A NEW BIOCHEMICAL ROUTE TO ASTAXANTHIN
Inventor: Francis X. Cunningham, Jr. Chevy Chase, MD (US)
[0001] This research was supported in part by the National Science Foundation, Contract No. MCB0316448. The U.S. Government has certain rights in this invention
BACKGROUND OF THE INVENTION
[0002] The blood red color, verging on black at the base, displayed by the petals of flowers of Adonis aestivalis and Adonis annua results from the accumulation of carotenoid pigments (Egger, 1965; Neamtu et al, 1966; Seybold and Goodwin, 1959), predominantly the ketocarotenoid astaxanthin (3,3'-dihydroxy-4,4'-diketo-β,β-carotene; FIG. 1). The biosynthesis of astaxanthin occurs in a number of bacteria and fungi (Goodwin, 1980; Johnson and An, 1991), and in certain unicellular algae (Goodwin, 1980; Grung and Liaaen- Jensen, 1993; Johnson and An, 1991; Orosa et al, 2000). Astaxanthin has been found in a few other plant species (Czeczuga, 1987; Goodwin, 1980), but no other plant produces this ketocarotenoid in as great a quantity as in Adonis flowers [ca. 1% of dry weight for the flower petals of Adonis annua according to Rεnstxøm et al., (1981)].
[0003] Astaxanthin has found use as a topical antioxidant (in sun blocking lotions, for example) and as an ingredient of human nutritional supplements. See U.S. Patent 6,433,025 to Lorenz. This carotenoid, however, is perhaps best known for providing an attractive orange-red color to the flesh of wild salmon and other fish (Shahidi et al., 1998) and a blue hue (changing to red upon boiling as the proteins that bind astaxanthin are denatured) to the carapace of lobster and of other crustaceans (Chayen et al, 2003; Tanaka e/ α/., 1976).
[0004] Fish and crustaceans that are raised in captivity require the addition of astaxanthin to their feed in order to acquire the appropriate coloration. The substantial and expanding market for astaxanthin as a fish feed additive is supplied largely by chemical synthesis, but there is considerable interest in the development of a biological production process to provide an alternative source of this valuable ketocarotenoid. The green alga Haematococcus pluvialis (Lorenz and Cysewski, 2000; Orosa et al, 2000) and the fungus Xanthophyllomyces dendrorhous (formerly known as Phqffia rhodozyma; Johnson, 2003; Visser et al, 2003,) have received the most attention in this regard. See also U.S. patent 6,413,736 to Jacobson et al, and incorporated by reference herein as if set forth in its entirety. However, the cost of producing astaxanthin in these organisms remains much greater than that for astaxanthin produced by chemical synthesis.
[0005] Currently, synthetic astaxanthin is added to feeds prepared for production of salmonids and red sea bream in aquaculture to provide a source of this carotenoid compound. See, for example, U.S. patent No. 5,739,006 to Abe et al. In some cases, synthetic canthaxanthin (an oxygenated carotenoid compound that is very closely related to astaxanthin) is used in place of astaxanthin in feeds for salmonids and red sea bream, but this compound does not add the appropriate color to these fishes as efficiently as the naturally predominant astaxanthin.
[0006] Recently, attempts have been made, with limited success, to engineer plants for astaxanthin production by introduction of genes from algal and/or bacterial carotenoid pathways (Mann et al, 2000; Ralley et al, 2004; Stalberg et al, 2003). Problems encountered with this strategy include: an incomplete conversion of precursors (i.e. β- carotene and zeaxanthin) into astaxanthin, competition of the introduced bacterial or green algal enzymes with endogenous enzymes that also use β-carotene and/or zeaxanthin as substrates (i.e. zeaxanthin epoxidase), and the accumulation of unwanted intermediates of the pathway (i.e. adonixanthin and adonirubin).
[0007] A few attempts have been made to develop and exploit Adonis aestivalis as a source of astaxanthin for the pigmentation of fish (Kamata et al, 1990; Rodney, 1995), and this plant is currently grown in China expressly for this purpose. However, despite high concentrations of astaxanthin in the flower petals, a relatively low yield of petal biomass per acre makes Adonis a less than ideal vehicle for biological production of this pigment. An understanding of the biosynthetic pathway leading to astaxanthin in Adonis aestivalis would enable the pathway to be transferred to other plants, such as marigold, that could provide a much greater yield of carotenoid-containing biomass and, therefore, a much less costly source of natural astaxanthin.
[0008] From zeaxanthin (3,3'-dihydroxy-β,β-carotene), a dihydroxy carotenoid present in the green tissues of most higher plants, the formation of astaxanthin requires only that a carbonyl be introduced at the number 4 carbon of each ring (FIG. 1). As a practical matter, the addition of the carbonyl may need to occur prior to hydroxylation of the ring [i.e. β-carotene rather than zeaxanthin would be the substrate for the enzyme, and echinenone (4-keto-β,β-carotene) and canthaxanthin (4,4'-diketo-β,β-carotene) would be the immediate products (Breitenbach et al., 1996; Fraser et al., 1998; Lotan and Hirschberg, 1995)]. Enzymes that catalyze carbonyl addition at the number 4 carbon of carotenoid β-rings have so far been identified in bacteria (De Souza et al., 2002; Harker and Hirschberg, 1999; Misawa et al., 1995a and 1995b), photosynthetic bacteria (Hannibal et al., 2000), cyanobacteria (Fernandez-Gonzalez et al., 1997; Steiger and Sandmann, 2004), and green algae (Kajiwara et al., 1995; Lotan and Hirschberg, 1995). The green algal enzymes that have been characterized are orthologs of those found in bacteria, in photosynthetic bacteria, and in certain of the cyanobacteria, as evidenced by the significant similarity of their amino acid sequences. The "4-ketolase" enzyme of the cyanobacterium Synechocystis sp. PCC6803 is distinctly different from these others (Fernandez-Gonzalez et al., 1997). It is related instead to an enzyme that catalyzes an earlier step in the carotenoid pathway of Synechocystis: the carotene isomerase
(Breitenbach et ah, 2001; Masamoto et ah, 2001). What appears to be a third type of 4- ketolase enzyme, found in the fungus Xanthophyllomyces dendrorhous (Phaffϊa rhodozymά), is related to cytochrome P*jo enzymes (Hoshiπo et ah, 2002). The activity of this enzyme has not yet been demonstrated directly. The enzyme's putative function as an "astaxanthin synthase" has been attributed on the basis of genetic complementation experiments. The gene encoding this enzyme restores the ability to synthesize astaxanthin in a X. dendrorhous mutant that accumulates only β-carotene (Hoshino et ah, 2002). Because no mutants have been found that accumulate any of the intermediates between β- carotene and astaxanthin (Visser et ah, 2003), it is thought that the product of this gene is responsible for both 3 -hydroxy lation and 4-keto addition.
