,
Oregon Health Sciences University, Portland, Oregon, USA), utilising a 295-bp fragment
(coding region) of the rat cyclophilin cDNA cloned into the Pst VBamR I sites of pSP65.
Total RNA was prepared from groups of three animals per time-point using a commercial reagent RNA-B (Biogenesis, Southampton, UK) and RNAse protection assay was performed according to the method described previously (Smith et al., 2001). Autoradiographs were digitally scanned and intensities of bands corresponding to p75NTR were quantified using NIH Image software (NIH, USA). For control animals, the mean intensity was given a value of 1.0 and the relative fold-change in lesioned animals was then calculated. mRNA levels were internally standardized by quantifying cyclophilin mRNA levels. Data were examined statistically by one-way analysis of variance (ANOVA) with results judged as significant at P< 0.05.
Tissue preparation and immunohistochemistry
Groups of at least 3 rats were killed by anaesthetic overdose and perfusion fixed with 4% paraformaldehyde and their retinae and ON excised, cryoprotected, immersed in OCT (Miles Inc, CA, USA), and frozen in liquid nitrogen. Longitudinal and parasagittal cryostat sections, 10 μm thick, were cut through ON and retinae (Bright Instrument Co. Ltd., Cambridgeshire, UK) at 40C5 collected onto Vectabond coated slides (Vector Laboratories, Cambridgeshire, UK), air dried and processed for immunohistochemistry as previously described (Lorber et al., 2002). Cultured retinal cells on glass coverslips were fixed in 4% paraformaldehyde and also processed as previously described (Lorber et al., 2002).
In situ hybridisation (ISH)
Parasagittal cryostat sections, 10 μm thick, were cut through retinae and collected onto charged slides (Vector Laboratories), air dried and processed for ISH using a TSA Biotin System (NEN Life Sciences Inc., Boston, MA) as previously described (Lagord et al.,
2002). Oligonucleotide probes used for p75NTR (Radeke et al., 1987; Suzuki et al., 1998) and
TACE (Black et al., 1997) were designed from published sequences.
Protein extraction and Western blotting At 0, 6, 8 and 20dpi, 3 rats in each treatment group (3 independent experiments) were killed and both retinae and ON dissected, proteins extracted and processed for Western blotting as previously described (Winton et al., 2002). To determine levels of p75NTR in siRNA treated RGC cultures by Western blotting, 375 x 103 cells/siRNA treatment (n=6) were lysed and blotted as described previously (Winton et al., 2002).
Affinity precipitation of Rho-GTP
GTP-bound Rho was assayed from tissues and cell lysates using a Rho activation assay kit (Upstate Biotechnology, Milton Keynes, UK) following the manufacturer's instructions, and as described earlier (Dubreuil et al., 2003).
In situ Rho-GTP pull-down assay
In situ localisation of Rho-GTP was determined according to a modified earlier published method (Dubreuil et al., 2003). Briefly, 10 μm thick post-fixed sections of retinae were incubated with either GST-RBD, or GST alone (both from Upstate Biotechnology) overnight at 40C. Sections were then washed X3 in PBS and blocked in 3% bovine serum albumin for 1 hr at room temperature and incubated with an anti-GST antibody (New England Biolabs, Hertfordshire, UK) and βlll-tubulin antibody (Sigma), Overnight at 40C. Sections were then washed in PBS, incubated with FITC or Texas red secondary antibodies (Molecular Probes), mounted in Fluorsave (Calbiochem) and viewed under an epi- fluorescent microscope (Zeiss, Hertfordshire, UK).
Adult retinal cultures
Adult rats (6-8 wk-old) were killed by cervical dislocation and retinae removed by dissection and dissociated using a papain system according to the manufacturer's protocol (Worthington Biochem, New Jersey, USA). Dissociated retinal cells, 125 x 103, containing RGC were cultured on glass coverslips precoated with 100 μg/ml poly-D-lysine (Sigma, Dorset, UK) and 20 μg/ml merosin (Chemicon, Harrow, UK) in 4-well tissue culture plates (Nunc, UK) in supplemented Neurobasal-A (Invitrogen) medium for 4 d at 370C in a humidified 5% CO2 atmosphere.
