WO2007056266A2 - Cd40 ligand fusion protein vaccine - Google Patents

Cd40 ligand fusion protein vaccine Download PDF

Info

Publication number
WO2007056266A2
WO2007056266A2 PCT/US2006/043164 US2006043164W WO2007056266A2 WO 2007056266 A2 WO2007056266 A2 WO 2007056266A2 US 2006043164 W US2006043164 W US 2006043164W WO 2007056266 A2 WO2007056266 A2 WO 2007056266A2
Authority
WO
WIPO (PCT)
Prior art keywords
antigen
fusion protein
influenza
ligand
protein
Prior art date
Application number
PCT/US2006/043164
Other languages
French (fr)
Other versions
WO2007056266A3 (en
Inventor
Yucheng Tang
Albert Deisseroth
Original Assignee
Sidney Kimmel Cancer Center
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Sidney Kimmel Cancer Center filed Critical Sidney Kimmel Cancer Center
Priority to JP2008539106A priority Critical patent/JP2009514536A/en
Priority to AU2006311752A priority patent/AU2006311752A1/en
Priority to EP06827550.2A priority patent/EP1951862B1/en
Priority to CA2628837A priority patent/CA2628837C/en
Publication of WO2007056266A2 publication Critical patent/WO2007056266A2/en
Publication of WO2007056266A3 publication Critical patent/WO2007056266A3/en

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/12—Viral antigens
    • A61K39/145—Orthomyxoviridae, e.g. influenza virus
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/12—Viral antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04—Antibacterial agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70575—NGF/TNF-superfamily, e.g. CD70, CD95L, CD153, CD154
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/525—Virus
    • A61K2039/5256—Virus expressing foreign proteins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53—DNA (RNA) vaccination
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/55—Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/575—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 humoral response
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/58—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
    • A61K2039/585—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031—Proteins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/385—Haptens or antigens, bound to carriers
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/06—Fusion polypeptide containing a localisation/targetting motif containing a lysosomal/endosomal localisation signal
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/10011—Adenoviridae
    • C12N2710/10034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/10011—Adenoviridae
    • C12N2710/10041—Use of virus, viral particle or viral elements as a vector
    • C12N2710/10043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/10011—Adenoviridae
    • C12N2710/10311—Mastadenovirus, e.g. human or simian adenoviruses
    • C12N2710/10341—Use of virus, viral particle or viral elements as a vector
    • C12N2710/10343—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/20011—Papillomaviridae
    • C12N2710/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011—Details
    • C12N2760/16011—Orthomyxoviridae
    • C12N2760/16111—Influenzavirus A, i.e. influenza A virus
    • C12N2760/16122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011—Details
    • C12N2760/16011—Orthomyxoviridae
    • C12N2760/16111—Influenzavirus A, i.e. influenza A virus
    • C12N2760/16134—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