[0009] The green plant Adonis aestivalis synthesizes carotenoids with 4-keto-β-rings via a biochemical pathway unrelated to any yet characterized or described. The present inventor has previously disclosed (U.S. Patent No. 6,551,807 to Cunningham) two nucleic acid sequences from Adonis aestivalis (FIG. 2 and FIG. 3; SEQ ID NO: 1 and SEQ ID NO: 2) that encode enzymes (FIG. 4; SEQ ID NO: 3 and SEQ ID NO: 4) which convert β-carotene into carotenoids with ketocarotenoid-like absorption spectra (i.e. red- shifted and with a diminution of spectral fine structure). More recent work (Cunningham and Gantt, 2005) has demonstrated that the Adonis aestivalis "ketolase" enzymes described in this earlier patent (AdKetol and AdKeto2) each catalyze two different reactions: a desaturation of carotenoid β-rings at the 3-4 position and a hydroxylation at the number 4 carbon. The inventor now discloses herein the DNA sequence of an Adonis aestivalis cDNA that encodes an enzyme, referred to as AdKC28, that works in concert with either one of the two 3,4-desaturase/4-hydroxylase enzymes previously described (AdKetol and AdKeto2) to convert β-carotene into astaxanthin..
SUMMARY OF THE INVENTION
[0010] There is an increasing demand for biological or "natural" sources of carotenoid pigments for use as food colorants, feed additives, and nutritional supplements. The invention described herein provides the nucleotide sequence of a cDNA (AdKC28) obtained from the flowering plant Adonis aestivalis, and entails the use of this cDNA or other nucleotides similar in sequence to this cDNA, together with either one of two Adonis aestivalis "ketolase" cDNAs (AdKetol and AdKetoT) disclosed in an earlier patent (US 6,551,807 Bl), to produce polypeptides that catalyze the conversion of β- carotene into astaxanthin. This invention makes available a new biochemical route, one unrelated to any previously described, that leads to the valuable ketocarotenoid astaxanthin. This new biochemical process provides a number of advantages when compared to the already existing biotechnology.
[0011] It is an object of the present invention to provide Adonis aestivalis enzymes adapted to function and efficiently produce a substantial quantity of astaxanthin in the context of a plant pathway of carotenoid biosynthesis. The production of astaxanthin in transgenic plants that express these Adonis aestivalis enzymes is more likely to proceed efficiently and with high yield of astaxanthin than in those wherein genes encoding bacterial or fungal or green algal enzymes are introduced.
[0012] Another object of the present invention is to provide Adonis aestivalis genes that produce enzymes having N-terminal sequences needed to target them efficiently to the appropriate membranes within the plastids of plant cells.
[0013] Yet another object of the present invention is to provide transgenic plants that are engineered to produce astaxanthin using genes obtained from Adonis aestivalis, itself a plant species that may be more readily accepted by consumers than transgenic plants constructed using genes isolated from bacteria or fungi or green algae. In addition,
because the target tissues of transformed plants will have an obvious phenotype (a dark red color), it should be possible to select for transgenic plants visually rather than with selectable markers of bacterial origin as is commonly done
[0014] It is a further object of the present invention to provide an efficient method for production of astaxanthin that requires only two Adonis aestivalis gene products to convert β-carotene into astaxanthin not only in a plant plastid, but also within the context of a simple bacterial cell (see Example 1 below). Therefore, the process described in the present invention will function in cells, tissues, organs, and organisms of almost any type, as long as they produce or can be made to produce the requisite substrate, β-carotene.
BRIEF DESCRIPTION OF THE DRAWINGS
[0015] A more complete appreciation of the invention and many of the attendant advantages thereof will be readily obtained as the same becomes better understood by reference to the following detailed description when considered in connection with the accompanying drawings.
[0016] FIG. 1 illustrates the pathway to astaxanthin from β-carotene in green algae and in bacteria. Several routes may be followed, depending on the order of addition of the 3- hydroxyl and 4-keto groups to the two β-rings of the symmetrical substrate β-carotene. Conventional numbering of the carbon atoms of a β-ring is shown at the lower right. Abbreviations: BKT, β-carotene 4-ketolase (Note: while the green algal enzymes are commonly referred to as BKT, the bacterial β-carotene 4-ketolase enzymes are referred to as CrtW); CHYβ, β-carotene 3-hydroxylase (Note: bacterial β-carotene 3-hydroxylase enzymes are referred to as CrtZ).
