WO2006111925A2 - Inhibition of tumorigenesis by inhibition of a6b4 integrin - Google Patents

Inhibition of tumorigenesis by inhibition of a6b4 integrin Download PDF

Info

Publication number
WO2006111925A2
WO2006111925A2 PCT/IB2006/051199 IB2006051199W WO2006111925A2 WO 2006111925 A2 WO2006111925 A2 WO 2006111925A2 IB 2006051199 W IB2006051199 W IB 2006051199W WO 2006111925 A2 WO2006111925 A2 WO 2006111925A2
Authority
WO
WIPO (PCT)
Prior art keywords
neu
integrin
cells
mice
therapeutic agent
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2006/051199
Other languages
French (fr)
Other versions
WO2006111925A3 (en
Inventor
Filippo G. Giancotti
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Memorial Sloan Kettering Cancer Center
Original Assignee
Memorial Sloan Kettering Cancer Center
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Memorial Sloan Kettering Cancer Center filed Critical Memorial Sloan Kettering Cancer Center
Priority to US10/596,364 priority Critical patent/US20080317752A1/en
Publication of WO2006111925A2 publication Critical patent/WO2006111925A2/en
Publication of WO2006111925A3 publication Critical patent/WO2006111925A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2839Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the integrin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents

Definitions

  • This application relates to a method of inhibiting tumorigenesis, particularly in the case of tyrosine kinase-related cancers such as breast and prostate cancer, through the inhibition of a6b4 integrin using a therapeutic agant that targets the beta 4 portion of the integrin.
  • a6b4 refers to the alpha-6-beta-4 integrin. Similar nomenclature with arabic or roman numerals is used for other integrins.
  • Integrins are a class of cellular transmembrane receptors known to bind to extracellular matrix proteins, and therefore they mediate cell-cell and cell-extracellular matrix interactions, referred generally to as cell adhesion events.
  • the integrins connect the extracellular matrix to the intracellular cytoskeleton and cooperate with Receptor Protein Tyrosine Kinases (RPTKs) to regulate cell fate (Giancotti and Ruoslahti, 1999; Hynes, 2003; Miranti and Brugge, 2002).
  • RPTKs Receptor Protein Tyrosine Kinases
  • the integrin receptors constitute a family of proteins with shared structural characteristics of noncovalent heterodimeric glycoprotein complexes formed of alpha and beta subunits. There are eight known beta subunits and fourteen known alpha subunits, which associate in various combinations to form twenty five receptors with different ligand specificities.
  • the ligands for several of the integrins are adhesive extracellular matrix (ECM) proteins such as fibronectin, vitronectin, collagens and laminin. It has been reported that the aVbl integrin, a fibronectin receptor, and the aV integrins aVb3 and aVb5, which bind to several RGD-cotnaining matrix proteins, promote an- iogenesis.
  • the a6b4 integrin is a laminin-5 receptor expressed by epithelial cells, Schwann cells, and endothelial cells and has several distinguishing features.
  • the cytoplasmic domain of b4 is unusually long (ca. 1000 amino acids) and displays no homology to the short cytoplasmic tails of other b subunits.
  • the unique cytoplasmic domain of b4 is phosphorylated on multiple tyrosines by a Src Family kinase (SFK) and interacts directly with the signaling adaptor protein She, causing activation of the Ras to ERK cascade (Dans et al., 2001; Gagnoux-Palacios et al., 2003; Mainiero et al., 1995).
  • SFK Src Family kinase
  • the b4 tail mediates activation of PI-3K and Rac (Shaw, 2001; Shaw et al., 1997).
  • the cytoplasmic domain of b4 associates with the keratin cytoskeleton, causing assembly of hemidesmosomes and, hence, strengthening adhesion to laminin-5-containing basement membranes (Dans et al., 2001; Murgia et al., 1998; Spinardi et al., 1993).
  • the other integrins activate FAK/SFK signaling at focal adhesions (Geiger et al., 2001; Schlaepfer and Hunter, 1998) and, although some of them also recruit She, they do so by a distinct, indirect mechanism (Wary et al., 1998).