Definitions

  • the present invention relates generally to the field of vaccines.
  • the present invention relates to the use of fusion proteins of CD40 ligand and an antigen in developing immunity to foreign proteins or infectious agents.
  • Influenza is an acute contagious illness often characterized by inflammation of the respiratory tract, fever, chills, muscular pain, prostration and maliase and is caused by the Orthomyxoviridae family of influenza viruses. Infection can cause mild to severe illness, and at times can lead to death.
  • Influenza viruses are classified into three types: Types A, B, and C.
  • Type A influenzas have been responsible for pandemics, spreading over a wide geographic area and affecting a large proportion of the population.
  • Type A influenza viruses are known to infect many animals including birds and mammals ⁇ e.g., humans, dogs, horses, cattle, sheep, pigs and seals).
  • type B influenzas tend usually to infect only humans.
  • Type A and B influenzas are responsible for the increased flu- related illnesses, hospitalizations and deaths that occur each year.
  • Type C influenzas tend to be the least worrisome. Infection in humans may cause mild respiratory distress or no symptoms at all.
  • Type A influenza viruses are further classified by strain.
  • the strain name is determined by identifying differences between two antigenic proteins, hemagglutinin ("HA”) and neuraminidase (“NA”), both present on the viral surface. Rapid alterations in the sequence of these two proteins (termed “antigenic shift”) are mainly responsible for the yearly changes in immunogenicity and the requirement for new vaccines each year. Examples of antigenic shift and the concomitant strain change are clear: between 1918 and 1957, the HlNl strain was dominant; between 1957 and 1968, the H2N2 strain was dominant; then, since 1968, the H3N2 virus dominated. Most recently, in 1997, the H5N1 strain of avian influenza was shown to infect humans.
  • antigenic drift the slow, gradual process of viral evolution.
  • Antigenic variation (drift) of HA sequences is noted, for example, in human trials with the escape of viral strains from vaccine induced immunity.
  • Hemagglutinin is an antigenic glycoprotein found on the surface of influenza viruses.
  • HA functions to secure the virus to the target cells by binding to N-acetyl neuraminic acid or sialic acid on host cell receptors.
  • HA is composed of two subunits, HAl and HA2.
  • HA2 is the viral membrane anchoring domain, while HAl is responsible for binding host cell receptors.
  • HA is highly mutable and variations, mainly in HAl, are a key source of viral antigen variability conferring the ability to evade the immune system.
  • Hl, H2 and H3 have been the dominant human influenza subtypes, while the H5 and H7 subtypes have been prevalent for avian species.
  • Neuraminidase (“NA”) is also presented on the viral surface and functions to catalyze the removal of terminal sialic acid residues of glycosyl groups, thus destroying potential receptors for hemagglutinin. It is probable that neuraminidase is required to prevent viral aggregation and to promote more efficient spreading of the virus from cell to cell.
  • the neuraminidase protein sequence is also highly variable; there are currently nine different neuraminidase varieties known. Accordingly, changes in this protein sequences also play a role in antigenic shift.
  • M2 Matrix protein 2
  • the M2 protein is homotetramer comprised of three domains: a 23 amino-acid region present on the outside of the virus (extra cellular domain), a 54 amino acid region that is inside the virus (cytoplasmic domain) and a 19 amino-acid transmembrane domain. M2 is expressed at low levels on the viral surface but is present at high levels on influenza infected cells. The M2 protein sequence is stable compared to hemagglutinin or neuraminidase.
  • the 23 -amino acid extra cellular domain of M2 is well conserved in many known influenza strains (some exceptions include A/PR/8/34, A/Brevig and Mission/1/8). Although this protein is not immunogenic normally, it has been shown that chimeric molecules made from the extra cellular domain of the M2 and "adjuvant proteins" such as the hepatitis B core protein induce a potent immune response (Virology 2005 337:149-161; Infection and Immunity 2002 70:6860-70).
  • M2HB core particle protected 2-4 month old BaIbC mice from challenge with human influenza virus (Virology 2005 337:149-161).
  • adjuvants such as a detoxified enterotoxin adjuvant
  • M2 which is important in determining host range (J. Virology 1999 73:3366-3374), is present at such low levels in the virus that antibodies are not generated.
  • HA has been the target for vaccines since the antibodies to HA have been shown to prevent influenza viral infection.
  • the H5N1 strain has been reported to infect humans (J. Virology 2000 74:1443-1450). It is estimated that if this virus acquires the capability of spreading from human to human, there impact in the USA will be over 200,000 deaths, over 700,000 hospitalizations, over 40 million outpatient visits, and an economic impact of over 100 billion dollars (Infect. Dis. 1999 5:659-671). The recent apparent trend for increased reporting deaths of individuals believed infected with the avian flu virus has created concern among governments around the world (J. Virology 2004 78:9499- 9511; J. Emerg. Infect. Dis. 2004 10; Virology 2003 208:270-278; Eur. J. Biochem. 1999 260:166-175).
  • the H9N2 study involves a cold- adapted resorted attenuated viral vaccine which is administered by intramuscular injection. It is hoped that this study will provide insight into an H5N1 immune response. Additionally, an intramuscularly administered vaccine from baculovirus expressing H5 HA was tested in 147 adults. A 23% antibody response was observed after a single injection and 52% response after two injections ⁇ Lancet 2004 357:1937- 1943).
  • the elderly are especially at risk with respect to influenza infection, and vaccination against influenza is recommended for older individuals to prevent the potentially deadly complications of infection such as pneumonia or bronchitis.
  • One cause of increased risk in the elderly is the decrease in function of the immune system with age. For example, there is a decrease in the number of na ⁇ ve, antigen unexposed CD4 and CD8 T cells. Additionally, the ratio of the na ⁇ ve to memory CD8/CD4 cells decreases as the chronological age increases.
  • the fusion protein is administered as an expression vector containing DNA encoding the fusion protein.
  • the fusion protein is directly administered as a protein.
  • Vaccination regimens wherein vector and protein are administered are also provided.
  • an immune response to an influenza antigen is achieved by administering an expression vector encoding a secretable fusion protein which includes an influenza antigen and CD40 ligand.
  • the influenza antigen may be any influenza antigen to which an immune response may be generated in an individual or animal.
  • the influenza antigen is an mammalian influenza virus antigen (such as a human influenza antigen) or an avian influenza virus antigen.
  • the influenza antigen may be a combination of mammalian and avian influenza virus antigens, such as a combination of human and avian influenza virus antigens.
  • the influenza antigen is preferably an influenza viral protein, or fragment thereof, which comprises at least one antigenic determinant.
  • the influenza antigen of the fusion protein is the matrix protein 2 ("M2") ion channel protein.
  • M2 protein which is a tetrameric 23 amino acid long type III transmembrane protein involved in tropism of the virus, is barely detectable on the influenza virus but is expressed at high levels on influenza virus infected cells. In contrast to the HA protein, the M2 has a stable sequence from year to year among different influenza strains.
  • the invariant nature of the M2 antigen when fused to CD40 ligand in the present vaccine design will provide a "universal" influenza vaccine that, unlike current vaccines, will be effective against different strains of influenza resulting from antigenic drift. This is especially important in that there may not be time to prepare a vaccine against a known unique HA antigen for the avian influenza virus once a pandemic occurs, as there is each year for the human influenza reassorted virus.
  • the M2 antigen of the fusion protein lacks all or substantially all of the M2 transmembrane domain.
  • the M2 antigen of the fusion protein includes all of the extracellular domain of M2 or at least an antigenic fragment of the extracellular domain of M2.
  • the influenza antigen may be a chimeric influenza antigen having at least one antigenic determinant from at least two viral influenza proteins.
  • Such different antigens may be variants of the same antigen (e.g. hemagglutinins from different virus strains, e.g. from H5N1, H2N2, H3N2 or HlNl strains) or a chimeric influenza antigen having at least one antigenic determinant from at least two different viral influenza proteins (e.g. HA and M2).
  • the influenza antigen may be a viral protein or fragment thereof.
  • the viral protein or fragment may be a hemagglutinin ("HA"), a neuraminidase ("NA”), an M2 or any combination of HA, NA or M2.
  • the influenza antigen may comprise: an extracellular domain or domain fragment of the viral antigen (e.g., HA, NA or M2); a cytoplasmic domain or domain fragment; or a combination of extracellular and cytoplasmic sequences from the same protein.
  • an "antigen" is any foreign material that is specifically bound by the combining site of an antibody or by the combining site of a T cell antigen receptor. Antigens may also be immunogens if they are able to trigger an immune response, or haptens if not.
  • the fusion protein encoding an influenza antigen may be administered before, concurrently or after administration of the vector.
  • the fusion protein is administered after the vector.
  • the sequence of the influenza antigen encoded by the vector and that present in the fusion protein may be identical or may be different. If different, the two preferably have at least one antigenic determinant in common.
  • the sequence encoding the influenza antigen in the fusion protein transcription unit is 5' to sequence encoding the CD40 ligand.
  • the sequence encoding the CD40 ligand in the fusion protein transcription unit is 5' to sequence encoding the influenza antigen.
  • the CD40 ligand lacks all or a portion of its transmembrane domain.
  • the invention provides methods of immunizing an individual against infection by an influenza virus.
  • the method includes administering an expression vector which includes a transcription unit encoding a secretable fusion protein that contains an influenza antigen associated and CD40 ligand.
  • a fusion protein that encodes an influenza antigen associated with the virus and CD40 ligand may also be administered before, concurrently or after administration of the vector.
  • the fusion protein is administered after the vector.
  • the influenza antigen which is encoded by the vector is chosen to cross-react with the influenza virus for which protection is being sought.
  • the immune response generated by this approach is both cell mediated and humoral (i.e. antibody response). The antibody response can neutralize infectious influenza virus.
  • the expression vector may be a viral expression vector or a non- viral expression vector; the expression vector may be an adenoviral vector; the vector may be advantageously administered subcutaneously; the vector may be administered on a subsequent occasion(s) to increase the immune response; a signal sequence may be placed upstream of the fusion protein for secretion of the fusion protein; immunity against the antigen may be long lasting and involve generation of cytotoxic CD8 + T cells against antigen expressing cells and the production of antibody to the antigen; the transcription unit may include sequence that encodes a linker between the antigen and the CD40 ligand; suitable linkers may vary in length and composition; the expression vector may include a human cytomegalovirus promoter/enhancer for controlling transcription of the transcription unit; and the CD40 ligand may be a human CD40 ligand.
  • the invention provides methods of effectively immunizing older individuals by administering an expression vector encoding a secretable fusion protein which includes an antigen and CD40 ligand.
  • Older individuals which may realize an improved immune response using the methods of the invention as compared to other immunization methods are at least 50 years of age, or even at least 55 years of age or even yet at least 60 years of age.
  • antigens which are fused to CD40 ligand.
  • antigen include cancer antigens (tumor associated or tumor specific) or infectious agent antigens.
  • infectious agent antigens may be bacterial, viral, fungal, protozoan, and the like.
  • Viral antigens may be an influenza antigen as described above.
  • the viral antigen may be from a human papilloma virus.
  • the viral antigen may be the E6 or E7 protein of human papilloma virus.
  • CD40L CD40 ligand
  • an expression vector in accordance with the methods of the invention is believed to result in in vivo activation and antigen loading of dendritic cells (DCs) following release of the fusion protein from vector infected cells.
  • DCs dendritic cells
  • the loading of DC with the CD40 ligand from the fusion protein bypasses the CD4 cell of older individuals which are deficient in CD40L. It has been found that two sc injections of this vaccine vector induces an immune response that last for over a year and which is independent of CD4 cells.
  • a method of increasing the immune responsiveness of an individual having CD4 T cells exhibiting reduced levels of CD40 ligand as compared to young, healthy individuals to vaccination against a cancer antigen or an infectious agent antigen is accomplished by administering to the individual an effective amount of an expression vector having a transcription unit encoding a secretable fusion protein, having a cancer or infectious agent antigen and CD40 ligand.
  • Abbreviations used herein include “Ad” (adenoviral); “sig” (signal sequence); and “ecd” (extra cellular domain); “sc” (subcutaneous).
  • FIG. 1 shows an amino sequence of an M2 protein from an H5N1 influenza virus (GenBank Accession No. AF036358, SEQ ID NO:1).
  • FIG. 3 shows an amino sequence of an M2 protein from an H3N2 influenza virus (GenBank Accession No. AAA43276, SEQ ID NO:3)
  • FIG. 4 shows an amino sequence of an HA protein from an H3N2 influenza virus (GenBank Accession No. VOl 085, SEQ ID NO:4).
  • FIG. 5 shows a nucleotide sequences encoding A) a fragment of an HA protein from an H5N1 influenza virus, and B) a fragment of an M2 protein from an H5N1 influenza virus. (SEQ ID NOs:5 and 6, respectively)
  • FIG. 6 depicts the growth of E7-positive TC-I and E7-negative EL-4 cells in Ad-sig-E7/ecdCD40L vector vaccinated mice. E7 -positive TC-I cells (diamonds); E7-negative EL-4 cells (squares).
  • FIG. 7 depicts growth of E7-positive TC-I cells versus E7-negative EL-4 cells in mice injected with splenic T lymphocytes from donor mice vaccinated with Ad-sig-E7/ecdCD40L vector.
  • FIG. 9 depicts the level of E7-specif ⁇ c T cell response after injection of different vector constructs.
  • FIG. 10 shows the levels of splenocytes producing interferon-gamma and IL4 in Ad-sig-E7/ecdCD40L vector vaccinated and unvaccinated young and old mice.
  • FIG. 11 shows the percentage of antigen specific T cells in the CD8 population antigen positive tumor of old animals unimmunized (control) and immunized with Ad-sig-E7/ecdCD40L vector.
  • FIG. 13 depicts cytotoxic T cell activity at various effector to target ratios induced by Ad-sig-E7/ecdCD40L vector vaccination of young and old mice.
  • FIG. 14 depicts the suppression of E7 tumor growth in old and young Ad- sig-E7/ecdCD40L vector vaccinated mice.
  • FIG. 15 depicts the percentage of E7 tumor free mice after vaccination with the Ad-sig-E7/ecdCD40L vector and protein boost in old and young mice.
  • FIG. 16 shows the percentage of FoxP3 regulatory CD4+ cells among tumor infiltrating lymphocytes in the tumor before (control) and after vaccination (old) of old (18 month) mice with Ad-sig-E7/ecdCD40L vector.
  • FIG. 17 shows the percentage of effector CD8+ cells in tumor nodules of rH2n.Tg (i.e., HER2 transgenic) mice injected with Ad-sig-rH2N/ecd ⁇ Ct ⁇ TmCD40L vector.
  • FIG. 18 depicts the level of H5HA-specific CD8 T cells in the spleen of Ad- sig-H5HA/ecdCD40L vaccinated mice compared to unvaccinated mice via ELISA spot assay interferon gamma detection.
  • FIG. 19 depicts an exemplary amino acid sequence of neuraminidase H5N1 (FIG. 19A) and the encoding nucleotide sequence (FIG. 19B) of GenBank ID No. g2865377 (SEQ ID NO:7 and SEQ ID NO:8, respectively).
  • FIG. 20 depicts an exemplary amino acid sequence of an HA from H5N1 (SEQ ID NO:9; GenBank ID g2865380). Underlined are residues reported to be involved in receptor binding.
  • FIG. 21 depicts an exemplary precursor HA molecule from strain H3N2 (GenBank Accession No. V01086; SEQ ID NO:10). Underlined and italicized sequence is involved in receptor binding or represents an epitope against which neutralizing antibodies have been generated.
  • FIG. 22 depicts an exemplary amino acid sequence of neuraminidase from influenza A virus strain A/Memphis/31/98 (H3N2), GenBank ID g30385699 (SEQ ID NO: 11). Residues reported to be mutated in known escape mutants are shown underlined in bold. The extracellular domain is shaded.
  • FIG. 23 depicts the level of H5HA-specific CD8 T cells in a preparation of splenocytes from Ad-sig-H5HA/ecdCD40L vaccinated old and young mice compared to unvaccinated mice, as determined by via ELISpot assay interferon gamma detection.
  • FIG. 24 demonstrates the presence of antibodies against HA in serum of old and young mice following vaccination with Ad ⁇ sig-H5HA/ecdCD40L vector followed by three protein boosts of HA/ecdCD40L fusion protein.
  • FIG. 25 depicts the level of M2-specific CD8 T cells in a preparation of splenocytes from Ad-sig-H5M2/ecdCD40L vaccinated old and young mice compared to unvaccinated mice, as determined by via ELISpot assay interferon gamma detection.
  • FIG. 26 demonstrates the presence of antibodies against M2 in serum of old and young mice following vaccination with Ad-sig-H5M2/ecdCD40L vector followed by two protein boosts of M2/ecdCD40L fusion protein.
  • FIG. 27 depicts the level of E7-specific CD8 T cells in a preparation of splenocytes from 2 month old mice ("Young") vaccinated according to the V, VP, VPP, or VPPP vaccination regimens wherein "V” means to administer the Ad-sig- E7/ecdC40L and "P” means to administer the E7/ecdCD40L protein.
  • FIG. 29 depicts the level of E7-specif ⁇ c CD8 T cells in a preparation of splenocytes from 18 month old mice ("Old") vaccinated according to the V, VP, VPP, or VPPP vaccination regimens wherein "V” means to administer the Ad-sig- E7/ecdC40L and "P” means to administer the E7/ecdCD40L protein.
  • FIG. 30 depicts the level of E7-specific antibody in serum from 18 month old mice ("Old") vaccinated according to the V, VP, VPP, or VPPP vaccination regimens wherein "V” means to administer the Ad-sig-E7/ecdC40L and "P” means to administer the E7/ecdCD40L protein.
  • FIG. 31 demonstrates the presence of antibodies against HA in serum of mice following a vaccination by three administrations of HA/ecdCD40L fusion protein.
  • FIG. 32 demonstrates the presence of antibodies against M2 in serum of mice following vaccination by three administrations of M2/ecdCD40L fusion protein.
  • a method for generating an immune response against an influenza antigen using an expression vector and/or the fusion protein encoded thereby.
  • the vector includes a transcription unit encoding a secretable fusion protein containing the influenza antigen and CD40 ligand.
  • the transcription unit includes from the amino terminus, a secretory signal sequence, the influenza antigen, a linker and a secretable form of CD40 ligand.
  • the secretable form of CD40 ligand lacks all or substantially all of its transmembrane domain.
  • the individual is first administered the vector on one or more occasions to generate a primary immune response.
  • a fusion protein having the influenza antigen and CD40 ligand protein is also administered in an effective amount after administration of vector to boost the immune response to the antigen above that obtained with vector administration alone.
  • the term "in an effective amount" in reference to administering the fusion protein is an amount that generates an increased immune response over that obtained using the expression vector alone.
  • a time interval between administrations is generally required for optimal results.
  • An increase in the immune response may be measured as an increase in T cell activity or antibody production.
  • at least one week between vector administration and protein boosting is effective although a shorter interval may be possible.
  • An effective spacing between administrations may be from 1 week to 12 weeks or even longer. Multiple boosts may be given which may be separated by from 1-12 weeks or even longer periods of time.
  • the fusion protein may be produced in a variety of cell systems.
  • the antigen is desired to be glycosylated.
  • a cell system that produces glycosylated proteins can be used, such as a eukaryotic cell, preferably a mammalian cell.
  • Exemplary cell systems include CHO cells, COS cells, and MDCK cells.
  • Avian cells may also be used when avian-specif ⁇ c glycosylation is desired.
  • glycosylation of the foreign protein portion of the fusion protein may be avoided by producing the fusion protein synthetically or by using a non- glycosylation system such as a bacterial expression system.
  • the fusion protein may be prepared in a mammalian cell line system, which is complementary to the vector.
  • the cell line system can be 293 cells that contain the Early Region 1 (El) gene and can support the propagation of the El -substituted recombinant adenoviruses.
  • El Early Region 1
  • the viral vectors will propagate themselves following the viral replication cycles.
  • the gene of interest that is carried by the viral vector in the expression cassette will express during the viral propagation process.
  • This can be utilized for preparation of the fusion protein encoded by the vector in the same system for production of the vector.
  • the production of both the vector and the fusion protein will take place simultaneously in the production system.
  • the vector and protein thus produced can be further isolated and purified via different processes.
  • the fusion protein may also be prepared in non-mammalian cells, such as bacterial cells.
  • cDNA encoding the fusion protein can be subcloned into a vector such as pTriEx Hygro (Novagen, Inc.) and transfected into E. coli (e.g., Rosetta cells from Novagen, Inc.) where the fusion protein is produced.
  • Other non- mammalian cells include yeast, algae, insect, and plant cells.
  • the fusion protein may be administered parenterally, such as intravascularly, intravenously, intraarterially, intramuscularly, subcutaneously, or the like. Administration can also be orally, nasally, rectally, transdermally or inhalationally via an aerosol.
  • the protein boost may be administered as a bolus, or slowly infused. The protein boost is preferably administered subcutaneously.
  • the fusion protein boost may be formulated with an adjuvant to enhance the resulting immune response.
  • adjuvant means a chemical that, when administered with the vaccine, enhances the immune response to the vaccine.
  • An adjuvant is distinguished from a carrier protein in that the adjuvant is not chemically coupled to the immunogen or the antigen.
  • Adjuvants are well known in the art and include, for example, mineral oil emulsions (U.S. Pat. No. 4,608,251, supra) such as Freund's complete or Freund's incomplete adjuvant (Freund, Adv. Tuberc. Res.
  • the fusion protein can be administered in a microencapsulated or a macroencapsulated form using methods well known in the art.
  • Fusion protein can be encapsulated, for example, into liposomes (see, for example, Garcon and Six, J. Immunol. 146:3697 (1991)), into the inner capsid protein of bovine rotavirus (Redmond et al., MoI. Immunol. 28:269 (1991)) into immune stimulating molecules (ISCOMS) composed of saponins such as Quil A (Morein et al., Nature 308:457 (1984)); Morein et al., in Immunological Adjuvants and Vaccines (G. Gregoriadis al.
  • the fusion protein also can be adsorbed to the surface of lipid microspheres containing squalene or squalane emulsions prepared with a PLURONIC block- copolymer such as L-121 and stabilized with a detergent such as TWEEN 80 (see Allison and Byers, Vaccines: New Approaches to Immunological Problems (R. Ellis ed.) pp. 431-449, Butterworth-Hinemann, Stoneman N.Y. (1992)).
  • a microencapsulated or a macroencapsulated fusion protein can also include an adjuvant.
  • the fusion protein also may be conjugated to a carrier or foreign molecule such as a carrier protein that is foreign to the individual to be administered the protein boost.
  • Foreign proteins that activate the immune response and can be conjugated to a fusion protein as described herein include proteins or other molecules with molecular weights of at least about 20,000 Daltons, preferably at least about 40,000 Daltons and more preferably at least about 60,000 Daltons.
  • Carrier proteins useful in the present invention include, for example, GST, hemocyanins such as from the keyhole limpet, serum albumin or cationized serum albumin, thyroglobulin, ovalbumin, various toxoid proteins such a tetanus toxoid or diphtheria toxoid, immunoglobulins, heat shock proteins, and the like.
  • Methods to chemically couple one protein to another (carrier) protein are well known in the art and include, for example, conjugation by a water soluble carbodiimide such as l-ethyl-3-(3dimethylaminopropyl)carbodiimide hydrochloride, conjugation by a homobifunctional cross-linker having, for example, NHS ester groups or sulfo-NHS ester analogs, conjugation by a heterobifunctional cross-linker having, for example, and NHS ester and a maleimide group such as sulfosuccinimidyl-4-(N-maleimidomethyl) cyclohexane-1 -carboxylate and, conjugation with gluteraldehyde (see, for example, Hermanson, Bioconjugate Techniques, Academic Press, San Diego, Calif. (1996)); see, also, U.S. Pat. Nos. 4,608,251 and 4, 161,519).
  • a water soluble carbodiimide
  • cells is used expansively to encompass any living cells such as mammalian cells, plant cells, eukaryotic cells, prokaryotic cells, and the like.
  • adenoviral expression vector refers to any vector from an adenovirus that includes exogenous DNA inserted into its genome which encodes a polypeptide. The vector must be capable of replicating and being packaged when any deficient essential genes are provided in trans.
  • An adenoviral vector desirably contains at least a portion of each terminal repeat required to support the replication of the viral DNA, preferably at least about 90% of the full ITR sequence, and the DNA required to encapsidate the genome into a viral capsid.
  • Many suitable adenoviral vectors have been described in the art. See U.S. Patent nos. 6,440,944 and 6,040,174 (replication defective El deleted vectors and specialized packaging cell lines).
  • a preferred adenoviral expression vector is one that is replication defective in normal cells.
  • Adenoviral expression vectors may include vectors that have been modified to better target and infect specific cell types (e.g., fibroblasts and dendritic cells), or that have been modified to avoid neutralization by pre-existing, high-titer antibodies, such as the antibodies circulating in humans against Ad5 and Ad2.
  • Adeno-associated viruses represent a class of small, single-stranded DNA viruses that can insert their genetic material at a specific site on chromosome 19. The preparation and use of adeno-associated viral vectors for gene delivery is described in U.S. Patent no. 5,658,785.
  • Non- viral vectors for gene delivery comprise various types of expression vectors (e.g., plasmids) which are combined with lipids, proteins and other molecules (or combinations of thereof) in order to protect the DNA of the vector during delivery.
  • Fusigenic non- viral particles can be constructed by combining viral fusion proteins with expression vectors as described.
  • Kaneda CurrDrug Targets (2003) 4(8):599- 602.
  • Reconstituted HVJ (hemagglutinating virus of Japan; Sendai virus)-liposomes can be used to deliver expression vectors or the vectors may be incorporated directly into inactivated HVJ particles without liposomes. See Kaneda, Curr Drug Targets (2003) 4(8):599-602.
  • DMRIE/DOPE lipid mixture are useful a vehicle for non-viral expression vectors. See U.S. 6,147,055. Polycation-DNA complexes also may be used as a non- viral gene delivery vehicle. See Thomas et al., Appl Microbiol Biotechnol (2003) 62(l):27-34.
  • transcription unit as it is used herein in connection with an expression vector means a stretch of DNA that is transcribed as a single, continuous mRNA strand by RNA polymerase, and includes the signals for initiation and termination of transcription.
  • a transcription unit of the invention includes nucleic acid that encodes from 5' to 3,' a secretory signal sequence, an influenza antigen and CD40 ligand.
  • the transcription unit is in operable linkage with transcriptional and/or translational expression control elements such as a promoter and optionally any upstream or downstream enhancer element(s).
  • a useful promoter/enhancer is the cytomegalovirus (CMV) immediate-early promoter/enhancer. See U.S. Patents no. 5,849,522 and 6,218,140.
  • secretory signal sequence refers to a short peptide sequence, generally hydrophobic in charter, including about 20 to 30 amino acids which is synthesized at the N-terminus of a polypeptide and directs the polypeptide to the endoplasmic reticulum.
  • the secretory signal sequence is generally cleaved upon translocation of the polypeptide into the endoplasmic reticulum.
  • Eukaryotic secretory signal sequences are preferred for directing secretion of the exogenous gene product of the expression vector.
  • suitable such sequences are well known in the art and include the secretory signal sequence of human growth hormone, immunoglobulin kappa chain, and the like.
  • the endogenous tumor antigen signal sequence also may be used to direct secretion.
  • antigen refers broadly to any antigen to which a human, mammal, bird or other animal can generate an immune response.
  • Antigen refers broadly to a molecule that contains at least one antigenic determinant to which the immune response may be directed. The immune response may be cell mediated or humoral or both.
  • an antigen may be protein in nature, carbohydrate in nature, lipid in nature, or nucleic acid in nature, or combinations of these biomolecules.
  • an antigen may be native, recombinant or synthetic.
  • an antigen may include non-natural molecules such as polymers and the like.
  • Antigens include both self antigens and non-self antigens. "Self antigens include antigens encoded by the host's genome. Self antigens include those variant sequences that arise through natural recombination events in the host genome. For example, the variable regions of immunoglobulin genes recombine in many combinations to produce a large diversity in immunoglobulins.
  • Other self antigens may include proteins that are overexpressed or underexpressed in disease states such as cancer. For example, various mucin isoforms are overexpressed in certain cancer types.
  • Foreign antigens refer to non-self antigens.
  • Foreign antigens may be the products of or encoded by the genome of other organisms.
  • a foreign antigen to a mammal can be an antigen encoded by an infectious agent such as a microbe.
  • Infectious agent antigens may be bacterial, viral, fungal, protozoan, and the like.
  • infectious agent antigens may be bacterial, viral, fungal, protozoan, and the like.
  • infectious agent antigens may be bacterial, viral, fungal, protozoan, and the like.
  • infectious agent antigens may be bacterial, viral, fungal, protozoan, and the like.
  • infectious agent antigens may be bacterial, viral, fungal, protozoan, and the like.
  • infectious agent antigens may be bacterial, viral, fungal, protozoan, and the like.
  • influenza virus refers to any of the influenza virus Types A, B and C that can infect mammals or birds.
  • hemagglutinin is a major glycoprotein that comprises over 80% of the envelope proteins present in the influenza virus particle. Hemagglutinin binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. Hemagglutinin also is responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induce an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide.
  • hemagglutinin refers to the full length protein and fragments thereof which share at least one antigenic determinant with full length hemagglutinin.
  • Hemagglutinin as used herein may be native, recombinant or synthetic and may be post-translationally modified such as by glycosylation and/or palmitoylation.
  • Hl subtypes of hemagglutinin characterized antigenicly
  • Hemagglutinin is synthesized as a precursor of about 566 amino acids.
  • An exemplary amino sequence of an HA from an H5N1 virus is shown in FIG. 2 and an HA from an H3N2 virus is shown in FIG. 4.
  • the sequence of various hemagglutinins are found in protein and nucleotide databases such as SwissProt and GenBank. See, e.g., Swiss Prot accession nos. P03437, P03441, P19694, P19695, P12581, P07976, P07977, P09345, GenBank accession no. AF036356 (H5N1 virus); and VOl 085 (H3N2 virus). These databases notate the various functional domains of the HA protein.
  • SwissProt accession no. P03437 discloses a sequence of an H3 hemagglutinin. This molecule is synthesized as a 566 aa precursor. Amino acids 1- 16 represent a 16 aa signal sequence; 17-530 represents a 514 aa extracellular domain; 531-551 represents a 21 aa transmembrane domain; and 552-566 represents a 15 aa cytoplasmic domain. Nucleotide sequence encoding the extracellular domain of an HA is shown in FIG. 5a. The 566 amino acid precursor is exported to the cell membrane of influenza virus where it gets cleaved into the HAl and HA2 subunits.
  • the HAl subunit represents 17-344 of the HA precursor while the HA2 subunit represents 345-566 of the HA precursor.
  • the HA molecule has a large extracellular domain of about 500 aa.
  • a posttranslational cleavage by host-derived enzymes generates 2 polypeptides that remain linked by a disulfide bond.
  • the larger N- terminal fragment HAl which includes about 320-330 aa forms a membrane-distal globular domain (or head) of about 170 amino acids that contains the receptor-binding site and most antigenic determinants recognized by virus-neutralizing antibodies.
  • the smaller C-te ⁇ ninal portion HA2 which includes about 180 aa (excluding transmembrane and cytoplasmic domain) forms a stem-like structure that anchors the globular domain to the cellular or viral membrane.
  • the hinge region is located between the stem and globular domain.
  • HA subtypes have been currently identified among influenza A viruses; three of these (Hl, H2, H3) have been associated with classic influenza isolates, and 3 (H5, H7, H9) have been associated with recent sporadic human isolates.
  • Influenza B viruses possess only 1 HA subtype.
  • sequence for each HA and the positions of the various functional domains of the HA can differ and are easily determined by one skilled in the art.
  • the antigen is the entire extracellular domain of HA.
  • smaller regions of the extracellular domain may serve as the antigen for invention vaccines.
  • an antigen one of skill in the art would recognize that one could select an antigen that is recognized by MHC class II molecules to elicit an antibody ("humoral") response or an antigen that is recognized by MHC class I molecules to illicit a cytotoxic T cell ("cellular") response.
  • a region of the viral protein is chosen that encompasses antigens recognized by both MHC I and MHC II. Such a region may be a contiguous stretch of amino acids from the native protein or may include discontinuous regions linked together.
  • fragments of HA from the H5N1 strain of influenza are used as the influenza antigen.
  • the sequence set forth in SEQ ID NO: 9 represents an exemplary amino acid sequence of a precursor HA molecule from strain H5N1 (GenBank ID g2865380).
  • the extracellular domain of this sequence is from about amino acid 17 to 530. In some embodiments, the entire extracellular domain is used as the influenza antigen. In other embodiments, one or more fragments of the extracellular domain of HA are used. Preferred fragments of the extracellular domain of SEQ ID NO:9 are shown below. Further, there are a number of epitopes predicted to bind MHC class I or MHC class II molecules within this region. Exemplary predicted MHC class I epitopes and MHC class II epitopes are underlined and italicized, respectively, in the sequences below.
  • ATRPKVNGQSGRMEFFWTILK (SEQ ID NO: 18).
  • SYFPEITHI is a publicly available database for MHC ligands and peptide motifs is supported by DFG-Sonder Wunschs Kunststoff, 510 and the European Union: EU BIOMED CT95-1627, BIOTECH CT95-0263, and EU QLQ-CT- 1999-00713 (www. syfpeithi . de/S cripts/MHCS erver . dll/EpitopePrediction.htm) .
  • KSSWSNHDASSGVSSACPYLGRSSFFRNVVWLIKKNSAYPTATRPKVN GQSGRMEFFWTILK (SEQ ID NO:21), which represents SEQ ID NO: 15 immediately adjacent and upstream of SEQ ID NO: 18.
  • SEQ ID NO:21 represents SEQ ID NO: 15 immediately adjacent and upstream of SEQ ID NO: 18.
  • fragments of HA from the H3N2 strain of influenza are the influenza antigen.
  • the sequence set forth in SEQ ID NO: 10 and shown in FIG. 21 represents an exemplary amino acid sequence of a precursor HA molecule from strain H3N2 (GenBank ID Accession No. VOl 086).
  • the extracellular domain of this sequence is from about amino acid 17 to 530.
  • the extracellular domain of this sequence is from about amino acid 17 to 530.
  • the entire extracellular domain is used as the antigen in invention vaccines.
  • one or more fragments of the extracellular domain of HA are used.
  • Preferred fragments of the extracellular domain of SEQ ID NO: 10 are shown below.
  • fragments include those residues reported to be involved in receptor binding of a precursor HA molecule from strain H3N2 (SEQ ID NO: 10). Such residues are shown in FIG. 21 as underlined residues.
  • preferred fragments include, for example, EFINEG (SEQ ID NO:33).
  • a further preferred fragment is KAFSNCYPYDVPDY (SEQ ID NO:34) which has been shown to be an epitope against which neutralizing antibodies have been generated (Int Arch Allergy Immunol 2002 127:245-50).
  • NA neuraminidase
  • Neuraminidase catalyses the removal of terminal sialic acid residues of glycosyl groups, thereby destroying potential receptors for HA. It is believed that neuraminidase ensures the efficient spread of the virus by dissociating the mature virions from the neuraminic acid containing glycoproteins.
  • NA-specif ⁇ c antibodies inhibit the release of newly formed virus from infected host cells and thereby limit the spread and shedding of virus during infection.
  • Neuroneuraminidase refers to the full length protein and fragments thereof which share at least one antigenic determinant with full length neuraminidase.
  • Neuroaminidase as used herein may be native, recombinant or synthetic and may be post-translationally modified such as by glycosylation. There are currently at least nine neuraminidase sub-types.
  • Neuraminidase is synthesized as a precursor of about 469 amino acids. The sequence of various NA are found in protein and nucleotide databases such as Swiss- Prot and GenBank.
  • Amino acids 1-6 represent a 6 aa cytoplasmic domain; 7-35 represent a 29 aa transmembrane domain; and 36-469 represents a 434 aa extracellular domain.
  • the extracellular domain consists of a 55 aa hypervariable stalk region (amino acid residues 36 through 90) and a 379 aa head region (amino acid residues 91 through 469).
  • the sequence for each NA and the positions of the various functional domains of the NA can differ and are easily determined by one skilled in the art.
  • the influenza antigen is from the neuraminidase protein.
  • the entire extracellular domain of neuraminidase is used as the influenza antigen.
  • fragments of the extracellular domain may also be selected as the influenza antigen.
  • one of skill in the art can use any of a number of computer software programs for choosing antibody epitopes or antigens for MHC class I or MHC class II molecules, known in the art and discussed above.
  • the antigen is focused around regions of the neuraminidase protein known in the art to be antigenic and, more particularly, regions which include residues of known escape mutants.
  • Escape mutants are proteins which have a mutation in an antigenic region such that an antibody that previously bound to that region will no longer bind. In this way, such mutants escape or evade an immune response. In other embodiments, one or more fragments of the extracellular domain of NA are used.
  • the influenza antigen is neuraminidase from influenza virus A/Memphis/31/98, H3N2.
  • An exemplary sequence NA from H3N2 is set forth in SEQ ID NO: 11 (GenBank ID No. g30385699) and is shown in FIG. 22.
  • the extracellular domain of SEQ ID NO:11 is indicated in FIG. 22 (shaded region) and is the influenza antigen in some embodiments.
  • escape mutants have been described in the literature. For example, Gulati and coworkers describe escape mutants with mutations at amino acid positions 198, 199, 220, and 221 (underlined and in bold in FIG. 22) (J Virol 2002 76(23): 12274-80).
  • Preferred fragments of SEQ ID NO:11 are shown below.
  • ID NO:35 corresponds to the head region of NA
  • M2 is synthesized as a precursor of about 109 amino acids.
  • An exemplary amino sequence of an M2 from an H5N1 virus is shown in FIG. 1 and an M2 from an H3N2 virus is shown in FIG. 3.
  • the sequence of various M2 are found in protein and nucleotide databases such as SwissProt and GenBank. See, e.g., Swiss Prot accession nos. P13881, P13882, P03493, Q80DN6, P08383, P0C0X4, P21430, P03491, GenBank accession no. AF036358 (H5N1 virus); and AAA43276 (H3N2 virus). These databases annotate the various functional domains of the M2 protein. For example, SwissProt accession no.
  • P21430 discloses a sequence of an M2. This molecule is synthesized as a 97 aa precursor. Amino acids 1-22 represent a 22 aa extracellular domain; 23-43 represents a 21 aa transmembrane domain; and 44-97 represents an 54 aa cytoplasmic domain. Nucleotide sequence encoding the extracellular domain of an M2 is shown in FIG. 5b. The sequence for each M2 and the positions of the various functional domains of the M2 can differ and are easily determined by one skilled in the art. For example, M2 from Influenza B virus has a very short 4 aa extracellular domain.