Treatment of retinal cultures with NTF Experimental adult retinal cultures were grown in triplicates on glass coverslips, as described above, and subjected to treatment with either 25 ng/ml phorbol 12-myristate 13- acetate (PMA; Sigma) to upregulate TACE production (Weskamp et al., 2004; Kamiing et al, 2003), or a combined NTF cocktail consisting of: CNTF (10 ng/ml); NT-3 (50 ng/ml); FGF'2 (10 ng/ml); and BDNF (50 ng/ml) (all purchased from Peprotech, London, UK) to stimulate TACE production. Retinal cultures were also treated with either recombinant TACE enzyme (10 ng/ml) (R&D Systems, UK), or active human TIMP3 enzyme (5 μg/ml, Chemicon) to inhibit TACE production, or γ-secretase inhibitor (30 μM) (S2188, Sigma) to block p75cτF fragmentation and the production of P75JCD- Cells were treated for 48 hr before harvesting for Western blotting and subsequent quantitative assessment of proteins by densitometry as described below. Cultures were prepared as above and comprised RGC which were either: (1), untreated; (2), treated with combined NTF; (3), treated with TACE and combined NTF; or (4), treated with TACE, combined NTF and TACE and γ-secretase inhibitors either in the presence, or absence of CNS myelin.
Antibodies
Monoclonal β-III tubulin (1:100) was from Sigma, Poole, UK. Polyclonal anti-p75NTR (1:500 for Western blots and immunohisto/cyto-chemistry) which recognises intact p75NTR, P75ECD and P25JCD was from Promega, Southampton, UK. Goat anti-human NgR (1:100 for Western blots) and TROY (1:500 for Western blots) (both from Santa Cruz, C.A., USA) were used to detect NgR and TROY levels in Western blots. Rabbit polyclonal TACE (ADAM-17) from Neomarkers, CA, USA, was used at 1:500 dilution to detect TACE and in Western blots and retinal sections. Chicken anti-presinilin-1 (PSl, Cambridge Bioscience, Cambridge, USA) was used at 1 :200 in Western blots.
Densitometry
Western blots were scanned digitally in Adobe Photoshop keeping scanning parameters the same for all blots to provide a densitometric value for bands of interest. TIFF files were then analysed in Scionlmage (version 4.0.2, Scion Corp, Maryland, USA) using the built-in gel plotting macros. The integrated density of each band in each lane was calculated for 3 separate blots from 3 independent experiments.
Quantification of neurite outgrowth and RGC survival The mean number of RGC with neurites and mean neurite length were quantified by splitting each coverslip into 9 quadrants and randomly capturing images of βlll-tubulin immunostained RGC from each quadrant using a Zeiss Axioplan epi-fluorescent microscope. Axiovision image analysis software (Zeiss, Hertfordshire, UK) was then used to measure neurite length and count the number of RGC in each coverslip using the built in macros (n = 9 coverslips/ condition), as previously described (Lorber et al., 2002).
Statistical analysis
Sample means were calculated and analysed for significance using GraphPad Prism (GraphPad Software Inc., Version 4.0, San Diego, USA) by one-way analysis of variance (ANOVA) followed by post-hoc testing with Dunnett's method.
Results
2.1) yl5vrr>. P75ΓTF and p75τrn products were produced by TACE-induced RIP of p75NTR
Referring to Figure 6, at all dpi, there was an upregulation and activation of both pro- and active-TACE levels in retinae of RM but not NRM. In addition, the levels of presenilin- 1 (PSl), which a major protein of the multi-component γ-secretase enzyme was significantly higher in the RM compared to NRM retinae at all time points (Fig. 6A). At 20dpi, TACE was predominantly co-localised to βIII-tubulin+ RGC, with higher levels of immunoreactivity in RM than NRM RGC (Fig. 6B). Whilst levels of TACE rose post-injury in both RM and NRM on, in RM ON, TACE was predominantly in the active-, rather than the pro-form, while in NRM ON, most TACE was in the pro-form (Fig. 6C). PSl levels also increased with
time post-injury and were significantly higher in RM compared to NRM ON (Fig. 6C). TACE was similarly localised within RM and NRM ON and, in RM ON, TACE and GAP-43 were seen co-localised to occasional axons (not shown). There was a small increase in TACE and GAP-43 in RGC of controls with intravital PN implantation (no ONC), accompanied by a modest proportional enhancement of p75NTR fragmentation, but there were no changes in levels of downstream Rho-GTP (not shown). AU other controls showed no modulation of any of these proteins, confirming that inflammatory/macrophage cell-derived factors did not contribute to receptor shedding in RM (not shown).