[0017] FIG. 2 displays the nucleotide sequence of the Adonis aestivalis cDNA referred to asAdKetol (SEQ ID NO: 1)
[0018] FIG. 3 displays the nucleotide sequence of the Adonis aestivalis cDNA referred to asAdKeto2 (SEQ ID NO: 2)
[0019] FIG. 4 shows an alignment of the amino acid sequences (SEQ ID NO: 3 and SEQ ID NO: 4) deduced for polypeptides encoded by Adonis aestivalis cDNAs AdKe to 1 (SEQ ID NO: 1) (GenBank accession number AY644757) and AdKeto2 (SEQ ID NO: 2) (GenBank accession numbers AY644758 and AY644759). A total of 276 of 306 residues (90.2%) of the overlapping sequences (with no gaps in the alignment) are identical. These residues are shown in white text within a black box.
[0020] FIG. 5 displays the nucleotide sequence of the Adonis aestivalis cDNA referred to herein as AdKC28 (SEQ ID NO: 5).
[0021] FIG. 6 displays the deduced amino acid sequence of the polypeptide (SEQ ID NO: 6) encoded by AdKC28 for bases 13-1233 (SEQ ID NO: 5).
[0022] FIG. 7 provides an alignment of the deduced amino acid sequence (SEQ ID NO:
6) of Adonis aestivalis cDNA AdKC28 (SEQ ID NO: 5) with that deduced (SEQ ID NO:
7) for an Arabidopsis thaliana gene referred to as Atlg50450 (GenBank accession number AAMl 9877.1 and GL20453277). Residues identical for both sequences are shown in white text within a black box. A total of 256 of 408 residues (62.7%) of the overlapping sequences (with one gap) are identical.
[0023] FIG. 8 depicts the biosynthetic pathway leading to a 3-hydroxy-4-keto-β-ring as catalyzed by Adonis aestivalis gene product AdKetol (or AdKeto2) together with AdKC28. The quite different pathway used by bacteria and green algae is also shown for comparison.
[0024] FIG. 9 shows the DNA sequence for Adonis aestivalis cDNA AdKCl 7.
[0025] FIG. 10 is the corresponding amino acid translated sequence of cDNA AdKCl 7 for bases 3-1229.
[0026] FIGS. 1 IA and 1 IB is a comparison of the nucleotide sequences of AdKC28 and AdKCl 7.
[0027] FIG. 12 is a comparison of the predicted amino acid sequences of AdKC28 and AdKC 17.
DETAILED DESCRIPTION AND PREFERRED EMBODIMENTS
[0028] The present invention is directed to two purified nucleic acid sequences that have all or some substantial portion of the nucleic acid sequence of AdKC28 (SEQ ID NO: 5), or AdKCl 7 (FIG. 9), and which encodes for a protein having a particular enzymatic activity such that β-carotene is converted into astaxanthin when the polypeptide product of this nucleotide is produced together with the product of one or the other of two previously described nucleic acids (AdKetol and AdKeto2; SEQ ID NOS: 1 and 2; US Patent 6,551,807 Bl).
[0029] The present invention also provides for a purified polypeptide having all or a substantial portion of the amino acid sequence of SEQ ID NO: 6 or FIG. 10. This invention also includes the combination of the nucleic acid of SEQ ID NO: 5, or one which otherwise encodes all or a substantial portion of the polypeptide sequence of SEQ ID NO: 6, together with a nucleic acid that encodes all or a substantial portion of the polypeptide of SEQ ID NO: 3 or that of SEQ ID NO: 4. This invention also includes the combination of a polypeptide with all or a substantial portion of the amino acid sequence of SEQ ID NO: 6, together with a polypeptide with all or a substantial portion of the
amino acid sequence of SEQ ID NO: 3 or that of SEQ ID NO: 4.
[0030] The nucleic acid sequence of the Adonis aestivalis cDNA referred to as AdKC28 (SEQ ID NO: 5) is shown in FIG. 5, and the amino acid sequence deduced for the polypeptide product (SEQ ID NO: 6) of this nucleic acid is displayed in FIG. 6. The nucleic acid sequence of the Adonis aestivalis cDNA referred to as AdKCl 7 is shown in FIG.9, and the amino acid sequence deduced for the polypeptide product of this nucleic acid is displayed in FIG. 10. No sequence in the GenBank database is more than 70% identical in amino acid sequence to AdKC28. The amino acid sequence deduced for an Arabidopsis thaliana gene/cDNA known as Atlg50450 is the closest match, with only about 63% identity overall. An alignment of AdKC28 and Atlg50450 is shown in FIG. 7. Genes encoding products similar in sequence to AdKC28 (SEQ ID NO: 6) are also present in many other plants (based on a BLAST search of the GenBank EST database), in the green alga Chlamydomonas reinhardtii (based on a BLAST search of the JGI Chlamydomonas reinhardtii genome database at http://genome.jgi- psf.org/chlre2/chlre2.horne.html) and in several cyanobacteria (ca. 30% identity for comparisons of the various cyanobacterial gene products with AdKC28). The functions of the plant, algal and cyanobacterial gene products that are similar in sequence to AdKC28 are, as yet, unknown.
[00311 An alignment of the amino acid sequences of the products (SEQ ID NO: 3 and SEQ ID NO: 4) of Adonis aestivalis cDNAs AdKetoI and AdKeto2 (SEQ ID NO: 1 and SEQ ID NO: 2) is displayed in FIG. 4. As discussed earlier, these polypeptides, which are about 90% identical in amino acid sequence overall (FIG. 4), exhibit essentially the same enzymatic activity when provided with β-carotene as the substrate, and various truncations, deletions and alterations of the coding region may be made without impairing the catalytic activity. No polypeptides presently in the GenBank database are more than 53% identical to the amino acid sequences of the two AdKeto polypeptides (AdKetol and AdKeto2; SEQ ID NO: 3 and SEQ ID NO: 4).