  • influenza antigen refers to any part, portion or region of an influenza virus protein that can elicit an immune response in mammals or birds.
  • Influenza antigens can be native, recombinant or synthetic.
  • An "influenza antigen” may be include epitopes derived from a single viral type or strain or from multiple viral types or strains.
  • An “influenza antigen” may be a fusion protein of epitopes from the same or different viral types or strains.
  • an “influenza antigen” as used herein may include the HA, NA or M2 protein, or fragments thereof containing one or more epitopes; an “influenza antigen” may contain the entire extracellular domain of HA, NA or M2, the cytoplasmic domain of HA, NA or M2 and/or any immunogenic combination of these proteins or domains.
  • HA and M2 fragments are joined by an optional 2 amino acid linker (nucleotides encoding the linker are underlined in the sequence above).
  • the HA fragment precedes the linker and the M2 fragment follows the linker.
  • One of skill in the art would recognize that the order of these fragments could be reversed with the M2 fragment preceding the HA fragment.
  • An exemplary nucleotide sequence encoding such a fragment is below.
  • a chimeric influenza antigen includes fragments of HA and M2 (underlined) from H3N2 and is as follows,
  • IRNEWGCRCN DSSD (SEQ ID NO:45).
  • chimeras can be constructed from fragments of neuraminidase and M2 or HA.
  • the following sequence consists of the head region of neuraminidase and a the extracellular domain of M2 (underlined), both from H3N2.
  • M2 comprises one of the two fragments.
  • a fragment of HA from H5N1 is combined with an M2 fragment (underlined) from H3N2,
  • an "influenza antigen-CD40L” means an influenza protein linked to CD40L.
  • this may be an H3N2 or H5N1 HA antigen linked to CD40L; an H3N2 or H5N1 HA-M2 chimeric antigen linked to CD40L; or an H3N2 or H5N1 M2 linked to CD40L.
  • an "influenza antigen” as used herein refers to antigens expressed by an influenza virus and includes proteins or fragments from other Type A, B or C influenza viruses.
  • a secretable form of an antigen is one that lacks all or substantially all of its transmembrane domain, if present in the mature protein.
  • the transmembrane domain if present, is generally about 19-21 amino acids in length and functions to anchor the hemagglutinin or a fragment of the hemagglutinin in the cell membrane.
  • a secretable form of this hemagglutinin in which the transmembrane domain has been deleted is missing residues 531-551 of the precursor protein.
  • a hemagglutinin missing substantially all of the transmembrane domain is one where the domain comprises 6 residues or less of sequence at one end of the transmembrane domain, more preferably less than about 4 residues of sequence at one end of the transmembrane domain, even more preferably less than about 2 residues of sequence on one end of the transmembrane domain, and most preferably 1 residue or less on one end of the transmembrane domain.
  • the vaccine vector transcription unit encodes a secretable form of a hemagglutinin lacking the entire transmembrane domain.
  • a hemagglutinin that lacks substantially all of the transmembrane domain rendering the hemagglutinin secretable is one that contains no more than six residues of sequence on one end of the domain.
  • the extracellular domain of a human HA is denoted herein as "ecdHA.”
  • a hemagglutinin, neuraminidase or M2 protein which lacks a functional transmembrane domain may still include all or a portion of the cytoplasmic domain.
  • a source of DNA encoding the various hemagglutinins, neuraminidases or M2 antigens may be obtained from hemagglutinins, neuraminidases or M2 expressing cell lines using a commercial cDNA synthesis kit and amplification using a suitable pair of PCR primers that can be designed from the published DNA sequences.
  • Hemagglutinin, neuraminidase or M2 encoding DNA also may be obtained by amplification from RNA or cDNA obtained or prepared from infected human or other animal tissues or cells, or from viral isolates. For DNA segments that are not that large, the DNA may be synthesized using an automated oligonucleotide synthesizer.
  • Linkers may be up to about 50 amino acids, or up to about 100 amino acids. A linker of about 30 residues is preferred when the M2 or hemagglutinin antigen is N-terminal to the CD40 ligand.
  • linker well-known in the art is a 15 amino acid linker consisting of three repeats of four glycines and a serine (i.e., [GIy 4 SCr] 3 ).
  • CD40 ligand refers to a full length or portion of the molecule known also as CD 154 or TNF5.
  • CD40L is a type II membrane polypeptide having a cytoplasmic domain at its N-terminus, a transmembrane region and then an extracellular domain at its C-terminus.
  • CD40L full length CD40L
  • wtCD40L wtTmCD40L
  • ⁇ CtCD40L The form of CD40L in which the cytoplasmic domain has been deleted.
  • ⁇ TmCD40L The form of CD40L where the transmembrane domain has been deleted.
  • ⁇ Ct ⁇ TmCD40L The form of CD40L where both the cytoplasmic and transmembrane domains have been deleted is designated herein as " ⁇ Ct ⁇ TmCD40L” or “ecdCD40L.”
  • the nucleotide and amino acid sequence of CD40L from mouse and human is well known in the art and can be found, for example, in U.S. Patent No.
  • Human CD40L (hCD40L) is 261 amino acids in length.
  • the cytoplasmic domain of hCD40L extends approximately from position 1-22, the transmembrane domain extends approximately from position 23-46, while the extracellular domain extends approximately from position 47-261.
  • CD40 ligand is missing all or substantially all of the transmembrane domain rendering CD40 ligand secretable
  • the transmembrane domain of CD40L which contains about 24 amino acids in length, functions to anchor CD40 ligand in the cell membrane.
  • CD40L from which all of the transmembrane domain has been deleted is CD40 ligand lacking residues 23-46.
  • CD40L would contain, in addition to the extracellular domain and optionally the cytoplasmic domain, no more than amino acids 41-46 or 23-28, or a combination totaling 6 residues or less from both ends of the transmembrane domain of CD40L.
  • the vaccine vector transcription unit encodes a secretable form of CD40 containing less than 10% of the transmembrane domain. More preferably, CD40L contains no transmembrane domain.
  • Expression vectors encoding a secretable fusion protein that includes an influenza antigen and CD40 ligand can be constructed in accordance with methods known in the art. See, e.g., U.S. Patent Application Publication US 2005-0226888 (application serial No. 11/009,533) titled “Methods for Generating Immunity to Antigen,” filed 12/10/2004, which is incorporated herein in its entirety including the drawings.
  • an expression vector and fusion protein boost is administered as a vaccine to induce immunity to an influenza antigen.
  • the expression vector and protein boost may be formulated as appropriate with a suitable pharmaceutically acceptable carrier. Accordingly, the vectors or protein boost may be used in the manufacture of a medicament or pharmaceutical composition.
  • Expression vectors and the fusion protein may be formulated as solutions or lyophilized powders for parenteral administration. Powders may be reconstituted by addition of a suitable diluent or other pharmaceutically acceptable carrier prior to use. Liquid formulations may be buffered, isotonic, aqueous solutions. Powders also may be sprayed in dry form.
  • Suitable diluents are normal isotonic saline solution, standard 5% dextrose in water, or buffered sodium or ammonium acetate solution.
  • Such formulations are especially suitable for parenteral administration, but may also be used for oral administration or contained in a metered dose inhaler or nebulizer for insufflation. It may be desirable to add excipients such as polyvinylpyrrolidone, gelatin, hydroxy cellulose, acacia, polyethylene glycol, mannitol, sodium chloride, sodium citrate, and the like.
  • expression vectors and the fusion protein may be prepared for oral administration.
  • Pharmaceutically acceptable solid or liquid carriers may be added to enhance or stabilize the composition, or to facilitate preparation of the vectors.
  • Solid carriers include starch, lactose, calcium sulfate dihydrate, terra alba, magnesium stearate or stearic acid, talc, pectin, acacia, agar or gelatin.
  • Liquid carriers include syrup, peanut oil, olive oil, saline and water.
  • the carrier may also include a sustained release material such as glyceryl monostearate or glyceryl distearate, alone or with a wax.
  • the amount of solid carrier varies but, preferably, will be between about 20 mg to about 1 g per dosage unit.
  • the preparation may be in the form of a syrup, elixir, emulsion, or an aqueous or nonaqueous suspension.
  • Expression vectors and the fusion protein may be formulated to include other medically useful drugs or biological agents.
  • the vectors also may be administered in conjunction with the administration of other drugs or biological agents useful for the disease or condition that the invention compounds are directed.
  • an effective amount refers to a dose sufficient to provide concentrations high enough to generate (or contribute to the generation of) an immune response in the recipient thereof.
  • the specific effective dose level for any particular subject will depend upon a variety of factors including the disorder being treated, the severity of the disorder, the activity of the specific compound, the route of administration, the rate of clearance of the viral vectors, the duration of treatment, the drugs used in combination or coincident with the viral vectors, the age, body weight, sex, diet, and general health of the subject, and like factors well known in the medical arts and sciences.
  • the range of particles per administration typically if from about 1 X 10 7 to 1 X 10 n , more preferably 1 X 10 8 to 5 X 10 10 , and even more preferably 5 X 10 8 to 2 X 10 10 .
  • vectors encoding influenza antigens can induce a protective cellular and humoral immunity against such antigens, including those to which tolerance had developed.
  • the invention vaccines generate upon administration a continual local release of the fusion protein composed of the secretable form of the antigen linked to a secretory form of CD40 ligand. As demonstrated herein this facilitates DCs maturation, promoting the development of effective antigen-specific immunity.
  • the secretable fusion protein encoding the extracellular domain of H5N1 HA and the murine CD40L lacking a transmembrane and cytoplasmic domain (i.e.
  • H5HA- ⁇ Ct ⁇ TmCD40L produced from an adenoviral vector dramatically increased the number of CD8 T cells responsive to H5HA.
  • subcutaneous injection of the Ad-sig-H5HA - ⁇ Ct ⁇ TmCD40L vector elicits a strong HA specific CD8 + T cell- mediated immunity.
  • the immunity generated against the antigens using the invention methods is long lasting.
  • the term long lasting means that immunity elicited by the antigen encoded by the vector can be demonstrated for up to 6 months from the last administration, more preferably for up to 8 months, more preferably for up to one year, more preferably up to 1.5 years, and more preferably for at least two years.
  • Methods to test the novel influenza vaccines, proteins and vaccination methods of the present invention may include in vitro and in vivo methods well known in the art, method as described herein, and may also involve methods utilizing mouse models and viruses that have been mouse adapted.
  • the laboratories of M.K. Sim and Vincent Chow at the National University of Singapore's School of Medicine have developed a mouse model for the study of the Ad-sig- H3N2/ecdCD40L vaccine against H3N2 influenza A virus.
  • the A/Aichi/2/68 (H3N2) strain was mouse-adapted by passaging through several batches of 2 month old mice via intranasal administration.
  • the invention provides methods of effectively immunizing older individuals by administering an expression vector encoding a secretable fusion protein which includes an antigen and CD40 ligand.
  • Older individuals which may realize an improved immune response using the methods of the invention as compared to other immunization methods are at least 50 years of age, or even at least 55 years of age or even yet at least 60 years of age.
  • the invention methods are advantageous over traditional vaccination in providing increased immune responses in older individuals.
  • the benefits of immunizing older individuals, at least 50 years of age, or event at least 55 years of age or even at least 60 years of age is afforded for antigens including cancer antigens (tumor associated or tumor specific) or infectious agent antigens.
  • TAA tumor associated antigen
  • TAA tumor associated antigen
  • a variety of TAA are described that can be used in the invention methods for immunizing older individuals are described in U.S. Patent Application Publication US 2005-0226888 (application serial No. 11/009,533) titled “Methods for Generating Immunity to Antigen,” filed 12/10/2004.
  • the patent publication describes various mucin TAA including MUCl and tandem repeats of the mucin VNTR region, and HER2 (neu).
  • Other TAA include but are not limited to carcinoembryonic antigen, prostate specific antigen, CA 125, CA 15-3, and EFGr.
  • adenoviral expression vectors (general considerations) [0156] Details for constructing adenoviral expression vectors containing a transcription unit encoding a fusion protein that includes an antigen fused to CD40 ligand can be found in U.S. Patent Application Publication US 2005-0226888 (application serial No. 11/009,533) titled “Methods for Generating Immunity to Antigen,” filed 12/10/2004.
  • U.S. Patent Application Publication US 2005-0226888 also describes how to prepare a transcription unit that includes DNA encoding the signal sequence of the mouse IgG kappa chain gene upstream of DNA encoding human MUC-I ("sig- ecdhMUC-1").
  • the transcription unit is formed with the assistance of pShuttle - ⁇ Ct ⁇ TmCD40L (no signal sequence and murine CD40L) as described in U.S. Patent Application Publication US 2005-0226888.
  • Primers are used to encode spacer (linker) between the antigen and CD40L (a 10 residue spacer LEND AQ APKS; single letter code; SEQ ID NO:48).
  • the sig-ecdhMUCl/ ⁇ Ct ⁇ TmCD40L encoding DNA was cut from the pCDNA3TOPO vector using Hindlll-Xbal restriction and inserted into pShuttle-CMV (see Murphy et al., Prostate 38: 73-78, 1999) downstream of the CMV promoter.
  • U.S. Patent Application Publication US 2005-0226888 also describes cloning the mouse HSFl trimer domain which was added between the ecdhMUCl (antigen) encoding DNA and ⁇ Ct ⁇ Tm CD40L by PCR.
  • the construction design includes use of a spacer on each end of the trimer segment.
  • U.S. Patent Application Publication US 2005-0226888 also describes use of PCR to add a His tag encoding sequence added to the end of the ⁇ Ct ⁇ Tm CD40L.
  • the recombinant adenoviral vectors were generated using the AdEasy vector system (Stratagene, San Diego, CA). Briefly the resulting plasmid pShuttle-sig- ecdhMUCl- ⁇ Ct ⁇ TmCD40L, and other control adenoviral vectors were linearized with Pme I and co-transformed into E. coli strain BJ5183 together with pAdEasy-1, the viral DNA plasmid. Recombinants were selected with kanamycin and screened by restriction enzyme analysis.
  • E7 is a protein encoded by the human papilloma virus which appears on all HPV associated dysplastic and neoplastic cells.
  • the transcription unit included DNA encoding the signal peptide from the HGH gene, upstream of DNA encoding the full- length HPV type 16 E7 protein, consisting of 98 amino acids and having the following amino acid sequence:
  • the coding sequence for this E7 protein was upstream of the coding sequence of a 10 aa spacer, which was upstream of the coding sequence of the coding sequence of ⁇ Ct ⁇ TmCD40L in the transcription unit.
  • Plasmid pDC406-mCD40L was purchased from the American Type Culture Collection.
  • a pair of PCR primers (SEQ ID NOs: 50 and 51) was designed to amplify the mouse CD40 ligand from position 52 to 260 (i.e., without the cytoplasmic and transmembrane domains) and include sequence encoding a linker (indicated as "+ spacer ”) at the 5' end of the amplicon.
  • GAA GAG GAA GTA AAC-V (SEQ ID NO:50).
  • pShuttle-E7- ⁇ Ct ⁇ TmCD40L (no signal sequence) was prepared by inserting HPV- 16 E7 upstream of the CD40 ligand sequence as follows: Sequence encoding the full-length HPV- 16 E7 protein was obtained by PCR amplifying from the HPV viral genome using the following primers:
  • PCR was performed using the above primers and the HPV 16 viral genome as template under the following conditions: hold 3 min at 94 0 C; cycle 94 0 C for 40 sec, 58 0 C for 40 sec, 72 0 C for 40 sec (30 cycles); hold 7 min at 72 0 C; and hold at 4 0 C.
  • the resulting amplicon was HPV 16 E7 encoding DNA with Not I and Xho 1 restriction sites at the 5' and 3' ends, respectively.
  • the E7 DNA was inserted into the pShuttle-sp- ⁇ Ct ⁇ TmCD40L(no signal sequence) vector between the CMV promoter and directly 5' to the spacer of the spacer- ⁇ Ct ⁇ TmCD40L sequence using the Not I (GCGGCCGC) and Xho I (CTCGAG) restriction sites.
  • the resulting plasmid is designated pShuttle-E7- ⁇ Ct ⁇ TmCD40L(no signal sequence).
  • Synthetic HGH signal sequence was prepared by annealing the above upper and lower strand oligos.
  • the oligos were dissolved in 50 ⁇ l H 2 O (about 3 mg/ml). 1 ⁇ l from each oligo (upper and lower strand) was added to 48 ⁇ l annealing buffer (100 mM potassium acetate, 30 mM HEPES-KOH pH 7.4, and 2 mM Mg-acetate) incubated for 4 minutes at 95 0 C, 10 minutes at 7O 0 C and slowly cooled to about 4°C.
  • the annealed DNA was phosphorylated using T4 PNK (polynucleotide kinase) under standard conditions.
  • HGH signal sequence with BgI II and Not I overhangs was inserted via BgI II and Not I into pShuttle-E7-sp- ⁇ Ct ⁇ TmCD40L(no signal sequence) to yield pShuttle-HGH/E7-sp- ⁇ Ct ⁇ TmCD40L.
  • the transcription unit HGH/E7-sp- ⁇ Ct ⁇ TmCD40L encodes the HGH secretory signal followed by the full length HPV type 16 E7 followed by a 10 amino acid linker with (LEND AQ APKS; SEQ ID NO:48) followed by murine CD40 ligand residues 52-260.
  • a transcription unit that included DNA encoding the signal sequence of the mouse IgG kappa chain gene upstream of DNA encoding the full length HPV type 16 E7 protein (“K/E7”) was generated by PCR using HPVl 6 plasmid and the following primers:
  • K/E7 with the upstream kappa signal sequence was generated by four rounds of PCR amplification (1 st round: primers 4 +5; 2 nd round: add primer 3; 3 rd round: add primer 2; 4 th round: add primer 1).
  • the K/E7 encoding DNA was cloned into the pcDNATM 3.1 TOPO vector (Invitrogen, San Diego, CA) forming ⁇ cDNA-K/E7.
  • a DNA fragment that contained coding sequence for the 10 aa spacer upstream of mouse CD40 ligand from which the transmembrane and cytoplasmic domain had been deleted was generated from a mouse CD40 ligand cDNA plasmid, pDC406-mCD40L (American Type Culture Collection), using the following PCR primers:
  • Fragment sp- ⁇ Ct ⁇ TmCD40L was digested with Xba I and Xhol restriction endonucleases and then ligated into pcDNA-K/E7.
  • the K/E7-sp- ⁇ Ct ⁇ TmCD40L fragment was cut from the pcDNA vector and inserted into the pShuttle plasmid using Hind III and Xba I sites (pShuttle K/E7-s ⁇ - ⁇ Ct ⁇ TmCD40L).
  • the K/E7-s ⁇ - ⁇ Ct ⁇ TmCD40L fragment includes the kappa chain secretory signal followed by the full length HPV type 16 E7 followed by a 10 amino acid linker (LEND AQ APKS; SEQ ID NO:48) followed by murine CD40 ligand residues 52-260.
  • Adenoviral vector encoding a fusion protein with E7 upstream of full length mouse CD40L (with no intervening linker) was made using primers to amplify full length mouse CD40L using PCR. The following primers were used:
  • forward primer 5'- GAGAC CTCGAG CAGTCA GC ATGATAGA AACATACAGC CAACCTTCCC-3' (SEQ ID NO: 64);
  • Amplified DNA was initially subcloned into the pcDNA3-K/E7 vector with Xba I and Xhol restriction endonucleases.
  • the full length CD40L gene or ⁇ Ct ⁇ TmCD40L was directionally cloned into the pShuttle plasmid with the Hind III and Xba I sites.
  • a vector encoding an E7/human CD40 ligand fusion protein (pShuttle- HGH/E7-sp- ⁇ Ct ⁇ TmCD40L(human)) is described as follows. Primers for amplifying human ⁇ Ct ⁇ TMCD40L+ spacer using a human CD40 ligand cDNA template are set forth below. Human ⁇ Ct ⁇ TmCD40L+ spacer forward primer (HCD40LSPF) (CD40L sequence italicized):
  • PCR is performed using the above primers and the plasmid pDC406-hCD40L as template under the following conditions: hold 3 min at 94 0 C; cycle 94 0 C for 45 sec, 52 0 C for 45 sec, 72 0 C for 70 sec (30 cycles); hold 7 min at 72 0 C; and hold at 4 0 C.
  • This amplification results in the "-sp- ⁇ Ct ⁇ TmCD40L(human)" fragment, which encodes 44-261 of human CD40L and an amino terminal 10 aa spacer.
  • the forward primer HCD40LSPF encodes a 10 residue spacer (LEND AQ APKS; single letter code; SEQ ID NO:48) to be located between the tumor antigen and the CD40 ligand (hCD40L) of the transcription unit.
  • LEND AQ APKS single letter code
  • SEQ ID NO:48 10 residue spacer
  • the "sp- ⁇ Ct ⁇ TmCD40L(human)" fragment is then inserted into the plasmid pShuttle-CMV (Murphy GP, et al. Prostate 38: 73-78 (1999)) after restriction endonuclease digestion with Xba I (AAGCTT) and Xho I (CTCGAG).
  • This vector is designated pShuttle-sp- ⁇ Ct ⁇ TmCD40L(human)(no signal sequence).
  • Modification of pShuttle-sp- ⁇ Ct ⁇ TmCD40L(human)(no signal sequence) to include the HPV- 16 E7 upstream of the human CD40 ligand sequence is accomplished essentially as described above for the murine CD40 ligand encoding vectors.
  • the resulting plasmid is designated pShuttle-E7-sp- ⁇ Ct ⁇ TmCD40L(human)(no signal sequence) and is used for insertion of the HGH signal sequence upstream of E7 to generate HGH/E7-sp- ⁇ Ct ⁇ TmCD40L(human).
  • the recombinant adenoviral vectors were generated using the AdEasy vector system (Strategene, San Diego, CA). Briefly, the resulting plasmids pShuttle- HGH/E7-sp- ⁇ Ct ⁇ TmCD40L, pShuttle-HGH/CD40L, pShuttle-HGH/E7-CD40L, and pShuttle-HGH/E7 were linearized by Pme I digestion and then co-transformed into E. coli strain BJ5183 together with pAdEasy-1. Recombinants were selected with kanamycin and screened by restriction enzyme analysis.
  • the recombinant adenoviral construct was then cleaved with Pac I, and transfected into 293A cells to produce viral particles.
  • the titer of recombinant adenovirus was decided by the tissue culture infectious dose 50 (TCID 50 ) method.
  • E7/ecdCD40L fusion cDNAs were inserted into the expression vector pTri by Xcml and Notl sites.
  • the expression bacterial cell line Rosetta (DE3) was transfected by pTri E7/ecdCD40L vectors and induced by IPTG for 3 hours at 37°C.
  • the bacterial pallets were harvested and purified by His Selected Nickel Affinity Gel (Sigma).
  • PE-labeled H-2Db tetramer containing HPVl 6 E7 49-57 peptide (SEQ ID NO: 68) was purchased from Beckman Coulter and used for the analysis of peptide specific CTL immunity.
  • RAHYNIVTF HPVl 6 E7 49-57 peptide
  • FITC fluorescein isothiocyanate
  • CD8a clone53-6.7, BD Pharmingen
  • TC-I tumor cells / were labeled with the red-fluorescent dye PKH26 (Sigma, St Louis, MO) according to the manufacturer's specifications. In brief, the target cells were washed in PBS then resuspended at 10 7 cells/ml in solution.
  • PKH26 red-fluorescent dye
  • Injected mice were challenged with 500,000 E7 positive TC-I cells and 500,000 E7 negative EL-4 cells implanted subcutaneously (at a different site than the adenoviral vector injection site) seven days following the last vaccination injection.
  • the growth of E7 negative EL-4 cells was not suppressed in the Ad-sig- E7/ecdCD40L injected mice, while E7-positive syngeneic TC-I cell growth was completely suppressed in injected mice.
  • the C57BL/6 donor mice were treated in vivo with antibodies which were cytolytic and specific for CD4 (solid diamonds) or CD8 (solid triangles) positive cells to deplete the respective T cell population 5, 3, and 1 days prior to the vector injection, and every six days after the sc injection of the Ad-sig-E7/ecdCD40L vector, and also on days 6, 7, 8, 10, 12, and 14 days following the injection of the TC-I cells. Then the sensitized CD8+ T cells from the CD4 depleted vaccinated mice (see solid diamonds in FIG. 8) or CD4+ T cell lymphocytes from the CD8 depleted vaccinated mice (see solid triangles in FIG.
  • Ad-sig-E7/ecdCD40L Vector Increases E7 Viral Antigen Specific Cytotoxic T Lymphocytes in Young (Two Month Old) Mice
  • Spleen cells were isolated from C57B1/6 mice (from Harlan) before and 7 days after two injections with IxIO 8 PFU of the Ad-sig-E7/ecdCD40L vector.
  • the level of the E7-specific T cells was determined by tetramer assay as described above.
  • T cells increased three fold in the spleen following the Ad-sig-E7/ecdCD40L vector injection, whereas no significant increases occurred with the other control vectors (Ad-E7/wtCD40L; ad-wtCD40L; Ad-sig-ecdCD40L) including the Ad- E7/wtCD40L, in which the E7/CD40L protein was not secretable from the infected cells.
  • FIG. 9. 8 Ad-sig-E7/ecdCD40L Vector Induces Viral Antigen Immunity in Old (18 Month Old) Mice
  • the ability to elicit viral antigen immunity in old (18 month old) mice using The Ad-sig-E7/ecdCD40L vector was evaluated.
  • the Ad-sig-E7/ecdCD40L vector was injected once sc with IxIO 8 IU.
  • an sc injection of the E7/ecdCD40L protein (10 micrograms/injection) was given as a booster.
  • mice were sacrificed and the level of E7 specific T cells in the spleen determined by ELISPOT assay.
  • CTLs antigen specific cytotoxic T lymphocytes
  • the levels of the E7-specific splenic CD8 T cells of the vaccinated mice increased going from V to VP to VPP and to VPPP.
  • VP, VPP and VPPP are significantly different from each other (p ⁇ 0.05).
  • the levels of the E7 specific serum antibodies against the E7 B cell epitope EIDGP AGQ AEPDRAHYNIVTFCCKCD of the vaccinated mice increased significantly with the number of fusion protein boosts after the initial vector injection (VP ⁇ VPP ⁇ VPPP).
  • the chemokine pathway plays a major role in the trafficking of effector and memory T cells from the lymph nodes draining sites of vaccination or infection to the tissue sites harboring inflammation or infection (Current Opinion 2003 15:343-348; Cell Adhesion and Communication 1998 6:105- 110).
  • a portion of the HA sequence from an H5N1 influenza virus was used as an antigen in the Ad-sig-TAA-ecdCD40L vector, creating an Ad-sig-H5 HA-ecdCD40L expression vector. As described below, this vector induced an immune response in mice; a significant increase in the level of H5 HA specific CD8 T cells was detected.
  • DNA (SEQ ID NO: 69) encoding a portion of a receptor binding region corresponding to amino acid residues 135-175 connected to residues 230-250 (see FIG. 2, underlined) of the hemagglutinin (HA) protein of the H5N1 avian influenza strain (H5HA), first isolated in 1997 in Hong Kong from a child with a fatal respiratory illness (see, e.g., Science 1998 279:393-96; J. Virology 1998 73: 2094-98; Emerging Infectious Disease 2002 8(8):1-12) is shown below.
  • HA hemagglutinin
  • AAG-3' (SEQ ID NO:69).
  • Double-stranded nucleic acid encoding the HA region was generated as follows.
  • the oligos were dissolved in 50 ⁇ l H 2 O (about 3 mg/ml). 1 ⁇ l from each oligo (forward and reverse primers) was added to 48 ⁇ l annealing buffer plus 7 ⁇ L ddH 2 O (100 mM Tris-HCl, IM NaCl, 1OmM EDTA) incubated for 4 minutes at 95°C, 10 minutes at 70°C and slowly cooled to about 4°C.
  • a transcription unit that included DNA encoding the signal sequence of the mouse IgG kappa chain gene upstream of DNA encoding the Avian HA antigen epitope was generated by PCR using the double-stranded HA generated in the previous paragraph and the following primers:
  • K/Avian FIuHA (i.e., kappa signal-H5 fragment) was generated by four rounds of PCR amplification (1 st round: primers 4 +5; 2 nd round: add primer 3; 3 rd round: add primer 2; 4 th round: add primer 1), under the following conditions: hold 3 min at 94 0 C; cycle 94 0 C for 30 sec, 55 0 C for 30 sec, 72 0 C for 30 sec (30 cycles); hold 7 min at 72 0 C; and hold at 4 0 C.
  • the K/Avian FIuHA encoding DNA was cloned into the pcDNATM 3.1 TOPO vector (Invitrogen, San Diego, CA) forming pcDNA-K/Avian FIuHA.
  • Mouse CD40L reverse primer (MCD40LR):
  • These primers will amplify a ⁇ Ct ⁇ TmCD40L+spacer which encodes 52-260 of mouse CD40L.
  • the forward primer MCD40LSPF encodes a 10 residue spacer (LENDAQAPKS) (SEQ ID NO:48) to be located between the antigen and the CD40 ligand (MCD40L) of the transcription unit.
  • PCR was performed using the forward and reverse primers (SEQ ID NOs 50 and 51) and plasmid pDC406-mCD40L as the template under the following conditions: hold 3 min at 94 0 C; cycle 94 0 C for 45 sec, 55 0 C for 45 sec, 72 0 C for 70 sec (30 cycles); hold 7 min at 72 0 C; and hold at 4 0 C.
  • This PCR resulted in a fragment "spacer+ ⁇ Ct ⁇ TmCD40L,”which was subcloned into ⁇ cDNA3TOPO.
  • the "spacer+ ⁇ Ct ⁇ TmCD40L" fragment was then inserted into the plasmid pcDNA-sig- AfIuHA after restriction endonuclease digestion with Xbal (TCTAGA) and Xho I (CTCGAG).
  • TCTAGA restriction endonuclease digestion with Xbal
  • CTCGAG Xho I
  • the sig-AfluHA / ⁇ Ct ⁇ TmCD40L (mouse) encoding DNA was cut from the pCDNA3TOPO using Hindlll-Xbal restriction and inserted into pShuttle-CMV (see Murphy et al., Prostate 38: 73-78, 1999) downstream of the CMV promoter. This vector is designated pShuttle sig- AfluHA/ ⁇ Ct ⁇ TmCD40L(mouse).
  • HCD40LSPF Human ⁇ Ct ⁇ TmCD40L+ spacer forward primer
  • the forward primer HCD40LSPF encodes a 10 residue spacer (LENDAQAPKS; single letter code; SEQ ID NO:48) to be located between the tumor antigen and the CD40 ligand (hCD40L) of the transcription unit.
  • LENDAQAPKS single letter code
  • SEQ ID NO:48 CD40 ligand
  • the "sp- ⁇ Ct ⁇ TmCD40L(human)” fragment is subcloned into pcDNA3TOPO.
  • the "spacer+ ⁇ Ct ⁇ TmCD40L(human)” fragment is then inserted into the plasmid pcDNA- sig- AfIuHA after restriction endonuclease digestion with Xbal (TCTAGA) and Xho I (CTCGAG).
  • the sig-AfluHA / ⁇ Ct ⁇ TmCD40L(human) encoding DNA is cut from the pCDNA3TOPO using Kpnl-Xbal restriction and inserted into pShuttle-CMV (see Murphy et al, Prostate 38: 73-78, 1999) downstream of the CMV promoter.
  • This vector is designated pShuttle sig-AfluHA/ ⁇ Ct ⁇ TmCD40L(human).
  • the transcription unit sig-AfluHA- ⁇ Ct ⁇ TmCD40L(human) encodes the kappa secretory signal followed by the extracellular domain of Avian flue HA followed by a 10 amino acid linker (LENDAQAPKS; SEQ ID NO:48) followed by human CD40 ligand residues 44-261.
  • This amplified H5 HA sequence is cloned so that it is located between a secretory mouse Ig kappa sequence (sig) and a linker (sp), which linker connects to the gene encoding the ecdhCD40L (extracellular domain of the human CD40L) in an AdEasy shuttle vector.
  • sig secretory mouse Ig kappa sequence
  • sp linker connects to the gene encoding the ecdhCD40L (extracellular domain of the human CD40L) in an AdEasy shuttle vector.
  • Recombinant adenoviral vectors were generated using the AdEasy vector system (Stratagene, San Diego, CA) as described above, resulting in the Ad-K/HA/ecdCD40L vector. Fusion protein were prepared as described below.
  • Ad-sig-H5HA/ecdhCD40L vector was processed for administration in accordance with the methods of reference PNAS 2003 100:15101-15106; Blood 2004 104:2704-2713, was injected twice (at a 7 day interval) sc into immunocompetent mice (2 months old).
  • the H5N1 M2 protein does not change in strains with influenza viral strains harboring transitions of sequence in the HA antigens. However, it is a weak antigen during vaccination. Thus, a portion of the coding sequence of the M2 gene was linked to the extracellular domain of CD40 ligand in the Ad-sig-M2/ecdCD40L to increase its immunogenicity.
  • the M2 protein is not normally immunogenic, but can be made so by including it in a chimeric protein with another immunogenic protein sequence.
  • the amino terminal end or an internal "immunodominant loop" from the extracellular domain of the M2 was used in such chimeric structures.
  • Ad-K ⁇ M2/ecdCD40L vector where the M2 is from an H5N 1 influenza virus is constructed to generate an immune response to the M2.
  • MSLLTEVDTLTRNGWGSRSSDSSD (SEQ ID NO:77)
  • Oligonucleotides corresponding to the sense and antisense strands of the DNA encoding SEQ ID NO: 77 are as follows: M2 sense oligonucleotide:
  • ATCACTTGAATCGCTGGATCTGGACCCCCATCCGTTTCTGGTAAGC GTGTC AACCTCGGTTAGAAGGCTCAT-3' (SEQ ID NO:79)
  • the oligonucleotides were dissolved in STE buffer at high concentration (about 1-10 OD 26 O units/ 100 ⁇ L).
  • the two strands were mixed together in equal molar amounts and heated to 94 0 C and slowly cooled to about 4 0 C.
  • the annealed DNA was phosphorylated using T4 PNK (polynucleotide kinase) under standard conditions.
  • T4 PNK polynucleotide kinase
  • the K/ Avian FluM2 fragment having an upstream kappa signal sequence was generated by four rounds of PCR amplification (1 st round: primers 4 +5; 2 nd round: add primer 3; 3 rd round: add primer 2; 4 th round: add primer 1).
  • the K/ Avian FluM2 encoding DNA was subcloned into the pcDNATM 3.1 TOPO vector (Invitrogen, San Diego, CA) resulting in plasmid pcDNA-K/ Avian FluM2.
  • the "spacer+ ⁇ Ct ⁇ TmCD40L(mouse)" fragment was cut from the pcDNA3TOPO-sp- ⁇ Ct ⁇ TmCD40L using Xho I and Xba I and was inserted into the plasmid pcDNA-K/ Avian FluM2 after restriction endonuclease digestion with Xbal (TCTAGA) and Xho I (CTCGAG).
  • the K/AvianFluM2/ ⁇ Ct ⁇ TmCD40L (mouse) encoding DNA was cut from the pCDNA3TOPO using Hindlll-Xbal restriction and inserted into pShuttle-CMV downstream of the CMV promoter.
  • This vector is designated pShuttle sig AfluM2 / ⁇ Ct ⁇ TmCD40L(mouse).
  • Recombinant adenoviral vectors were generated using the AdEasy vector system (Stratagene, San Diego, CA) as described above, resulting in the Ad- K/AvianFluM2/ecdCD40L vector. Fusion protein was prepared as described below.
  • Ad-sig-TAA/ecdCD40L vectors carrying an antigen which is a chimeric fusion of the HA and the M2 proteins is constructed as follows.
  • the H5N1 HA and M2 sequences are synthesized by PCR amplification from an H5N1 template.
  • An exemplary DNA sequence encoding an H5N1 HA antigen is as follows.
  • HA, NA, or M2 from H5N1 , H3N2 or other Type A viral strains such as H2N2 or HlNl are cloned into the TAA/ecdCD40L vector.
  • the influenza fusion protein is expressed and used as a protein boost.
  • the vector is administered two times (7 days apart), or a vector is injection followed by 2 protein boosts at 7 and 21 days.
  • Subjects are vaccinated with the Ad-sig-TAA/ecdCD40L vector where the TAA is replaced with an influenza antigen.
  • the stability of the expressed influenza antigen proteins is evaluated as follows.
  • the TAA/ecdCD40L protein is generated with a hexhis tag and once released from 293 infected cells, it is purified by a nickel column.
  • the protein is studied by reducing and non-reducing SDS-PAGE gels to determine if the trimeric structure is stable with the HA, M2 or HAM2 as antigen.
  • Western blotting is used with a flag antibody to test the relative stability of the HA/ecdCD40L, M2/ecdCD40L and the HAM2/ecdCD40L proteins by methods reported previously (see Blood 2004 104:2704-2713).
  • the recombinant protein is added to mouse bone marrow derived dendritic cells (DCs) by methods reported previously (Deisseroth et al, DC Vector Vaccine and Chemotherapy in Breast Cancer, Submitted 2006).
  • the endpoint of these studies is: FACS analysis of the DCs for appearance of CD 86 and PCR assay for expression of the CCR7 gene (PNAS 2004 100:15101-15106; Blood 2004 104:2704-2713).
  • Induction of immune response is evaluated for each influenza vaccine vector as follows. Two sc injections at 7 day intervals are administered to 2 month and 18 month old BaIbC mice. Seven, 14 and 21 days following the last injection, the animal is sacrificed and the following assays carried out.
  • the test mouse When the tumor nodule reaches the size of 150 cu mm, the test mouse is injected sc with the Ad-sig-TAA/ecdCD40L vector (2 injections 7 days apart). Seven days following the last vaccination, the animal is sacrificed. The tumor is minced, treated with DNAase and collagenase, filtered through nylon mesh and the frequency of CD8 effector cells and CD4CD25FOXP3 T negative regulatory cells is measured by FACS before and after vaccination.
  • SEQ ID NO:21 represents a portion of the HA sequence from an H5N1 Influenza A virus (A/Hong Kong/156/97) was used as an antigen in the HA-CD40L fusion protein. As described below, this fusion protein induced an immune response in mice; as shown by the level of anti-H5 HA antibody in the serum of vaccinated animals.
  • SEQ ID NO:21 is present in the receptor binding region corresponding to amino acid residues 135-175 connected to residues 230-250 (see FIG. 2, underlined) of the hemagglutinin (HA) protein of the H5N1 avian influenza strain (H5HA).
  • HA hemagglutinin
  • H5HA H5N1 avian influenza strain
  • the HA-CD40L fusion was prepared as follows.
  • a CD40L plasmid was generated by PCR amplifying HSFl/ ⁇ Ct ⁇ TmCD40L using plasmid pcDNA-sig- hMUC-l/HSFl/ ⁇ Ct ⁇ TmCD40L as template (the construction of this plasmid is described in U.S. Patent Application Publication US 2005-0226888).
  • the PCR primers and conditions for PCR are as follows:
  • Primer 1 (forward) (Xcml restriction site underlined; EcoRV restriction site underlined and italicized):
  • TGAGAAGCC -3' (SEQ IDNO:88).
  • HSFl/ ⁇ Ct ⁇ Tm CD40L was amplified by two rounds of PCR amplification (1st round: primers 2 +3; 2nd round: primer 1+3).
  • PCR was conducted using the GC- RICH PCR kit (Roche, Inc) under the following conditions:
  • the HSFl/ ⁇ Ct ⁇ Tm CD40L encoding DNA was subcloned into pTriEx-2 restriction sites Xcml (CCA TCA CTC TTC TGG) and EcoRI (GAATTC).
  • the final vector was named ⁇ TriEx-2 HSFl/ ⁇ Ct ⁇ Tm CD40L.
  • cDNA encoding the HA antigen above (SEQ ID NO:21) was amplified from plasmid pcDNA-K/ Avian FIuHA (described above) using the following PCR primers:
  • the PCR amplification product was ligated into pcDNA3.1 /V5-His TOPO TA vector and named as pcDNA3.1/HA then subcloned into the expression plasmid pTriEx-2 HSFl/ ⁇ Ct ⁇ TmCD40L using the Xcml and EcoRV sites to produce the plasmid pTriEx-2HA/mCD40L. Competent cells (Rosetta DE3 pLacI) were transformed with pTriEx-2HAmCD40L and single colony of transformed cells was selected. His-tagged HA/mCD40L fusion protein was produced from the transformed cells using the Overnight ExpressTM Autoinduction System (Novagen, Inc.).
  • the resulting media containing the cells was centrifuged at 5000 g for 10 minutes and the resulting supernatant discarded.
  • Cells were lysed using the CelLytic B Plus Kit (Sigma, Inc.) as follows: 10 mL Lytic Buffer was added for each gram of pelleted cells; the Lytic Buffer was prepared by adding 10 mL CelLytic B reagent, 0.2 mL lysozyme, 0.1 mL protease inhibitor and 500 U benzonase; cells were resuspended in Lytic Buffer and incubated with shaking at RT for 10-15 minutes; and lysed cells were centrifuged 16,00Og for 10 minutes.
  • the neutralizing dose (ND 50 ) of the antibody to HA was determined using the following method.
  • MDCK cells were harvested and the cell suspension diluted to 3 x 10 5 cells/mL (or other appropriate concentration so that the cells are at least 90% confluent at the initiation of theassay). 200 ⁇ L of the diluted cell suspension was transferred into each well of a 96-well microplate and incubated at 37 ⁇ 2°C and 5.0 ⁇ 2 % CO 2 for a minimum of 16 hours in a humidified incubator until the wells were at least 90% confluent. Serum samples were obtained from the above-described mice vaccinated with HA/ecdCD40L, 7 days after the third immunization.
  • 300 ⁇ L aliquots of serum were serially diluted in inoculation medium (dilutions of 1 :5 to 1 :2560).
  • the virus challenge solution was prepared by diluting the challenge virus to 200 TCID 50 /100 ⁇ L (or 2 x 10 3 TCID 50 /mL) in inoculation media.
  • 300 ⁇ L of virus challenge solution was added to each serum dilution to produce inoculating solutions having a final serum dilution of 1 :10 to 1 :5120 and incubated at 37 ⁇ 2°C and 5.0 ⁇ 2 % CO 2 in a humidified incubator for 1 hour ⁇ 5 minutes.
  • HBSS Hank's Balanced Salt Solution
  • CPE cytopathological effects
  • M2 amino acid sequence from an H5N1 Influenza A virus was used as an antigen in the M2/ecdCD40L fusion protein. As described below, this fusion protein induced an immune response in mice; that is, a significant level of anti-M2 antibody was detected in the serum of vaccinated animals.
  • MSLLTEVDTLTRNGWGSRSSDSSD (SEQ ID NO:77)
  • Oligonucleotides corresponding to the sense and antisense strands of the DNA encoding SEQ ID NO:77 are as follows: M2 sense oligonucleotide:
  • the PCR amplification product was ligated into ⁇ cDNA3.1 /V5-His TOPO TA vector and named as pcDNA3.1/M2 then subcloned into the expression plasmid pTriEx-2 HSFl/ ⁇ Ct ⁇ TmCD40L using the Xcml and EcoRV sites to produce the plasmid pTriEx-2M2/mCD40L. Competent cells (Rosetta DE3 pLacI) were transformed with pTriEx-2 M2mCD40L and single colony of transformed cells was selected. His-tagged M2/mCD40L fusion protein was produced from the transformed cells using the Overnight ExpressTM Autoinduction System (Novagen, Inc.).
  • the resulting media containing the cells was centrifuged at 5000 g for 10 minutes and the resulting supernatant discarded.
  • Cells were lysed using the CelLytic B Plus Kit (Sigma, Inc.) as follows: 10 mL Lytic Buffer was added for each gram of pelleted cells; the Lytic Buffer was prepared by adding 10 mL CelLytic B reagent, 0.2 mL lysozyme, 0.1 mL protease inhibitor and 500 U benzonase; cells were resuspended in Lytic Buffer and incubated with shaking at RT for 10-15 minutes; and lysed cells were centrifuged 16,000 g for 10 minutes.
  • the fusion protein was purified by HIS-Select Nickel Affinity Gel (Sigma, Inc.) as follows: 1 mL of His-Select Nickel Affinity Gel was prepared for each 10 mL of cell lysate supernatant and the fusion protein isolated using the "Batch Method" protocol from the manufacturer and performing 3 wash steps before the final elution of the His-tagged fusion protein; and the eluted protein (in 3 mL buffer) was applied to a 1 ODG desalting column and extracted from the column using 4 mL PBS. The eluted protein was concentrated using a Vivaspin column.
  • the neutralizing dose (ND 50 ) of the sera from M2 immunized mice was determined using the method as described in the preceding example.
  • ND 50 neutralizing dose
  • the serum from M2 immunized animals showed a neutralizing titer of 1.27 x 10 2 .
  • TCso/mL targeted challenge concentration of virus
  • 200 TC 5 o/mL