  • a6b4 The pattern of expression of a6b4 in the skin is consistent with a role for a6b4 signaling in the control of epithelial proliferation.
  • the expression of a6b4 is restricted to the basal cell layer, which comprises the rapidly dividing transit-amplifying cells (Borradori and Sonnenberg, 1999; Fuchs et al., 1997), while in skin diseases characterized by suprabasal proliferation, such as squamous carcinoma and psoriasis, a6b4 extends to the suprabasal layers (Pellegrini et al., 1992).
  • ligation of a6b4 promotes progression through Gl and entry in S phase in keratinocytes treated with EGF, whereas ligation of a2bl does not exert this effect (Mainiero et al., 1997).
  • the integrin is still expressed at significant levels in Prostate Intraepithelial Neoplasia (PIN), and it may play a role at this stage of tumor progression. Nothwithstanding these findings, the role, if any, of a6b4 in tumor progression is not understood in the art. For example, whether the observed variations in expression levels are cause or effect, whether reduction changes I na6b4 have any actual impact of tumor growth or invasiveness in vivo, and how a6b4 interacts with other signaling moieties are not known.
  • the present invention provides methods for the inhibition of tumorigenesis in tumors of this type using inhibitors of a6b4 integrin that target beta 4.
  • a therapeutic agent effective to reduce the amount of active a6b4 integrin in the individual, at least at locations relevant to tumorigenesis.
  • the individual is a human patient.
  • the therapeutic agent may be an antibody or a small molecule, for example a laminin-5 analog, which binds to a6b4 integrin and inhibits its normal function.
  • the therapeutic agent may also be a chemical species that interferes with the production of beta 4, including for example an antisense or RNAi species.
  • the therapeutic agent is administered to the tissue or patient in a therapeutically effective amount.
  • the therapeutic agent may be used as a single agent or in combination with other therapies, especially those directed toward suppressing the activity of RPTKs known to cooperate with a6b4, including but not limited to ErbB2, EGF-R, Met, and Ron.
  • FIG. 1 shows a breeding strategy for introduction of MMTV-Neu Ndl -YD transgene into both wild-type and b4-1355T mice.
  • FIGs. 2 A and B shows the extent of tumor free survival in b4 mutant and wild-type breed in accordance with the scheme in Fig. 1.
  • FIG. 3 shows the number of individual mammary tumors in individual mice.
  • FIG. 4 shows the growth of mammary tumors in wild-type and b4-mutant mice.
  • Figs. 5A-C shows the difference in histological progression in mammary tumors in wild-type and b4-mutant mice.
  • Fig. 6 shows a breeding strategy for introduction of TRAMP into both wild-type and b4-1355T mice.
  • Figs. 7A-D shows results of an MRI analysis indicative of tumor growth in b4-mutant and b4-wild-type TRAMP mice.
  • FIG. 8 shows survival of b4-mutant and b4- wild-type TRAMP mice.
  • mice bearing mammary tumors were treated with Iressa or vehicle (0.1% Tween- 80).
  • Figs. 1OA and B shows reduction in tumor volume when MMTV-Neu (YD) mice bearing mammary tumors were treated with Iressa.
  • Fig. 12 shows histological grading of tumor cells. Tumors isolated from 5-month old mice were subjected to H&E staining and examined microscopically. The graph shows the percentages of tumors in each catagory (WD: well differentiated; MD: moderately differentiated, PD: poorly differentiated) in Neu(YD)/b4-WT and Neu(YD)/b4-1355T mice.
  • Fig. 13 shows levels of spontaneous metastasis. Mice were sacrificed approximately
  • mice 7.5 weeks after detection of their first palpable tumor. Sagittal lung sections (2-4 per mouse) were stained with H&E and examined microscopically. Mice were assigned to 3 groups depending on their average number of metastases per lung section ( ⁇ 1, 1-5, > 5). The graph shows the percentage of mice of the indicated genotypes in each group. The P value was calculated by the Chi-squared test. The inset shows the mean cumulative tumor burden + SD in each cohort of mice at the time of euthanasia.