[0032] In each case, nucleic acid and amino acid sequence similarity and identity is measured using sequence analysis software, for example, the Sequence Analysis, Gap, or BestFit software packages of the Genetics Computer Group (University of Wis. Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705), MEGAlign (DNAStar, Inc., 1228 S. Park St., Madison, Wis. 53715), or Mac Vector (Oxford Molecular Group, 2105 S. Bascom Avenue, Suite 200, Campbell, Calif. 95008).
[0033] Conservative {i.e. similar) substitutions typically include substitutions within the following groups: glycine and alanine; valine, isoleucine and leucine; aspartic acid, glutamic acid, asparagine and glutamine; serine and threonine; lysine and arginine; and phenylalanine and tyrosine. Substitutions may also be made on the basis of conserved hydrophobicity or hydrophilicity (see Kyte and Doolittle, J. MoI. Biol. 157: 105-132 (1982)), or on the basis of the ability to assume similar polypeptide secondary structure (see Chou and Fasman, Adv. Enzymol. 47: 45-148 (1978)).
[0034] The nucleic acid molecules of the present invention are useful for probes, primers, chemical intermediates, and in biological assays. The nucleic acid molecules are useful as hybridization probes for messenger RNA, transcript/cDNA and genomic DNA to isolate full-length cDNA and genomic clones encoding polypeptides similar in sequence to that described in FIG. 6 (SEQ ID NO: 6) and to isolate cDNA and genomic clones that correspond to variants (alleles, orthologs, etc.) producing polypeptides identical or similar in sequence to that shown in FIG. 6.
[0035] A probe can correspond to any sequence along the entire length of the nucleic acid molecules provided in the Figures. Accordingly, it could be derived from 5' noncoding regions, the coding region, and 3' noncoding regions. However, as discussed, fragments are not to be construed as encompassing fragments disclosed prior to the present invention.
[0036] The nucleic acid molecules are also useful for designing primers for PCR to amplify any given region of a nucleic acid molecule and are useful to synthesize antisense molecules of desired length and sequence.
[0037] The nucleic acid molecules are also useful for constructing recombinant vectors. Such vectors include expression vectors that express a portion of, or all of, the polypeptide sequences. Vectors also include insertion vectors, used to integrate into another nucleic acid molecule sequence, such as into the cellular genome, to alter in situ expression of a gene and/or gene product. For example, an endogenous coding sequence can be replaced via homologous recombination with all or part of the coding region containing one or more specifically introduced mutations.
[0038] The nucleic acid molecules are also useful for constructing transgenic animals expressing all, or a part, of the nucleic acid molecules and polypeptides and are discussed in detail further.
[0039] The invention also provides vectors containing the nucleic acid molecules described herein. The term "vector" refers to a vehicle, preferably a nucleic acid molecule, which can transport the nucleic acid molecules. When the vector is a nucleic acid molecule, the nucleic acid molecules are covalently linked to the vector nucleic acid. With this aspect of the invention, the vector includes a plasmid, single or double stranded phage, a single or double stranded RNA or DNA viral vector, or artificial chromosome, such as a BAC, PAC, YAC, or MAC. A vector can be maintained in the host cell as an extrachromosomal element where it replicates and produces additional copies of the nucleic acid molecules. Alternatively, the vector may integrate into the host cell genome and produce additional copies of the nucleic acid molecules when the host cell replicates.
[0040] Expression vectors contain cw-acting regulatory regions that are operably linked
in the vector to the nucleic acid molecules such that transcription of the nucleic acid molecules is facilitated or allowed in a host cell. The nucleic acid molecules can be introduced into the host cell with a separate nucleic acid molecule capable of affecting transcription. Thus, the second nucleic acid molecule may provide a /rαns-acting factor interacting with the c/s-regulatory control region to facilitate or allow transcription of the nucleic acid molecules from the vector. Alternatively, a frα«_?-acting factor may be supplied by the host cell. Finally, a trans-acting factor can be produced from the vector itself. It is understood, however, that in some embodiments, transcription and/or translation of the nucleic acid molecules can occur in a cell-free system.
[0041] As described herein, it may be desirable to express the polypeptides as fusion proteins. Accordingly, the invention provides fusion vectors that allow for the production of the peptides. Fusion vectors can increase the expression of a recombinant protein; increase the solubility of the recombinant protein, and aid in the purification of the protein by acting, for example, as a ligand for affinity purification. A proteolytic cleavage site may be introduced at the junction of the fusion moiety so that the desired peptide can ultimately be separated from the fusion moiety. Proteolytic enzymes include, but are not limited to, factor Xa, thrombin, enterokinase, and the TEV protease. Typical fusion expression vectors include pGEX (Smith et al, Gene 67:31-40 (1988)), pMAL (New England Biolabs, Beverly, Mass.) and pRJT5 (Pharmacia, Piscataway, NJ.) which fuse glutathione S -transferase (GST), maltose-binding protein, or protein A, respectively, to the target recombinant protein. Examples of suitable inducible non-fusion E. coli expression vectors include pTrc (Amann et al, Gene 69:301-315 (1988)) and pET 1 Id (Studier et al, Gene Expression Technology: Methods in Enzymology 185:60-89 (1990)).
Pharmaceutical and Nutritional Preparations
[0042] Dried Haematococcus algae, Phqffia yeast powder, or synthetic astaxanthin can
each be formulated into various food grade oils such as safflower, canola, tocopherols or rice bran and manufactured into gelcaps for convenient ingestion. Alternatively, dried Haematococcus algae, Phqffia yeast powder, or synthetic astaxanthin can be stabilized by various commercial processes and added directly to foods or beverages.