Abstract

Provided are methods of generating an immune response to any of various antigens including foreign antigens such as infectious agent antigens. In general, the method comprises administering an expression vector encoding a transcription unit encoding a secretable fusion protein, the fusion protein containing the foreign antigen and CD40 ligand and also administering the encoded fusion protein. In another approach, an immune response to the foreign antigen is elicited using the encoded fusion protein without administering the vector. The invention methods may be used to immunize an individual against an infectious agent such as influenza virus. Methods of obtaining an immune response in older individuals also is described.

Description

CD40 LIGAND FUSION PROTEIN VACCINE
FIELD OF THE INVENTION
[0001] The present invention relates generally to the field of vaccines. In particular, the present invention relates to the use of fusion proteins of CD40 ligand and an antigen in developing immunity to foreign proteins or infectious agents.
BACKGROUND OF THE INVENTION
[0002] The following discussion of the background of the invention is merely provided to aid the reader in understanding the invention and is not admitted to describe or constitute prior art to the present invention.
[0003] Influenza is an acute contagious illness often characterized by inflammation of the respiratory tract, fever, chills, muscular pain, prostration and maliase and is caused by the Orthomyxoviridae family of influenza viruses. Infection can cause mild to severe illness, and at times can lead to death.
[0004] Influenza viruses are classified into three types: Types A, B, and C. Type A influenzas have been responsible for pandemics, spreading over a wide geographic area and affecting a large proportion of the population. Type A influenza viruses are known to infect many animals including birds and mammals {e.g., humans, dogs, horses, cattle, sheep, pigs and seals). In contrast, type B influenzas tend usually to infect only humans. Type A and B influenzas are responsible for the increased flu- related illnesses, hospitalizations and deaths that occur each year. Type C influenzas tend to be the least worrisome. Infection in humans may cause mild respiratory distress or no symptoms at all.
[0005] Type A influenza viruses are further classified by strain. The strain name is determined by identifying differences between two antigenic proteins, hemagglutinin ("HA") and neuraminidase ("NA"), both present on the viral surface. Rapid alterations in the sequence of these two proteins (termed "antigenic shift") are mainly responsible for the yearly changes in immunogenicity and the requirement for new vaccines each year. Examples of antigenic shift and the concomitant strain change are clear: between 1918 and 1957, the HlNl strain was dominant; between 1957 and 1968, the H2N2 strain was dominant; then, since 1968, the H3N2 virus dominated. Most recently, in 1997, the H5N1 strain of avian influenza was shown to infect humans. In addition to antigenic shift, the antigenic properties of influenza viruses can also change more slowly via "antigenic drift," the slow, gradual process of viral evolution. Antigenic variation (drift) of HA sequences is noted, for example, in human trials with the escape of viral strains from vaccine induced immunity.
[0006] One cause of the rapid sequence changes associated with "antigenic shift" is the formation of reassortant viral strains. The pig can be infected by both human and avian influenza strains, and an exchange of RNA stands between human and avian strains can occur within the pig. These "reassortant" viruses may infect the human species causing a yearly epidemic of influenza. Thus, the rapid changes in the HA and NA proteins resulting from antigenic shift render old influenza viral vaccines ineffective.
[0007] Hemagglutinin ("HA"), one of the proteins affected by antigenic shift, is an antigenic glycoprotein found on the surface of influenza viruses. HA functions to secure the virus to the target cells by binding to N-acetyl neuraminic acid or sialic acid on host cell receptors. HA is composed of two subunits, HAl and HA2. HA2 is the viral membrane anchoring domain, while HAl is responsible for binding host cell receptors. As noted above, HA is highly mutable and variations, mainly in HAl, are a key source of viral antigen variability conferring the ability to evade the immune system. There are currently between 16 and 20 different HA varieties known. Hl, H2 and H3 have been the dominant human influenza subtypes, while the H5 and H7 subtypes have been prevalent for avian species.
[0008] Neuraminidase ("NA") is also presented on the viral surface and functions to catalyze the removal of terminal sialic acid residues of glycosyl groups, thus destroying potential receptors for hemagglutinin. It is probable that neuraminidase is required to prevent viral aggregation and to promote more efficient spreading of the virus from cell to cell. The neuraminidase protein sequence is also highly variable; there are currently nine different neuraminidase varieties known. Accordingly, changes in this protein sequences also play a role in antigenic shift.
[0009] Another viral protein present on the viral influenza surface is the Matrix protein 2 ("M2"), an ion channel protein that selectively allows protons to enter the virus. After the virus enters a cell, an influx of protons is key in the removal of the viral protein coat. The M2 protein is homotetramer comprised of three domains: a 23 amino-acid region present on the outside of the virus (extra cellular domain), a 54 amino acid region that is inside the virus (cytoplasmic domain) and a 19 amino-acid transmembrane domain. M2 is expressed at low levels on the viral surface but is present at high levels on influenza infected cells. The M2 protein sequence is stable compared to hemagglutinin or neuraminidase. In fact, the 23 -amino acid extra cellular domain of M2 is well conserved in many known influenza strains (some exceptions include A/PR/8/34, A/Brevig and Mission/1/8). Although this protein is not immunogenic normally, it has been shown that chimeric molecules made from the extra cellular domain of the M2 and "adjuvant proteins" such as the hepatitis B core protein induce a potent immune response (Virology 2005 337:149-161; Infection and Immunity 2002 70:6860-70).
[0010] The intranasal administration of the M2HB core particle, along with adjuvants (such as a detoxified enterotoxin adjuvant), protected 2-4 month old BaIbC mice from challenge with human influenza virus (Virology 2005 337:149-161). M2, which is important in determining host range (J. Virology 1999 73:3366-3374), is present at such low levels in the virus that antibodies are not generated. HA has been the target for vaccines since the antibodies to HA have been shown to prevent influenza viral infection.
[0011] A commercial human vaccine against the H5N1 strain of influenza has not yet been developed, although the H5 strain of avian influenza virus was seen to infect human directly in 1997; 6/18 infected people died. Since that time, outbreaks have occurred in 2003 in Hong Kong (2 deaths in 3 cases), and in Vietnam/Thailand in 2004 (28 deaths in 39 infected cases (Kash JC et al., Journal of Virology 78: 9499- 9511 (2004); Apisarnthanarak A, et al., Emerg. Infect. Dis. 10 (2004)). In 2005, 79/150 H5N1 infected human beings died. Over 99% of the sequences of the infecting H5N1 virsus are avian, suggesting direct transmission from the poultry to human beings (Science 2001 293:1840-1842; J. Virology 2000 74:1443-1450). When the avian influenza viruses acquire the capability of directly jumping from birds to humans, there is a potential for a pandemic. For this to occur, the virus must be able to be transmitted in aerosols from person to person. A transition from avian:human to human:human transmission resulting in a pandemic was documented for the first time in 1918 in an HlNl strain. The result was more than 600,000 deaths in the USA and 40 million worldwide (J. Virology 2004 78: 9499-9511). Statistics show that most of the deaths were restricted to younger individuals living in crowded conditions (soldiers involved in World War I).
[0012] The H5N1 strain has been reported to infect humans (J. Virology 2000 74:1443-1450). It is estimated that if this virus acquires the capability of spreading from human to human, there impact in the USA will be over 200,000 deaths, over 700,000 hospitalizations, over 40 million outpatient visits, and an economic impact of over 100 billion dollars (Infect. Dis. 1999 5:659-671). The recent apparent trend for increased reporting deaths of individuals believed infected with the avian flu virus has created concern among governments around the world (J. Virology 2004 78:9499- 9511; J. Emerg. Infect. Dis. 2004 10; Virology 2003 208:270-278; Eur. J. Biochem. 1999 260:166-175).
[0013] The testing of vaccine efficacy for the H5N1 avian flu has been carried out in mice and ferrets, but the virulence of the various human strains in ferrets is closer to that seen in humans (J. Virology 2005 79:2191-2198). The pathogenicity of the various strains has been correlated with the HA protein structure (Id). After the 1997 cases in Hong Kong, two strategies for vaccines against the H5N1 strains were tested. First, it was discovered that a subunit H5 vaccine did not appear to be immunogenic in humans (J. Infect. Dis. 2005 191:1213-1215; Vaccine 2003 21 :1687-1693). However, the addition of MF59 adjuvant increased the antibody response (PNAS USA 2005 102:12915-12920). In a second approach, a multivalent vaccine (H3N1 and H5N1) was used but this proved equally ineffective (Virology 1999 73:2094- 2098). [0014] Recently, an HA DNA vaccine was shown to protect mice from the H5N1 strain (clintrials.gov/ct/gui/sho/NCT00110279;jsessionid=743259FCC0A680603EA), and there is currently a clinical trial to evaluate the immune response to H9N2 avian flu in humans (Vaccine 2002 20:1099-1105). The H9N2 study involves a cold- adapted resorted attenuated viral vaccine which is administered by intramuscular injection. It is hoped that this study will provide insight into an H5N1 immune response. Additionally, an intramuscularly administered vaccine from baculovirus expressing H5 HA was tested in 147 adults. A 23% antibody response was observed after a single injection and 52% response after two injections {Lancet 2004 357:1937- 1943).
[0015] The elderly are especially at risk with respect to influenza infection, and vaccination against influenza is recommended for older individuals to prevent the potentially deadly complications of infection such as pneumonia or bronchitis. One cause of increased risk in the elderly is the decrease in function of the immune system with age. For example, there is a decrease in the number of naϊve, antigen unexposed CD4 and CD8 T cells. Additionally, the ratio of the naϊve to memory CD8/CD4 cells decreases as the chronological age increases. Further, CD4 cells become impaired, acquiring both quantitiative and functional defects, such as diminished levels of the CD40 ligand (CD40L) on the surface of CD4 cells as well as a temporal retardation of the rate at which CD40 ligand (CD40L) is expressed on the surface of the CD4 cells following activation. Accordingly, the amount of antibody that an elderly system is able to generate will be lower following infection or conventional vaccination.
[0016] Testing has shown that current methods of vaccination are, at best, only moderately effective. Usually, three strains of the human influenza virus are grown up in eggs, purified and then chemically inactivated. Using the induction of neutralizing antibodies in the vaccinated individuals as an endpoint for response, the response to the vaccine is in the 65-70% range (Lancet 2004 357:1937-1943). The response is 4-fold less in individuals vaccinated after age 55.
[0017] Vaccines have been described that include an expression vector encoding a fusion protein that includes an antigen fused to CD40 ligand. See, e.g., U.S. Patent Application Publication US 2005-0226888 (application serial No. 11/009,533) titled "Methods for Generating Immunity to Antigen," filed 12/10/2004.
SUMMARY OF THE INVENTION
[0018] According to the present invention there are provided methods of generating an immune response to a fusion protein having CD40 ligand and a foreign antigen. In some embodiments the fusion protein is administered as an expression vector containing DNA encoding the fusion protein. In other embodiments, the fusion protein is directly administered as a protein. Vaccination regimens wherein vector and protein are administered are also provided.
[0019] Thus, in a first aspect, there are provided new vaccines for protecting against infection by influenza viruses. An immune response to an influenza antigen is achieved by administering an expression vector encoding a secretable fusion protein which includes an influenza antigen and CD40 ligand.
[0020] The influenza antigen may be any influenza antigen to which an immune response may be generated in an individual or animal. In preferred embodiments, the influenza antigen is an mammalian influenza virus antigen (such as a human influenza antigen) or an avian influenza virus antigen. In further embodiments, the influenza antigen may be a combination of mammalian and avian influenza virus antigens, such as a combination of human and avian influenza virus antigens. The influenza antigen is preferably an influenza viral protein, or fragment thereof, which comprises at least one antigenic determinant.
[0021] In a preferred embodiment, the influenza antigen of the fusion protein is the matrix protein 2 ("M2") ion channel protein. The M2 protein, which is a tetrameric 23 amino acid long type III transmembrane protein involved in tropism of the virus, is barely detectable on the influenza virus but is expressed at high levels on influenza virus infected cells. In contrast to the HA protein, the M2 has a stable sequence from year to year among different influenza strains. [0022] It is believed that the invariant nature of the M2 antigen when fused to CD40 ligand in the present vaccine design, will provide a "universal" influenza vaccine that, unlike current vaccines, will be effective against different strains of influenza resulting from antigenic drift. This is especially important in that there may not be time to prepare a vaccine against a known unique HA antigen for the avian influenza virus once a pandemic occurs, as there is each year for the human influenza reassorted virus.
[0023] In one embodiment, the M2 antigen of the fusion protein lacks all or substantially all of the M2 transmembrane domain. Preferably, the M2 antigen of the fusion protein includes all of the extracellular domain of M2 or at least an antigenic fragment of the extracellular domain of M2.
[0024] In other embodiments, the influenza antigen may be a chimeric influenza antigen having at least one antigenic determinant from at least two viral influenza proteins. Such different antigens may be variants of the same antigen (e.g. hemagglutinins from different virus strains, e.g. from H5N1, H2N2, H3N2 or HlNl strains) or a chimeric influenza antigen having at least one antigenic determinant from at least two different viral influenza proteins (e.g. HA and M2).
[0025] In some embodiments, the influenza antigen may be a viral protein or fragment thereof. For example, the viral protein or fragment may be a hemagglutinin ("HA"), a neuraminidase ("NA"), an M2 or any combination of HA, NA or M2. The influenza antigen may comprise: an extracellular domain or domain fragment of the viral antigen (e.g., HA, NA or M2); a cytoplasmic domain or domain fragment; or a combination of extracellular and cytoplasmic sequences from the same protein. In some embodiments, the influenza antigen may be a protein chimera having any immunogenic combination of different influenza proteins (e.g., any combination of hemagglutinin, neuraminidase or M2 proteins or fragments thereof). The influenza protein may be from any strain for which protection is sought. In some embodiments, the influenza antigen may be from an H5N1, H3N2, HlNl or H2N2 influenza strain. In some embodiments the influenza antigen is a chimeric of HA and M2 proteins or fragments thereof. In other embodiments, the influenza antigen is a chimeric of HA and M2 extracellular domain regions from one or more influenza strains (e.g., from H5N1, H3N2, HlNl or H2N2).
[0026] As used herein an "antigen" is any foreign material that is specifically bound by the combining site of an antibody or by the combining site of a T cell antigen receptor. Antigens may also be immunogens if they are able to trigger an immune response, or haptens if not.
[0027] As used herein, "antigenic determinant" refers to a single antigenic site or epitope on a complex antigenic molecule or particle, a minimal portion of a molecule that interacts with an antibody or T cell receptor. Antigenic determinants may be linear or discontinuous.
[0028] The fusion protein encoding an influenza antigen may be administered before, concurrently or after administration of the vector. Preferably, the fusion protein is administered after the vector. The sequence of the influenza antigen encoded by the vector and that present in the fusion protein may be identical or may be different. If different, the two preferably have at least one antigenic determinant in common.
[0029] In one approach, the sequence encoding the influenza antigen in the fusion protein transcription unit is 5' to sequence encoding the CD40 ligand. In another approach, the sequence encoding the CD40 ligand in the fusion protein transcription unit is 5' to sequence encoding the influenza antigen. In a preferred embodiment, the CD40 ligand lacks all or a portion of its transmembrane domain.
[0030] In another aspect, the invention provides methods of immunizing an individual against infection by an influenza virus. The method includes administering an expression vector which includes a transcription unit encoding a secretable fusion protein that contains an influenza antigen associated and CD40 ligand. A fusion protein that encodes an influenza antigen associated with the virus and CD40 ligand may also be administered before, concurrently or after administration of the vector. Preferably, the fusion protein is administered after the vector. In this approach, the influenza antigen which is encoded by the vector is chosen to cross-react with the influenza virus for which protection is being sought. The immune response generated by this approach is both cell mediated and humoral (i.e. antibody response). The antibody response can neutralize infectious influenza virus.
[0031] In preferred embodiments, the expression vector may be a viral expression vector or a non- viral expression vector; the expression vector may be an adenoviral vector; the vector may be advantageously administered subcutaneously; the vector may be administered on a subsequent occasion(s) to increase the immune response; a signal sequence may be placed upstream of the fusion protein for secretion of the fusion protein; immunity against the antigen may be long lasting and involve generation of cytotoxic CD8+ T cells against antigen expressing cells and the production of antibody to the antigen; the transcription unit may include sequence that encodes a linker between the antigen and the CD40 ligand; suitable linkers may vary in length and composition; the expression vector may include a human cytomegalovirus promoter/enhancer for controlling transcription of the transcription unit; and the CD40 ligand may be a human CD40 ligand.
[0032] In a further aspect, the invention provides methods of effectively immunizing older individuals by administering an expression vector encoding a secretable fusion protein which includes an antigen and CD40 ligand. Older individuals which may realize an improved immune response using the methods of the invention as compared to other immunization methods are at least 50 years of age, or even at least 55 years of age or even yet at least 60 years of age.
[0033] The achievement of improved immune responses with the invention methods as compared to other immunization approaches are applicable to any of various antigens which are fused to CD40 ligand. Such antigen include cancer antigens (tumor associated or tumor specific) or infectious agent antigens. Infectious agent antigens may be bacterial, viral, fungal, protozoan, and the like. Viral antigens may be an influenza antigen as described above. The viral antigen may be from a human papilloma virus. The viral antigen may be the E6 or E7 protein of human papilloma virus. [0034] It is believed that traditional vaccination is poorly effective in older individuals because the expression level of the CD40 ligand (CD40L) on the surface of CD4 cells following activation is greatly reduced in older individuals as compared to young, healthy individuals. On the basis of this functional CD4 defect alone, it is believed that the levels of antibodies that will be made following the conventional vaccination with recombinant antigen and inactivated viral particle vaccines, even with adjuvants, will be lower in older individuals as compared to younger individuals. It is further believed that poor immune responses in older individuals may be due in part to the diminished expression of CD40L by CD4 cells. The administration of an expression vector in accordance with the methods of the invention is believed to result in in vivo activation and antigen loading of dendritic cells (DCs) following release of the fusion protein from vector infected cells. The loading of DC with the CD40 ligand from the fusion protein bypasses the CD4 cell of older individuals which are deficient in CD40L. It has been found that two sc injections of this vaccine vector induces an immune response that last for over a year and which is independent of CD4 cells.
[0035] In yet another aspect, the invention provides a vector and the fusion protein encoded thereby along the lines described herein for generating an immune response in an individual against an influenza antigen.
[0036] In still another aspect, there is provided a method of increasing the immune responsiveness of an individual having CD4 T cells exhibiting reduced levels of CD40 ligand as compared to young, healthy individuals to vaccination against a cancer antigen or an infectious agent antigen. The method is accomplished by administering to the individual an effective amount of an expression vector having a transcription unit encoding a secretable fusion protein, having a cancer or infectious agent antigen and CD40 ligand.
[0037] In a further aspect, there are provided methods of immunizing individuals above the age of 50 against foreign antigens. Such methods are particularly suited for generating immunity to influenza in older individuals, which represent the majority group for which influenza A as well as avian influenza protection is needed. [0038] In another aspect, the invention provides a method of generating an immune response in an individual against a foreign antigen. This method is accomplished by administering to the individual an effective amount of a fusion protein without administering an expression vector encoding the fusion protein, wherein the administering is repeated, and wherein the fusion protein contains the antigen and CD40 ligand. The foreign antigen may be from an infectious agent such as influenza. The foreign antigen of the fusion protein may be glycosylated or non- glycosylated. The immune response generated by this approach may be both cell mediated and humoral (i.e. antibody response). The antibody response can neutralize infectious influenza virus.
[0039] Abbreviations used herein include "Ad" (adenoviral); "sig" (signal sequence); and "ecd" (extra cellular domain); "sc" (subcutaneous).
[0040] These and other embodiments are described in detail below.
BRIEF DESCRIPTION OF THE DRAWINGS
[0041] FIG. 1 shows an amino sequence of an M2 protein from an H5N1 influenza virus (GenBank Accession No. AF036358, SEQ ID NO:1).
[0042] FIG. 2 shows an amino sequence of an HA protein (without the N-terminal 16 amino acid signal peptide) from an H5N1 influenza virus (GenBank Accession No. AF036356, SEQ ID NO:2).
[0043] FIG. 3 shows an amino sequence of an M2 protein from an H3N2 influenza virus (GenBank Accession No. AAA43276, SEQ ID NO:3)
[0044] FIG. 4 shows an amino sequence of an HA protein from an H3N2 influenza virus (GenBank Accession No. VOl 085, SEQ ID NO:4).
[0045] FIG. 5 shows a nucleotide sequences encoding A) a fragment of an HA protein from an H5N1 influenza virus, and B) a fragment of an M2 protein from an H5N1 influenza virus. (SEQ ID NOs:5 and 6, respectively) [0046] FIG. 6 depicts the growth of E7-positive TC-I and E7-negative EL-4 cells in Ad-sig-E7/ecdCD40L vector vaccinated mice. E7 -positive TC-I cells (diamonds); E7-negative EL-4 cells (squares).
[0047] FIG. 7 depicts growth of E7-positive TC-I cells versus E7-negative EL-4 cells in mice injected with splenic T lymphocytes from donor mice vaccinated with Ad-sig-E7/ecdCD40L vector.
[0048] FIG. 8 depicts percent survival days after injection of test mice. The test mice were first injected with CD8+ cells (black diamonds), CD4 cells (triangles) or no cells (squares) from Ad-sig-E7/ecdCD40L vector vaccinated mice. Seven days later the test mice were injected with E7-positive Tc-I cells.
[0049] FIG. 9 depicts the level of E7-specifϊc T cell response after injection of different vector constructs.
[0050] FIG. 10 shows the levels of splenocytes producing interferon-gamma and IL4 in Ad-sig-E7/ecdCD40L vector vaccinated and unvaccinated young and old mice.
[0051] FIG. 11 shows the percentage of antigen specific T cells in the CD8 population antigen positive tumor of old animals unimmunized (control) and immunized with Ad-sig-E7/ecdCD40L vector.
[0052] FIG. 12 shows the percentage of CD4 and CD8 T cells infiltrating tumor nodules in old animals vaccinated with Ad-sig-E7/ecdCD40L vector and in young animals unvaccinated.
[0053] FIG. 13 depicts cytotoxic T cell activity at various effector to target ratios induced by Ad-sig-E7/ecdCD40L vector vaccination of young and old mice.
[0054] FIG. 14 depicts the suppression of E7 tumor growth in old and young Ad- sig-E7/ecdCD40L vector vaccinated mice.
[0055] FIG. 15 depicts the percentage of E7 tumor free mice after vaccination with the Ad-sig-E7/ecdCD40L vector and protein boost in old and young mice. [0056] FIG. 16 shows the percentage of FoxP3 regulatory CD4+ cells among tumor infiltrating lymphocytes in the tumor before (control) and after vaccination (old) of old (18 month) mice with Ad-sig-E7/ecdCD40L vector.
[0057] FIG. 17 shows the percentage of effector CD8+ cells in tumor nodules of rH2n.Tg (i.e., HER2 transgenic) mice injected with Ad-sig-rH2N/ecdΔCtΔTmCD40L vector.
[0058] FIG. 18 depicts the level of H5HA-specific CD8 T cells in the spleen of Ad- sig-H5HA/ecdCD40L vaccinated mice compared to unvaccinated mice via ELISA spot assay interferon gamma detection.
[0059] FIG. 19 depicts an exemplary amino acid sequence of neuraminidase H5N1 (FIG. 19A) and the encoding nucleotide sequence (FIG. 19B) of GenBank ID No. g2865377 (SEQ ID NO:7 and SEQ ID NO:8, respectively).
[0060] FIG. 20 depicts an exemplary amino acid sequence of an HA from H5N1 (SEQ ID NO:9; GenBank ID g2865380). Underlined are residues reported to be involved in receptor binding.
[0061] FIG. 21 depicts an exemplary precursor HA molecule from strain H3N2 (GenBank Accession No. V01086; SEQ ID NO:10). Underlined and italicized sequence is involved in receptor binding or represents an epitope against which neutralizing antibodies have been generated.
[0062] FIG. 22 depicts an exemplary amino acid sequence of neuraminidase from influenza A virus strain A/Memphis/31/98 (H3N2), GenBank ID g30385699 (SEQ ID NO: 11). Residues reported to be mutated in known escape mutants are shown underlined in bold. The extracellular domain is shaded.
[0063] FIG. 23 depicts the level of H5HA-specific CD8 T cells in a preparation of splenocytes from Ad-sig-H5HA/ecdCD40L vaccinated old and young mice compared to unvaccinated mice, as determined by via ELISpot assay interferon gamma detection. [0064] FIG. 24 demonstrates the presence of antibodies against HA in serum of old and young mice following vaccination with Ad~sig-H5HA/ecdCD40L vector followed by three protein boosts of HA/ecdCD40L fusion protein.
[0065] FIG. 25 depicts the level of M2-specific CD8 T cells in a preparation of splenocytes from Ad-sig-H5M2/ecdCD40L vaccinated old and young mice compared to unvaccinated mice, as determined by via ELISpot assay interferon gamma detection.
[0066] FIG. 26 demonstrates the presence of antibodies against M2 in serum of old and young mice following vaccination with Ad-sig-H5M2/ecdCD40L vector followed by two protein boosts of M2/ecdCD40L fusion protein.
[0067] FIG. 27 depicts the level of E7-specific CD8 T cells in a preparation of splenocytes from 2 month old mice ("Young") vaccinated according to the V, VP, VPP, or VPPP vaccination regimens wherein "V" means to administer the Ad-sig- E7/ecdC40L and "P" means to administer the E7/ecdCD40L protein.
[0068] FIG. 28 depicts the level of E7-specific antibody in serum from 2 month old mice vaccinated according to the V, VP, VPP, or VPPP vaccination regimens wherein "V" means to administer the Ad-sig-E7/ecdC40L and "P" means to administer the E7/ecdCD40L protein.
[0069] FIG. 29 depicts the level of E7-specifϊc CD8 T cells in a preparation of splenocytes from 18 month old mice ("Old") vaccinated according to the V, VP, VPP, or VPPP vaccination regimens wherein "V" means to administer the Ad-sig- E7/ecdC40L and "P" means to administer the E7/ecdCD40L protein.
[0070] FIG. 30 depicts the level of E7-specific antibody in serum from 18 month old mice ("Old") vaccinated according to the V, VP, VPP, or VPPP vaccination regimens wherein "V" means to administer the Ad-sig-E7/ecdC40L and "P" means to administer the E7/ecdCD40L protein. [0071] FIG. 31 demonstrates the presence of antibodies against HA in serum of mice following a vaccination by three administrations of HA/ecdCD40L fusion protein.
[0072] FIG. 32 demonstrates the presence of antibodies against M2 in serum of mice following vaccination by three administrations of M2/ecdCD40L fusion protein.
DETAILED DESCRIPTION OF THE INVENTION
[0073] In accordance with one aspect of the invention, a method is provided for generating an immune response against an influenza antigen using an expression vector and/or the fusion protein encoded thereby. The vector includes a transcription unit encoding a secretable fusion protein containing the influenza antigen and CD40 ligand. In a preferred embodiment, the transcription unit includes from the amino terminus, a secretory signal sequence, the influenza antigen, a linker and a secretable form of CD40 ligand. In preferred embodiments, the secretable form of CD40 ligand lacks all or substantially all of its transmembrane domain.
[0074] In a preferred approach, the individual is first administered the vector on one or more occasions to generate a primary immune response. A fusion protein having the influenza antigen and CD40 ligand protein is also administered in an effective amount after administration of vector to boost the immune response to the antigen above that obtained with vector administration alone.
[0075] The term "in an effective amount" in reference to administering the fusion protein is an amount that generates an increased immune response over that obtained using the expression vector alone. A time interval between administrations is generally required for optimal results. An increase in the immune response may be measured as an increase in T cell activity or antibody production. Generally, at least one week between vector administration and protein boosting is effective although a shorter interval may be possible. An effective spacing between administrations may be from 1 week to 12 weeks or even longer. Multiple boosts may be given which may be separated by from 1-12 weeks or even longer periods of time.
[0076] The use of the fusion protein to boost the immune response avoids having to repetitively administer the expression vector which might generate hypersensitivity to multiple injections. The antigen portion of the fusion protein is preferably the fusion protein which is encoded by the transcription unit of the expression vector used in the initial administration. However, the antigen portion of the fusion protein may differ from the encoded antigen provided that there is at least one shared antigenic determinant or epitope common to the antigen of the expression vector and that of the fusion protein used for boosting.
[0077] The fusion protein may be produced in a variety of cell systems. In certain embodiments, the antigen is desired to be glycosylated. In these embodiments, if the foreign protein contains a glycosylation signal, a cell system that produces glycosylated proteins can be used, such as a eukaryotic cell, preferably a mammalian cell. Exemplary cell systems include CHO cells, COS cells, and MDCK cells. Avian cells may also be used when avian-specifϊc glycosylation is desired. In some embodiments, glycosylation of the foreign protein portion of the fusion protein may be avoided by producing the fusion protein synthetically or by using a non- glycosylation system such as a bacterial expression system.
[0078] The fusion protein may be prepared in a mammalian cell line system, which is complementary to the vector. For example, in the case of adenovirus, the cell line system can be 293 cells that contain the Early Region 1 (El) gene and can support the propagation of the El -substituted recombinant adenoviruses. When the adenoviral vectors infect the production cells, the viral vectors will propagate themselves following the viral replication cycles. However, the gene of interest that is carried by the viral vector in the expression cassette will express during the viral propagation process. This can be utilized for preparation of the fusion protein encoded by the vector in the same system for production of the vector. The production of both the vector and the fusion protein will take place simultaneously in the production system. The vector and protein thus produced can be further isolated and purified via different processes.
[0079] The fusion protein may also be prepared in non-mammalian cells, such as bacterial cells. For example, cDNA encoding the fusion protein can be subcloned into a vector such as pTriEx Hygro (Novagen, Inc.) and transfected into E. coli (e.g., Rosetta cells from Novagen, Inc.) where the fusion protein is produced. Other non- mammalian cells include yeast, algae, insect, and plant cells.
[0080] The fusion protein may be administered parenterally, such as intravascularly, intravenously, intraarterially, intramuscularly, subcutaneously, or the like. Administration can also be orally, nasally, rectally, transdermally or inhalationally via an aerosol. The protein boost may be administered as a bolus, or slowly infused. The protein boost is preferably administered subcutaneously.
[0081] The fusion protein boost may be formulated with an adjuvant to enhance the resulting immune response. As used herein, the term "adjuvant" means a chemical that, when administered with the vaccine, enhances the immune response to the vaccine. An adjuvant is distinguished from a carrier protein in that the adjuvant is not chemically coupled to the immunogen or the antigen. Adjuvants are well known in the art and include, for example, mineral oil emulsions (U.S. Pat. No. 4,608,251, supra) such as Freund's complete or Freund's incomplete adjuvant (Freund, Adv. Tuberc. Res. 7:130 (1956); Calbiochem, San Diego Calif.), aluminum salts, especially aluminum hydroxide or ALHYDROGEL (approved for use in humans by the U.S. Food and Drug Administration), muramyl dipeptide (MDP) and its analogs such as [Thr1 J-MDP (Byers and Allison, Vaccine 5:223 (1987)), monophosphoryl lipid A (Johnson et al, Rev. Infect. Dis. 9:S512 (1987)), and the like.
[0082] The fusion protein can be administered in a microencapsulated or a macroencapsulated form using methods well known in the art. Fusion protein can be encapsulated, for example, into liposomes (see, for example, Garcon and Six, J. Immunol. 146:3697 (1991)), into the inner capsid protein of bovine rotavirus (Redmond et al., MoI. Immunol. 28:269 (1991)) into immune stimulating molecules (ISCOMS) composed of saponins such as Quil A (Morein et al., Nature 308:457 (1984)); Morein et al., in Immunological Adjuvants and Vaccines (G. Gregoriadis al. eds.) pp.153-162, Plenum Press, NY (1987)) or into controlled-release biodegradable microspheres composed, for example, of lactide-glycolide copolymers (OΗagan et al., Immunology 73:239 (1991); OΗagan et al., Vaccine 11 :149 (1993)).
[0083] The fusion protein also can be adsorbed to the surface of lipid microspheres containing squalene or squalane emulsions prepared with a PLURONIC block- copolymer such as L-121 and stabilized with a detergent such as TWEEN 80 (see Allison and Byers, Vaccines: New Approaches to Immunological Problems (R. Ellis ed.) pp. 431-449, Butterworth-Hinemann, Stoneman N.Y. (1992)). A microencapsulated or a macroencapsulated fusion protein can also include an adjuvant.
[0084] The fusion protein also may be conjugated to a carrier or foreign molecule such as a carrier protein that is foreign to the individual to be administered the protein boost. Foreign proteins that activate the immune response and can be conjugated to a fusion protein as described herein include proteins or other molecules with molecular weights of at least about 20,000 Daltons, preferably at least about 40,000 Daltons and more preferably at least about 60,000 Daltons. Carrier proteins useful in the present invention include, for example, GST, hemocyanins such as from the keyhole limpet, serum albumin or cationized serum albumin, thyroglobulin, ovalbumin, various toxoid proteins such a tetanus toxoid or diphtheria toxoid, immunoglobulins, heat shock proteins, and the like.
[0085] Methods to chemically couple one protein to another (carrier) protein are well known in the art and include, for example, conjugation by a water soluble carbodiimide such as l-ethyl-3-(3dimethylaminopropyl)carbodiimide hydrochloride, conjugation by a homobifunctional cross-linker having, for example, NHS ester groups or sulfo-NHS ester analogs, conjugation by a heterobifunctional cross-linker having, for example, and NHS ester and a maleimide group such as sulfosuccinimidyl-4-(N-maleimidomethyl) cyclohexane-1 -carboxylate and, conjugation with gluteraldehyde (see, for example, Hermanson, Bioconjugate Techniques, Academic Press, San Diego, Calif. (1996)); see, also, U.S. Pat. Nos. 4,608,251 and 4, 161,519).