  • Figs. 14A and B show results for tumor growth in 3D Matrigel. Primary tumor cells
  • the graph shows the average growth curves + SEM (standard error of the mean) of Neu(YD)/b4-WT cells (W) and Neu(YD)/ b-1355T cells (T).
  • Figs 15A-C shows results when Neu-b4-WT and Neu-b4-1355T cells were cultured on collagen I in serum-free
  • the arrow indicates when cells reached confluence
  • Fig. 16 shows results when Neu-b4-WT and Neu-b4-1355T cells treated with Iressa
  • the graph shows the mean number of invaded cells + SD per microscopic field in triplicate.
  • Fig. 17 shows results when Neu-b4-WT and Neu-b4-1355T cells were injected in the tail vein. Percentages of lung section areas occupied by metastases (mean + standard deviation) were quantified 30 days later by image analysis with Metamorph software.
  • Figs. 18A shows results when tumor-bearing Neu(YD)/b4-WT (b4-WT) and
  • mice Neu(YD)/b4-1355T (b4-1355T) mice were treated with Iressa (100 mg/Kg/day) or vehicle control (0.1% Tween-80) for 24 days or with a single dose of Doxorubicin (10 mg/Kg).
  • the graph shows the mean change in tumor volume + SEM at day 24 for Iressa or vehicle alone and day 21 for Doxorubicin.
  • Fig. 18B shows resyults when tumor-bearing Neu(YD)/b4-WT (b4-WT) and
  • 'tumorigenesis refers to initiation of primary or metastatic tumor growth, and the promotion of invasive growth.
  • the term 'inhibition' refers to a reduction of the event or activity inhibited to an extent sufficient to produce an observable result. Complete elimination of the event or activity is not required.
  • the term 'amount of active a6b4 integrh ⁇ refers to the observable tumorigenesis-promoting activity resulting from a6b4 integrin present in a tissue. Reductions in the amount of the active a6b4 integrin can result from a reduction in the amount of a6b4 integrin, i.e, effectively a reduction in concentration; a reduction in the capacity of individual molecules of a6b4 integrin to promote tumorigenesis, i.e. effectively a change in the quality of the integrin, or combinations thereof.
  • the first type of reduction will most commonly be achieved by limiting the production of a6b4 integrin, for example using a antisense oligonucleotide or RNAi techniques, although it could also be achieved by accelerating the decomposition of a6b4 integrin.
  • the second type of reduction is most readily achieved through physical binding of the integrin with a ligand that competes with the normal ligand for binding to the receptor.
  • the terms 'treatment' or 'treating' refer to the application of a therapeutic agent to achieve a reduction in the amount of active a6b4 integrin so as to produce a benefit to a patient being treated.
  • a benefit need not be a complete or permanent cure, but may be only a lessening of the rate at which tumorigenesis is occurring, thereby delaying progression of a disease condition.
  • the term 'administration' refers to any means by which a therapeutic agent can be delivered to a tissue, including without limitation oral, nasal and transdermal administration and injection, for example subcutaneous, subdermal, intramuscular, intravenous, intrathecal or peritoneal injection.
  • a therapeutic agent can be delivered to a tissue, including without limitation oral, nasal and transdermal administration and injection, for example subcutaneous, subdermal, intramuscular, intravenous, intrathecal or peritoneal injection.
  • direct injection to the eye may be used.
  • the therapeutic agent of the invention can be used in combination with other agents used in the treatment of cancer.
  • the therapeutic agent of the invention is suitably used in combination with kinase inhibitors such as Iressa.
  • Use in combination entails the administration of two or more agents in a time course where the effects of at least one of the agents is improved as a result of the use of the other. Two agents need no be administered at the same time to be considered use in combination, and may be used in any order.
  • the effective amount of a therapeutic agent to be administered varies depending on the nature of the therapeutic agent, and will frequently reflect a balancing of therapeutic benefits and side effects. However, the determination of specific amounts for a given therapeutic is routine and within the skill in the art.