[0043] Thus, the inventor also presents a treatment and method for retarding and prevention of sunburns, and possibly related cancers resulting from long term sunburn damage and a treatment and method of retarding and preventing sunburns by administering a therapeutically effective dose of astaxanthin made using the enzyme derived from the DNA sequence AdKC28.
[0044] The astaxanthin made using the enzyme derived from the DNA sequence AdKC28 is preferably administered orally, in doses of between about 1 to about 100 mg per day. Doses of between about 2 to about 10 mg per day are preferable. The dose may be administered to be taken with meals, twice daily.
[0045] In addition to an oral administration, a formulation of astaxanthin may also be applied in a cream or injected into the exposed area. Such a dose would also be in the range of about 1 to 100 mg per day.
[0046] It is preferable, with an ingestible form of astaxanthin, to begin administering the astaxanthin at least two or three days before sun exposure, and preferably at least a week before exposure, in order to prevent sunburn. However, as seen below in the examples, even ingestion during or after exposure provides beneficial effects. With the topical and injectable treatment, astaxanthin may be administered before, during, or after exposure.
[0047] Any and all organisms that synthesize carotenoids are potential candidates for astaxanthin production using the Adonis aestivalis cDNAs disclosed and described
herein. A number of plants, some fungi and yeasts, and several green algae have been utilized commercially as sources of carotenoid pigments. In these organisms the carotenoids of interest may be accumulated within specific organs or tissues (e.g. the flower petals of marigold, the roots of carrot and the tubers of sweet potato), may be induced under particular environmental conditions or times of development (as in certain species of the green algae Haematococcus and Dunaliellά), or may result from transgenic modification of the host (as in the seeds of canola expressing a bacterial phytoene synthase gene; Ravanello et al, 2003; Shewmaker et al, 1999).
[0048] Host systems according to the present invention preferably comprise any organism which is capable of producing carotenoids, or which already produces carotenoids. Such organisms include plants, algae, certain bacteria, cyanobacteria and other photosynthetic bacteria. Transformation of these hosts with vectors according to the present invention can be done using standard techniques. See, for example, Sambrook et al, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N. Y., 1989; Ausubel et al, Current Protocols in Molecular Biology, Greene Publishing and Wiley Interscience, New York, 1991.
[0049] The present invention also includes vectors containing the nucleic acids of the invention. Suitable vectors according to the present invention comprise a gene encoding a ketolase enzyme as described above, wherein the gene is operably linked to a suitable promoter. Suitable promoters for the vector can be constructed using techniques well known in the art (see, for example, Sambrook et al, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N. Y., 1989; Ausubel et al, Current Protocols in Molecular Biology, Greene Publishing and Wiley Interscience, New York, 1991). Suitable vectors for eukaryotic expression in plants are described in Fray et al, (1995; Plant J. 8:693-701) and Misawa et al, (1994; Plant J. 6:481-489). Suitable vectors for prokaryotic expression include pACYC184, pUCl 19, and pBR322 (available from New England BioLabs, Beverly, Mass.) and pTrcHis (Invitrogen) and pET28
(Novagen) and derivatives thereof. The vectors of the present invention can additionally contain regulatory elements such as promoters, repressors, selectable markers such as antibiotic resistance genes, etc., the construction of which is very well known in the art.
[0050] For the purpose of astaxanthin production of the present invention, the preferred microbial, fungal, plant and algal hosts for the Adonis aestivalis genes are those that produce or can be made to produce a substantial quantity of β-carotene or metabolites thereof. Among the more preferred hosts at this time are: marigold (in the flowers; especially those of mutants or varieties that accumulate predominantly β- carotene), transgenic canola (with carotenoid-accumulating seeds, as in Shewmaker et ah, 1999), oil palm (various species of the genus Elaeis; the carotenoid-accumulating seeds), carrot (the β-carotene-accumulating root), sweet potato (the β-carotene-rich tubers), maize (the carotenoid-accumulating seeds), tomato (the fruits, especially in varieties or transgenic plants that accumulate largely β-carotene rather than lycopene), and various high β-carotene producing species of the green alga Dunaliella.
[0051] The genes encoding the Adonis aestivalis ketolase enzymes as described above, when cloned into a suitable expression vector, can be produce these enzymes in great quantity in a host cell expression system or to inhibit the production of these enzymes. For example, a vector containing a gene of the invention may be used to increase the amount of ketocarotenoids in an organism and thereby alter the nutritional or commercial value or pharmacology of the organism. A vector containing a gene of the invention may also be used to modify the carotenoid production in an organism.
[0052] Methodologies for producing transgenic bacteria, fungi, algae, and plants are widely known and familiar to those skilled in the arts. It is desirable to employ promoters that restrict the expression of the Adonis aestivalis genes to the carotenoid-rich tissues or to an appropriate time of development in order to avoid possible adverse effects on yield.
[0053] Therefore, the present invention includes a method of producing a ketocarotenoid in a host cell, the method comprising inserting into the host cell a vector comprising a heterologous nucleic acid sequence which encodes for a protein having ketolase enzyme activity and comprises (1) SEQ ID NO: 5 or (2) a sequence which encodes the amino acid sequence of SEQ ID NO: 6, wherein the heterologous nucleic acid sequence is operably linked to a promoter; and expressing the heterologous nucleic acid sequence, thereby producing ketocarotenoid when the appropriate substrate is available.