[0086] The term "vector" which contains a transcription unit (aka. "expression vector") as used herein refers to viral and non- viral expression vectors that when administered in vivo can enter target cells and express an encoded protein. Viral vectors suitable for delivery in vivo and expression of an exogenous protein are well known and include adenoviral vectors, adeno-associated viral vectors, retroviral vectors, herpes simplex viral vectors, and the like. Viral vectors are preferably made replication defective in normal cells. See U.S. Patent no. 6,669,942; 6,566,128; 6,794,188; 6,110, 744; 6,133,029.
[0087] As used herein, the term "cells" is used expansively to encompass any living cells such as mammalian cells, plant cells, eukaryotic cells, prokaryotic cells, and the like.
[0088] The term "adenoviral expression vector" as used herein, refers to any vector from an adenovirus that includes exogenous DNA inserted into its genome which encodes a polypeptide. The vector must be capable of replicating and being packaged when any deficient essential genes are provided in trans. An adenoviral vector desirably contains at least a portion of each terminal repeat required to support the replication of the viral DNA, preferably at least about 90% of the full ITR sequence, and the DNA required to encapsidate the genome into a viral capsid. Many suitable adenoviral vectors have been described in the art. See U.S. Patent nos. 6,440,944 and 6,040,174 (replication defective El deleted vectors and specialized packaging cell lines). A preferred adenoviral expression vector is one that is replication defective in normal cells.
[0089] "Adenoviral expression vectors" may include vectors that have been modified to better target and infect specific cell types (e.g., fibroblasts and dendritic cells), or that have been modified to avoid neutralization by pre-existing, high-titer antibodies, such as the antibodies circulating in humans against Ad5 and Ad2. [0090] Adeno-associated viruses represent a class of small, single-stranded DNA viruses that can insert their genetic material at a specific site on chromosome 19. The preparation and use of adeno-associated viral vectors for gene delivery is described in U.S. Patent no. 5,658,785.
[0091] Non- viral vectors for gene delivery comprise various types of expression vectors (e.g., plasmids) which are combined with lipids, proteins and other molecules (or combinations of thereof) in order to protect the DNA of the vector during delivery. Fusigenic non- viral particles can be constructed by combining viral fusion proteins with expression vectors as described. Kaneda, CurrDrug Targets (2003) 4(8):599- 602. Reconstituted HVJ (hemagglutinating virus of Japan; Sendai virus)-liposomes can be used to deliver expression vectors or the vectors may be incorporated directly into inactivated HVJ particles without liposomes. See Kaneda, Curr Drug Targets (2003) 4(8):599-602. DMRIE/DOPE lipid mixture are useful a vehicle for non-viral expression vectors. See U.S. 6,147,055. Polycation-DNA complexes also may be used as a non- viral gene delivery vehicle. See Thomas et al., Appl Microbiol Biotechnol (2003) 62(l):27-34.
[0092] The term "transcription unit" as it is used herein in connection with an expression vector means a stretch of DNA that is transcribed as a single, continuous mRNA strand by RNA polymerase, and includes the signals for initiation and termination of transcription. For example, in one embodiment, a transcription unit of the invention includes nucleic acid that encodes from 5' to 3,' a secretory signal sequence, an influenza antigen and CD40 ligand. The transcription unit is in operable linkage with transcriptional and/or translational expression control elements such as a promoter and optionally any upstream or downstream enhancer element(s). A useful promoter/enhancer is the cytomegalovirus (CMV) immediate-early promoter/enhancer. See U.S. Patents no. 5,849,522 and 6,218,140.
[0093] The term "secretory signal sequence" (aka. "signal sequence," "signal peptide," leader sequence," or leader peptide") as used herein refers to a short peptide sequence, generally hydrophobic in charter, including about 20 to 30 amino acids which is synthesized at the N-terminus of a polypeptide and directs the polypeptide to the endoplasmic reticulum. The secretory signal sequence is generally cleaved upon translocation of the polypeptide into the endoplasmic reticulum. Eukaryotic secretory signal sequences are preferred for directing secretion of the exogenous gene product of the expression vector. A variety of suitable such sequences are well known in the art and include the secretory signal sequence of human growth hormone, immunoglobulin kappa chain, and the like. In some embodiments the endogenous tumor antigen signal sequence also may be used to direct secretion.
[0094] The term "antigen" as used herein refers broadly to any antigen to which a human, mammal, bird or other animal can generate an immune response. "Antigen" as used herein refers broadly to a molecule that contains at least one antigenic determinant to which the immune response may be directed. The immune response may be cell mediated or humoral or both.
[0095] As is well known in the art, an antigen may be protein in nature, carbohydrate in nature, lipid in nature, or nucleic acid in nature, or combinations of these biomolecules. As is well known in the art, an antigen may be native, recombinant or synthetic. For example, an antigen may include non-natural molecules such as polymers and the like. Antigens include both self antigens and non-self antigens. "Self antigens include antigens encoded by the host's genome. Self antigens include those variant sequences that arise through natural recombination events in the host genome. For example, the variable regions of immunoglobulin genes recombine in many combinations to produce a large diversity in immunoglobulins. Other self antigens may include proteins that are overexpressed or underexpressed in disease states such as cancer. For example, various mucin isoforms are overexpressed in certain cancer types.
[0096] "Foreign" antigens, as used herein refer to non-self antigens. Foreign antigens may be the products of or encoded by the genome of other organisms. For example, a foreign antigen to a mammal can be an antigen encoded by an infectious agent such as a microbe. Infectious agent antigens may be bacterial, viral, fungal, protozoan, and the like. [0097] The term "influenza virus" as used herein refers to any of the influenza virus Types A, B and C that can infect mammals or birds. "Influenza" as used herein refers to an acute contagious influenza virus infection that is generally characterized by fever, chills, muscular pain, prostration and that generally involves the respiratory system with symptoms such as inflammation of the respiratory tract.
[0098] The term "hemagglutinin" ("HA") is a major glycoprotein that comprises over 80% of the envelope proteins present in the influenza virus particle. Hemagglutinin binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. Hemagglutinin also is responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induce an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide.
[0099] The term "hemagglutinin" refers to the full length protein and fragments thereof which share at least one antigenic determinant with full length hemagglutinin. "Hemagglutinin" as used herein may be native, recombinant or synthetic and may be post-translationally modified such as by glycosylation and/or palmitoylation. There are currently at least sixteen different known subtypes of hemagglutinin characterized antigenicly, termed Hl through Hl 6.
[0100] Hemagglutinin is synthesized as a precursor of about 566 amino acids. An exemplary amino sequence of an HA from an H5N1 virus is shown in FIG. 2 and an HA from an H3N2 virus is shown in FIG. 4. The sequence of various hemagglutinins are found in protein and nucleotide databases such as SwissProt and GenBank. See, e.g., Swiss Prot accession nos. P03437, P03441, P19694, P19695, P12581, P07976, P07977, P09345, GenBank accession no. AF036356 (H5N1 virus); and VOl 085 (H3N2 virus). These databases notate the various functional domains of the HA protein. For example, SwissProt accession no. P03437 discloses a sequence of an H3 hemagglutinin. This molecule is synthesized as a 566 aa precursor. Amino acids 1- 16 represent a 16 aa signal sequence; 17-530 represents a 514 aa extracellular domain; 531-551 represents a 21 aa transmembrane domain; and 552-566 represents a 15 aa cytoplasmic domain. Nucleotide sequence encoding the extracellular domain of an HA is shown in FIG. 5a. The 566 amino acid precursor is exported to the cell membrane of influenza virus where it gets cleaved into the HAl and HA2 subunits. The HAl subunit represents 17-344 of the HA precursor while the HA2 subunit represents 345-566 of the HA precursor. The HA molecule has a large extracellular domain of about 500 aa. A posttranslational cleavage by host-derived enzymes generates 2 polypeptides that remain linked by a disulfide bond. Thus, the larger N- terminal fragment HAl which includes about 320-330 aa forms a membrane-distal globular domain (or head) of about 170 amino acids that contains the receptor-binding site and most antigenic determinants recognized by virus-neutralizing antibodies. The smaller C-teπninal portion HA2 which includes about 180 aa (excluding transmembrane and cytoplasmic domain) forms a stem-like structure that anchors the globular domain to the cellular or viral membrane. The hinge region is located between the stem and globular domain.
[0101] Sixteen HA subtypes have been currently identified among influenza A viruses; three of these (Hl, H2, H3) have been associated with classic influenza isolates, and 3 (H5, H7, H9) have been associated with recent sporadic human isolates. Influenza B viruses possess only 1 HA subtype. Thus, the sequence for each HA and the positions of the various functional domains of the HA can differ and are easily determined by one skilled in the art.
[0102] In some embodiments, the antigen is the entire extracellular domain of HA. Alternatively, smaller regions of the extracellular domain may serve as the antigen for invention vaccines. In choosing an antigen, one of skill in the art would recognize that one could select an antigen that is recognized by MHC class II molecules to elicit an antibody ("humoral") response or an antigen that is recognized by MHC class I molecules to illicit a cytotoxic T cell ("cellular") response. In preferred embodiments, a region of the viral protein is chosen that encompasses antigens recognized by both MHC I and MHC II. Such a region may be a contiguous stretch of amino acids from the native protein or may include discontinuous regions linked together. [0103] In addition, antigenic regions of the HA molecule have been identified through the production of antibodies, some of which are neutralizing. The literature identifies four sites (A through D) on the HA molecule that tend to elicit antibody responses. Sites A, B, and D can be found on the head portion of the HA molecule, while site C is on the hinge (Nature 1981 289:373-8).
[0104] In one example, fragments of HA from the H5N1 strain of influenza are used as the influenza antigen. The sequence set forth in SEQ ID NO: 9 represents an exemplary amino acid sequence of a precursor HA molecule from strain H5N1 (GenBank ID g2865380). The extracellular domain of this sequence is from about amino acid 17 to 530. In some embodiments, the entire extracellular domain is used as the influenza antigen. In other embodiments, one or more fragments of the extracellular domain of HA are used. Preferred fragments of the extracellular domain of SEQ ID NO:9 are shown below. Further, there are a number of epitopes predicted to bind MHC class I or MHC class II molecules within this region. Exemplary predicted MHC class I epitopes and MHC class II epitopes are underlined and italicized, respectively, in the sequences below.
NHFEKIQIIPKSSWSNHD ASSGVSSACP YLGRSSFFRNJΨWLIKKNSAYPT
IKRSYNNTNQEDLLVLWGVHHPNDAAEQTKLYQNPTTYISVGTSTLN QRLVPEIATRPKVNGQSGRMEFFWTILKPNDAINFESN (SEQ ID
NO:12);
NHFEKIQIIPKSSWSNHD ASSGYSSACPYLGRSSFFRNVrWLIKKNSAY? TIKRSYNNTNQ (SEQ ID NO: 13);
IOnPKSSWSNHDASSGVSSACPYLGRSSFFRNPT^/i^aV&4yP7IKRSY (SEQ ID NO: 14);
KSSWSNHDASSGVSSACPYLGRSSFFRNVVWLIKKNSAYPT (SEQ ID NO: 15);
TLNQRLVPEIATRPKVNGQSGRMEFFWTILKPNDAINFESN (SEQ ID NO: 16) LVPEIATRPKVNGQSGRMEFFWTILKPNDAI (SEQ ID NO: 17); or
ATRPKVNGQSGRMEFFWTILK (SEQ ID NO: 18).
[0105] Additional antigen sequences are possible and may be identified with any of a number of computer programs known in the art for that purpose. For example, "SYFPEITHI is a publicly available database for MHC ligands and peptide motifs is supported by DFG-Sonderforschungsbereich, 510 and the European Union: EU BIOMED CT95-1627, BIOTECH CT95-0263, and EU QLQ-CT- 1999-00713 (www. syfpeithi . de/S cripts/MHCS erver . dll/EpitopePrediction.htm) .
[0106] In further embodiments the focus of the influenza antigen one could design an antigen that is dominated by portions of the HA receptor binding site which elicit neutralizing antibodies (i.e., antibodies that prevent host infection by, for example, the blocking of HA binding to the HA receptor). For example, neutralizing antibodies to H5N1 (GenBank ID g2865380, SEQ ID NO:9) have been described in the literature to react mainly with (amino acid residues Y91, Wl 49, E 186, and Ll 90 and sequences SGVSS (SEQ ID NO:19, corresponding to amino acid residues 129-133) and NGQSG (SEQ ID NO:20, corresponding to amino acid residues 220-224) (Science 279:393-6, 1998, Figure 1). These residues are shown in FIG. 20 as underlined residues. Thus, an influenza antigen may include mainly the two sites SGVSS (SEQ ID NO: 19) and NGQSG (SEQ ID NO: 20). As is known in the art, the receptor binding site can vary from HA molecule to HA molecule from different strains and even within a strain.
[0107] An exemplary "influenza antigen" includes a protein fragment representing the receptor binding region of HA from an H5N1 virus, repressing amino acids 134- 205 (see FIG 2).
[0108] Combinations of two or more of the above fragments may be used as the antigen. Such fragments may be joined by a linker or may be immediately adjacent to each other. One example of a combination of two fragments is
KSSWSNHDASSGVSSACPYLGRSSFFRNVVWLIKKNSAYPTATRPKVN GQSGRMEFFWTILK (SEQ ID NO:21), which represents SEQ ID NO: 15 immediately adjacent and upstream of SEQ ID NO: 18. One skilled in the art would recognize that these fragments could be joined with SEQ ID NO: 18 upstream of SEQ ID NO: 15 as well.
[0109] In another example, fragments of HA from the H3N2 strain of influenza are the influenza antigen. The sequence set forth in SEQ ID NO: 10 and shown in FIG. 21 represents an exemplary amino acid sequence of a precursor HA molecule from strain H3N2 (GenBank ID Accession No. VOl 086). The extracellular domain of this sequence is from about amino acid 17 to 530. The extracellular domain of this sequence is from about amino acid 17 to 530. hi some embodiments, the entire extracellular domain is used as the antigen in invention vaccines. In other embodiments, one or more fragments of the extracellular domain of HA are used. Preferred fragments of the extracellular domain of SEQ ID NO: 10 are shown below.
[0110] Preferred fragments of the extracellular domain of SEQ ID NO: 10 are shown below.
TITNDQIEVTNATELVQSSSTGKICNNPHRILDGINCTLID ALLGDPHCD
GFQNEKWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFINEGF
NWTGVTQNGGSSACKRGPDSGFFSRLNWLYKSGSTYPVQNVTMPNN
DNSDKLYIWGVHHPSTDKEQTNLYVQASGKVTVSTKRSQQTIIPNVGS
RPWVRGLSSRISIYWTIVKPGDILVINSNGNLIAPRGYFK (SEQ ID
NO:22).
[0111] SEQ ID NO:22 comprises antigenic regions recognized by MHC class I molecules. The following sequences represent exemplary MHC class I epitopes.
TITNDQIEV (SEQ ID NO:23); ILDGINCTLIDA (SEQ ID NO:24); LFVERSKAF (SEQ ID NO:25); PYDVPDYASLRSLVASSG (SEQ ID NO:26); WLYKSGSTY (SEQ ID NO:27) NNDNSDKLY (SEQ ID NO:28); and STDKEQTNLY (SEQ ID NO:29).
[0112] SEQ ID NO:22 comprises antigenic regions recognized by MHC class II molecules. The following sequences represent exemplary MHC class II epitopes.
TELVQSSSTGKICNN (SEQ ID NO: 30); PHRILDGINCTLIDA (SEQ ID NO:31); and VPDYASLRSLVASSG (SEQ ID NO:32).
[0113] Further preferred fragments include those residues reported to be involved in receptor binding of a precursor HA molecule from strain H3N2 (SEQ ID NO: 10). Such residues are shown in FIG. 21 as underlined residues. Thus, preferred fragments include, for example, EFINEG (SEQ ID NO:33). A further preferred fragment is KAFSNCYPYDVPDY (SEQ ID NO:34) which has been shown to be an epitope against which neutralizing antibodies have been generated (Int Arch Allergy Immunol 2002 127:245-50).
[0114] One of skill in the art would recognize one could join two or more of the above sequences to form an antigen. Further one could extend the sequence of any of the fragments by, for example, 5 amino acids or more preferably, 10 amino acids, on either end or both ends.
[0115] The term neuraminidase ("NA") as used herein refers to a glycoprotein found on the surface of influenza viruses. Neuraminidase catalyses the removal of terminal sialic acid residues of glycosyl groups, thereby destroying potential receptors for HA. It is believed that neuraminidase ensures the efficient spread of the virus by dissociating the mature virions from the neuraminic acid containing glycoproteins. Thus, NA-specifϊc antibodies inhibit the release of newly formed virus from infected host cells and thereby limit the spread and shedding of virus during infection.
[0116] The term "neuraminidase" refers to the full length protein and fragments thereof which share at least one antigenic determinant with full length neuraminidase. "Neuraminidase" as used herein may be native, recombinant or synthetic and may be post-translationally modified such as by glycosylation. There are currently at least nine neuraminidase sub-types. [0117] Neuraminidase is synthesized as a precursor of about 469 amino acids. The sequence of various NA are found in protein and nucleotide databases such as Swiss- Prot and GenBank. See, e.g., Swiss-Prot accession nos P06818, P26143, Q9Q0U7, P06820, GenBank accession no. AF028708 (H5N1 virus), and AB124658 (H3N2 virus). These databases annotate the various functional domains of the NA protein. For example, SwissProt accession no. P06818 discloses a sequence of an N2 Neuraminidase from influenza A virus (strain A/Bangkok/1/79). This molecule is synthesized as a 469 aa precursor. Amino acids 1-6 represent a 6 aa cytoplasmic domain; 7-35 represent a 29 aa transmembrane domain; and 36-469 represents a 434 aa extracellular domain. The extracellular domain consists of a 55 aa hypervariable stalk region (amino acid residues 36 through 90) and a 379 aa head region (amino acid residues 91 through 469). The sequence for each NA and the positions of the various functional domains of the NA can differ and are easily determined by one skilled in the art.
[0118] In some embodiments, the influenza antigen is from the neuraminidase protein. In preferred embodiments, the entire extracellular domain of neuraminidase is used as the influenza antigen. Alternatively, fragments of the extracellular domain may also be selected as the influenza antigen. In such fragments, one of skill in the art can use any of a number of computer software programs for choosing antibody epitopes or antigens for MHC class I or MHC class II molecules, known in the art and discussed above. In preferred embodiments the antigen is focused around regions of the neuraminidase protein known in the art to be antigenic and, more particularly, regions which include residues of known escape mutants. "Escape mutants" as used herein are proteins which have a mutation in an antigenic region such that an antibody that previously bound to that region will no longer bind. In this way, such mutants escape or evade an immune response. In other embodiments, one or more fragments of the extracellular domain of NA are used.
[0119] In one example, the influenza antigen is neuraminidase from influenza virus A/Memphis/31/98, H3N2. An exemplary sequence NA from H3N2 is set forth in SEQ ID NO: 11 (GenBank ID No. g30385699) and is shown in FIG. 22. The extracellular domain of SEQ ID NO:11 is indicated in FIG. 22 (shaded region) and is the influenza antigen in some embodiments. Furthermore, several escape mutants have been described in the literature. For example, Gulati and coworkers describe escape mutants with mutations at amino acid positions 198, 199, 220, and 221 (underlined and in bold in FIG. 22) (J Virol 2002 76(23): 12274-80). Preferred fragments of SEQ ID NO:11 are shown below.
QCKITGFAPFSICDNSIRLSAGGDIWVTREPYVSCDPDKCYQFALGQGT
TLNNRHSNDTVHDRTPYRTLLMNELGVPFHLGTKQVCIAWSSSSCHD
GICAWLHVCVTGHDENATASFIYDGRLVDSIGSWSKKILRTQESECVCI
NGTCTVVMTDGSASGRADTKILFIEEGKIVHISPLSGSAQHVEECSCYP
RYPGVRCVCRDNWKGSNRPIVDINVKDYSIVSSYVCSGLVGDTPRKN
DSSSSSHCLNPNNEEGGHGVKGWAFDDGNDVWMGRTISEKFRSGYET
FKVIEGWSICPNSKLQINRQVIVDRGNRSGYSGIFSVEGKSCINRCFYVE
LIRGRKQETEVWWTSNSIVVFCGTSGTYGTGSWPDGADINLMPI (SEQ
ID NO:35, corresponds to the head region of NA);
AWLHVCVTGHDENATASFIYDGRLVDSIGSWSKKILRTQESECV (SEQ ID NO:36);
CVTGHDENATASFIYDGRLVDSIGSWSKKILRTQ (SEQ ID NO:37); and
DENATASFIYDGRLVDSIGSWSKK (SEQ ID NO:38).
[0120] The term Matrix protein 2 ("M2") as used herein refers to an integral membrane protein expressed on the surface of the influenza virus and the infected cells. M2 is expressed at high levels of influenza virus infected cells, and compared to hemagglutinin and neuraminidase has a stable sequence from year to year among different influenza strains. Although this protein is not typically immunogenic, it has been shown that chimeric molecules made from the extracellular domain of M2 and "adjuvant proteins" such as the hepatitis B core protein induce a potent immune response. (Virology 2005 337:149-161; Infection and Immunity 2002 70:6860-70).
[0121] M2 is synthesized as a precursor of about 109 amino acids. An exemplary amino sequence of an M2 from an H5N1 virus is shown in FIG. 1 and an M2 from an H3N2 virus is shown in FIG. 3. The sequence of various M2 are found in protein and nucleotide databases such as SwissProt and GenBank. See, e.g., Swiss Prot accession nos. P13881, P13882, P03493, Q80DN6, P08383, P0C0X4, P21430, P03491, GenBank accession no. AF036358 (H5N1 virus); and AAA43276 (H3N2 virus). These databases annotate the various functional domains of the M2 protein. For example, SwissProt accession no. P21430 (influenza A virus) discloses a sequence of an M2. This molecule is synthesized as a 97 aa precursor. Amino acids 1-22 represent a 22 aa extracellular domain; 23-43 represents a 21 aa transmembrane domain; and 44-97 represents an 54 aa cytoplasmic domain. Nucleotide sequence encoding the extracellular domain of an M2 is shown in FIG. 5b. The sequence for each M2 and the positions of the various functional domains of the M2 can differ and are easily determined by one skilled in the art. For example, M2 from Influenza B virus has a very short 4 aa extracellular domain.
[0122] The term "influenza antigen" as used herein refers to any part, portion or region of an influenza virus protein that can elicit an immune response in mammals or birds. Influenza antigens can be native, recombinant or synthetic. An "influenza antigen" may be include epitopes derived from a single viral type or strain or from multiple viral types or strains. An "influenza antigen" may be a fusion protein of epitopes from the same or different viral types or strains. An "influenza antigen" as used herein may include the HA, NA or M2 protein, or fragments thereof containing one or more epitopes; an "influenza antigen" may contain the entire extracellular domain of HA, NA or M2, the cytoplasmic domain of HA, NA or M2 and/or any immunogenic combination of these proteins or domains.
[0123] An exemplary extracellular domain of M2 from Hong Kong/485/97(H5Nl) matrix protein 2 (GenBank Accession No:AJ278648)
MSLLTEVDTLTRNGWGCRCSDSSD (SEQ ID NO:39),
which is encoded by the nucleotide sequence 5'- ATG AGC CTT CTA ACC GAG GTT GAC ACG CTT ACC AGA AAC GGA TGG GGG TGC AGA TGC AGC GATTCA AGT GAT - 3' (SEQ ID NO:40).
[0124] A further example of an M2 antigen Influenza A virus (A/New York/522/1997(H3N2) CY006508) is
5'- ATGAGCC TTCTAACCGA GGTCGAAACACC TATCAGAAAC GAATGGGGGT GCAGATGCAA CGATTCAAGT GAC-3' (SEQ ID NO:41).
The above sequence encodes the following sequence, corresponding to amino acids 1- 24 ofthe M2 protein,
MSLLTEVETPIRNEWGCRCNDSSD (SEQ ID NO:42)
[0125] Another example of an influenza antigen is a chimeric protein having a segment of an HA and a segment of an M2 protein (e.g. from an H5N1 or H3N2 virus). In one example of a chimeric influenza antigen is the following sequence which encodes an HA-M2 chimera from H5N1.
5 '- AAAAGTTCTTGGTCCAATCATGATGCCTCATCAGGGGTGAGCTC AGCATGTCCATACCTTGGGAGGTCCTCCTTTTTCAGAAATGTGGTAT GGCTTATCAAAAAGAACAGTGCATACCCAACAGCTACTAGACCCA A
AGTAAACGGGCAAAGTGGAAGAATGGAGTTCTTCTGGACAATTTTA AAG GATATC ATGA GCCTTCTAAC CGAGGTTGAC ACGCTTACCAGA AACGGATGGG GGTGCAGATG CAGCGATTCAAGTGAT-3' (SEQ ID NO:43).
[0126] In the above exemplary sequence the HA and M2 fragments are joined by an optional 2 amino acid linker (nucleotides encoding the linker are underlined in the sequence above). The HA fragment precedes the linker and the M2 fragment follows the linker. One of skill in the art would recognize that the order of these fragments could be reversed with the M2 fragment preceding the HA fragment. An exemplary nucleotide sequence encoding such a fragment is below.
5'- ATGAGCCTTCTAACCGAGGTTGACACGCTTACCAGAAACGGATG
GGGGTGCAGATGCAGCGATTCAAGTGATAAAAGTTCTTGGTCCAAT
CATGATGCCTCATCAGGGGTGAGCTCAGCATGTCCATACCTTGGGA
GGTCCTCCTTTTTCAGAAATGTGGTATGGCTTATCAAAAAGAACAG
TGCATACCCAACAGCTACTAGACCCAAAGTAAACGGGCAAAGTGG
A AGAATGGAGTTCTTCTGGACAATTTTAAAG -3' (SEQ ID NO:44).
[0127] Another example of a chimeric influenza antigen includes fragments of HA and M2 (underlined) from H3N2 and is as follows,
TITNDQIEVTNATELVQSSSTGKICNNPHRILDGINCTLID ALLGDPHCD
GFQNEKWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFINEGF
NWTGVTQNGGSSACKRGPDSGFFSRLNWLYKSGSTYPVQNVTMPNN
DNSDKLYIWGVHHPSTDKEQTNLYVQASGKVTVSTKRSQQTIIPNVGS
RPWVRGLSSRISIYWTIVKPGDILVINSNGNLIAPRGYFKMSLLTEVETP
IRNEWGCRCN DSSD (SEQ ID NO:45).
[0128] Other chimeras can be constructed from fragments of neuraminidase and M2 or HA. For example, the following sequence consists of the head region of neuraminidase and a the extracellular domain of M2 (underlined), both from H3N2.
QCKITGF APFSKDNSIRLSAGGDIWVTREPYVSCDPDKCYQFALGQGT TLNNRHSNDTVHDRTPYRTLLMNELGVPFHLGTKQVCIAWSSSSCHD GKAWLHVCVTGHDENATASFΓYDGRLVDSIGSWSKKILRTQESECVCI • NGTCTWMTDGSASGRADTKILFIEEGKIVHISPLSGSAQHVEECSCYP RYPGVRCVCRDNWKGSNRPIVDINVKDYSIVSSYVCSGLVGDTPRKN DSSSSSHCLNPNNEEGGHGVKGWAFDDGNDVWMGRTISEKFRSGYET FKVIEGWSKPNSKLQINRQVIVDRGNRSGYSGIFSVEGKSCINRCFYVE LIRGRKOETEVWWTSNSIVVFCGTSGTYGTGSWPDGADINLMPIMSLL TEVETPIRNEWGCRCN DSSD (SEQ ID NO:46). [0129] One of skill in the art would recognize that fragments from different proteins of different strains of influenza viruses may be combined to form an antigen. In some embodiments, M2 comprises one of the two fragments. In the following example, a fragment of HA from H5N1 is combined with an M2 fragment (underlined) from H3N2,
KSSWSNHDASSGVSSACPYLGRSSFFRNVVWLIICK-NSAYPTATRPKVN GOSGRMEFFWTILK MSLLTEVETPIRNEWGCRCNDSSD (SEQ ID NO:47).
[0130] As used herein, an "influenza antigen-CD40L" means an influenza protein linked to CD40L. For example, this may be an H3N2 or H5N1 HA antigen linked to CD40L; an H3N2 or H5N1 HA-M2 chimeric antigen linked to CD40L; or an H3N2 or H5N1 M2 linked to CD40L. Although the above examples list H3N2 and H5N1, an "influenza antigen" as used herein refers to antigens expressed by an influenza virus and includes proteins or fragments from other Type A, B or C influenza viruses.
[0131] A secretable form of an antigen is one that lacks all or substantially all of its transmembrane domain, if present in the mature protein. For example, in the case of a hemagglutinin, the transmembrane domain, if present, is generally about 19-21 amino acids in length and functions to anchor the hemagglutinin or a fragment of the hemagglutinin in the cell membrane. For example, in the case of the hemagglutinin disclosed in SwissProt accession no. P03437, a secretable form of this hemagglutinin in which the transmembrane domain has been deleted is missing residues 531-551 of the precursor protein. A hemagglutinin missing substantially all of the transmembrane domain is one where the domain comprises 6 residues or less of sequence at one end of the transmembrane domain, more preferably less than about 4 residues of sequence at one end of the transmembrane domain, even more preferably less than about 2 residues of sequence on one end of the transmembrane domain, and most preferably 1 residue or less on one end of the transmembrane domain. In a preferred embodiment, the vaccine vector transcription unit encodes a secretable form of a hemagglutinin lacking the entire transmembrane domain. A hemagglutinin that lacks substantially all of the transmembrane domain rendering the hemagglutinin secretable is one that contains no more than six residues of sequence on one end of the domain. The extracellular domain of a human HA is denoted herein as "ecdHA."
[0132] It should be understood that a hemagglutinin, neuraminidase or M2 protein which lacks a functional transmembrane domain (i.e., is in secretable form) may still include all or a portion of the cytoplasmic domain.
[0133] A source of DNA encoding the various hemagglutinins, neuraminidases or M2 antigens may be obtained from hemagglutinins, neuraminidases or M2 expressing cell lines using a commercial cDNA synthesis kit and amplification using a suitable pair of PCR primers that can be designed from the published DNA sequences. Hemagglutinin, neuraminidase or M2 encoding DNA also may be obtained by amplification from RNA or cDNA obtained or prepared from infected human or other animal tissues or cells, or from viral isolates. For DNA segments that are not that large, the DNA may be synthesized using an automated oligonucleotide synthesizer.
[0134] The term "linker" as used herein with respect to the transcription unit of the expression vector refers to one or more amino acid residues between the carboxy terminal end of the antigen and the amino terminal end of CD40 ligand. The composition and length of the linker may be determined in accordance with methods well known in the art and may be tested for efficacy. (See e.g. Arai et al., design of the linkers which effectively separate domains of a bifunctional fusion protein. Protein Engineering, Vol. 14, No. 8, 529-532, August 2001). The linker is generally from about 3 to about 15 amino acids long, more preferably about 5 to about 10 amino acids long, however, longer or shorter linkers may be used or the linker may be dispensed with entirely. Longer linkers may be up to about 50 amino acids, or up to about 100 amino acids. A linker of about 30 residues is preferred when the M2 or hemagglutinin antigen is N-terminal to the CD40 ligand. One example of a linker well-known in the art is a 15 amino acid linker consisting of three repeats of four glycines and a serine (i.e., [GIy4SCr]3).
[0135] The term "CD40 ligand" (CD40L) as used herein refers to a full length or portion of the molecule known also as CD 154 or TNF5. CD40L is a type II membrane polypeptide having a cytoplasmic domain at its N-terminus, a transmembrane region and then an extracellular domain at its C-terminus. Unless otherwise indicated the full length CD40L is designated herein as "CD40L," "wtCD40L" or "wtTmCD40L." The form of CD40L in which the cytoplasmic domain has been deleted is designated herein as "ΔCtCD40L." The form of CD40L where the transmembrane domain has been deleted is designated herein as "ΔTmCD40L." The form of CD40L where both the cytoplasmic and transmembrane domains have been deleted is designated herein as "ΔCtΔTmCD40L" or "ecdCD40L." The nucleotide and amino acid sequence of CD40L from mouse and human is well known in the art and can be found, for example, in U.S. Patent No. 5,962,406 (Armitage et al.). Also included within the meaning of CD40 ligand are variations in the sequence including conservative amino acid changes and the like which do not alter the ability of the ligand to elicit an immune response to a mucin in conjunction the fusion protein of the invention.
[0136] Murine CD40L (mCD40L) is 260 amino acids in length. The cytoplasmic (Ct) domain of mCD40L extends approximately from position 1-22, the transmembrane domain extends approximately from position 23-46, while the extracellular domain extends approximately from position 47-260.
[0137] Human CD40L (hCD40L) is 261 amino acids in length. The cytoplasmic domain of hCD40L extends approximately from position 1-22, the transmembrane domain extends approximately from position 23-46, while the extracellular domain extends approximately from position 47-261.
[0138] The phrase "CD40 ligand is missing all or substantially all of the transmembrane domain rendering CD40 ligand secretable" as used herein refers to a recombinant form of CD40 ligand that can be secreted from a cell. The transmembrane domain of CD40L which contains about 24 amino acids in length, functions to anchor CD40 ligand in the cell membrane. CD40L from which all of the transmembrane domain has been deleted is CD40 ligand lacking residues 23-46. CD40 ligand missing substantially all of the transmembrane domain is one that comprises 6 residues or less of the transmembrane domain, more preferably less than about 4 residues of transmembrane domain sequence, even more preferably less than about 2 residues of transmembrane domain sequence and most preferably 1 residue residues from the transmembrane domain sequence. Any transmembrane sequence that is present from the CD40L may be at one end of the domain or may constitute transmembrane domain sequence contributed by both ends. Thus, a CD40L that lacks substantially all of the transmembrane domain rendering the CD40L secretable is one that retains no more than six residues of sequence of the transmembrane domain. Such as CD40L would contain, in addition to the extracellular domain and optionally the cytoplasmic domain, no more than amino acids 41-46 or 23-28, or a combination totaling 6 residues or less from both ends of the transmembrane domain of CD40L. In a preferred embodiment, the vaccine vector transcription unit encodes a secretable form of CD40 containing less than 10% of the transmembrane domain. More preferably, CD40L contains no transmembrane domain.
[0139] It should be understood that a CD40L which lacks a functional transmembrane domain may still include all or a portion of the cytoplasmic domain. Likewise, a CD40L which lacks a functional transmembrane domain may include all or a substantial portion of the extracellular domain.
[0140] Expression vectors encoding a secretable fusion protein that includes an influenza antigen and CD40 ligand can be constructed in accordance with methods known in the art. See, e.g., U.S. Patent Application Publication US 2005-0226888 (application serial No. 11/009,533) titled "Methods for Generating Immunity to Antigen," filed 12/10/2004, which is incorporated herein in its entirety including the drawings.
[0141] As used herein, an expression vector and fusion protein boost is administered as a vaccine to induce immunity to an influenza antigen. The expression vector and protein boost may be formulated as appropriate with a suitable pharmaceutically acceptable carrier. Accordingly, the vectors or protein boost may be used in the manufacture of a medicament or pharmaceutical composition. Expression vectors and the fusion protein may be formulated as solutions or lyophilized powders for parenteral administration. Powders may be reconstituted by addition of a suitable diluent or other pharmaceutically acceptable carrier prior to use. Liquid formulations may be buffered, isotonic, aqueous solutions. Powders also may be sprayed in dry form. Examples of suitable diluents are normal isotonic saline solution, standard 5% dextrose in water, or buffered sodium or ammonium acetate solution. Such formulations are especially suitable for parenteral administration, but may also be used for oral administration or contained in a metered dose inhaler or nebulizer for insufflation. It may be desirable to add excipients such as polyvinylpyrrolidone, gelatin, hydroxy cellulose, acacia, polyethylene glycol, mannitol, sodium chloride, sodium citrate, and the like.
[0142] Alternately, expression vectors and the fusion protein may be prepared for oral administration. Pharmaceutically acceptable solid or liquid carriers may be added to enhance or stabilize the composition, or to facilitate preparation of the vectors. Solid carriers include starch, lactose, calcium sulfate dihydrate, terra alba, magnesium stearate or stearic acid, talc, pectin, acacia, agar or gelatin. Liquid carriers include syrup, peanut oil, olive oil, saline and water. The carrier may also include a sustained release material such as glyceryl monostearate or glyceryl distearate, alone or with a wax. The amount of solid carrier varies but, preferably, will be between about 20 mg to about 1 g per dosage unit. When a liquid carrier is used, the preparation may be in the form of a syrup, elixir, emulsion, or an aqueous or nonaqueous suspension.
[0143] Expression vectors and the fusion protein may be formulated to include other medically useful drugs or biological agents. The vectors also may be administered in conjunction with the administration of other drugs or biological agents useful for the disease or condition that the invention compounds are directed.
[0144] As employed herein, the phrase "an effective amount," refers to a dose sufficient to provide concentrations high enough to generate (or contribute to the generation of) an immune response in the recipient thereof. The specific effective dose level for any particular subject will depend upon a variety of factors including the disorder being treated, the severity of the disorder, the activity of the specific compound, the route of administration, the rate of clearance of the viral vectors, the duration of treatment, the drugs used in combination or coincident with the viral vectors, the age, body weight, sex, diet, and general health of the subject, and like factors well known in the medical arts and sciences. Various general considerations taken into account in determining the "therapeutically effective amount" are known to those of skill in the art and are described, e.g., in Gilman et al., eds., Goodman And Gilman's: The Pharmacological Bases of Therapeutics, 8th ed., Pergamon Press, 1990; and Remington's Pharmaceutical Sciences, 17th ed., Mack Publishing Co., Easton, Pa., 1990. For administration of vectors, the range of particles per administration typically if from about 1 X 107 to 1 X 10n , more preferably 1 X 108 to 5 X 1010, and even more preferably 5 X 108 to 2 X 1010. A vector can be administered parenterally, such as intravascularly, intravenously, intraarterially, intramuscularly, subcutaneously, or the like. Administration can also be orally, nasally, rectally, transdermally or inhalationally via an aerosol. The vectors may be administered as a bolus, or slowly infused. The vector is preferably administered subcutaneously.