2.2) TACE was upregulated by NTF stimulation of retinal cultures, while exogenous addition of TACE induced RIP of υ75NTR and disinhibited NTF-stimulated RGC neurite outgrowth in the presence of CNS myelin
Levels of both active and pro-forms of TACE were significantly increased after addition of a combination of pre-optimised concentrations of CNTF, BDNF, NT-3 and FGF2 to adult rat retinal cultures. NTF increased TACE activation by 43% over that observed with PMA (phorbol 12-myristate 13-acetate, a known activator of TACE) treatment (PO.0001). Addition of TIMP3, a specific inhibitor of TACE activation, abolished active TACE from NTF-stimulated retinal cultures (Fig. 7A). Densitometry of Western blots confirmed the presence of significantly higher amounts of active TACE in response to NTF when compared with those produced in the presence of PMA (Fig. 7A).
The inventors then tested whether the addition of exogenous TACE to adult rat RGC in culture disinhibited RGC neurite outgrowth by initiating RIP of p75NTR in the presence of a pre-determined inhibitory concentration of CNS myelin extract. The extent of RIP of p75NTR (induced by NTF-stimulated activation of TACE) was further increased when NTF- treated retinal cultures were coincidently treated with PMA (Fig. 7B). This RIP was correlated with the suppression of Rho activation. Exogenous TACE completely cleaved p75NTR into p75EcD, p75cτF and p75ΪCD, alone or with NTF, blocked Rho activation (Fig. 7B) and enhanced NTF-stimulated RGC neurite outgrowth in the presence of CNS myelin extract (Fig. 8A-C); increasing both the number of RGC with neurites (Fig. 8B) and mean neurite length (Fig. 8C). TIMP3 (a TACE inhibitor) blockade of NTF-induced RJP of p75NTR (Fig. 7C) re-established the levels of active Rho and inhibition of RGC neurite outgrowth in the presence of CNS myelin extracts (Fig. 8A-C). The treatment of cultures with NTF + a γ-
secretase inhibitor in the presence of CNS myelin induced limited fragmentation of p75NTR to produce P75ECD and p75cτF fragments but p75ico genesis was prevented. This treatment did not affect Rho activation, allowing CNS myelin to inhibit RGC neurite outgrowth (Fig. 7B, Fig 8B and C). Similarly, the addition of NTF + TACE + γ-secretase inhibitor, in the presence of CNS myelin, promoted fragmentation of most of the full length p75NTR into P75ECD and p75cτF, but the generation of P75ICD was prevented, with an accompanying reduction in levels of activated Rho, leading to a level of RGC neurite outgrowth in the presence of CNS myelin that was equivalent to that seen in the absence of CNS myelin (Fig. 7B, Fig 8B and C). It was noted that this treatment did not attenuate the levels of active Rho to the same degree as NTF + TACE treatment, and the levels of active Rho correlated with the extent of neurite outgrowth (see Fig. 8 A-C). Whenever fragmentation of p75NTR was observed in cell lysates, some P75ECD was retained in the cell fraction, probably reflecting binding of the fragment to element of the plasmalemma, but most was shed into the medium
Discussion
Interestingly, enhanced levels of TACE-induced RIP of p75NTR blocked the conversion of downstream Rho-GDP to Rho-GTP, consequently arresting inhibitory downstream signalling. However, TACE-mediated fragmentation of p75NTR in the presence of γ-secretase inhibitor, which generates only P75ECD and ρ75cτF but not ρ75icD, did not significantly block Rho activation, suggesting that RIP of p75NTR is required to effectively block Rho activation. This may explain why NTF plus TACE, which induced RIP of p75NTR promoted significantly greater neurite outgrowth than NTF + TACE + γ-secretase inhibitor, in the presence of inhibitory CNS myelin. The release of Rho from Rho-GDP dissociation inhibitor (Rho-GDI) allows the GDP-bound form to be activated by guanine nucleotide exchange factors (GEF), probably by direct interaction of Rho-GDI with p75NTR, an event that liberates Rho-GDP for conversion into its active form. It is possible that RIP of p75NTR perturbs the interaction of Rho-GDI with p75NTR, thereby preventing Rho activation by the failure of Rho-GDP dissociation from Rho-GDI. Accordingly, NTF-stimulated ON axon regeneration after intravitreal PN implantation may promote uninhibited polymerisation of actin in RGC growth cones after paralysis of p75NTR inhibitory signalling.