[0054] On the basis of the teachings disclosed here and in an earlier patent (U.S. Patent 6,551,807, hereby incorporated by reference in its entirety as if completely set forth in the specification), one of ordinary skill in the art would be able create nucleotides that encode polypeptides similar in sequence to and with the same catalytic activity as AdKC28, AdKetol and AdKeto2. One can isolate such nucleotides from a different accession of Adonis aestivalis or from one of the other species of Adonis that produce astaxanthin. Alternatively, one skilled in the art can create different nucleotides that would encode the polypeptides of SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 6, or polypeptides somewhat different from SEQ ID NO: 3, SEQ ID NO: 4, and SEQ ID NO: 6 but that would retain the catalytic activity of these proteins. Such modifications are well known in genetic engineering. Examples include the introduction of a restriction site, addition of a transit sequence, "conservative" (i.e. similar) substitutions for various amino acids, and alteration of the codon usage so as to be more compatible with transcriptional machinery of the host organism. Therefore, in the context of the present invention, the applicant discloses and claims nucleotides that encode polypeptides that are >70% identical to, in whole or in large part, and exhibit the catalytic function of those polypeptides of SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 6. Such claims would not include or encompass any other nucleotides or polypeptides that are currently available in the GenBank databases.
[0055J The term "modifying the production" means that the amount of carotenoids produced can be enhanced, reduced, or left the same, as compared to an untransformed host cell, hi accordance with one embodiment of the present invention, the composition of the carotenoids (i.e. the identities and relative amounts of the specific carotenoids produced) may be altered, and this change in composition may result in either a net gain, net loss, or no net change in the amount of carotenoids produced in the cell.
[0056] It is expressly stated that the numbering of the elements of the sequences (on the one hand nucleic acid sequences and on the other amino acid sequences) shall not be understood as a fixed or limiting definition. The numbering shall merely provide the information of the positions of the sequence elements to each other in relative terms and is therefore a reference.
[0057] The term "derivative" means, within the context of the present invention, that the sequences of these molecules differ from the sequences of the nucleic acid molecules according to the invention or to be suitably employed in accordance with the invention in one or more positions and exhibit a high degree of homology to these sequences. Homology in the present context means a sequence identity of at least 60%, preferably over 70%, and especially preferably over 85%, in particular over 90% and very especially preferably over 95%. The deviations relative to the nucleic acid molecules according to the invention or to the nucleic acid molecules to be suitably employed in accordance with the invention may have originated by means of one or more deletions, substitutions, insertions (addition) or recombinations.
[0058] Furthermore, homology means that a functional and/or structural equivalence exits between the nucleic acid molecules in question and the proteins encoded by them. The nucleic acid molecules which are homologous to the molecules according to the invention or to the molecules to be suitably employed in accordance with the invention and which constitute derivatives of these molecules are, as a rule, variations of these
molecules which constitute modifications which exert the same, a virtually identical or a similar biological function. They may be naturally occurring variations, for example sequences from other plant species, or mutations, it being possible for these mutations to have occurred naturally or to have been introduced by directed or random mutagenesis. The variations may further be synthetic sequences. The allelic variants may be naturally occurring variants or else synthetic variants or variants generated by recombinant DNA technology.
[00591 The term "part" regarding the nucleic acid molecule encoding an AdKC28 protein according to this invention encompasses a poly- or oligonucleotide consisting of about at least 30-99, preferably at least 100, more preferably at least 200, in particular at least 300, and most preferably at least 400 of the nucleotides of the nucleic acid molecule encoding an AdKC28 protein or derivative thereof according to the invention. The term "part" is not limited to portions of the nucleic acid molecules which are long enough to encode a functionally active portion of the AdKC28 protein as described.
[0060] Having generally described this invention, a further understanding can be obtained by reference to the following specific example which is provided herein for the purpose of illustration only. It is not intended that this example be limiting.
EXAMPLE l
Production of Astaxanthin in the Bacterium Escherichia coli: a Case Study
[0061] A strain of the common laboratory bacterium E. coli was engineered to produce the carotenoid β-carotene by introduction of a plasmid (pAC-BETA) containing the requisite genes from the bacterium Erwinia herbicola (Cunningham et ah, 1996). Introduction of a second plasmid containing either the Adonis aestivalis DNA sequence AdKetol oτAdKeto2 (SEQ ID NO: 1 or SEQ ID NO: 2; in plasmid pAdKetol or plasmid
pAdKeto2) resulted in the conversion of β-carotene into several other carotenoids that contain β-rings with a desaturation at the 3-4 position and/or an hydroxy 1 group at the number 4 carbon (Cunningham and Gantt, 2005). Addition of a third plasmid, containing the Adonis aestivalis nucleotide sequence of AdKC28 (SEQ ID NO: 5) resulted in the synthesis and accumulation, predominantly, of the ketocarotenoid astaxanthin. Absent the second plasmid that contained either AdKetol oτAdKeto2, the introduction of the plasmid containing the Adonis aestivalis DNA sequence AdKC28 into the β-carotene accumulating E. coli strain did not alter the carotenoid content: β-carotene remained the predominant pigment.
[0062] Two different versions of the third plasmid were used in the above experiments, with each resulting in the accumulation of astaxanthin in good yield. In one plasmid the AdKC28 cDNA (SEQ ID NO: 5) was fused in frame to a portion of a gene encoding the N terminus of a polypeptide encoded by the lacZ gene (in plasmid vector pBluescript SK- ; from Stratagene Cloning Systems). The amino acid sequence of the fusion protein specified by this chimerical gene consisted of the full length coding region of AdKC28 (SEQ ID NO: 5; encoding the amino acid sequence of SEQ ID NO: 6) with additional N terminal sequence specified by lacZ and by the 5' untranslated region of AdKC28 (SEQ ID NO: 8; MTMITPSSKLTLTKGNKSWSSTAVAAALELVDPPGCRNSHEEEHY).