[0145] As described herein, vectors encoding influenza antigens can induce a protective cellular and humoral immunity against such antigens, including those to which tolerance had developed. Although not wishing to be bound by any theory, it is believed that the invention vaccines generate upon administration a continual local release of the fusion protein composed of the secretable form of the antigen linked to a secretory form of CD40 ligand. As demonstrated herein this facilitates DCs maturation, promoting the development of effective antigen-specific immunity. It is also demonstrated herein that the secretable fusion protein encoding the extracellular domain of H5N1 HA and the murine CD40L lacking a transmembrane and cytoplasmic domain (i.e. H5HA-ΔCtΔTmCD40L) produced from an adenoviral vector dramatically increased the number of CD8 T cells responsive to H5HA. Although not wishing to be bound by any theory, it is believed that subcutaneous injection of the Ad-sig-H5HA -ΔCtΔTmCD40L vector elicits a strong HA specific CD8+ T cell- mediated immunity.
[0146] The immunity generated against the antigens using the invention methods is long lasting. As used herein, the term long lasting means that immunity elicited by the antigen encoded by the vector can be demonstrated for up to 6 months from the last administration, more preferably for up to 8 months, more preferably for up to one year, more preferably up to 1.5 years, and more preferably for at least two years.
[0147] In one embodiment, immunity to an influenza hemagglutinin can be generated by producing a fusion protein that comprises part of the extracellular domain of the hemagglutinin fused to the amino-terminal end of the CD40 ligand from which the transmembrane and cytoplasmic domains were deleted. Construction of such vector is disclosed in the Examples. As was observed herein, subcutaneous administration of this adenoviral vector hemagglutinin vaccine induced a CD8+ cytotoxic T cell lymphocyte dependent systemic immune response.
[0148] Although not wishing to be bound by any theory, it is believed that the cells infected in the vicinity of the site of subcutaneous injection of the vector release the antigen/CD40 ligand secretory which is taken up by antigen presenting cells (e.g. DCs) in the vicinity of the infected cells. The internalized influenza antigen would be digested in the proteosome with the resultant influenza antigen peptides trafficking to the endoplasmic reticulum where they would bind to Class I MHC molecules. Eventually, the DCs would present the influenza antigen on the surface in the Class I MHC molecule. Activated, influenza antigen-loaded antigen presenting cells would migrate to lymphocyte bearing secondary organs such as the regional lymph nodes or the spleen. During the two weeks of continuous release of the antigen/CD40 fusion protein, CD8 cytotoxic T cell lymphocytes competent to recognize and kill cells, which carried the antigens, would be expanded in the lymph nodes and spleen by the presence of the activated and antigen loaded dendritic cells. The continuous nature of the stimulation and the expansion of the influenza antigen specific cytotoxic T cells by the continuous release from the vector infected cells is believed to generate an immune response which would be greater in magnitude than is possible using a vector which carried an antigen/CD40 ligand which is non-secretory.
[0149] Methods to test the novel influenza vaccines, proteins and vaccination methods of the present invention may include in vitro and in vivo methods well known in the art, method as described herein, and may also involve methods utilizing mouse models and viruses that have been mouse adapted. For example, the laboratories of M.K. Sim and Vincent Chow at the National University of Singapore's School of Medicine have developed a mouse model for the study of the Ad-sig- H3N2/ecdCD40L vaccine against H3N2 influenza A virus. The A/Aichi/2/68 (H3N2) strain (Arch. Virol. 1983 75:17-27; Virology 1995 212:526-534) was mouse-adapted by passaging through several batches of 2 month old mice via intranasal administration. Briefly, influenza virus was initially administered intranasally to 6 week-old female BALB/c mice. Two days later, the animals were sacrificed, lung homogenates prepared and labeled as "passage- 1 lung homogenate". A second batch of BALB/c mice was infected with 50 μL of passage- 1 lung homogenate, and the process of passaging was repeated. The virus virulence and titer in each passage of lung homogenate was monitored by assaying its infectivity in Madin-Darby canine kidney (MDCK) cells, host cells which are permissive for influenza A virus replication. The influenza A virus titer increased progressively with each passage. Thus it is possible to adapt an H3N2 influenza virus to the Balb/C mouse strain.
[0150] In similar fashion, an H5N1 influenza virus may also be adapted to a mouse strain by passaging through several batches of 2 month old mice via intranasal administration, using the method of Chow described above. Briefly, the virus is initially administered intranasally to 6 week-old female BALB/c mice. Two days later, the animals are sacrificed, lung homogenates prepared and labeled as "passage- 1 lung homogenate." A second batch of BALB/c mice is infected with 50 μL of passage- 1 lung homogenate, and the process of passaging is repeated. The virus virulence and titer in each passage of lung homogenate is monitored by assaying its infectivity in host cells which are permissive for H5N1 virus replication.
[0151] In a further aspect, the invention provides methods of effectively immunizing older individuals by administering an expression vector encoding a secretable fusion protein which includes an antigen and CD40 ligand. Older individuals which may realize an improved immune response using the methods of the invention as compared to other immunization methods are at least 50 years of age, or even at least 55 years of age or even yet at least 60 years of age. [0152] The invention methods are advantageous over traditional vaccination in providing increased immune responses in older individuals. The benefits of immunizing older individuals, at least 50 years of age, or event at least 55 years of age or even at least 60 years of age is afforded for antigens including cancer antigens (tumor associated or tumor specific) or infectious agent antigens. Infectious agent antigens may be bacterial, viral, fungal, protozoan, and the like. Viral antigens may be an influenza antigen as described above. The viral antigen may be from a human papilloma virus. The viral antigen may be the E6 or E7 protein of human papilloma virus.
[0153] The term "tumor associated antigen" (TAA) as used herein refers to a protein which is present on tumor cells, and on normal cells during fetal life (onco-fetal antigen), after birth in selected organs, or on many normal cells, but at much lower concentration than on tumor cells. A variety of TAA are described that can be used in the invention methods for immunizing older individuals are described in U.S. Patent Application Publication US 2005-0226888 (application serial No. 11/009,533) titled "Methods for Generating Immunity to Antigen," filed 12/10/2004. The patent publication describes various mucin TAA including MUCl and tandem repeats of the mucin VNTR region, and HER2 (neu). Other TAA include but are not limited to carcinoembryonic antigen, prostate specific antigen, CA 125, CA 15-3, and EFGr.
[0154] As used herein, tumor specific antigen (TSA) (aka. "tumor-specific transplantation antigen or TSTA) refers to a protein absent from normal cells. TSAs usually appear when an infecting virus has caused the cell to become immortal and to express a viral antigen(s). An exemplary viral TSA is the E6 or E7 proteins of HPV type 16. TSAs not induced by viruses include idiotypes the immunoglobulin idiotypes associated with B cell lymphomas or the T cell receptor (TCR) on T cell lymphomas.
[0155] The following examples serve to illustrate the present invention. These examples are in no way intended to limit the scope of the invention. EXAMPLES
1. Construction of adenoviral expression vectors (general considerations) [0156] Details for constructing adenoviral expression vectors containing a transcription unit encoding a fusion protein that includes an antigen fused to CD40 ligand can be found in U.S. Patent Application Publication US 2005-0226888 (application serial No. 11/009,533) titled "Methods for Generating Immunity to Antigen," filed 12/10/2004. This publication describes the preparation of expression vector sig-ecdhMUCl-ΔCtΔTmCD40L, which encodes a signal sequence (from an Ig kappa chain) followed by the extracellular domain of human MUCl which is connected via a linker to a fragment of the CD40 ligand (human or mouse), which contains the extracellular domain without the transmembrane or cytoplasmic domains. The fusion protein was engineered to be secreted from vector infected cells by the addition of the kappa chain signal sequence to the amino-terminal end of the fusion protein. As described therein, the transcription unit was introduced into the El gene region of the adenoviral vector backbone. After the adenoviral vector particles were generated in HEK 293 cells, the vector DNA was purified by cesium chloride gradient centrifugation. The presence of the signal peptide in the adenoviral vector was confirmed by restriction enzyme analysis and by DNA sequencing.
[0157] U.S. Patent Application Publication US 2005-0226888 also describes how to prepare a transcription unit that includes DNA encoding the signal sequence of the mouse IgG kappa chain gene upstream of DNA encoding human MUC-I ("sig- ecdhMUC-1"). The transcription unit is formed with the assistance of pShuttle - ΔCtΔTmCD40L (no signal sequence and murine CD40L) as described in U.S. Patent Application Publication US 2005-0226888. Primers are used to encode spacer (linker) between the antigen and CD40L (a 10 residue spacer LEND AQ APKS; single letter code; SEQ ID NO:48). The sig-ecdhMUCl/ΔCtΔTmCD40L encoding DNA was cut from the pCDNA3TOPO vector using Hindlll-Xbal restriction and inserted into pShuttle-CMV (see Murphy et al., Prostate 38: 73-78, 1999) downstream of the CMV promoter. The plasmid is designated ρShuttle-sig-ecdhMUCl-ΔCtΔTmCD40L and contains transcription unit sig-ecdhMUCl-ΔCtΔTmCD40L which encodes the mouse IgG kappa chain secretory signal followed by the extracellular domain of human MUCl followed by a 10 amino acid linker with (LEND AQ APKS; SEQ ID NO:48) followed by murine CD40 ligand residues 52-260.
[0158] U.S. Patent Application Publication US 2005-0226888 also describes cloning the mouse HSFl trimer domain which was added between the ecdhMUCl (antigen) encoding DNA and ΔCtΔTm CD40L by PCR. The construction design includes use of a spacer on each end of the trimer segment. U.S. Patent Application Publication US 2005-0226888 also describes use of PCR to add a His tag encoding sequence added to the end of the ΔCtΔTm CD40L.
[0159] The recombinant adenoviral vectors were generated using the AdEasy vector system (Stratagene, San Diego, CA). Briefly the resulting plasmid pShuttle-sig- ecdhMUCl-ΔCtΔTmCD40L, and other control adenoviral vectors were linearized with Pme I and co-transformed into E. coli strain BJ5183 together with pAdEasy-1, the viral DNA plasmid. Recombinants were selected with kanamycin and screened by restriction enzyme analysis. The recombinant adenoviral construct was then cleaved with Pac I to expose its Inverted Terminal Repeats (ITR) and transfected into 293 A cells to produce viral particles. The titer of recombinant adenovirus was determined by the Tissue culture Infectious Dose (TCID50) method.
2. Production of the fusion protein and vector
[0160] The influenza virus antigen fusion protein was produced directly from an adenoviral vector that carries the expression cassette of the fusion gene encoding the fusion protein. The production cells (e.g. 293 cell line) at 80% confluency in growth medium were infected with the viral vector at the ratio of 10-100 viral particles per cell. The infected cells were further cultured for 48-72 hours, when the viral vectors propagated in the cells and the tumor antigen fusion proteins were expressed in the cells and secreted into culture media. The infected cells were collected when 70-90% of them showed cytopathic effect (CPE). The cell culture media was collected separately. Cell lysates were prepared through 3 -time freeze-and-thaw cycles. The viral particles were isolated via the standard procedure {see e.g., PNAS 2003 100:15101-15106; Blood 2004 104:2704-2713)). The tumor antigen fusion proteins were purified through affinity chromatograph from the collected cell media.
[0161] The fusion protein also were produced in bacterial cells as follows. The cDNA encoding the fusion protein was subcloned into the pTriEx-2 hygro Vectors (Novagen). Competent cells (Rosetta™ cells, Novagen Inc.) were transformed with the resulting plasmid. Following incubation of the cells in IPTG supplemented medium for 4 hours, a cell lysate was prepared using the CelLytic™ B Plus Kit (Sigma). The fusion protein was purified from the soluble fraction by HIS-select Nickel Affinity Gel (Sigma). Then, the protein was concentrated and desalted by centrifugation through an Ultrafree-15 Biomax-50 filter (Millipore) and eluted with PBS.
3. Construction of Adenoviral vectors encoding HPV E7-CD40 Iigand fusion protein.
[0162] E7 is a protein encoded by the human papilloma virus which appears on all HPV associated dysplastic and neoplastic cells. The transcription unit included DNA encoding the signal peptide from the HGH gene, upstream of DNA encoding the full- length HPV type 16 E7 protein, consisting of 98 amino acids and having the following amino acid sequence:
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEP DRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQ KP (SEQ ID NO:49).
[0163] The coding sequence for this E7 protein was upstream of the coding sequence of a 10 aa spacer, which was upstream of the coding sequence of the coding sequence of ΔCtΔTmCD40L in the transcription unit.
[0164] Construction of an adenoviral vector expressing a transcription unit fusion protein constituting E7 linked to a secretable form of CD40 Iigand has been described See, e.g., U.S. Patent Application Publication US 2005-0226888 (application serial No. 11/009,533) titled "Methods for Generating Immunity to Antigen," filed 12/10/2004. This approach is detailed below.
a) Construction of pShutfle-sp-ΔCtΔTmCD40L(no signal sequence*).
[0165] Plasmid pDC406-mCD40L was purchased from the American Type Culture Collection. A pair of PCR primers (SEQ ID NOs: 50 and 51) was designed to amplify the mouse CD40 ligand from position 52 to 260 (i.e., without the cytoplasmic and transmembrane domains) and include sequence encoding a linker (indicated as "+ spacer ") at the 5' end of the amplicon.
Mouse ΔCtΔTmCD40L+ spacer forward primer (MCD40LSPF) (Xho I recognition site in bold and underlined; spacer sequence underlined (includes the Xho I site); CD40L sequence italicized):
5'- CCG CTCGAG AAC GAC GCA CAA GCA CCA AAA TCA AA G GTC
GAA GAG GAA GTA AAC-V (SEQ ID NO:50).
Mouse CD40L reverse primer (MCD40LR) (Xba I recognition site in bold and underlined)
5'-CCC TCTAGA ATCAGAGTTTCACTAAGCCAA-3 ' (SEQ ID NO: 51).
[0166] The forward primer MCD40LSPF encoded a 10 residue spacer (LENDAQAPKS; single letter code; SEQ ID NO: 48) to be located between the tumor antigen and the CD40 ligand (mCD40L) of the transcription unit. PCR was performed using the forward and reverse primers (SEQ ID NOs:50 and 51) and plasmid pDC406-mCD40L as the template under the following conditions: hold 3 min at 94 0C; cycle 94 0C for 45 sec, 55 0C for 45 sec, 72 0C for 70 sec (30 cycles); hold 7 min at 72 0C; and hold at 4 0C. This PCR resulted in a fragment "sρacer+ΔCtΔTmCD40L," which was inserted into the plasmid pShuttle-CMV (Murphy et al. Prostate 38:73-8, 1999) after restriction endonuclease digestion with Xba I (TCTAGA) and Xho I (CTCGAG). This vector is designated pShuttle-sp- ΔCtΔTmCD40L(no signal sequence). [0167] A vector was produced that was otherwise the same except that it encoded full length CD40L rather than the truncated form. This vector was made using a CD40 forward primer that annealed to the starting codons of murine CD40L. This vector is designated pShuttle-mCD40L (no signal sequence).
b) Construction of pShuttle-E7-sp-ΔCtΔTmCD40L(no signal sequence).
[0168] pShuttle-E7-ΔCtΔTmCD40L (no signal sequence) was prepared by inserting HPV- 16 E7 upstream of the CD40 ligand sequence as follows: Sequence encoding the full-length HPV- 16 E7 protein was obtained by PCR amplifying from the HPV viral genome using the following primers:
HPV 16 E 7 forward primer
5'-ATTT GCGGCCGC TGTAATCATGCATGGAGA-3 ' (SEQ ID NO: 52); HPV E7 reverse primer
5-CC CTCGAG TTATGGTTTCTGAGAACAGAT-S' (SEQ ID NO: 53).
[0169] PCR was performed using the above primers and the HPV 16 viral genome as template under the following conditions: hold 3 min at 94 0C; cycle 94 0C for 40 sec, 58 0C for 40 sec, 72 0C for 40 sec (30 cycles); hold 7 min at 72 0C; and hold at 4 0C. The resulting amplicon was HPV 16 E7 encoding DNA with Not I and Xho 1 restriction sites at the 5' and 3' ends, respectively. The E7 DNA was inserted into the pShuttle-sp-ΔCtΔTmCD40L(no signal sequence) vector between the CMV promoter and directly 5' to the spacer of the spacer-ΔCtΔTmCD40L sequence using the Not I (GCGGCCGC) and Xho I (CTCGAG) restriction sites. The resulting plasmid is designated pShuttle-E7-ΔCtΔTmCD40L(no signal sequence).
c) Construction of pShuttle-HGH/E7-sp-ΔCtΔTmCD40L.
[0170] The pShuttle-E7-sp-ΔCtΔTmCD40L(no signal sequence) vector was used for insertion of the HGH signal sequence, upstream of E7 to generate HGH/E7-sp- ΔCtΔTmCD40L, described as follows. [0171] DNA encoding the human growth hormone signal sequence MATGSRTSLLLAFGLLCLPWLQEGSA (single letter amino acid code) (SEQ ID NO:54) was prepared by annealing phosphorylated oligonucleotides (SEQ ID NOs:55 and 56) to generate the full 26 amino acid HGH sequence with BgI II and Notl overhangs.
Growth hormone signal upper strand (coding sequence in italics):
5'-GATCT CCACC ATG GCTACA GGC TCC CGGACG TCC CTG CTC CTG GCT TTT GGC CTG CTC TGC CTG CCC TGG CTT CAA GAG GGC AGT GCC GGC -3' (SEQ ID NO:55). Growth hormone signal lower strand:
3'-A GGTGG TAC CGA TGT CCG AGG GCC TGC AGG GAC GAG GAC CGA AAA CCG GAC GAG ACG GAC GGG ACC GAA GTT CTC CCG TCA CGG CCGCCGG -5? (SEQ ID NO:56).
[0172] Synthetic HGH signal sequence was prepared by annealing the above upper and lower strand oligos. The oligos were dissolved in 50 μl H2O (about 3 mg/ml). 1 μl from each oligo (upper and lower strand) was added to 48 μl annealing buffer (100 mM potassium acetate, 30 mM HEPES-KOH pH 7.4, and 2 mM Mg-acetate) incubated for 4 minutes at 950C, 10 minutes at 7O0C and slowly cooled to about 4°C. The annealed DNA was phosphorylated using T4 PNK (polynucleotide kinase) under standard conditions.
[0173] The HGH signal sequence with BgI II and Not I overhangs was inserted via BgI II and Not I into pShuttle-E7-sp-ΔCtΔTmCD40L(no signal sequence) to yield pShuttle-HGH/E7-sp-ΔCtΔTmCD40L. Thus, the transcription unit HGH/E7-sp- ΔCtΔTmCD40L encodes the HGH secretory signal followed by the full length HPV type 16 E7 followed by a 10 amino acid linker with (LEND AQ APKS; SEQ ID NO:48) followed by murine CD40 ligand residues 52-260. d) Construction of pShuttle-K/E7-sp-ΔCtΔTmCD40L
[0174] A transcription unit that included DNA encoding the signal sequence of the mouse IgG kappa chain gene upstream of DNA encoding the full length HPV type 16 E7 protein ("K/E7") was generated by PCR using HPVl 6 plasmid and the following primers:
(primer 1) 5'-ACG ATG GAG ACA GAC ACA CTC CTG CTA TGG GTA CTG CTG-3 '
(SEQ ID NO:57);
(primer 2) 5'- TC CTG CTA TGG GTA CTG CTG CTC TGG GTT CCA GGT TC-3 ' (SEQ ID NO:58);
(primer 3) 5'- TG CTC TGG GTT CCA GGT TCCACT GGT GACATG CAT G-S ' (SEQ ID NO:59);
(primer 4) 5'- TGG GTT CCA GGT TCC ACT GGT GAC ATG CAT GGA G AT ACA CCT AC-3' (SEQ ID NO:60); and
(primer 5) 5'- CCG CTC GAG TGG TTT CTG AGA ACA GAT GGG GCA C -3.' (SEQ ID NO:61).
K/E7 with the upstream kappa signal sequence was generated by four rounds of PCR amplification (1st round: primers 4 +5; 2nd round: add primer 3; 3rd round: add primer 2; 4th round: add primer 1). The K/E7 encoding DNA was cloned into the pcDNA™ 3.1 TOPO vector (Invitrogen, San Diego, CA) forming ρcDNA-K/E7.
[0175] A DNA fragment that contained coding sequence for the 10 aa spacer upstream of mouse CD40 ligand from which the transmembrane and cytoplasmic domain had been deleted (-sp-ΔQΔTmCD40L) was generated from a mouse CD40 ligand cDNA plasmid, pDC406-mCD40L (American Type Culture Collection), using the following PCR primers:
5'-CCG CTCGAG AA C GAC GCA CAA GCA CCA AAA AGCAAG GTC GAA GAG GAA GTA AAC CTT C-3'(SEQ ID NO:62); and 5'-CGCGCCGCGCGCTAG TCTAGA GAGTTTGAGTAAGCCAAAAGATGAG- 3'(SEQ ID NO:63) (high fidelity PCR kit, Roche).
[0176] Fragment sp-ΔCtΔTmCD40L was digested with Xba I and Xhol restriction endonucleases and then ligated into pcDNA-K/E7. The K/E7-sp-ΔCtΔTmCD40L fragment was cut from the pcDNA vector and inserted into the pShuttle plasmid using Hind III and Xba I sites (pShuttle K/E7-sρ-ΔCtΔTmCD40L). Thus, the K/E7-sρ- ΔCtΔTmCD40L fragment includes the kappa chain secretory signal followed by the full length HPV type 16 E7 followed by a 10 amino acid linker (LEND AQ APKS; SEQ ID NO:48) followed by murine CD40 ligand residues 52-260.
e) Construction of pShuttle-HGH/E7-CD40L.
[0177] Adenoviral vector encoding a fusion protein with E7 upstream of full length mouse CD40L (with no intervening linker) was made using primers to amplify full length mouse CD40L using PCR. The following primers were used:
forward primer: 5'- GAGAC CTCGAG CAGTCA GC ATGATAGA AACATACAGC CAACCTTCCC-3' (SEQ ID NO: 64);
reverse primer: 5'-CGCGCCGCGCGC CCC TCTAGA TCA GAG TTT GAG TAA GCC AAA AGA TGA G-3' (SEQ ID NO: 65).
[0178] Amplified DNA was initially subcloned into the pcDNA3-K/E7 vector with Xba I and Xhol restriction endonucleases. The full length CD40L gene or ΔCtΔTmCD40L was directionally cloned into the pShuttle plasmid with the Hind III and Xba I sites.
f) Construction of pShuttle-HGH/E7-sp-ΔCtΔTmCD40LQiuman).
[0179] A vector encoding an E7/human CD40 ligand fusion protein (pShuttle- HGH/E7-sp-ΔCtΔTmCD40L(human)) is described as follows. Primers for amplifying human ΔCtΔTMCD40L+ spacer using a human CD40 ligand cDNA template are set forth below. Human ΔCtΔTmCD40L+ spacer forward primer (HCD40LSPF) (CD40L sequence italicized):
5'- CCGCTC GAG AAC GAC GCA CAA GCA CCA AAA TCA GTG TAT
CTT CATAGA AGG TTG GAC -V (SEQ ID NO:66);
Human CD40L reverse primer (HCD40LR)
5'-CCC TCTAGA TCAGAGTTTGAGTAAGCCAAAGGAC-S' (SEQ ID NO:67).
PCR is performed using the above primers and the plasmid pDC406-hCD40L as template under the following conditions: hold 3 min at 94 0C; cycle 94 0C for 45 sec, 52 0C for 45 sec, 72 0C for 70 sec (30 cycles); hold 7 min at 72 0C; and hold at 4 0C. This amplification results in the "-sp-ΔCtΔTmCD40L(human)" fragment, which encodes 44-261 of human CD40L and an amino terminal 10 aa spacer. The forward primer HCD40LSPF encodes a 10 residue spacer (LEND AQ APKS; single letter code; SEQ ID NO:48) to be located between the tumor antigen and the CD40 ligand (hCD40L) of the transcription unit. The "sp-ΔCtΔTmCD40L(human)" fragment is then inserted into the plasmid pShuttle-CMV (Murphy GP, et al. Prostate 38: 73-78 (1999)) after restriction endonuclease digestion with Xba I (AAGCTT) and Xho I (CTCGAG). This vector is designated pShuttle-sp-ΔCtΔTmCD40L(human)(no signal sequence). Modification of pShuttle-sp-ΔCtΔTmCD40L(human)(no signal sequence) to include the HPV- 16 E7 upstream of the human CD40 ligand sequence is accomplished essentially as described above for the murine CD40 ligand encoding vectors. The resulting plasmid is designated pShuttle-E7-sp- ΔCtΔTmCD40L(human)(no signal sequence) and is used for insertion of the HGH signal sequence upstream of E7 to generate HGH/E7-sp-ΔCtΔTmCD40L(human). Thus, the transcription unit HGH/E7-sp-ΔCtΔTmCD40L(human) encodes the HGH secretory signal, followed by the full length HPV type 16 E7, followed by a 10 amino acid linker (LEND AQAPKS; SEQ ID NO:48) followed by human CD40 ligand representing residues 44-261. h) Recombinant adenovirus
[0180] The recombinant adenoviral vectors were generated using the AdEasy vector system (Strategene, San Diego, CA). Briefly, the resulting plasmids pShuttle- HGH/E7-sp-ΔCtΔTmCD40L, pShuttle-HGH/CD40L, pShuttle-HGH/E7-CD40L, and pShuttle-HGH/E7 were linearized by Pme I digestion and then co-transformed into E. coli strain BJ5183 together with pAdEasy-1. Recombinants were selected with kanamycin and screened by restriction enzyme analysis. The recombinant adenoviral construct was then cleaved with Pac I, and transfected into 293A cells to produce viral particles. The titer of recombinant adenovirus was decided by the tissue culture infectious dose 50 (TCID50) method.
4. Purification of Recombinant E7/ecdCD40L Protein in Bacterial System and E7 Assay Methods a) purification of recombinant E7/ecdCD40L Protein
[0181] The E7/ecdCD40L fusion cDNAs were inserted into the expression vector pTri by Xcml and Notl sites. The expression bacterial cell line Rosetta (DE3) was transfected by pTri E7/ecdCD40L vectors and induced by IPTG for 3 hours at 37°C. The bacterial pallets were harvested and purified by His Selected Nickel Affinity Gel (Sigma).
b) Flow cytometry analysis of T regulatory cells
[0182] To quantify T regulatory cells, the CD4 T cells from lymph node, spleen or tumor nodule were respectively stained by two different kinds of markers, CD4CD25 and CD4FOXP3, with FITC- or PE-conjugated anti-mouse monoclonal antibodies (Pharmingen, eBiscience) for 30 min on ice, prior to immunostaining with labeled antibodies. The T cells were first incubated with a Fc-Y blocking antibody (anti- mouse CD16/CD32 antibody) to avoid the nonspecific binding of mAbs to Fc-Y receptors. The cells were then washed twice, fixed in 4% paraformaldehyde, and analyzed using a Becton Dickinson flow cytometer (FACS Calipur). c) Tetramer staining
[0183] PE-labeled H-2Db tetramer containing HPVl 6 E7 49-57 peptide (RAHYNIVTF) (SEQ ID NO: 68) was purchased from Beckman Coulter and used for the analysis of peptide specific CTL immunity. Ten days after immunization, 1 x 106 erythrocyte-depleted spleen cells were stained by lOul of tetramer together with 1/100 diluted fluorescein isothiocyanate (FITC)-anti mouse CD8a (clone53-6.7, BD Pharmingen) in lOOul PBS supplemented with 3% FCS, incubated at room temperature for 30 minutes, and then washed with 3ml of PBS. Following centrifugation, the cell pellet was resuspended in 500ul of PBS/0.5% paraformaldehyde for FACS analysis. Tetramer positive and CD8+ cells are shown as a percentage of total spleen cells.
d) Cytokine Profile by ELISPOT Assays
[0184] The presence of E7-specific effector T cells in the immunized mice was also assessed by carrying out ELISPOT assays, as described previously. Briefly, splenocytes obtained from mice vaccinated with each of the different vectors were- restimulated in vitro by culture with the TC-I cell line (responder-to-stimulator ratio=25/l) in the presence of 10 U/ml IL-2 for 48 hours. Re-stimulated splenocytes were then plated in 96-well nitrocellulose filter plates (5 X 104 cells in 100 microliters). The wells were pre-coated with rat anti-mouse anti-IFN-antibody or anti-IL-4 antibody. After incubation for 24 hours at 37°C/5% CO2, the plates were then washed with PBS, and the presence of cytokine-producing spleen cells was detected by incubation at 40C with biotinylated goat anti-rat secondary antibody, followed by 100 microliter/well of horseradish peroxidase avidin D. To this was added 150 microliter/well freshly prepared substrate buffer (0.4 mg/ml 3-amino-9- ethyl-carbazole in a total of 50 ml 0.05 mol/L sodium acetate buffer) and 20 microliter 30% H2O2. The stained spots corresponding to IFN producing cells or to IL-4 producing cells, were enumerated under a dissecting microscope.
e) Cytotoxicity Assay
[0185] Mononuclear cells from the spleens of these mice were incubated with mitomycin C-treated TC-I cells in RPMI 1640 medium, supplemented with 10% fetal bovine serum (FBS), 5 mM 2-mercaptoethanol, 2 raM glutamine, ImM pyruvate, and nonessential amino acids for 5 days. To perform the cytotoxicity assay, firstly TC-I tumor cells / (target cells) were labeled with the red-fluorescent dye PKH26 (Sigma, St Louis, MO) according to the manufacturer's specifications. In brief, the target cells were washed in PBS then resuspended at 107 cells/ml in solution. PKH26 dye was added to a final concentration of 2 μM, mixed and incubated at room temperature. After 5 min, the reaction was quenched with 3 volumes of FCS and the cells were washed an additional 3 times in RPMI/10%FCS medium then 5 X 103 labeled TC-I cells were incubated with the stimulated splenic mononuclear cells (effector cells) at a different effector/target ratio for 4 hours at 37°C, in culture media containing 5% FBS. At the end of the incubation, mononuclear cell-mediated cytotoxicity was stained for intracellular Caspase-3 according to the manufacturer's protocoKBD PharMingen), double positive cells was determined by flow cytometry on live gated PKH26+ cells.
f) In Vivo Efficacy Experiment in Mouse Model
[0186] Mice (5 or 10 per group) were challenged by subcutaneous injection of 5 x 105 TC-I cells were injected subcutaneously. On the next day, the mice were vaccinated via SC injection with 1 x 108 PFU Ad-sig-E7/ecdCD40L. One week later, mice were boosted with the same adenoviral vector regimen as the first vaccination or followed by SC injections of the lOug recombinant E7/ecdCD40L protein every week. Tumor volumes were measured in centimeters by caliper. One month later, the tumor free mice were rechallenged by 1 x 107 TC-I cells and the tumor volume was calculated as tumor volume= length x (width2)/2 (this assumes an ellipitical shape).
g) Statistics
[0187] All parameters were analyzed using Student's t test, or ANOVA followed by Scheffe's procedure for multiple comparisons as post-hoc analysis; all data shown is presented as mean ± S. E. of the mean (S. E.).
5. Inducing Immunity Against a Viral Antigens in Young (Two Month Old) Mice with Ad-sig-E7/ecdCD40L Vector. [0188] Two sc injections (seven days apart), each 10 μg/mouse of the Ad-sig- E7/ecdCD40L adenoviral vector were given to six week old C57BL/6J mice which were evaluated for induction of resistance to engraftment of the E7 positive TC-I cells (see PNAS 2003 100:15101-15106; Blood 2004 104:2704-2713). Injected mice were challenged with 500,000 E7 positive TC-I cells and 500,000 E7 negative EL-4 cells implanted subcutaneously (at a different site than the adenoviral vector injection site) seven days following the last vaccination injection. The growth of E7 negative EL-4 cells (measured by tumor volume) was not suppressed in the Ad-sig- E7/ecdCD40L injected mice, while E7-positive syngeneic TC-I cell growth was completely suppressed in injected mice. FIG. 6. These results indicate that the Ad- sig-E7/ecdCD40L vector induces a specific immune response directed to the E7 viral antigen in young 2 month old animals.
6. Ad-sig-E7/ecdCD40L Vector Induced Immunity in Young (Two Month Old) Mice is CD8 Dependent
[0189] To test if the Ad-sig-E7/ecdCD40L vector injections in 2 month old mice induced immunological memory cells, splenic T lymphocytes were collected from C57BL/6J mice which had survived for a full year after vaccination with the Ad-sig- E7/ecdCD40L vector and challenge with the E7 positive TC-I cells. The test C57BL/6 nude mice (n=7) were injected sc with 500,000 TC-I cells and then injected intraperitoneally five days later with 10 x 106 splenic lymphocytes from mice which had been vaccinated with the Ad-sig-E7/ecdCD40L vector one year earlier. As shown in FIG. 7, only transient growth of the TC-I cells (solid diamonds) occurred in the C57BL/6 nu/nu mice which had received intraperitoneal injections of the T cells from the Ad-sig-E7/ecdCD40L vaccinated mice (♦). In contrast, the TC-I cells grew well (line defined by the solid squares (■)) in control C57BL/6 nu/nu mice which were injected intraperitoneally with 10 x 106 splenic T cells from unsensitized donor C57BL/6 mice five days after injection of TC-I cells. These results show that the immunity induced by the vector injections involves memory cells.
[0190] To test whether this immune resistance was dependent on CD8+ or CD4+ T cell lymphocytes, donor immunocompetent C57BL/6 mice were injected sc with the Ad-sig-E7/ecdCD40L vector at days zero and seven. Seven days later (day 14), the mice were injected sc with 100,000 E7 positive TC-I cells. As shown below in FIG. 8, the C57BL/6 donor mice were treated in vivo with antibodies which were cytolytic and specific for CD4 (solid diamonds) or CD8 (solid triangles) positive cells to deplete the respective T cell population 5, 3, and 1 days prior to the vector injection, and every six days after the sc injection of the Ad-sig-E7/ecdCD40L vector, and also on days 6, 7, 8, 10, 12, and 14 days following the injection of the TC-I cells. Then the sensitized CD8+ T cells from the CD4 depleted vaccinated mice (see solid diamonds in FIG. 8) or CD4+ T cell lymphocytes from the CD8 depleted vaccinated mice (see solid triangles in FIG. 8) from sensitized C57BL/6 donors were injected intraperitoneally into C57BL nude mice 7 days after subcutaneous injection of 1 x 105 TC-I cells. A third group of C57BL/6 nude mice, which were control mice, did not receive passive transfer of T cells (see solid squares in FIG. 8) 7 days following subcutaneous injection of TC-I cells. The C57BL/6 nu/nu mice injected with CD8+ T cells from the Ad-sig-E7/ecdCD40L injected donor animals survived statistically significantly longer than did the other groups. Thus, the induction of immunity to TAA positive tumor cells by the injection of the Ad-sig-TAA/ecdCD40L vector was dependent on CD8+ T cell lymphocytes and not dependent on CD4 cells. This vaccine is therefore useful for circumventing the CD4 defects in old people for influenza vaccines.
7. Ad-sig-E7/ecdCD40L Vector Increases E7 Viral Antigen Specific Cytotoxic T Lymphocytes in Young (Two Month Old) Mice [0191] Spleen cells were isolated from C57B1/6 mice (from Harlan) before and 7 days after two injections with IxIO8PFU of the Ad-sig-E7/ecdCD40L vector. The level of the E7-specific T cells was determined by tetramer assay as described above.
[0192] T cells increased three fold in the spleen following the Ad-sig-E7/ecdCD40L vector injection, whereas no significant increases occurred with the other control vectors (Ad-E7/wtCD40L; ad-wtCD40L; Ad-sig-ecdCD40L) including the Ad- E7/wtCD40L, in which the E7/CD40L protein was not secretable from the infected cells. FIG. 9. 8. Ad-sig-E7/ecdCD40L Vector Induces Viral Antigen Immunity in Old (18 Month Old) Mice
[0193] The ability to elicit viral antigen immunity in old (18 month old) mice using The Ad-sig-E7/ecdCD40L vector was evaluated. The Ad-sig-E7/ecdCD40L vector was injected once sc with IxIO8 IU. At days 7, 14 and 21 after the vector injection, an sc injection of the E7/ecdCD40L protein (10 micrograms/injection) was given as a booster. Seven days later, mice were sacrificed and the level of E7 specific T cells in the spleen determined by ELISPOT assay.
[0194] The levels of interferon- gamma positive cells/100,000 splenocytes was increased to 225 in the old mice and 725 in young mice, while IL-4 cell numbers increased to over 100 antigen specific T cells/100,000 splenocytes. FIG. 10 Although the magnitude of the induction of antigen specific T cells in the 18 month old mice was less than that seen in the 2 month old mice, the absolute magnitude of the response in the 18 month old mice is in the range induced by most other vaccines in young mice and is clearly sufficient to produce a robust immune response.
[0195] The increase in the percentage of antigen specific T cells to total CD8 T cells in the tumor tissue in old mice was measured via E7 tetramers before and after vaccination. The Ad-sig-E7/ecdCD40L vaccine induced the level of antigen specific T cells in the tumor tissue by 10 fold (FIG. 11).
[0196] The increase in the number of T cells as a percentage of the total number of cells in the tumor tissue following vaccination in the old mice was also measured. The increase of the percentage of T cells increased over 10 fold after the vaccination in the old mice (FIG. 12).
[0197] The level of increase of antigen specific cytotoxic T lymphocytes ("CTLs") induced by vaccination in 2 month and 18 month old mice was also evaluated using the protein boost immunization scheme. Increases in antigen specific CTLs following vaccination in the old as well as the young animals is shown in FIG. 13. Again, the level of the increase of the CTLs seen in the 18 month old mice was less than that seen in the 2 month old mice, but the absolute magnitude of the induction was impressive in the 18 month old mice.
9. Immune Response Induced by the V, VP, VPP, and VPPP Vaccination Regimens with the Ad-sig-E7/ecdC40L Vector Prime in 2 Month Old ("Young") Mice.
[0198] Two month old C57BL6 mice were vaccinated using one of the following four vaccination regimens: a single subcutaneous injection of Ad-sig-E7/ecdCD40L ("V"), or a single subcutaneous vector injection followed by one boost with fusion protein ("VP"), two boosts with fusion protein ("VPP"), or three boosts with fusion protein ("VPPP"), in which each boost is a weekly subcutaneous injections of the E7/ecdCD40L fusion protein. The levels of E7-specific splenic CD8 T cells and E7- specific antibody levels in serum were determined. As shown in FIG. 27, the levels of the E7-specific splenic CD8 T cells of the vaccinated mice increased going from V to VP to VPP and to VPPP. VP, VPP and VPPP are significantly different from each other (p<0.05). As shown in FIG. 28, the levels of the E7 specific serum antibodies against the E7 B cell epitope EIDGP AGQ AEPDRAHYNIVTFCCKCD of the vaccinated mice increased significantly with the number of fusion protein boosts after the initial vector injection (VP < VPP < VPPP). At a dilution factor of 1/1000, the difference of the serum antibody levels in the vaccinated versus the unvaccinated control group was statistically significant for VP mice (p=0.004); VPP mice(pO.OOl); and VPPP mice(p<0.0001).