  • Therapeutic agents useful in the present invention may be antibodies, aptamers or small molecules that bind to a6b4 integrin to produce a reduction in activity. Examples include small molecules which block b4 signalling by binding to b4, and have specific functions such as inhibiting nuclear translocation of NfkB. Where an antibody therapeutic agent is used, it may be administered in the form of the antibody, or formed in situ by expression of a nucleic acid sequence encoding an a6b4 integrin-specific antibody. Such antibodies may be monoclonal, polyclonal, or modified constructs, for example single chain Fv constructs, targeting a6b4 integrin. Binding sites may be on the alpha chain, the beta chain or both chains of the a6b4 integrin. Non-antibody binding proteins could also be employed. For example, human integrin-beta-4 binding protein is known and has the sequence:
  • the therapeutic agent may also be a nucleic acid that results in a reduction in the amount of active a6b4 integrin, for example an antisense oligonucleotide or an RNA molecule that works by an RNAi mechanism.
  • the nucleic acid may target, via a sequence specific mechanism, the alpha chain or the beta chain.
  • the coding sequence of the beta 4 chain of human integrin is known from NM_000213 to be as follows: 1 atggcagggc cacgccccag cccatgggcc aggctgctcc tggcagcctt gatcagcgtc 61 agcctctctg ggaccttggc aaaccgctgc aagaaggccc cagtgaagag ctgcacggag 121 tgtgtccgtg tggataagga ctgcgctac tgcacagacg agatgttcag ggaccggcgc 181 tgcaacaccc aggcggagct gctggccgcg ggctgccagc gggagagcat cgtggtcatg 241 gagagcagct tccaaatcac agagg
  • Antisense and RNAi sequence are derivable from these sequences.
  • Antisense oligonucleotides are commonly from 12 to 50 bases in length, more preferably 15-30 bases length. Effective regions for targeting of antisense sequences may be found throughout the target nucleic acid.
  • a preferred intragenic site is the region encompassing the translation initiation or termination codon of the open reading frame (ORF) of the gene. Since, as is known in the art, the translation initiation codon is typically 5'-AUG (in transcribed mRNA molecules; 5'-ATG in the corresponding DNA molecule), the translation initiation codon is also referred to as the 'AUG codon,' the 'start codon' or the 'AUG start codon'.
  • RNA sequence 5'-GUG, 5'-UUG or 5'-CUG, and 5'-AUA, 5'-ACG and 5'-CUG have been shown to function in vivo.
  • the terms 'translation initiation codon' and 'start codon' can encompass many codon sequences, even though the initiator amino acid in each instance is typically methionine (in eukaryotes) or formyl- methionine (in prokaryotes).
  • eukaryotic and prokaryotic genes may have two or more alternative start codons, any one of which may be preferentially utilized for translation initiation in a particular cell type or tissue, or under a particular set of conditions.
  • 'start codon' and 'translation initiation codon' refer to the codon or codons that are used in vivo to initiate translation of an mRNA molecule transcribed from a gene encoding Integrin beta 4, regardless of the sequence(s) of such codons.
  • a translation termination codon (or 'stop codon') of a gene may have one of three sequences, i.e., 5'-UAA, 5'-UAG and 5'-UGA (the corresponding DNA sequences are 5'-TAA, 5'-TAG and 5'-TGA, respectively).
  • the terms 'start codon region' and 'translation initiation codon region' refer to a portion of such an mRNA or gene that encompasses from about 25 to about 50 contiguous nucleotides in either direction (i.e., 5' or 3') from a translation initiation codon.
  • 'stop codon region' and 'translation termination codon region' refer to a portion of such an mRNA or gene that encompasses from about 25 to about 50 contiguous nucleotides in either direction (i.e., 5' or 3') from a translation termination codon.
  • the open reading frame (ORF) or 'coding region,' which is known in the art to refer to the region between the translation initiation codon and the translation termination codon, is also a region which may be targeted effectively.