In summary, the inventors have proposed a model (as shown in Figure 9) in which RIP of p75NTR activated by TACE is a key factor in NTF-stimulated RGC axon/neurite
outgrowth through inhibitory CNS myelin ligand-rich environments. RIP of p75NTR blocks Rho-A activation and inhibitory signalling, thereby stabilising growth cone morphology and allowing NTF -stimulated axons to regenerate in the presence of inhibitory ligands. Hence, examples 1 and 2 both illustrate that TACE-mediated receptor shedding may be used a therapeutic strategy to block the function of receptor in the axon growth inhibitory cascade.
Claims
1. A method of promoting axon and/or neurite branching and/or outgrowth and/or for inhibiting cell apoptosis in a subject, the method comprising administering to a subject in need of such treatment a composition comprising a sheddase enzyme, or analogue, or derivative, or activator thereof.
2. A method according to claim 1, wherein the composition is for the treatment of a disease condition characterised by damaged or impaired nerves.
3. A method according to claim 1, wherein the composition is for the treatment of spinal cord injury (SCI), glaucoma, and neurodegenerative disorders, such as MS, ALS, dementia, Huntingdon's Disease, Motor Neuron Disease, CJD, Alzheimer's disease, Parkinson's disease, diabetic neuropathy, and spinal muscular atrophy (SMA), chronic or acute brain trauma, spinal cord injury, neurotoxicity, stroke, glaucoma, optic nerve damage, blindness, haemorrhage, facial nerve injury, caused by elective surgery, nerve compression, concussion, ischaemia, and burns.
4. A method according to claim 1, wherein the sheddase comprises an enzyme independently selected from a group consisting of a cysteine protease; an aspartic protease; or a serine protease, or any combination thereof.
5. A method according to claim 1, wherein the sheddase comprises a metalloprotease.
6. A method according to claim 1, wherein the sheddase comprises a metalloprotease independently selected from a group consisting of angiotensin converting enzyme (ACE), matrix metalloproteinase (MMP), and a NEP.
7. A method according to claim 1, wherein the sheddase comprises a zinc metalloproteinease.
8. A method according to claim 1, wherein the sheddase comprises an ADAM.
9. A method according to claim 1, wherein the sheddase comprises ADAM 10 or ADAM 17 (TACE).
10. A method according to claim 1, wherein the sheddase comprises substantially the sequence identified as SEQ ID No.3.
11. A method according to claim 1, wherein the sheddase, or analogue, derivative or activator thereof is used in combination with an axon/neurite growth-stimulating molecule.
12. A method according to claim 11, wherein the axon/neurite growth- stimulating molecule comprises a Neurotrophic Factor (NTF).
13. A method according to claim 12, wherein the NTF comprises NGF, NT-3, NT-4, BDNF, GDNF, FGF-I, FGF-5, CT-I, CDF, insulin, IGF-I, IGF-2, IL-6, LIF, NPF, PDGF, PN-I, S-IOO, TGF-β, or VIP.