10. Immune Response Induced by the V, VP, VPP, and VPPP Vaccination Regimens with the Ad-sig-E7/ecdC40L Vector Prime in 18 Month Old ("Old") Mice.
[0199] 18 month old C57BL6 mice were vaccinated using one of the following four vaccination regimens: a single subcutaneous injection of Ad-sig-E7/ecdCD40L (V), or a single subcutaneous vector injection followed by one (VP), two (VPP) or three (VPPP) weekly subcutaneous injections of the E7/ecdCD40L protein boost. The levels of E7-specific splenic CD8 T cells and E7-specific antibody levels in serum were determined. As shown in FIG. 29, increases in the levels of the E7-specific splenic CD8 T cells of the vaccinated mice were detectable only at the VPP and VPPP level. As shown in FIG. 30, the levels of the E7-specific serum antibodies against the E7 B cell epitope EIDGP AGQAEPDRAHYNIVTFCCKCD of the vaccinated mice increased significantly only with three protein boost injections after the initial vector injection (VPPP).
11. Effect of the Ad-sig-TAA/ecdCD40L Vector Vaccine and Protein Boost Against Viral Antigen in Old (18 Month Old) Mice on Growth of Cells Positive for Viral Antigen
[0200] The suppression of E7 positive tumor growth in 18 month old mice was almost equal to the level of suppression of the tumor growth in 2 month old mice with the vector vaccination alone. FIG. 14. The effect of the protein boosts on the induction of the immune response induced by the Ad-sig-E7/ecdCD40L vector was tested. Test C57B1/6J mice were injected first with IxIO8 PFU Ad-sig-E7/ecdCD40L vector followed by 3 protein boosts (lOμg protein per injection) given at 7, 14 and 21 days after the vector injection.
[0201] The endpoint of these studies was in vivo suppression of the E7 tumor growth in C57B1/6J mice, as measured by the percentage of mice which remained tumor free. As shown in FIG. 15, the sc injection of the E7/ecdCD40L protein induced regressions of existing tumor and converted tumor positive mice to tumor negative mice. These data suggested that Ad-sig-TAA/ecdCD40L by sc vector and protein boost could induce complete regressions in existing tumor which was progressive in 18 month old mice.
12. Effect of the Ad-sig-TAA/ecdCD40L Vector Vaccination in Old Mice on the Levels of CD4 FOXP3 Negative Regulatory T Cells in Tumor Tissue
[0202] Increases CD4 FOXP3 negative regulatory T cells have been reported to limit the degree to which vaccines suppress the degree of immune response to vaccination. Decreases in the level of FOXP3 negative regulatory CD4 T cells have been reported with vaccination. Therefore the level of FOXP3 CD4 T cells in the tumor tissue before and after 1x108 PFU Ad-sig-E7/ecdCD40L vector (including the protein boosting) was measured by FACS analysis. As shown in FIG. 16, vaccination in old animals decreased the CD4 FOXP3 negative regulatory T cells in the tumor tissue by 2 fold.
13. Levels of CD8 Effector and CD4 Negative Regulatory T Cells in Tumor Tissue Following Ad-sig- rH2N /ecdCD40L Vector Vaccination in Young (2 Month Old) Mice
[0203] The levels of antigen specific CD8 effector T cells in tumor tissue was determined after vaccination with the Ad-sig-rH2N/ecdCD40L vector, the preparation of which is described in U.S. Patent Application Publication US 2005-0226888 (application serial No. 11/009,533) titled "Methods for Generating Immunity to Antigen," filed 12/10/2004. Subcutaneous tumor nodules of rH2N.Tg mice were minced before and after two sc injections of the Ad-sig-rH2N/ecdCD40L vector. IxIO8PFU vector were administered per injection; injections were given 7 days apart, and tumor nodules were isolated 10 days after the last injection. Single cell suspensions were generated from the tumor tissue after mincing, treated with 0.03% DNAse and then 0.14% collagenase I, and filtered through Nylon mesh. The number of effector T cells isolated from the tumor tissue after vaccination (CD8+, CD44+, LY6C+ and CD62L-) was increased roughly 5-7 fold. FIG. 17. This data suggests that the suppression of the growth of the rH2N positive tumor cells in the rH2N.Tg mice following Ad-sig-rH2N/ecdCD40L vaccination is mediated in part by the trafficking of rH2N specific CD8 effector T cells into the tumor tissue.
[0204] RNA was isolated from the tumor infiltrating CD8 effector T cells and the pattern of gene expression was compared before and after vaccination using the Affymetrix gene expression system. The expression level of the 21 known chemokine receptors and ligands in the effector T cells which were infiltrating the tumor tissue was also examined. The levels of the CCL3 (2.8 fold increase) and the CCR5 (16 fold increase), which are involved in the targeting of T cells to the extravascular sites of tissue inflammation, were increased in the rH2N specific CD8 effector T cells in the tumor tissue. The chemokine pathway plays a major role in the trafficking of effector and memory T cells from the lymph nodes draining sites of vaccination or infection to the tissue sites harboring inflammation or infection (Current Opinion 2003 15:343-348; Cell Adhesion and Communication 1998 6:105- 110).
14. Induction of Immunity with the Ad-sig-H5NlHA/ecdCD40L Vector Against the Hemagglutinin Protein of the H5N1 Avian Influenza Virus in 2 Month Old Mice and 18 Month Old Mice
[0205] A portion of the HA sequence from an H5N1 influenza virus was used as an antigen in the Ad-sig-TAA-ecdCD40L vector, creating an Ad-sig-H5 HA-ecdCD40L expression vector. As described below, this vector induced an immune response in mice; a significant increase in the level of H5 HA specific CD8 T cells was detected.
a) Construction of the Ad-sig-H5HA-ecdCD40L Expression Vector i) H5HA-ecdCD40L(mouse)
[0206] DNA (SEQ ID NO: 69) encoding a portion of a receptor binding region corresponding to amino acid residues 135-175 connected to residues 230-250 (see FIG. 2, underlined) of the hemagglutinin (HA) protein of the H5N1 avian influenza strain (H5HA), first isolated in 1997 in Hong Kong from a child with a fatal respiratory illness (see, e.g., Science 1998 279:393-96; J. Virology 1998 73: 2094-98; Emerging Infectious Disease 2002 8(8):1-12) is shown below.
5'AAAAGTTCTTGGTCCAATCATGATGCCTCATCAGGGGTGAGCTCA
GCATGTCCATACCTTGGGAGGTCCTCCTTTTTCAGAAATGTGGTATG
GCTTATCAAAAAGAACAGTGCATACCCAACAGCTACTAGACCCAA
AGTAAACGGGCAAAGTGGAAGAATGGAGTTCTTCTGGACAATTTTA
AAG-3' (SEQ ID NO:69).
The above HA construct was generated using the following two primers:
forward primer:
5'AAAAGTTCTTGGTCCAATCATGATGCCTCATCAGGGGTGAGCTCA GCATGTCCATACCTTGGGAGGTCCTCCTTTTTCAGAAATGTGGTATG GCTTATCAAAAAGAACAGTGC-3'(SEQ ID NO:70) and
reverse primer:
5'CTTTAAAATTGTCCAGAAGAACTCCATTCTTCCACTTTGCCCGTTT ACTTTGGGTCTAGTAGCTGTTGGGTATGCACTGTTCTTTTTGATAAG CCATACCAC-3'(SEQ ID NO:71).
[0207] Double-stranded nucleic acid encoding the HA region was generated as follows. The oligos were dissolved in 50 μl H2O (about 3 mg/ml). 1 μl from each oligo (forward and reverse primers) was added to 48 μl annealing buffer plus 7 μL ddH2O (100 mM Tris-HCl, IM NaCl, 1OmM EDTA) incubated for 4 minutes at 95°C, 10 minutes at 70°C and slowly cooled to about 4°C.
[0208] A transcription unit that included DNA encoding the signal sequence of the mouse IgG kappa chain gene upstream of DNA encoding the Avian HA antigen epitope was generated by PCR using the double-stranded HA generated in the previous paragraph and the following primers:
5'-CCACC ATG GAG ACA GAC ACA CTC CTG CTA TGG GTA CTG
CTG-3 '
(SEQ ID NO: 72);
5'- TC CTG CTA TGG GTA CTG CTG CTC TGG GTT CCA GGT TC-V (SEQ ID NO: 73);
5'- TG CTC TGG GTT CCA GGT TCCACT GGT GACATG CAT G-3 ' (SEQ ID NO: 74); 5'- TGG GTT CCA GGT TCC ACT GGT GAC ATG AAAAGTTCTTGGTCCAATCATGATGC -3' (SEQ ID NO: 75); and
5'- CCG CTCGAG GCTTTAAAATTGTCCAGAAGAACTCC -3' (SEQ ID NO: 76).
[0209] K/Avian FIuHA (i.e., kappa signal-H5 fragment) was generated by four rounds of PCR amplification (1st round: primers 4 +5; 2nd round: add primer 3; 3rd round: add primer 2; 4th round: add primer 1), under the following conditions: hold 3 min at 94 0C; cycle 94 0C for 30 sec, 55 0C for 30 sec, 72 0C for 30 sec (30 cycles); hold 7 min at 72 0C; and hold at 4 0C. The K/Avian FIuHA encoding DNA was cloned into the pcDNA™ 3.1 TOPO vector (Invitrogen, San Diego, CA) forming pcDNA-K/Avian FIuHA.
[0210] Primers for amplifying mouse ΔCtΔTmCD40L+ spacer using a mouse CD40 ligand cDNA template are set forth below.
Mouse ΔCtΔTmCD40L+ spacer forward primer (MCD40LSPF):
5'- CCG CTCGAG AA C GAC GCA CAA GCA CCA AAA TCA AAG GTCGAAGAGGAAGTAAAC-S' (SEQ ID NO: 50);
Mouse CD40L reverse primer (MCD40LR):
5'-CCC TCTAGA ATCAGAGTTTCACTAAGCC AA-3 ' (SEQ ID NO: 51).
[0211] These primers will amplify a ΔCtΔTmCD40L+spacer which encodes 52-260 of mouse CD40L. The forward primer MCD40LSPF encodes a 10 residue spacer (LENDAQAPKS) (SEQ ID NO:48) to be located between the antigen and the CD40 ligand (MCD40L) of the transcription unit. PCR was performed using the forward and reverse primers (SEQ ID NOs 50 and 51) and plasmid pDC406-mCD40L as the template under the following conditions: hold 3 min at 94 0C; cycle 94 0C for 45 sec, 55 0C for 45 sec, 72 0C for 70 sec (30 cycles); hold 7 min at 72 0C; and hold at 4 0C. This PCR resulted in a fragment "spacer+ΔCtΔTmCD40L,"which was subcloned into ρcDNA3TOPO. The "spacer+ΔCtΔTmCD40L" fragment was then inserted into the plasmid pcDNA-sig- AfIuHA after restriction endonuclease digestion with Xbal (TCTAGA) and Xho I (CTCGAG). The sig-AfluHA /ΔCtΔTmCD40L (mouse) encoding DNA was cut from the pCDNA3TOPO using Hindlll-Xbal restriction and inserted into pShuttle-CMV (see Murphy et al., Prostate 38: 73-78, 1999) downstream of the CMV promoter. This vector is designated pShuttle sig- AfluHA/ΔCtΔTmCD40L(mouse). Thus, the transcription unit sig-AfluHA- ΔCtΔTmCD40L(mouse) encodes the kappa secretory signal followed by the extracellular domain of Avian flue HA followed by a 10 amino acid linker (LENDAQAPKS; SEQ ID NO:48) followed by mouse CD40 ligand residues 52-260.
[0212] This amplified H5 HA sequence is cloned so that it is located between a secretory mouse Ig kappa sequence (sig) and a linker (sp), which linker connects to the gene encoding the ecdhCD40L (extracellular domain of the human CD40L) in an AdEasy shuttle vector. Vector and soluble fusion protein expressed therefrom will be prepared as described above.
ii) H5HA-ecdCD40L(human)
[0213] The construction of a vector encoding an HA/human CD40 ligand fusion protein (pShuttle-K/HA-sp-ΔCtΔTmCD40L(human)) is described as follows. Primers for amplifying human ΔQΔTMCD40L+ spacer using a human CD40 ligand cDNA template are set forth below.
Human ΔCtΔTmCD40L+ spacer forward primer (HCD40LSPF) (CD40L sequence italicized):
5'- CCGCTC GAG AAC GAC GCA CAA GCA CCA AAA TCA GTG TAT
CTT CATAGA AGG TTG GAC -3' (SEQ ID NO:66);
Human CD40L reverse primer (HCD40LR)
5'-CCC TCTAGA TCAGAGTTTGAGTAAGCCAAAGGAC-3 ' (SEQ ID NO:67). [0214] PCR is performed using the above primers and the plasmid pDC406- hCD40L as template under the following conditions: hold 3 min at 94 0C; cycle 94 0C for 45 sec, 52 0C for 45 sec, 72 0C for 70 sec (30 cycles); hold 7 min at 72 0C; and hold at 4 0C. This amplification results in the "-sρ-ΔCtΔTmCD40L(human)" fragment, which encodes 44-261 of human CD40L and an amino terminal 10 aa spacer. The forward primer HCD40LSPF encodes a 10 residue spacer (LENDAQAPKS; single letter code; SEQ ID NO:48) to be located between the tumor antigen and the CD40 ligand (hCD40L) of the transcription unit. The "sp- ΔCtΔTmCD40L(human)" fragment is subcloned into pcDNA3TOPO. The "spacer+ΔCtΔTmCD40L(human)" fragment is then inserted into the plasmid pcDNA- sig- AfIuHA after restriction endonuclease digestion with Xbal (TCTAGA) and Xho I (CTCGAG). The sig-AfluHA /ΔCtΔTmCD40L(human) encoding DNA is cut from the pCDNA3TOPO using Kpnl-Xbal restriction and inserted into pShuttle-CMV (see Murphy et al, Prostate 38: 73-78, 1999) downstream of the CMV promoter. This vector is designated pShuttle sig-AfluHA/ΔCtΔTmCD40L(human). Thus, the transcription unit sig-AfluHA-ΔCtΔTmCD40L(human) encodes the kappa secretory signal followed by the extracellular domain of Avian flue HA followed by a 10 amino acid linker (LENDAQAPKS; SEQ ID NO:48) followed by human CD40 ligand residues 44-261.
[0215] This amplified H5 HA sequence is cloned so that it is located between a secretory mouse Ig kappa sequence (sig) and a linker (sp), which linker connects to the gene encoding the ecdhCD40L (extracellular domain of the human CD40L) in an AdEasy shuttle vector. Recombinant adenoviral vectors were generated using the AdEasy vector system (Stratagene, San Diego, CA) as described above, resulting in the Ad-K/HA/ecdCD40L vector. Fusion protein were prepared as described below.
b) Induction of Immunity in Mice
[0216] The Ad-sig-H5HA/ecdhCD40L vector was processed for administration in accordance with the methods of reference PNAS 2003 100:15101-15106; Blood 2004 104:2704-2713, was injected twice (at a 7 day interval) sc into immunocompetent mice (2 months old). Seven days following the immunization, the CD 8 cells were isolated, and incubated for 2 days in the presence of the H5HA epitope (cultured with syngeneic gamma-irradiated spleen cells pulsed with HA peptides and cultured for 48 hours, and developed according to the ELISPOT protocol (see PNAS 2003 100:15101-15106; Blood 2004 104:2704-2713), and then the spleen cells were tested by ELISPOT assay for the level of H5HA specific CD8 T cells before and after vaccination. As shown in FIG. 18, the level of H5HA specific CD8 T cells increased significantly in the spleen of the vaccinated mice (N=4) compared to the unvaccinated mice (N=4), p<0.05.
c) Induction of Immunity in Old and Young Mice
[0217] Two month old ("Young") C57BL6 mice (n=4) and in 18 month old ("Old") C57BL6 mice (n=4) were administered with one subcutaneous injection of Ad-sig- HA/ecdCD40L vector followed by 3 separate injections of HA/ecdCD40L fusion protein at 7 day intervals starting 7 days after the initial vector injection. Age- matched unvaccinated mice served as controls. The levels of HA specific splenic CD8 T cells were determined by ELISPOT assay and the levels of the HA specific serum antibodies were determined by ELISA assay for all groups. As shown in FIG. 23, the levels of HA specific splenic CD8 T cells of the vaccinated mice were statistically significantly increased in the vaccinated groups as compared to an age- matched unvaccinated control group for the 2 month old mice (p— 0.0004) and the 18 month old mice (p=0.0001). FIG. 24 shows that the level of serum antibodies specific for the H5N1 HA antigen was statistically significantly increased in the vaccinated groups as compared to an age-matched unvaccinated control group for 2 month old mice ( p=0.004) and 18 month old mice (p=0.015) (determined at a 1/250 dilution).
15. Induction of Immunity with the Ad-sig-H5NlM2/ecdCD40L Vector Against the M2 Protein of the H5N1 Avian Influenza Virus in 2 Month Old Mice and 18 Month Old Mice
[0218] The H5N1 M2 protein does not change in strains with influenza viral strains harboring transitions of sequence in the HA antigens. However, it is a weak antigen during vaccination. Thus, a portion of the coding sequence of the M2 gene was linked to the extracellular domain of CD40 ligand in the Ad-sig-M2/ecdCD40L to increase its immunogenicity.
a) Construction of Ad-sig-H5NlM2/ecdCD40L vectors [0219] As discussed, the M2 protein is not normally immunogenic, but can be made so by including it in a chimeric protein with another immunogenic protein sequence. The amino terminal end or an internal "immunodominant loop" from the extracellular domain of the M2 was used in such chimeric structures.
[0220] An Ad-K~M2/ecdCD40L vector where the M2 is from an H5N 1 influenza virus is constructed to generate an immune response to the M2.
[0221] The amino acid sequence of a portion of an M2 protein corresponding to amino acid residues 1-24 of the M2 protein of an H5N1 Influenza A virus (A/Hong Kong/156/97), wherein the cysteine residues at positions 17 and 19 in the native protein have been mutated to serine residues as reported by De Fillette et al. (Virology 337:149-61, 2005) is shown below.
MSLLTEVDTLTRNGWGSRSSDSSD (SEQ ID NO:77)
[0222] Oligonucleotides corresponding to the sense and antisense strands of the DNA encoding SEQ ID NO: 77 are as follows: M2 sense oligonucleotide:
5'- ATGA GCCTTCTAAC CGAGGTTGAC ACGCTTACCAGA AACGGATGGG GGTCCAGATC CAGCGATTCA AGTGAT -3 ' (SEQ ID NO:78)
M2 antisense oligonucleotide: 5'-
ATCACTTGAATCGCTGGATCTGGACCCCCATCCGTTTCTGGTAAGC GTGTC AACCTCGGTTAGAAGGCTCAT-3' (SEQ ID NO:79) The oligonucleotides were dissolved in STE buffer at high concentration (about 1-10 OD26O units/ 100 μL). The two strands were mixed together in equal molar amounts and heated to 940C and slowly cooled to about 40C. The annealed DNA was phosphorylated using T4 PNK (polynucleotide kinase) under standard conditions. The resulting double stranded DNA was amplified by PCR using the following primers:
Primer 1 :
5'-ACG ATG GAG ACA GAC ACA CTC CTG CTA TGG GTA CTG CTG-
3'
(SEQ ID NO:80) Primer 2
5'- TC CTG CTA TGG GTA CTG CTG CTC TGG GTT CCA GGTTC-3'
(SEQIDNO:81) Primer 3:
5'- TG CTC TGG GTT CCA GGT TCC ACT GGT GAC ATG -3'
(SEQ ID NO:82); Primer 4:
5'- TGG GTT CCA GGT TCCACT GGT GAC ATGATGA
GCCTTCTAAC CGAGGTTGAC -3' (SEQ IDNO:83); and Primer 5:
5'- CCG CTCGAG ATCACTTGAATCGCTGCATCTGCACC-3'
(SEQ ID NO:84).
[0223] The K/ Avian FluM2 fragment having an upstream kappa signal sequence was generated by four rounds of PCR amplification (1st round: primers 4 +5; 2nd round: add primer 3; 3rd round: add primer 2; 4th round: add primer 1). The K/ Avian FluM2 encoding DNA was subcloned into the pcDNA™ 3.1 TOPO vector (Invitrogen, San Diego, CA) resulting in plasmid pcDNA-K/ Avian FluM2.
[0224] The "spacer+ΔCtΔTmCD40L(mouse)" fragment was cut from the pcDNA3TOPO-sp-ΔCtΔTmCD40L using Xho I and Xba I and was inserted into the plasmid pcDNA-K/ Avian FluM2 after restriction endonuclease digestion with Xbal (TCTAGA) and Xho I (CTCGAG). The K/AvianFluM2/ΔCtΔTmCD40L (mouse) encoding DNA was cut from the pCDNA3TOPO using Hindlll-Xbal restriction and inserted into pShuttle-CMV downstream of the CMV promoter. This vector is designated pShuttle sig AfluM2 /ΔCtΔTmCD40L(mouse). [0225] Recombinant adenoviral vectors were generated using the AdEasy vector system (Stratagene, San Diego, CA) as described above, resulting in the Ad- K/AvianFluM2/ecdCD40L vector. Fusion protein was prepared as described below.
b) Induction of Immunity in Old and Young Mice
[0226] Two month old C57BL6 mice (n = 5) and in 18 month old C57BL6 mice (n = 5) were administered with one subcutaneous injection of Ad-sig-M2/ecdCD40L vector followed by injections of M2/ecdCD40L fusion protein 7 and 21 days after the initial vector injection. Age-matched unvaccinated mice served as controls. The levels of M2 specific splenic CD8 T cells were determined by ELISPOT assay and the levels of the M2 specific serum antibodies were determined by ELISA assay for all groups. As shown in FIG. 25, the levels of M2 specific splenic CD8 T cells of the vaccinated mice were statistically significantly increased in the vaccinated groups as compared to an age-matched unvaccinated control group for both the 2 month old (p=0.0006), as well as the 18 month old mice (p=0.0009). FIG. 26 shows that the level of serum antibodies specific for the H5N1 M2 antigen was statistically significantly increased in the vaccinated groups as compared to an age-matched unvaccinated control group for 2 month old mice (p=0.0028) and 18 month old mice (p=0.0025) (determined at a 1/250 dilution). These data shows that the linkage of the CD40L to the M2 protein in the Ad-sig-M2/ecdCD40L vaccine prime-M2/ecdCD40L protein boost vaccine induces a significant immune response.
16. Construction of Ad-sig-H5HA-M2/ecdCD40L chimeric vectors
[0227] An Ad-sig-TAA/ecdCD40L vectors carrying an antigen which is a chimeric fusion of the HA and the M2 proteins is constructed as follows. The H5N1 HA and M2 sequences are synthesized by PCR amplification from an H5N1 template. An exemplary DNA sequence encoding an H5N1 HA antigen is as follows.
5'-
AAAAGTTCTTGGTCCAATCATGATGCCTCATCAGGGGTGAGCTCAG CATGTCCATACCTTGGGAGGTCCTCCTTTTTCAGAAATGTGGTATGG CTTATCAAAAAGAACAGTGCATACCCAACAGCTACTAGACCCAAA GTAAACGGGCAAAGTGGAAGAATGGAGTTCTTCTGGACAATTTTAA AG-3' (SEQ ID NO:69).
DNA sequence encoding a chimera HA-M2 is shown below with the H5N1 HA sequence 5' to the M2 sequence. The underlined segment is added sequence between the above two segments. 5'-
AAAAGTTCTTGGTCCAATCATGATGCCTCATCAGGGGTGAGCTCAG CATGTCCATACCTTGGGAGGTCCTCCTTTTTCAGAAATGTGGTATGG CTTATCAAAAAGAACAGTGCATACCCAACAGCTACTAGACCCAAA GTAAACGGGCAAAGTGGAAGAATGGAGTTCTTCTGGACAATTTTAA AGGATATCATGAGCCTTCTAACCGAGGTTGACACGCTTACCAGAAA CGGATGGGGGTGCAGATGCAGCGATTCAAGTGAT-S' (SEQ ID NO:43).
The above DNA encodes the following chimeric HA-M2 protein:
KSSWSNHDASSGVSSACPYLGRSSFFRNVVWLIKKNSAYPTATRPKVN GQSGRMEFFWTILKDIMSLLTEVDTLTRNGWGCRCSDSSD (SEQ ID NO:85).
[0228] The above HA-M2 chimeric sequence is cloned downstream of a secretory signal sequence (e.g., mouse IgG kappa chain signal or secretory sequence) (sig). This sig HA-M2 molecule is then linked via a 30 nucleotide linker sequence to DNA for ecdhCD40L. The TAA/ecdCD40L transcription unit is inserted into the Ad-sig- TAA/ecdCD40L vector by methods previously described and reported (see e.g., PNAS 2003 100:15101-15106; Blood 2004 104:2704-2713). The vector is then isolated from 293 cells, plaque purified, and the TAA/ecdCD40L insert sequenced and tested for replication competent adenovirus by PCR assay for ElA.
17. Testing and use of the Adenovirus Expression Constructs [0229] HA, NA, or M2 from H5N1 , H3N2 or other Type A viral strains such as H2N2 or HlNl are cloned into the TAA/ecdCD40L vector. The influenza fusion protein is expressed and used as a protein boost. Generally, the vector is administered two times (7 days apart), or a vector is injection followed by 2 protein boosts at 7 and 21 days. Subjects are vaccinated with the Ad-sig-TAA/ecdCD40L vector where the TAA is replaced with an influenza antigen.
a) In Vitro Stability of TAA/ecdCD40L and Activation of DCs
[0230] The stability of the expressed influenza antigen proteins is evaluated as follows. The TAA/ecdCD40L protein is generated with a hexhis tag and once released from 293 infected cells, it is purified by a nickel column. The protein is studied by reducing and non-reducing SDS-PAGE gels to determine if the trimeric structure is stable with the HA, M2 or HAM2 as antigen. Western blotting is used with a flag antibody to test the relative stability of the HA/ecdCD40L, M2/ecdCD40L and the HAM2/ecdCD40L proteins by methods reported previously (see Blood 2004 104:2704-2713). The recombinant protein is added to mouse bone marrow derived dendritic cells (DCs) by methods reported previously (Deisseroth et al, DC Vector Vaccine and Chemotherapy in Breast Cancer, Submitted 2006). The endpoint of these studies is: FACS analysis of the DCs for appearance of CD 86 and PCR assay for expression of the CCR7 gene (PNAS 2004 100:15101-15106; Blood 2004 104:2704-2713).
b) In Vivo Induction of Immune Response with each Ad-sig- TAA/ecdCD40L
[0231] Induction of immune response is evaluated for each influenza vaccine vector as follows. Two sc injections at 7 day intervals are administered to 2 month and 18 month old BaIbC mice. Seven, 14 and 21 days following the last injection, the animal is sacrificed and the following assays carried out.
a. ELISA for AG specific antibodies in serum (see Blood 2004 104: 2704-2713 for method). b. ELISPOT and CTL assays for level of AG specific CD8 effector cells in spleen (see Blood 2004 104: 2704-2713 for method). c. Determine the levels of CD8 Effector T cells and CD4 T negative regulatory cells at the site of AGG inflammation. [0232] The levels of CD8 and CD4 cells are evaluated. Two and 18 month old BaIbC mice are injected sc with a syngeneic tumor cell line carrying the HA or M2 or HAM2 transcription unit. When the tumor nodule reaches the size of 150 cu mm, the test mouse is injected sc with the Ad-sig-TAA/ecdCD40L vector (2 injections 7 days apart). Seven days following the last vaccination, the animal is sacrificed. The tumor is minced, treated with DNAase and collagenase, filtered through nylon mesh and the frequency of CD8 effector cells and CD4CD25FOXP3 T negative regulatory cells is measured by FACS before and after vaccination.
d) Suppression of Growth of TAA Positive Syngeneic Tumor Cell Line
[0233] Suppression of growth of influenza antigen positive cell-lines is also evaluated. The syngeneic HA positive or M2 positive or HAM2 positive syngeneic cell line (500,000 cells) are injected sc into 2 month or 18 month old mice. A growth curve is followed in mice that were vaccinated with two Ad-sig-TAA/ecdCD40L injections (7 days apart) prior to the injection of the tumor cell line. The growth curve is the endpoint of the experiment.
e) Effect of Vaccination Based on One Ad-sig-TAA/ecdCD40L sc Injection Followed by Two TAA/ecdCD40L Protein Injections as Boost [0234] In the above Examples, it was shown that a single Ad-sig-TAA/ecdCD40L sc injection followed by two sc injections of 10 microgram of the TAA/ecdCD40L protein at 7 and 21 days produced dramatic increases in the levels of both antigen specific antibodies in the serum and TAA specific CD8 effector T cells in test mice. Influenza antigen Ad-sig-TAA/ecdCD40L single vector injection followed by two sc (10 microgram) TAA/ecdCD40L protein boost injections at 7 and 21 days is used.
[0235] The number of boosts, the route of administration of the vaccine, and the addition of adjuvant are modified to illicit an adequate increase in antigenic specific CD8 cells as determined by ELISPOT (200 positive cells/100,000 spleen cells) or antibodies (6-fold increase). 18. Induction of Immunity with Influenza Antigen/CD40 Ligand Fusion Protein Against the Hemagglutinin Protein of an H5N1 Influenza A Virus in 2 Month Old Mice
[0236] SEQ ID NO:21 represents a portion of the HA sequence from an H5N1 Influenza A virus (A/Hong Kong/156/97) was used as an antigen in the HA-CD40L fusion protein. As described below, this fusion protein induced an immune response in mice; as shown by the level of anti-H5 HA antibody in the serum of vaccinated animals.
[0237] SEQ ID NO:21 is present in the receptor binding region corresponding to amino acid residues 135-175 connected to residues 230-250 (see FIG. 2, underlined) of the hemagglutinin (HA) protein of the H5N1 avian influenza strain (H5HA). This strain was first isolated in 1997 in Hong Kong from a child with a fatal respiratory illness (see, e.g., Science 1998 279:393-96; J. Virology 1998 73: 2094-98; Emerging Infectious Disease 2002 8(8): 1-12).
KSSWSNHDASSGVSSACPYLGRSSFFRNVVWLIKKNSAYPTATRPKVN GQSGRMEFFWTILK (SEQ ID NO:21).
[0238] The HA-CD40L fusion was prepared as follows. A CD40L plasmid was generated by PCR amplifying HSFl/ΔCtΔTmCD40L using plasmid pcDNA-sig- hMUC-l/HSFl/ΔCtΔTmCD40L as template (the construction of this plasmid is described in U.S. Patent Application Publication US 2005-0226888). The PCR primers and conditions for PCR are as follows:
Primer 1 (forward) (Xcml restriction site underlined; EcoRV restriction site underlined and italicized):
5'-AA CCA TCA CTC TTC TGG T GAGCTC AAA GATATC AACGA
CGCACAAGC-3' (SEQ ID NO: 86); Primer 2 (forward) (EcoRV restriction site underlined and italicized):
5'-GCTCAAA GATATC AACGACGCACAAGCACCAAAATCA
AAGGTC-3' (SEQ ID NO: 87); and Primer 3 (reverse) (EcoRI restriction site underlined and bold): 5'-ATCTCGAG CG GAATTC CAGAGTTTGAGTAAGCCAAAAGA
TGAGAAGCC -3' (SEQ IDNO:88).
HSFl/ΔCtΔTm CD40L was amplified by two rounds of PCR amplification (1st round: primers 2 +3; 2nd round: primer 1+3). PCR was conducted using the GC- RICH PCR kit (Roche, Inc) under the following conditions:
Figure imgf000074_0001
The HSFl/ΔCtΔTm CD40L encoding DNA was subcloned into pTriEx-2 restriction sites Xcml (CCA TCA CTC TTC TGG) and EcoRI (GAATTC). The final vector was named ρTriEx-2 HSFl/ΔCtΔTm CD40L.
[0239] The cDNA encoding the HA antigen above (SEQ ID NO:21) was amplified from plasmid pcDNA-K/ Avian FIuHA (described above) using the following PCR primers:
HA forward primer (Xcml restriction site underlined):
5'-AA CCATCACTCTTCTGG TAGATCTAAAAGTTCTTGGTCCAATC-
3' (SEQ ID NO:89) and HA reverse primer (Xhol restriction site underlined):
5'- AAA CTCGAG TCT GATATC CTTTAAAATTGTCCAGAAGAACTC •
3' (SEQ ID NO^O). PCR was conducted under the following conditions:
Figure imgf000074_0002
[0240] The PCR amplification product was ligated into pcDNA3.1 /V5-His TOPO TA vector and named as pcDNA3.1/HA then subcloned into the expression plasmid pTriEx-2 HSFl/ΔCtΔTmCD40L using the Xcml and EcoRV sites to produce the plasmid pTriEx-2HA/mCD40L. Competent cells (Rosetta DE3 pLacI) were transformed with pTriEx-2HAmCD40L and single colony of transformed cells was selected. His-tagged HA/mCD40L fusion protein was produced from the transformed cells using the Overnight Express™ Autoinduction System (Novagen, Inc.). Following protein expression, the resulting media containing the cells was centrifuged at 5000 g for 10 minutes and the resulting supernatant discarded. Cells were lysed using the CelLytic B Plus Kit (Sigma, Inc.) as follows: 10 mL Lytic Buffer was added for each gram of pelleted cells; the Lytic Buffer was prepared by adding 10 mL CelLytic B reagent, 0.2 mL lysozyme, 0.1 mL protease inhibitor and 500 U benzonase; cells were resuspended in Lytic Buffer and incubated with shaking at RT for 10-15 minutes; and lysed cells were centrifuged 16,00Og for 10 minutes. Fusion protein was purified by HIS-Select Nickel Affinity Gel (Sigma, Inc.) as follows: 1 mL of His-Select Nickel Affinity Gel was prepared for each 10 mL of cell lysate supernatant and the fusion protein isolated using the "Batch Method" protocol from the manufacturer and performing 3 wash steps before the final elution of the His- tagged fusion protein; and the eluted protein (in 3 mL buffer) was applied to a 1 ODG desalting column and extracted from the column using 4 mL PBS. The eluted protein was concentrated using a Vivaspin column.
[0241] The H5HA/ecdCD40L fusion protein (10 μg) was injected subcutaneously into immunocompetent mice (2 months old) on days 0, 7, and 21 with or without 100 μg aluminum hydroxide hydrogel. Seven days following the third immunization, serum samples were collected and assayed by ELISA for antibody to HA. As shown in FIG. 25, the level of H5HA specific antibodies in both groups (i.e., with and without aluminum hydroxide) are significantly higher in the sera of vaccinated mice (N= 4) compared to the control mice injected only with PBS (N= 4).
[0242] The neutralizing dose (ND50) of the antibody to HA was determined using the following method. [0243] MDCK cells were harvested and the cell suspension diluted to 3 x 105 cells/mL (or other appropriate concentration so that the cells are at least 90% confluent at the initiation of theassay). 200 μL of the diluted cell suspension was transferred into each well of a 96-well microplate and incubated at 37±2°C and 5.0 ± 2 % CO2 for a minimum of 16 hours in a humidified incubator until the wells were at least 90% confluent. Serum samples were obtained from the above-described mice vaccinated with HA/ecdCD40L, 7 days after the third immunization. 300 μL aliquots of serum were serially diluted in inoculation medium (dilutions of 1 :5 to 1 :2560). The virus challenge solution was prepared by diluting the challenge virus to 200 TCID50/100 μL (or 2 x 103 TCID50/mL) in inoculation media. 300 μL of virus challenge solution was added to each serum dilution to produce inoculating solutions having a final serum dilution of 1 :10 to 1 :5120 and incubated at 37±2°C and 5.0 ± 2 % CO2 in a humidified incubator for 1 hour ± 5 minutes. Each well of the plate containing the MDCK cells was washed once with 200 μL Hank's Balanced Salt Solution (HBSS), inoculated with 100 μL of inoculating solution and incubated at 37±2°C and 5.0 ± 2 % CO2 in a humidified incubator for a minimum of 16 hours or until cytopathological effects (CPE) are evident in comparison to control (no virus) wells. The ND50 is the dilution that results in the absence of CPE in 50% of the wells inoculated was calculated using the Spearman Karber method.
[0244] At a targeted challenge concentration of virus of 20 (TC50ZmL), the serum from HA immunized animals showed a neutralizing titer of 4.56 x 103. At a ten-fold higher dilution of challenge virus (i.e., 200 (TC5o/mL)) no neutralizing effect of the serum from HA immunized animals was observed.
19. Induction of Immunity with Influenza Antigen/CD40 Ligand Fusion Protein Against the M2 Protein of an H5N1 Influenza A virus in 2 Month Old Mice
[0245] A portion of the M2 amino acid sequence from an H5N1 Influenza A virus (A/Hong Kong/156/97) was used as an antigen in the M2/ecdCD40L fusion protein. As described below, this fusion protein induced an immune response in mice; that is, a significant level of anti-M2 antibody was detected in the serum of vaccinated animals.
[0246] The amino acid sequence of a portion of an M2 protein corresponding to amino acid residues 1-24 of the M2 protein of an H5N1 Influenza A virus (A/Hong Kong/156/97), wherein the cysteine residues at positions 17 and 19 in the native protein have been mutated to serine residues as reported by De Fillette et al. (Virology 337:149-61, 2005) is shown below.
MSLLTEVDTLTRNGWGSRSSDSSD (SEQ ID NO:77)
[0247] Oligonucleotides corresponding to the sense and antisense strands of the DNA encoding SEQ ID NO:77 are as follows: M2 sense oligonucleotide:
5'- ATGA GCCTTCTAAC CGAGGTTGAC ACGCTTACCAGA
AACGGATGGG GGTCCAGATC CAGCGATTCA AGTGAT -3' (SEQ ID
NO:78) M2 antisense oligonucleotide:
5'-
ATCACTTGAATCGCTGGATCTGGACCCCCATCCGTTTCTGGTAAGC
GTGTC AACCTCGGTTAGAAGGCTCAT-3' (SEQ ID NO:79) The oligonucleotides were dissolved in STE buffer at high concentration (about 1-10 OD260 units/100 μL). The two strands were mixed together in equal molar amounts and heated to 94°C and slowly cooled to about 4°C. The annealed DNA was phosphorylated using T4 PNK (polynucleotide kinase) under standard conditions. The resulting double stranded DNA was amplified by PCR using the following primers: M2 forward primer (Xcml restriction site underlined):
5 ' - AA CCA TCA CTC TTC TGG T AGATCT ATGA GCCTTCTAAC
CGAGGTTGAC-3 (SEQ ID NO:91) M2 reverse primer (Xhol restriction site underlined):
5'- AAA CTCGAG TCT GATATC ATCACTTGAATCGCTGGATCTGG-3'
(SEQ ID NO:92) PCR was conducted under the following conditions:
Figure imgf000078_0001
[0248] The PCR amplification product was ligated into ρcDNA3.1 /V5-His TOPO TA vector and named as pcDNA3.1/M2 then subcloned into the expression plasmid pTriEx-2 HSFl/ΔCtΔTmCD40L using the Xcml and EcoRV sites to produce the plasmid pTriEx-2M2/mCD40L. Competent cells (Rosetta DE3 pLacI) were transformed with pTriEx-2 M2mCD40L and single colony of transformed cells was selected. His-tagged M2/mCD40L fusion protein was produced from the transformed cells using the Overnight Express™ Autoinduction System (Novagen, Inc.). Following protein expression, the resulting media containing the cells was centrifuged at 5000 g for 10 minutes and the resulting supernatant discarded. Cells were lysed using the CelLytic B Plus Kit (Sigma, Inc.) as follows: 10 mL Lytic Buffer was added for each gram of pelleted cells; the Lytic Buffer was prepared by adding 10 mL CelLytic B reagent, 0.2 mL lysozyme, 0.1 mL protease inhibitor and 500 U benzonase; cells were resuspended in Lytic Buffer and incubated with shaking at RT for 10-15 minutes; and lysed cells were centrifuged 16,000 g for 10 minutes. The fusion protein was purified by HIS-Select Nickel Affinity Gel (Sigma, Inc.) as follows: 1 mL of His-Select Nickel Affinity Gel was prepared for each 10 mL of cell lysate supernatant and the fusion protein isolated using the "Batch Method" protocol from the manufacturer and performing 3 wash steps before the final elution of the His-tagged fusion protein; and the eluted protein (in 3 mL buffer) was applied to a 1 ODG desalting column and extracted from the column using 4 mL PBS. The eluted protein was concentrated using a Vivaspin column.
[0249] The M2/ecdCD40L fusion protein (10 μg) was injected subcutaneously into immunocompetent mice (2 months old) on days 0, 7, and 21 with or without 100 μg aluminum hydroxide hydrogel. Seven days following the third immunization, serum samples were collected and assayed by ELISA for antibody to M2. As shown in FIG. 26, the level of M2 specific antibodies in both groups (i.e., with and without aluminum hydroxide) are significantly higher in the sera of vaccinated mice (N= 4) compared to the control mice injected only with PBS (N= 4).
[0250] The neutralizing dose (ND50) of the sera from M2 immunized mice was determined using the method as described in the preceding example. At a targeted challenge concentration of virus of 20 (TCso/mL), the serum from M2 immunized animals showed a neutralizing titer of 1.27 x 102. At a ten-fold higher dilution of challenge virus (i.e., 200 (TC5o/mL)) no neutralizing effect of the serum from M2 immunized animals was observed.
[0251] AU patents and publications mentioned in the specification are indicative of the levels of those of ordinary skill in the art to which the invention pertains. All patents and publications are herein incorporated by reference to the same extent as if each individual publication was specifically and individually indicated to be incorporated by reference.
[0252] The invention illustratively described herein suitably may be practiced in the absence of any element or elements, limitation or limitations which is not specifically disclosed herein. Thus, for example, in each instance herein any of the terms "comprising," "consisting essentially of and "consisting of may be replaced with either of the other two terms. The terms and expressions which have been employed are used as terms of description and not of limitation, and there is no intention that in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention claimed. Thus, it should be understood that although the present invention has been specifically disclosed by preferred embodiments and optional features, modification and variation of the concepts herein disclosed may be resorted to by those skilled in the art, and that such modifications and variations are considered to be within the scope of this invention as defined by the appended claims. [0253] Other embodiments are set forth within the following claims.