  • Other target regions include the 5' untranslated region (5'UTR), known in the art to refer to the portion of an mRNA in the 5' direction from the translation initiation codon, and thus including nucleotides between the 5' cap site and the translation initiation codon of an mRNA or corresponding nucleotides on the gene, and the 3' untranslated region (3'UTR), known in the art to refer to the portion of an mRNA in the 3' direction from the translation termination codon, and thus including nucleotides between the translation termination codon and 3' end of an mRNA or corresponding nucleotides on the gene.
  • 5'UTR 5' untranslated region
  • 3'UTR 3' untranslated region
  • the 5' cap of an mRNA comprises an N7-methylated guanosine residue joined to the 5 '-most residue of the mRNA via a 5 '-5' triphosphate linkage.
  • the 5' cap region of an mRNA is considered to include the 5' cap structure itself as well as the first 50 nucleotides adjacent to the cap.
  • the 5' cap region may also be a preferred target region.
  • RNAi molecules are similarly selected based on the sequence and defined parameters known for the selection of appropriate sequences. RNAi molecules may be single or double stranded, and generally have a length of 19 to 23 bases, although longer and shorter species can be used.
  • a specific RNAi species useful in the method of the invention is based on the mouse sequence of beta-4 cDNA (Genebank Ace. # L04678): nucleotides 113 to 131, counting from the A of the ATG translational start site, having the sequence GAGCTGTACCGAGTGCATC (Seq. ID. No. 4). This molecule, and the corresponding molecule based on the human sequence, and their use form a further aspect of this invention.
  • the therapeutic agent is in combination with other therapy directed toward suppressing the activity of RPTKs known to cooperate with a6b4, including but not limited to ErbB2 (Her2), EGF-R, Met, and Ron.
  • a6b4 ErbB2
  • ErbB2 Her2
  • EGF-R EGF-R
  • Met Met
  • Ron Ron
  • Specific examples of such inhibitors include the Her2 inhibitor trastuzumab (HerceptinTM), and PPAR gamma ligands as described in US Patent No. 6,291,496, which is incorporated herein by reference
  • MMTV-Neu Ndl - YD transgene was introduced into both wild-type and b4-1355T mice of FVB background using the breeding strategy outlined in Fig. 1 (asterick points to Neu mutant. Tumor onset was evaluated by palpation, and mice carrying palpable mammary nodules considered affect. As shown in Fig. 2A, the b4 mutant mice lived free of tumors significantly longer than the corresponding control mice. In addition, the b4 mutant mice developed, on average, a smaller number of individual tumors in their mammary glands. (Fig. 3). In a second set of experiments, the test was repeated with a larger number of mice in each group. As reflected in Fig. 2B, the same t was observed. The dotted line in Fig. 2B corresponds to heterozygous MMTV-Neu(YD); b4 + mice. These results indicate that a6b4 signalling promotes tumorigenesis in this model of breast cancer.
  • RTK inhibitors a group which includes all tumor types expressing a6b4 and carrying amplified or activated versions of Neu, EGF-R, and Met RTKs (Bacus et al., 1994; Longati et al., 2001; Sawyers, 2002).
  • mice bearing mammary tumors bearing mammary tumors (>0.5 cm in diameter) were treated with Iressa (100 mg/Kg/day) or vehicle (0.1% Tween-80) by gastric gavage for 1 month or 7 days.
  • Tumor sections were stained with anti-Ki-67 Mab, which labels proliferating cells. There is no significant difference in Ki-67 staining between mice treated for 1 month or 7 days.
  • MMTV-Neu mice bearing mammary tumors (>0.5cm in diameter) were treated with Iressa (100 mg/Kg/day) by gastric gavage for 24 days. Tumor volumes were measured by caliper.
  • Fig. 1OA shows the fold changes in tumor volume from day
  • Fig. 1OB shows the percentage of mice with regressed tumors in each group.
  • the tumors in Neu(YD)/b4-1355T mice exhibited a similar up-regulation of b4 and down-regulation of laminin-5.