[0063] A second version of the plasmid containing AdKC28 was constructed so as to produce the authentic full length polypeptide (SEQ ID NO: 6) under control of the tightly-regulated bacterial araBAD promoter. The coding region of AdKC28 was amplified by PCR using oligonucleotide primers AdKC28Nco-N (CACACCATGGCTCCTGTTCTCCTTG) (SEQ ID NO: 9) and AdKC28-C (CTGGGCTACATAATGAATAATCCAATC) (SEQ ID NO: 10), and the PCR product was digested with the appropriate restriction enzymes and ligated in the Ncol and Xho\ sites of plasmid pBAD/HisB (Invitrogen). Biosynthesis of astaxanthin with this plasmid (in E. coli cultures also containing the plasmids p AC-BETA and pAdKetol or
pAdKeto2) occurred only when arabinose was added to induce expression of AdKC 28 from the araBAD promoter.
[00641 From the above results it can be deduced that, unexpectedly and in contrast to the pathways of bacteria and green algae, the route to carotenoids with 3-hydroxy-4-keto- β-rings in Adonis aestivalis does not proceed via either a 3-hydroxy-β ring or a 4-keto-β ring. The sequence of reactions of the present invention (FIG. 8) includes first a desaturation of the β-ring at the 3,4 position (a reaction catalyzed by the AdKetol and AdKeto2 "ketolase" enzymes; Cunningham and Gantt, 2005). This reaction is then followed by a dihydroxylation at the number 3 and 4 carbons (a reaction catalyzed by the product of Adonis aestivalis cDNA AdKC28), with the 3,4-desaturation either retained or reintroduced by AdKetol or AdKeto2. The 3,4-didehydro-3,4-dihydroxy-β-ring thereby produced will spontaneously be converted to a 3-hydroxy-4-keto-β-ring as a consequence of a keto-enol tautomerization.
[0065] The data obtained with β -carotene-accumulating E. coli clearly demonstrate that the products of two cDNAs derived from mRNA isolated from a flowering plant, Adonis aestivalis, are sufficient to convert β-carotene into the valuable ketocarotenoid astaxanthin in the context of a simple bacterial cell. The same two gene products, therefore, should prove sufficient to convert β-carotene into astaxanthin in a wide variety of host organisms, both prokaryotic and eukaryotic, and both photosynthetic and nonphotosynthetic.
[0066] Having described the invention, many modifications thereto will become apparent to those skilled in the art to which it pertains without deviation from the spirit of the invention as defined by the scope of the appended claims.
REFERENCES
[0067] The references cited in the above specification, along with the following references, are incorporated by reference in their entireties as if fully set forth in the specification:
Breitenbach, J., Misawa, N., Kajiwara, S. and Sandmann, G. (1996) Expression in Escherichia coli and properties of the carotene ketolase from Haematococcus pluvialis. FEMS Microbiol. Lett. 140, 241-246.
Breitenbach, J., Vioque, A. and Sandmann, G. (2001) Gene sll0033 from Synechocystis 6803 encodes a carotene isomerase involved in the biosynthesis of all-is lycopene. Z. Naturforsch. [C]. 56, 915-917.
Chayen, N.E., Cianci, M., Grossmann, J.G., Habash, J., Helliwell, J.R., Nneji, G.A., Raftery, J., Rizkallah, P.J. and Zagalsky, P.F. (2003) Unravelling the structural chemistry of the colouration mechanism in lobster shell. Acta Crystallographica D. Biological Crystallography 59, 2072-2082.
Choi S.-K., Nishida, Y., Matsuda, S., Adachi, K., Kasai, H., Peng, X., Komemushi, S., Mild, W. and Misawa, N. (2005) Characterization of β-carotene ketolases, CrtW, from marine bacteria by complementation analysis in Escherichia coli. Mar. Biotechnol. July 5; [Epub ahead of print].
Cunningham, F.X., Jr. and E. Gantt (2005) A study in scarlet: enzymes of ketocarotenoid biosynthesis in the flowers of Adonis aestivalis. Plant J. 41, 478-92.
Cunningham, F.X. Jr., Pogson, B., Sun, Z., McDonald, K.A., DellaPenna, D. and Gantt, E. (1996) Functional analysis of the beta and epsilon lycopene cyclase enzymes
of Arabidopsis reveals a mechanism for control of cyclic carotenoid formation. Plant Cell 8, 1613-1626.
Czeczuga, B. (1987) Ketocarotenoids — autumn carotenoids in Metasequoia glyptostroboides. Biochem. Syst. Ecol. 15, 303-306.
De Souza, M.L., Kollmanπ, S.R. and Schroeder, W.A. (2002) Carotenoid Biosynthesis. International patent application PCT WO/02/079395-B.
Egger, K. (1965) Die Ketocarotinoide in Adonis annua L. Phytochemistry 4, 609-618.
Fernandez-Gonzalez, B.F., Sandmann, G. and Vioque, A. (1997) A new type of asymmetrically acting Λefar-carotene ketolase is required for the synthesis of echinenone in the cyanobacterium Synechocystis sp. PCC 6803. J. Biol. Chem. 272, 9728-9733.
Fraser, P.D., Shimada, H., and Misawa, N. (1998) Enzymic confirmation of reactions involved in routes to astaxanthin formation, elucidated using a direct substrate in vitro assay. Eur. J. Biochem. 252, 229-236.
Goodwin, T. W. (1980) The Biochemistry of the Carotenoids 2nd edn, Vol. 1. London: Chapman and Hall.
Grung, M. and Liaaen-Jensen, S. (1993) Algal carotenoids 52; secondary carotenoids of algae 3; carotenoids in a natural bloom of Eυglena sanguined. Biochem. Syst. Ecol. 21, 757-763.
Hannibal, L., Lorquin, J., D'Ortoli, N.A., Garcia, N., Chaintreuil, C, Masson- Boivin, C, Dreyfus, B. and Giraud, E. (2000) Isolation and characterization of
canthaxanthin biosynthesis genes from the photosynthetic bacterium Bradyrhizobium sp. Strain ORS278. J. Bacteriol. 182, 3850-3853.