14. A method according to claim 12, wherein the NTF comprises Ciliary Neurotrophic Factor (CNTF) or Fibroblast Growth Factor 2 (FGF2).
15. A delivery system for use in a gene therapy technique, the delivery system comprising a nucleic acid molecule encoding a protein which directly or indirectly modulates activity of a sheddase, or analogue or derivative thereof, wherein said nucleic acid molecule is capable of being transcribed to allow the expression of the protein, which is effective for treating a disease condition characterised by a damaged or impaired nerves.
16. A delivery system according to claim 15, wherein the delivery system comprises a sheddase expression system adapted to increase the expression level of a sheddase or analogue or derivative thereof in a target cell.
17. A delivery system according to claim 16, wherein the expression system comprises a nucleic acid sequence encoding a sheddase enzyme or analogue or derivative thereof.
18. A delivery system according to claim 16, wherein the expression system comprises a nucleic acid sequence, which encodes a neurotrophic factor (NTF).
19. A composition for promoting axon and/or neurite branching and/or outgrowth, the composition comprising a sheddase or analogue, derivative or activator thereof, and a therapeutically effective amount of an NTF.
20. A composition according claim 19, wherein the NTF is FGF-2 or CNTF.
21. A composition according, to claim 19, for use as a medicament.
22. A method of promoting neurite outgrowth and/or branching in culture, the method comprising administering a composition comprising a sheddase, or analogue or derivative or activator thereof, to a culture of neurons.
23. A method according to claim 22, wherein the composition comprises an NTF.
24. A method according to claim 23, wherein the NTF is FGF-2 or CNTF.
25. A sheddase enzyme, or analogue, or derivative, or activator thereof, for use as a medicament.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PCT/GB2006/001904 WO2007138236A1 (en) | 2006-05-24 | 2006-05-24 | Sheddase enzymes for neuron growth |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PCT/GB2006/001904 WO2007138236A1 (en) | 2006-05-24 | 2006-05-24 | Sheddase enzymes for neuron growth |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2007138236A1 true WO2007138236A1 (en) | 2007-12-06 |
Family
ID=37649309
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/GB2006/001904 Ceased WO2007138236A1 (en) | 2006-05-24 | 2006-05-24 | Sheddase enzymes for neuron growth |
Country Status (1)
| Country | Link |
|---|---|
| WO (1) | WO2007138236A1 (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20110039774A1 (en) * | 2009-08-14 | 2011-02-17 | Eu Sol Biotech Co., Ltd. | Method for repairing neurodegeneration |
| CN112472796A (en) * | 2015-03-26 | 2021-03-12 | 苏州澳宗生物科技有限公司 | Methods of diagnosing or treating neurological disorders using P75ECD and/or P75 |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1997035538A2 (en) * | 1996-03-26 | 1997-10-02 | Glaxo Group Limited | Tumor necrosis factor alpha convertase |
| WO2000069822A1 (en) * | 1999-05-12 | 2000-11-23 | Darwin Discovery Limited | Hydroxamic and carboxylic acid derivatives |
| US20030121064A1 (en) * | 1997-06-11 | 2003-06-26 | Ann Logan | CNS neuroregenerative compositions and methods of use |
-
2006
- 2006-05-24 WO PCT/GB2006/001904 patent/WO2007138236A1/en not_active Ceased
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1997035538A2 (en) * | 1996-03-26 | 1997-10-02 | Glaxo Group Limited | Tumor necrosis factor alpha convertase |
| US20030121064A1 (en) * | 1997-06-11 | 2003-06-26 | Ann Logan | CNS neuroregenerative compositions and methods of use |
| WO2000069822A1 (en) * | 1999-05-12 | 2000-11-23 | Darwin Discovery Limited | Hydroxamic and carboxylic acid derivatives |