  • the mutant b4 integrin remained in part concentrated at the basement membrane junction in MIN lesions of these mice, indicating that b4 signaling may contribute to disruption of epithelial polarity.
  • individual tumors of Neu(YD)/b4-1355T mice grew only at a modestly reduced rate (approximately 70% of control value) and contained a number of microvessels similar to that of control Neu(YD)/b4-WT mice, we examined if loss of b4 signaling inhibits mammary tumor induction or initial growth.
  • MIN mammary intraepithelial neoplasia
  • MEN lesions from Neu(YD)/b4-WT mice contained a significantly higher proportion of proliferating tumor cells (approximately 40%) than those from Neu(YD)/b4b-1355T mice (approximately 20%) (Fig. 1 IB). Staining with antibodies to cleaved caspase-3 indicated modest apoptotic rates in most MEN lesions from Neu(YD)/b4-WT mice.
  • ErbB2 mammary tumors progress from MIN to invasive carcinoma through steps characterized by increasing degrees of de-differentiation.
  • Neu(YD)/b4-1355T mice exhibited a high proportion of well and moderately differentiated tumors characterized by a glandular appearance.
  • Neu(YD)/b4-WT mice had developed predominantly poorly differentiated tumors (Fig, 12), further indicating that deletion of the b4 signaling domain inhibits histological progression.
  • mammary tumors of MMTV-Neu(YD) mice retain expression of E-cadherin but lose the tight junction component Zonula Occludens 1 (ZO-I) like their human counterpart.
  • tumor cells expressing wild-type b4 exhibited a spindle-like morphology and their margins tended to overlap, whereas those expressing b4- 355T had polygonal shapes and their margins appeared closely apposed.
  • Anti-ZO-1 staining revealed that cells expressing wild-type b4 had severely disrupted tight junctions.
  • Anti-E-cadherin and anti-beta-catenin staining showed that they also had disorganized adherens junctions.
  • tumor cells expressing b4-1355T exhibited well-organized adherens and tight junctions, indicating that loss of b4 signaling restores epithelial adhesion in ErbB2-transformed MECs.
  • Gefitinib (Iressa), which was developed to block the EGF- R but also inhibits activated ErbB2 with an IC50 of approximately 1 ⁇ M, promoted reassembly of both adherens and tight junctions in tumor cells expressing wild-type b4. Since ErbB2-transformed mouse mammary epithelial cells do not express detectable levels of the EGF-R in vitro, it is likely that Iressa exerts its effect in these cells by inhibiting ErbB2. These results suggest that the b4 integrin cooperates with ErbB2 to induce disruption of epithelial adhesion.
  • 3D Matrigel normal MECs form monolayered acinar structures and undergo growth arrest. By contrast, tumorigenic MECs form disorganized solid aggregates and continue to proliferate. Consistent with their neoplastic nature, tumor cells expressing wild-type b4 formed expansive solid spheroids in 3D Matrigel. Immunofluorecent staining showed that these structures were profoundly disorganized. Laminin-5 was deposited both around and inside tumor cell aggregates and the b4 integrin was diffusely distributed over the cell surface. In addition, E-cadherin and beta-catenin were not concentrated at adherens junctions and ZO-I was present in intracellular granules.
  • the resulting vectors were named LTRHl-b4-WT and LTRHl-b4-1355T.
  • TAM67 cDNA was subcloned in pBMN-IRES-EGFP (from Gary Nolan, Stanford University).
  • the Stat3-beta vector was constructed by subcloning the Stat3-beta cDNA into pMSCV-IRES-EGFP and provided by Jackie Bromberg (Department of Medicine, MSKCC).
  • pLVTH lentiviral vectors encoding a control shRNA containing a scrambled anti-ALK sequence and a shRNA targeting STAT3 were previously described (Chatterjee et al., 2004).
  • the pLKOl vector encoding a shRNA targeting c-Jun (5'-CCGGGAAGCGCAT GAGGAACCGCATCTCGAGATGCGGTTCCTCAT- GCGCTTCTTTTTG-3') Seq ID. No: 6 was obtained from Open Biosystems. It incorporates an iRNA sequence that mediates efficient and specific knock down of c- Jun.