Claims

What is claimed is:
1. A method of generating an immune response in an individual against an influenza antigen, comprising: administering to the individual an effective amount of an expression vector, said vector comprising a transcription unit encoding a secretable fusion protein, said fusion protein comprising an influenza antigen and CD40 ligand.
2. The method of claim 1 further comprising administering an effective amount of a fusion protein comprising an influenza antigen and CD40 ligand.
3. The method of claim 2 where said protein is administered after administration of the vector.
4. The method of claim 1, wherein said influenza antigen of said fusion protein is glycosylated.
5. The method of claim 1 , wherein said influenza antigen of said fusion protein is not glycosylated.
6. The method of claim 1 wherein said influenza antigen is from an H3N2 or H5Nl influenza virus.
7. The method of claim 1 wherein said influenza antigen comprises at least one antigenic determinant of an influenza viral protein, said viral protein selected from the group consisting of hemagglutinin, neuraminidase and matrix protein 2.
8. The method of claim 6 wherein said influenza antigen comprises all or portion of the extracellular domain of said hemagglutinin, neuraminidase and matrix protein 2.
9. The method of claim 1 wherein said influenza antigen comprises a chimeric influenza antigen comprising at least one antigenic determinant from at least two different viral influenza proteins.
10. The method of claim 8 wherein said at least one antigenic determinant is from the extracellular domain of hemagglutinin, neuraminidase or matrix protein 2.
11. The method of claim 9 wherein said chimeric influenza antigen comprises all or a portion of the extracellular domain of hemagglutinin and all or a portion of the extracellular domain of matrix protein 2.
12. The method of claim 1 wherein said transcription unit encodes a linker between said influenza antigen and said CD40 ligand.
13. The method of claim 1 wherein said vector is a viral vector.
14. The method of claim 13 wherein said viral vector is an adenoviral vector.
15. The method of claim 1 wherein said CD40 ligand is human CD40 ligand.
16. The method of claim 1 wherein said CD40 ligand lacks a cytoplasmic domain.
17. The method of claim 1 wherein said CD40 ligand is missing all or substantially all of its transmembrane domain.
18. The method of claim 1 wherein said vector encodes a CD40L that includes a portion of the transmembrane domain wherein said protion comprises no more than six residues, said six residues being from either end of the transmembrane domain.
19. The method of claim 1 wherein said CD40 ligand comprises residues 47-261.
20. The method of claim 1 wherein said CD40 ligand comprises residues 44-261.
21. The method of claim 1 wherein said CD40 ligand comprises residues 1-23 and 47-261.
22. The method of claim 1 wherein said immune response includes the generation of cytotoxic CD8+ T cells against said influenza antigen.
23. The method of claim 1 wherein said immune response includes the generation of antibodies against said influenza antigen.
24. The method of claim 2 wherein said fusion protein is administered with an adjuvant.
25. The method of claim 2 wherein said fusion protein is administered subcutaneously.
26. The method of claim 2 wherein the sequence of CD40 ligand encoded by said vector and the sequence of CD40 ligand administered as a fusion protein are different.
27. The method of claim 2 wherein the sequence of the influenza antigen encoded by said vector and the sequence of the influenza antigen administered as a fusion protein are different
28. The method of claim 1 wherein the transcription unit encodes a secretory signal sequence.
29. The method of claim 1 wherein said individual is at least 50 years of age.
30. The method of claim 1 wherein said individual is at least 55 years of age.
31. The method of claim 1 wherein said individual is at least 60 years of age.
32. A method of increasing the immune responsiveness of an individual having CD4 T cells exhibiting reduced levels of CD40 ligand as compared to young, healthy individuals to vaccination against a cancer antigen or an infectious agent antigen comprising: administering to the individual an effective amount of an expression vector, said vector comprising a transcription unit encoding a secretable fusion protein, said fusion protein comprising a cancer or infectious agent antigen and CD40 ligand.
33. The method of claim 32 further comprising administering an effective amount of a fusion protein comprising a cancer or infectious agent antigen and CD40 ligand.
34. The method of claim 32 wherein said individual is at least 50 years of age.
35. The method of claim 32 wherein said individual is at least 55 years of age.
36. The method of claim 32 wherein said individual is at least 60 years of age.
37. The method of claim 32 wherein said cancer antigen is a tumor associated antigen.
38. The method of claim 32 wherein said infectious agent antigen is an influenza antigen.
39. The method of claim 38, wherein said infectious agent antigen of said fusion protein is glycosylated.
40. The method of claim 38, wherein said infectious agent \antigen of said fusion protein is not glycosylated.
41. A method of increasing the immune responsiveness of an individual of at least 50 years of age to vaccination against a cancer antigen or an infectious agent antigen comprising: administering to the individual an effective amount of an expression vector, said vector comprising a transcription unit encoding a secretable fusion protein, said fusion protein comprising a cancer antigen or infectious agent antigen and CD40 ligand.
42. The method of claim 41 wherein said individual has CD4 T cells exhibiting reduced levels of CD40 ligand as compared to young, healthy individuals.
43. The method of claim 41 further comprising administering an effective amount of a fusion protein comprising a cancer or infectious agent antigen and CD40 ligand.
44. The method of claim 43 further comprising a second administering of an effective amount of a fusion protein comprising an influenza antigen and CD40 ligand.
45. The method of claim 44 further comprising a third administering of an effective amount of a fusion protein comprising an influenza antigen and CD40 ligand.
46. The method of claim 41 wherein said individual is at least 55 years of age.
47. The method of claim 41 wherein said individual is at least 60 years of age.
48. The method of claim 41 wherein said cancer antigen is a tumor associated antigen.
49. The method of claim 41 wherein said infectious agent antigen is an influenza antigen.
50. The method of claim 49 wherein said influenza antigen of said fusion protein is glycosylated.
51. The method of claim 49 wherein said influenza antigen of said fusion protein is not glycosylated.
52. A method of generating an immune response in an individual against a foreign antigen, comprising: administering to the individual an effective amount of a fusion protein without administering an expression vector encoding said fusion protein, wherein said administering is repeated for multiple administrations, and wherein said fusion protein comprises the antigen and CD40 ligand.
53. The method of claim 52 wherein said multiple administrations includes three administrations.
54. The method of claim 52 wherein said foreign antigen is an infectious agent antigen.
55. The method of claim 52, wherein said infectious agent antigen of said fusion protein is glycosylated.
56. The method of claim 52, wherein said infectious agent antigen of said fusion protein is not glycosylated.
57. The method of claim 56 wherein said infectious agent antigen is a viral antigen.
58. The method of claim 57, wherein said viral antigen is from human papilloma virus.
59. The method of claim 58 wherein said human papilloma virus antigen is from the E6 protein or the E7 protein.
60. The method of claim 57 wherein said viral antigen is an influenza antigen.
61. The method of claim 60 wherein said influenza antigen is from an H3N2 or H5N1 influenza virus.
62. The method of claim 60 wherein said influenza antigen comprises at least one antigenic determinant of an influenza viral protein, said viral protein selected from the group consisting of hemagglutinin, neuraminidase and matrix protein 2.
63. The method of claim 60 wherein said influenza antigen comprises all or portion of the extracellular domain of said hemagglutinin, neuraminidase and matrix protein 2.
64. The method of claim 60 wherein said influenza antigen comprises a chimeric influenza antigen comprising at least one antigenic determinant from at least two different viral influenza proteins.
65. The method of claim 64 wherein said at least one antigenic determinant is from the extracellular domain of hemagglutinin, neuraminidase or matrix protein 2.
66. The method of claim 64 wherein said chimeric influenza antigen comprises all or a portion of the extracellular domain of hemagglutinin and all or a portion of the extracellular domain of matrix protein 2.
67. The method of claim 54 wherein said fusion protein includes a linker between said influenza antigen and said CD40 ligand.
68. The method of claim 54 wherein said CD40 ligand is human CD40 ligand.
69. The method of claim 54 wherein said CD40 ligand lacks a cytoplasmic domain.
70. The method of claim 54 wherein said CD40 ligand is missing all or substantially all of its transmembrane domain.
71. The method of claim 54 wherein said CD40L comprises a portion of the transmembrane domain wherein said portion comprises no more than six residues, said six residues being from either end of the transmembrane domain.
72. The method of claim 54 wherein said CD40 ligand comprises residues 47-261.
73. The method of claim 54 wherein said CD40 ligand comprises residues 44-261.
74. The method of claim 54 wherein said CD40 ligand comprises residues 1-23 and 47-261.
75. The method of claim 54 wherein said immune response includes the generation of cytotoxic CD8+ T cells against said influenza antigen.
76. The method of claim 54 wherein said immune response includes the generation of antibodies against said influenza antigen.
77. The method of claim 54 wherein said fusion protein is administered with an adjuvant.
78. The method of claim 54 wherein said fusion protein is administered subcutaneously.
79. The method of claim 54 wherein said individual is at least 50 years of age.
80. The method of claim 54 wherein said individual is at least 55 years of age.
81. The method of claim 54 wherein said individual is at least 60 years of age.
82. An expression vector in accordance with claim 1.
83. A pharmaceutical composition comprising the expression vector of claim 82.
84. The pharmaceutical composition of claim 83 further comprising an adjuvant.
85. A fusion protein encoded by the expression vector in accordance with claim 1.
86. A pharmaceutical composition comprising the fusion protein of claim 85.
87. The pharmaceutical composition of claim 86 further comprising an adjuvant.
PCT/US2006/043164 2005-11-07 2006-11-06 Cd40 ligand fusion protein vaccine WO2007056266A2 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
JP2008539106A JP2009514536A (en) 2005-11-07 2006-11-06 CD40 ligand fusion protein vaccine
AU2006311752A AU2006311752A1 (en) 2005-11-07 2006-11-06 CD40 ligand fusion protein vaccine
EP06827550.2A EP1951862B1 (en) 2005-11-07 2006-11-06 Cd40 ligand fusion protein vaccine
CA2628837A CA2628837C (en) 2005-11-07 2006-11-06 Cd40 ligand fusion protein vaccine

Applications Claiming Priority (10)

Application Number Priority Date Filing Date Title
US73413605P 2005-11-07 2005-11-07
US60/734,136 2005-11-07
US75588506P 2006-01-04 2006-01-04
US60/755,885 2006-01-04
US78927006P 2006-04-04 2006-04-04
US60/789,270 2006-04-04
US79320606P 2006-04-19 2006-04-19
US60/793,206 2006-04-19
US85318406P 2006-10-20 2006-10-20
US60/853,184 2006-10-20

Publications (2)

Publication Number Publication Date
WO2007056266A2 true WO2007056266A2 (en) 2007-05-18
WO2007056266A3 WO2007056266A3 (en) 2007-11-01

Family

ID=38023882

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2006/043164 WO2007056266A2 (en) 2005-11-07 2006-11-06 Cd40 ligand fusion protein vaccine

Country Status (6)

Country Link
US (3) US9533036B2 (en)
EP (1) EP1951862B1 (en)
JP (1) JP2009514536A (en)
AU (1) AU2006311752A1 (en)
CA (1) CA2628837C (en)
WO (1) WO2007056266A2 (en)

Cited By (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009029686A1 (en) * 2007-08-27 2009-03-05 Longhorn Vaccines & Diagnostics Llc Immunogenic compositions and methods
EP2097103A1 (en) * 2006-11-30 2009-09-09 Variation Biotechnologies Inc. Influenza vaccine formulation
US8097419B2 (en) 2006-09-12 2012-01-17 Longhorn Vaccines & Diagnostics Llc Compositions and method for rapid, real-time detection of influenza A virus (H1N1) swine 2009
US8604178B2 (en) 2006-09-18 2013-12-10 The Board Of Trustees Of The University Of Arkansas Compositions and methods of enhancing immune responses
US8956618B2 (en) 2010-01-21 2015-02-17 The Texas A&M University System Vaccine vectors and methods of enhancing immune responses
US8956849B2 (en) 2007-11-01 2015-02-17 The Board Of Trustees Of The University Of Arkansas Compositions and methods of enhancing immune responses to Eimeria
US8961990B2 (en) 2010-06-09 2015-02-24 The Board Of Trustees Of The University Of Arkansas Vaccine and methods to reduce campylobacter infection
US9125854B2 (en) 2007-10-30 2015-09-08 The Board Of Trustees Of The University Of Arkansas Compositions and methods of enhancing immune responses to flagellated bacterium
US9481912B2 (en) 2006-09-12 2016-11-01 Longhorn Vaccines And Diagnostics, Llc Compositions and methods for detecting and identifying nucleic acid sequences in biological samples
US9603915B2 (en) 2013-02-14 2017-03-28 The Board of Trustees of the University of Akansas Compositions and methods of enhancing immune responses to Eimeria or limiting Eimeria infection
US9683256B2 (en) 2007-10-01 2017-06-20 Longhorn Vaccines And Diagnostics, Llc Biological specimen collection and transport system
US9976136B2 (en) 2015-05-14 2018-05-22 Longhorn Vaccines And Diagnostics, Llc Rapid methods for the extraction of nucleic acids from biological samples
US10004799B2 (en) 2007-08-27 2018-06-26 Longhorn Vaccines And Diagnostics, Llc Composite antigenic sequences and vaccines
US10376571B2 (en) 2013-03-15 2019-08-13 The Board Of Trustees Of The University Of Arkansas Compositions and methods of enhancing immune responses to enteric pathogens
US10682398B2 (en) 2016-05-03 2020-06-16 The Texas A&M University System Yeast vaccine vector including immunostimulatory and antigenic polypeptides and methods of using the same
US11041216B2 (en) 2007-10-01 2021-06-22 Longhorn Vaccines And Diagnostics, Llc Compositions and methods for detecting and quantifying nucleic acid sequences in blood samples
US11041215B2 (en) 2007-08-24 2021-06-22 Longhorn Vaccines And Diagnostics, Llc PCR ready compositions and methods for detecting and identifying nucleic acid sequences
WO2023020637A1 (en) * 2021-08-20 2023-02-23 Centro De Ingenieria Genetica Y Biotecnologia Chimeric antigens for the control of coronavirus and compositions containing same
WO2023081595A1 (en) * 2021-11-05 2023-05-11 Navicure Biopharmaceuticals Limited Immunogenic fusion proteins against infectious animal diseases

Families Citing this family (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2007535304A (en) 2003-11-24 2007-12-06 シドニー キンメル キャンサー センター Mucin antigen vaccine
US8828957B2 (en) * 2003-12-11 2014-09-09 Microvax, Llc Methods for generating immunity to antigen
CU23576A1 (en) * 2006-02-28 2010-09-30 Ct Ingenieria Genetica Biotech CHEMICAL VACCINAL ANTIGENS AGAINST THE AVIAN INFLUENZA VIRUS
EP2030419B1 (en) 2006-06-07 2017-07-19 QUALCOMM Incorporated Efficient over the air address methods and apparatus
US8080645B2 (en) 2007-10-01 2011-12-20 Longhorn Vaccines & Diagnostics Llc Biological specimen collection/transport compositions and methods
US10426827B1 (en) * 2006-11-06 2019-10-01 Microvax, Llc Dengue hemorrhagic fever virus vaccine
US10293040B1 (en) * 2006-11-06 2019-05-21 Microvax, Llc Pharmaceutical compositions and methods of blocking Bacillus anthracis
US20130149330A1 (en) * 2006-11-06 2013-06-13 Microvax, Llc Pharmaceutical compositions and methods of blocking bacillus anthracis
US10174100B1 (en) * 2006-11-06 2019-01-08 Microvax, Llc Multivalent DNA composition for Yersinia pestis
EP3020832A1 (en) 2007-10-01 2016-05-18 Longhorn Vaccines and Diagnostics, LLC Biological specimen collection and transport system and methods of use
KR101425404B1 (en) * 2009-07-17 2014-08-01 한림대학교 산학협력단 Immunostimulatory Compositions Comprising Liposome―Encapsulated Oligonucleotides and Epitopes
CN104203272A (en) 2012-01-26 2014-12-10 长角牛疫苗和诊断有限责任公司 Composite antigenic sequences and vaccines
US10526375B2 (en) 2013-06-05 2020-01-07 Massachusetts Institute Of Technology Human Adaptation of H7 HA
US11154603B1 (en) 2015-11-10 2021-10-26 Microvax, Llc Burkholderia pseudomallei composition
US10149899B1 (en) 2015-12-11 2018-12-11 Microvax, Llc Composition and method against C-difficile
US11839655B2 (en) 2017-09-01 2023-12-12 Microvax, Llc Combination cancer therapy
WO2019241592A1 (en) * 2018-06-14 2019-12-19 Nantbio, Inc. Tnf-type receptor-ligand fusion proteins and methods
KR102393872B1 (en) * 2019-08-28 2022-05-04 엠브릭스 주식회사 Antiviral peptide from M2 protein and the use thereof
US20230241193A1 (en) * 2022-02-03 2023-08-03 Microvax, Llc mRNA VACCINE DESIGN USING MULTIPLE INTERACTING IMMUNO-STIMULATORY PATHWAYS, FOR CANCER AND INFECTIOUS DISEASES

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20050226888A1 (en) 2003-12-11 2005-10-13 Sidney Kimmel Cancer Center Methods for generating immunity to antigen

Family Cites Families (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA1054937A (en) * 1975-01-28 1979-05-22 Gursaran P. Talwar Antipregnancy vaccine
DE3431140A1 (en) * 1984-08-24 1986-03-06 Behringwerke Ag, 3550 Marburg ENHANCER FOR EUKARYOTIC EXPRESSION SYSTEMS
US4608251A (en) * 1984-11-09 1986-08-26 Pitman-Moore, Inc. LHRH analogues useful in stimulating anti-LHRH antibodies and vaccines containing such analogues
AU613590B2 (en) * 1986-11-19 1991-08-08 Bristol-Myers Squibb Company Hybridomas producing monoclonal antibodies to new mucin epitopes
US6133029A (en) * 1988-03-21 2000-10-17 Chiron Corporation Replication defective viral vectors for infecting human cells
US5962406A (en) * 1991-10-25 1999-10-05 Immunex Corporation Recombinant soluble CD40 ligand polypeptide and pharmaceutical composition containing the same
FR2705686B1 (en) * 1993-05-28 1995-08-18 Transgene Sa New defective adenoviruses and corresponding complementation lines.
US6080569A (en) * 1993-06-24 2000-06-27 Merck & Co., Inc. Adenovirus vectors generated from helper viruses and helper-dependent vectors
US5658785A (en) * 1994-06-06 1997-08-19 Children's Hospital, Inc. Adeno-associated virus materials and methods
FR2725726B1 (en) * 1994-10-17 1997-01-03 Centre Nat Rech Scient VIRAL VECTORS AND USE IN GENE THERAPY
US5641665A (en) * 1994-11-28 1997-06-24 Vical Incorporated Plasmids suitable for IL-2 expression
EP0827547B1 (en) * 1995-05-22 2001-08-16 THE GOVERNMENT OF THE UNITED STATES OF AMERICA, as represented by THE SECRETARY, DEPARTMENT OF HEALTH AND HUMAN SERVICES Retrovirus vectors derived from avian sarcoma leukosis viruses permitting transfer of genes into mammalian cells and therapeutic uses thereof
US6110744A (en) * 1996-11-13 2000-08-29 Board Of Regents, The University Of Texas System Diminishing viral gene expression by promoter replacement
US20020136722A1 (en) * 1997-06-18 2002-09-26 Heath Andrew William Vaccination method
ES2255181T3 (en) * 1997-08-05 2006-06-16 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw. IMMUNOPROTECTOR ANTIGEN AGAINST THE FLU AND ITS USE IN VACCINATION.
US6962790B1 (en) * 1998-09-23 2005-11-08 University Of Massachusetts Medical Center Predictive assay for immune response
US6440944B2 (en) * 1998-10-16 2002-08-27 Genvec, Inc. Methods of administering adenoviral vectors
IL127331A0 (en) * 1998-11-30 1999-09-22 Yeda Res & Dev Peptide-based vaccine for influenza
WO2001026608A2 (en) * 1999-10-14 2001-04-19 Ledbetter Jeffrey A Dna vaccines encoding antigen linked to a domain that binds cd40
DE60136334D1 (en) * 2000-02-02 2008-12-11 Us Health Cd40-ligand als adjuvant für respiratorisches syncytialvirus-impfstoff
US20040109869A1 (en) * 2001-03-19 2004-06-10 Iomai Corporation Transcutaneous immunostimulation
KR100835401B1 (en) * 2002-04-25 2008-06-04 피엠씨-시에라 이스라엘 엘티디. Forward error correction coding in ethernet networks
JP2006506072A (en) 2002-11-12 2006-02-23 デイッセロース，アルバート，ビー Adenovirus vector vaccine
WO2004075829A2 (en) * 2003-01-30 2004-09-10 Chiron Corporation Adjuvanted influenza vaccine
CA2816222A1 (en) * 2003-06-16 2005-03-03 Medimmune Vaccines, Inc. Influenza hemagglutinin and neuraminidase variants
JP2007535304A (en) 2003-11-24 2007-12-06 シドニー キンメル キャンサー センター Mucin antigen vaccine
WO2005058950A2 (en) 2003-12-11 2005-06-30 Sidney Kimmel Cancer Center Methods for generating immunity to antigen
EP1711206A2 (en) * 2004-01-26 2006-10-18 ChemoCentryx Inc Compositions and methods of use of w-peptides
WO2006130525A2 (en) 2005-05-31 2006-12-07 Sidney Kimmel Cancer Center Methods for immunotherapy of cancer

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20050226888A1 (en) 2003-12-11 2005-10-13 Sidney Kimmel Cancer Center Methods for generating immunity to antigen

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
DEISSEROTH ET AL., PROCEEDING OF THE ANNUAL MEETING OF THE AMERICAN ASSOCIATION FOR CANCER RESEARCH, vol. 46, 2005, pages 1454
See also references of EP1951862A4
YUCHENG ET AL., BLOOD, vol. 106, no. 11, 2005, pages 471B - 472B

Cited By (42)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9080204B2 (en) 2006-09-12 2015-07-14 Longhorn Vaccines And Diagnostics, Llc Compositions and methods for rapid, real-time detection of influenza a virus (H1N1) Swine 2009
US8097419B2 (en) 2006-09-12 2012-01-17 Longhorn Vaccines & Diagnostics Llc Compositions and method for rapid, real-time detection of influenza A virus (H1N1) swine 2009
US9481912B2 (en) 2006-09-12 2016-11-01 Longhorn Vaccines And Diagnostics, Llc Compositions and methods for detecting and identifying nucleic acid sequences in biological samples
US10004798B2 (en) 2006-09-18 2018-06-26 The Board Of Trustees Of The University Of Arkansas Compositions and methods of enhancing immune responses
US8604178B2 (en) 2006-09-18 2013-12-10 The Board Of Trustees Of The University Of Arkansas Compositions and methods of enhancing immune responses
US9226957B2 (en) 2006-09-18 2016-01-05 The Texas A&M University System Compositions and methods of enhancing immune responses
EP2097103A1 (en) * 2006-11-30 2009-09-09 Variation Biotechnologies Inc. Influenza vaccine formulation
EP2097103A4 (en) * 2006-11-30 2010-02-24 Variation Biotechnologies Inc Influenza vaccine formulation
US7807173B2 (en) 2006-11-30 2010-10-05 Variation Biotechnologies Inc. Influenza vaccine formulation
US11041215B2 (en) 2007-08-24 2021-06-22 Longhorn Vaccines And Diagnostics, Llc PCR ready compositions and methods for detecting and identifying nucleic acid sequences
US9777045B2 (en) 2007-08-27 2017-10-03 Longhorn Vaccines And Diagnostics, Llc Immunogenic compositions and methods
AU2008293504B2 (en) * 2007-08-27 2012-04-12 Longhorn Vaccines & Diagnostics, Llc Immunogenic compositions and methods
WO2009029686A1 (en) * 2007-08-27 2009-03-05 Longhorn Vaccines & Diagnostics Llc Immunogenic compositions and methods
EP3058954A3 (en) * 2007-08-27 2016-11-02 Longhorn Vaccines and Diagnostics, LLC Immunogenic compositions and methods
EP2772267A3 (en) * 2007-08-27 2014-12-10 Longhorn Vaccines & Diagnostics, LLC Immunogenic compositions and methods
US10596250B2 (en) 2007-08-27 2020-03-24 Longhorn Vaccines And Diagnostics, Llc Methods of treating and preventing influenza infections
US10004799B2 (en) 2007-08-27 2018-06-26 Longhorn Vaccines And Diagnostics, Llc Composite antigenic sequences and vaccines
US9683256B2 (en) 2007-10-01 2017-06-20 Longhorn Vaccines And Diagnostics, Llc Biological specimen collection and transport system
US11041216B2 (en) 2007-10-01 2021-06-22 Longhorn Vaccines And Diagnostics, Llc Compositions and methods for detecting and quantifying nucleic acid sequences in blood samples
US9125854B2 (en) 2007-10-30 2015-09-08 The Board Of Trustees Of The University Of Arkansas Compositions and methods of enhancing immune responses to flagellated bacterium
US8956849B2 (en) 2007-11-01 2015-02-17 The Board Of Trustees Of The University Of Arkansas Compositions and methods of enhancing immune responses to Eimeria
US10016493B2 (en) 2007-11-01 2018-07-10 The Board Of Trustees Of The University Of Arkansas Compositions and methods of enhancing immune responses to Eimeria
US10842858B2 (en) 2007-11-01 2020-11-24 The Board Of Trustees Of The University Of Arkansas Compositions and methods of enhancing immune responses to Eimeria
US8956618B2 (en) 2010-01-21 2015-02-17 The Texas A&M University System Vaccine vectors and methods of enhancing immune responses
US9913893B2 (en) 2010-01-21 2018-03-13 The Board Of Trustees Of The University Of Arkansas Vaccine vectors and methods of enhancing immune responses
US8961990B2 (en) 2010-06-09 2015-02-24 The Board Of Trustees Of The University Of Arkansas Vaccine and methods to reduce campylobacter infection
US10960068B2 (en) 2010-06-09 2021-03-30 The Board Of Trustees Of The University Of Arkansas Vaccine and methods to reduce campylobacter infection
US11904005B2 (en) 2013-02-14 2024-02-20 The Board Of Trustees Of The University Of Arkansas Compositions and methods of enhancing immune responses to Eimeria or limiting Eimeria infection
US11364290B2 (en) 2013-02-14 2022-06-21 The Board Of Trustees Of The University Of Arkansas Compositions and methods of enhancing immune responses to eimeria or limiting eimeria infection
US9603915B2 (en) 2013-02-14 2017-03-28 The Board of Trustees of the University of Akansas Compositions and methods of enhancing immune responses to Eimeria or limiting Eimeria infection
US9884099B2 (en) 2013-02-14 2018-02-06 The Board Of Trustees Of The University Of Arkansas Compositions and methods of enhancing immune responses to Eimeria or limiting Eimeria infection
US10792351B2 (en) 2013-02-14 2020-10-06 The Board Of Trustees Of The University Of Arkansas Compositions and methods of enhancing immune responses to Eimeria or limiting Eimeria infection
US10328137B2 (en) 2013-02-14 2019-06-25 The Board Of Trustees Of The University Of Arkansas Compositions and methods of enhancing immune responses to Eimeria or limiting Eimeria infection
US11013792B2 (en) 2013-03-15 2021-05-25 The Board Of Trustees Of The University Of Arkansas Compositions and methods of enhancing immune responses to enteric pathogens
US10716840B2 (en) 2013-03-15 2020-07-21 The Board Of Trustees Of The University Of Arkansas Compositions and methods of enhancing immune responses to enteric pathogens
US10376571B2 (en) 2013-03-15 2019-08-13 The Board Of Trustees Of The University Of Arkansas Compositions and methods of enhancing immune responses to enteric pathogens
US9976136B2 (en) 2015-05-14 2018-05-22 Longhorn Vaccines And Diagnostics, Llc Rapid methods for the extraction of nucleic acids from biological samples
US10087439B1 (en) 2015-05-14 2018-10-02 Longhorn Vaccines And Diagnostics, Llc Rapid methods for the extraction of nucleic acids from biological samples
US10682398B2 (en) 2016-05-03 2020-06-16 The Texas A&M University System Yeast vaccine vector including immunostimulatory and antigenic polypeptides and methods of using the same
US11382962B2 (en) 2016-05-03 2022-07-12 The Board Of Trustees Of The University Of Arkansas Yeast vaccine vector including immunostimulatory and antigenic polypeptides and methods of using the same
WO2023020637A1 (en) * 2021-08-20 2023-02-23 Centro De Ingenieria Genetica Y Biotecnologia Chimeric antigens for the control of coronavirus and compositions containing same
WO2023081595A1 (en) * 2021-11-05 2023-05-11 Navicure Biopharmaceuticals Limited Immunogenic fusion proteins against infectious animal diseases

Also Published As

Publication number Publication date
EP1951862B1 (en) 2013-07-24
US9533036B2 (en) 2017-01-03
US20220143171A1 (en) 2022-05-12
WO2007056266A3 (en) 2007-11-01
EP1951862A4 (en) 2009-07-22
CA2628837C (en) 2018-11-27
CA2628837A1 (en) 2007-05-18
US20170182147A1 (en) 2017-06-29
US20070128223A1 (en) 2007-06-07
AU2006311752A1 (en) 2007-05-18
US11077183B2 (en) 2021-08-03
JP2009514536A (en) 2009-04-09
EP1951862A2 (en) 2008-08-06

Similar Documents

Publication Publication Date Title
US20220143171A1 (en) Cd40 ligand fusion protein vaccine
AU2006236910B2 (en) Vaccine against pandemic strains of influenza viruses
JP5683811B2 (en) Chimera influenza virus-like particles
JP5200201B2 (en) Chimeric antigens to break host tolerance to foreign antigens
ES2387850T3 (en) Carcinoembryonic antigen fusion protein and its uses
CN113164586B (en) Immune composition and preparation method and application thereof
JP5917402B2 (en) VLPs based on chimeric RSV-F polypeptides and lentivirus Gag or alpha retrovirus Gag
KR20120052369A (en) Adenoviral-based vectors
US20230391830A1 (en) Conjugated virus-like particles and uses thereof as anti-tumor immune redirectors
US11806394B2 (en) Protein-based nanoparticle vaccine for metapneumovirus
WO2019092002A1 (en) Pharmaceutical compositions for treatment or prevention of viral infections
WO2023086961A1 (en) Sars-cov-2 spike fused to a hepatitis b surface antigen
WO2022135563A1 (en) Method for simultaneously inducing immune response against multiple viruses
US20170258886A1 (en) Production of an Immunogen Using a Plant Virus
JP2023539713A (en) Vaccine compositions, their methods and uses
JP2023523423A (en) Vaccine against SARS-CoV-2 and its preparation
US20230372466A1 (en) Universal mammalian influenza vaccine
KR20240011134A (en) Compositions and methods for preventing RSV and PIV3 infections
WO2023225562A1 (en) Multivalent vaccine for paramyxoviruses and uses thereof
JP2023530435A (en) RSV vaccine compositions, methods and uses thereof
KR20130001559A (en) Novel supplemented influenza vaccine having broad cross protective activity
US20150274784A1 (en) Production of an Immunogen Using a Plant Virus
Kittel Doctor of Medical Science

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application
ENP Entry into the national phase

Ref document number: 2008539106

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2628837

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2006311752

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2006827550

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2006311752

Country of ref document: AU

Date of ref document: 20061106

Kind code of ref document: A