Harker, M. and Hirschberg, J. (1999) Carotenoid biosynthesis genes in the bacterium Paracoccus marcusii MHl, unpublished. GenBank Accession Number Y15112.
Hoshino, T., Kazuyuki, O. and Setoguchi, Y. (2002) Astaxanthin synthase. U.S. Patent No. US 6,365,386 Bl.
Johnson, E.A. (2003) Phaffia rhodozyma: colorful odyssey. Int. Microbiol. 6, 169-174.
Johnson, E. A. and An, G.H. (1991) Astaxanthin from microbial sources. Crit. Rev. Biotechnol. 11, 297-326.
Kajiwara, S., Kakizono, T., Saito, T., Kondo, K., Ohtani, T., Nishio, N., Nagai, S. and Misawa, N. (1995) Isolation and functional identification of a novel cDNA for astaxanthin biosynthesis from Haematococcus plitvialis, and astaxanthin synthesis in Escherichia coli. Plant MoI. Biol. 29, 343-352.
Kamata, T., Tanaka, Y., Yamada, S. and Simpson K.L. (1990) Study of carotenoid composition and fatty-acids of astaxanthin diester in rainbow-trout salmo-gairdneri fed the Adonis extract. Nippon Suisan Gakkaishi 56, 789-794.
Lorenz, R.T. and Cysewski, G.R. (2000) Commercial potential for Haematococcus microalgae as a natural source of astaxanthin. Trends Biotechnol. 18, 160-167.
Lotan, T. and Hirschberg, J. (1995) Cloning and expression in Escherichia coli of the gene encoding όeta-C-4-oxygenase, that converts όefα-carotene to the ketocarotenoid canthaxanthin in Haematococcus pluvialis. FEBS Lett. 364, 125-128.
Mann, V., Harker, M., Pecker, I. and Hirschberg, J. (2000) Metabolic engineering of astaxanthin production in tobacco flowers. Nat. Biotechnol. 18, 888-892.
Masamoto, K., Wada, H., Kaneko, T. and Takaichi, S. (2001) Identification of a gene required for cis-to-trans carotene isomerization in carotenogenesis of the cyanobacterium Synechocystis sp. PCC 6803. Plant Cell Physiol. 42, 1398-1402.
Misawa, N., Satomi, Y., Kondo, K., Yokoyama, A., Kajiwara, S., Saito, T., Ohtani, T. and Miki, W. (1995a) Structure and functional analysis of a marine bacterial carotenoid biosynthesis gene cluster and astaxanthin biosynthetic pathway proposed at the gene level. J. Bacteriol. Ill, 6575-658418.
Misawa, N., Kajiwara, S., Kondo, K., Yokoyama, A., Satomi, Y., Saito, T., Miki, W. and Ohtani, T. (1995b) Canthaxanthin biosynthesis by the conversion of methylene to keto groups in a hydrocarbon δetar-carotene by a single gene. Biochem. Biophys. Res. Commun. 209, 867-876.
Neamtu, G., Tamas, V. and Bodea, C. (1966) Die carotinoide aus Einigen Adonis-arten. Rev. Roum. Biochem. 3, 305-310.
Orosa, M., Torres, E., Fidalgo, P. and Abalde, J. (2000) Production and analysis of secondary carotenoids in green algae. J. Appl. Phycol. 12, 553-556.
Ralley, L., Enfissi, E.M.A., Misawa, N., Schuch, W., Bramley, P.M. and Fraser, P.D.
(2004) Metabolic engineering of ketocarotenoid formation in higher plants. Plant J. 39, 477-486.
Ravanello, M.P., Ke, D., Alvarez, J., Huang, B. and Shewmaker, CK. (2003) Coordinate expression of multiple bacterial carotenoid genes in canola leading to altered carotenoid production. Metabolic Eng. 5, 255-263.
Renstrøm, B., Berger, H. and Liaaen-Jensen, S. (1981) Esterified, optically pure (3S, 3'S)-astaxanthin from flowers of Adonis annua. Biochem. Syst. Ecol. 9, 249-250.
Rodney, M. (1995) Astaxanthin from flowers of the genus Adonis. United States Patent 5,453,565.
Seybold, A. and Goodwin, T. W. (1959) Occurrence of astaxanthin in the flower petals of Adonis annua L. Nature 184, 1714-1715.
Shahidi, F., Metusalach and Brown, J. A. (1998) Carotenoid pigments in seafoods and aquaculture. Crit. Rev. Food Sci. Nutrition 38, 1-67.
Shewmaker, C.K., Sheehy, J.A., Daley, M., Colburn, S. and Ke, D. Y. (1999) Seed- specific overexpression of phytoene synthase: increase in carotenoids and other metabolic effects. Plant J. 20, 401-412.
Stalberg, K., Lindgren, O., Ek, B. and Hδglund, A.-S. (2003) Synthesis of ketocarotenoids in the seed of Arabidopsis thaliana. Plant J. 36, 771-779.
Steiger, S. and Sandmann, G. (2004) Cloning of two carotenoid ketolase genes from Nostoc punctiforme for the heterologous production of canthaxanthin and astaxanthin. Biotechnol. Lett. 26, 813-817.
Tanaka, Y., Matsuguchi, H., Katayama, T., Simpson, K.L. and Chichester, CO.
(1976) The biosynthesis of astaxanthin- XVI. The carotenoids in Crustacea. Comp. Biochem. Physiol. B. 54, 391-393.
Visser, H., van Ooyen, A.J.J. and Verdoes, J.C. (2003) Metabolic engineering of the astaxanthin-biosynthetic pathway of Xanthophyllomyces dendrorhous. FEMS Yeast Res. 4, 221-231.