  • beta-catenin was phosphorylated on tyrosine to similar levels in Neu- b4-WT and Neu-b4-1355T cells.
  • the tumors expressing mutant b4 exhibited a striking pseudo-glandular organization.
  • the epithelial cells surrounding the lumens of glandular structures were supported by a continuous, albeit partially disorganized, basement membrane containing laminin-5 and collagen IV. They exhibited many seemingly normal beta-catenin-containing junctions and assembled ZO-I -containing tight junctions toward their apical pole.
  • Neu-b4-WT cells produced numerous, large metastases in the lung, but Neu-b4-1355T formed only a few micro- metastases (Fig. 17). Together with the observation that Neu(YD)-b4-1355T mice progress to lung metastasis less efficiently than Neu(YD)-b4-WT mice, these results indicate that b4 signaling promotes mammary tumor invasion and metastasis.
  • deletion of the b4 signaling domain suppressed phosphorylation of the P-loop but not the major autophosphorylation site of ErbB2.
  • the 4 signaling domain contributes to phosphorylation of the P-loop of ErbB2 by promoting SFK association with the RTK.
  • b4 functions both upstream and downstream of ErbB2 and deletion of the b4 signaling domain uncouples b4 from ErbB2, suppressing joint signaling.
  • ErbB2 activates Ras, PI-3K, and JAK-STAT signaling .
  • b4 we compared the levels of activation of ERK, JNK, and Akt in Neu-b4-WT and Neu-b4-1355T cells stably adhering to laminin-5 or collagen I, as a control. These kinases were activated to similar levels in both types of cells on either substrate. Since b4 signaling controls translocation of activated MAP kinases to the nucleus in EGF-treated keratinocytes, we next monitored nuclear accumulation of activated ERK and JNK in Neu-b4-WT and Neu-b4-1355T cells.
  • TAM67 a dominant negative form of c-Jun
  • Neu-b4-WT cells were transduced with a retroviral vector encoding TAM67 or GFP, as a control. Expression of TAM67 inhibited mammary tumor cell proliferation in vitro and tumorigenicity in vivo.
  • STAT3 is frequently activated in human breast cancer samples.
  • recent studies have indicated that STAT3 activation is sufficient to transform mammary epit helial cells in vitro.
  • Expression of a dominant negative mutant form of STAT3 did not inhibit mammary tumor cell proliferation in vitro and tumorigenicity in vivo.
  • STAT3-beta did not inhibit mammary tumor cell proliferation in vitro and tumorigenicity in vivo.
  • it restored assembly of tight junctions to a significant extent and formation of adherens junctions partially.
  • STAT3-beta inhibited Matrigel invasion and experimental metastasis.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Veterinary Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Public Health (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)

Abstract

Inhibitors of a6b4 integrin that target beta 4 are used as therapeutic agents to inhibit tumorigensis in individuals, including humans, of tumors that express a6b4 integrin. The therapeutic agent may be an antibody or a small molecule, for example a laminin-5 analog, which binds to a6b4 integrin and inhibits its normal function. The therapeutic agent may also be a chemical species that interferes with the production of beta 4, including for example an antisense or RNAi species. The therapeutic agent is administered to the tissue or patient in a therapeutically effective amount. The therapeutic agent may be used as a single agent or in combination with other therapies, especially those directed toward suppressing the activity of RPTKs known to cooperate with a6b4, including but not limited to ErbB2, EGF-R, Met, and Ron.

Description

Description
Inhibition of tumorigenesis by inhibition of a6b4 integrin
Background of Invention
[1] This application relates to a method of inhibiting tumorigenesis, particularly in the case of tyrosine kinase-related cancers such as breast and prostate cancer, through the inhibition of a6b4 integrin using a therapeutic agant that targets the beta 4 portion of the integrin. In this application, the nomenclature a6b4 refers to the alpha-6-beta-4 integrin. Similar nomenclature with arabic or roman numerals is used for other integrins.