Non-Patent Citations (3)
| Title |
|---|
| AHMED ZUBAIR ET AL: "Schwann cell-derived factor-induced modulation of the NgR/p75(NTR)/EGFR axis disinhibits axon growth through CNS myelin in vivo and in vitro", BRAIN, vol. 129, no. Part 6, 13 April 2006 (2006-04-13), pages 1517 - 1533, XP009077910, ISSN: 0006-8950 * |
| CLARKE W E ET AL: "The role of matrix metalloproteinases (MMPS) in the regenerating optic nerve", JOURNAL OF ENDOCRINOLOGY, vol. 164, no. Suppl., March 2000 (2000-03-01), & 19TH JOINT MEETING OF THE BRITISH ENDOCRINE SOCIETIES, WITH THE EUROPEAN FEDERATION OF ENDOCRINE SO; BIRMINGHAM, ENGLAND, UK; MARCH 13-16, 2000, pages P158, XP009077936, ISSN: 0022-0795 * |
| LOGAN ANN ET AL: "Neurotrophic factor synergy is required for neuronal survival and disinhibited axon regeneration after CNS injury", BRAIN, vol. 129, no. Part 2, February 2006 (2006-02-01), pages 490 - 502, XP009077917, ISSN: 0006-8950 * |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20110039774A1 (en) * | 2009-08-14 | 2011-02-17 | Eu Sol Biotech Co., Ltd. | Method for repairing neurodegeneration |
| US9198953B2 (en) * | 2009-08-14 | 2015-12-01 | Eu Sol Biotech Co., Ltd. | Method for repairing neurodegeneration |
| CN112472796A (en) * | 2015-03-26 | 2021-03-12 | 苏州澳宗生物科技有限公司 | Methods of diagnosing or treating neurological disorders using P75ECD and/or P75 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11571463B2 (en) | Polynucleotides encoding interleukin-12 (IL12) and uses thereof | |
| US20230323371A1 (en) | Polynucleotides encoding alpha-galactosidase a for the treatment of fabry disease | |
| Ahmed et al. | Schwann cell-derived factor-induced modulation of the NgR/p75NTR/EGFR axis disinhibits axon growth through CNS myelin in vivo and in vitro | |
| US6709866B2 (en) | Methods for enhancing survival of a neuron | |
| US20200085916A1 (en) | Polynucleotides encoding porphobilinogen deaminase for the treatment of acute intermittent porphyria | |
| AU2017266948A1 (en) | Polynucleotides encoding porphobilinogen deaminase for the treatment of acute intermittent porphyria | |
| Dijkhuizen et al. | Adenoviral vector‐directed expression of neurotrophin‐3 in rat dorsal root ganglion explants results in a robust neurite outgrowth response | |
| US20150329867A1 (en) | Pharmaceutical Compositions and Diagnostic Methods for Inflammatory Skin Diseases, Disorders or Conditions | |
| US5929042A (en) | Antisense compounds which prevent cell death and uses thereof | |
| CA3147742A1 (en) | Use of frataxin for treating leigh syndrome, french canadian type | |
| WO2007138236A1 (en) | Sheddase enzymes for neuron growth | |
| JP2004508827A (en) | Calcium binding protein | |
| US7943755B2 (en) | Neuron regeneration | |
| US20220033450A1 (en) | Virally expressed inhibitors of pdz domains, such as pick1 and uses thereof | |
| US7223856B2 (en) | Antisense compounds which prevent cell death and uses thereof | |
| JP2012067081A (en) | Algia therapeutic agent | |
| KR20010074631A (en) | (-)-Strand RNA Virus Vector for Nerve Cell | |
| CN115710307A (en) | Application of scorpion toxin and mutant thereof in resisting epilepsy | |
| US20100168010A1 (en) | Compositions and methods of modulating cell growth and motility | |
| CN116519943A (en) | GABA A Application of BACE1 enzyme cutting site on receptor beta subunit as Alzheimer disease diagnosis or treatment target site | |
| AU2006240181A1 (en) | Ubiquilin regulation of presenilin endoproteolysis, and suppression of polyglutamine-induced toxicity in cells | |
| EA045597B1 (en) | REELIN COMPOSITIONS FOR THE TREATMENT OF NEUROLOGICAL DISORDERS |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 06743979 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 06743979 Country of ref document: EP Kind code of ref document: A1 |