[2] Integrins are a class of cellular transmembrane receptors known to bind to extracellular matrix proteins, and therefore they mediate cell-cell and cell-extracellular matrix interactions, referred generally to as cell adhesion events. The integrins connect the extracellular matrix to the intracellular cytoskeleton and cooperate with Receptor Protein Tyrosine Kinases (RPTKs) to regulate cell fate (Giancotti and Ruoslahti, 1999; Hynes, 2003; Miranti and Brugge, 2002). Depending on the integrins they express and the matrix they attach to, normal cells proliferate or undergo growth arrest, migrate or remain stationary, and live or undergo apoptotic death. These effects imply that the integrins impart a stringent control to the action of RPTKs, determining the nature and direction of the cell's response to growth factors and cytokines (Giancotti and Tarone, 2003). Despite considerable amounts of cell biological data, genetic evidence of the significance of integrin signaling remains scarce. In particular, it has been difficult to separate the adhesive and signaling function of individual integrins in any model system analyzed to date.
[3] The integrin receptors constitute a family of proteins with shared structural characteristics of noncovalent heterodimeric glycoprotein complexes formed of alpha and beta subunits. There are eight known beta subunits and fourteen known alpha subunits, which associate in various combinations to form twenty five receptors with different ligand specificities. The ligands for several of the integrins are adhesive extracellular matrix (ECM) proteins such as fibronectin, vitronectin, collagens and laminin. It has been reported that the aVbl integrin, a fibronectin receptor, and the aV integrins aVb3 and aVb5, which bind to several RGD-cotnaining matrix proteins, promote an- iogenesis. Hynes et al. (2002). This property has been considered as a basis for using inhibitors of such integrins as inhibitors of angiogenesis. See US Patents Nos. 5,981,478; 5,766,591; 6,358,970; and 6,645,991. However, while genetic experiments in mice have confirmed the role of a5bl integrin in angiogenesis, they have not confirmed a role for the aV integrins, thus calling into question the efficacy of anti- angiogeneic therapy based on the latter group. Anti-angiogenic therapy based on inhibition of a5bl integrin is problematic because of toxicity arising as a result of the critical involvement of this integrin adhesion of several cell types.
[4] The a6b4 integrin is a laminin-5 receptor expressed by epithelial cells, Schwann cells, and endothelial cells and has several distinguishing features. The cytoplasmic domain of b4 is unusually long (ca. 1000 amino acids) and displays no homology to the short cytoplasmic tails of other b subunits. Upon a6b4 binding to matrix, the unique cytoplasmic domain of b4 is phosphorylated on multiple tyrosines by a Src Family kinase (SFK) and interacts directly with the signaling adaptor protein She, causing activation of the Ras to ERK cascade (Dans et al., 2001; Gagnoux-Palacios et al., 2003; Mainiero et al., 1995). In addition, the b4 tail mediates activation of PI-3K and Rac (Shaw, 2001; Shaw et al., 1997). Upon dephosphorylation, the cytoplasmic domain of b4 associates with the keratin cytoskeleton, causing assembly of hemidesmosomes and, hence, strengthening adhesion to laminin-5-containing basement membranes (Dans et al., 2001; Murgia et al., 1998; Spinardi et al., 1993). In contrast, the other integrins activate FAK/SFK signaling at focal adhesions (Geiger et al., 2001; Schlaepfer and Hunter, 1998) and, although some of them also recruit She, they do so by a distinct, indirect mechanism (Wary et al., 1998).
[5] The pattern of expression of a6b4 in the skin is consistent with a role for a6b4 signaling in the control of epithelial proliferation. In normal epidermis, the expression of a6b4 is restricted to the basal cell layer, which comprises the rapidly dividing transit-amplifying cells (Borradori and Sonnenberg, 1999; Fuchs et al., 1997), while in skin diseases characterized by suprabasal proliferation, such as squamous carcinoma and psoriasis, a6b4 extends to the suprabasal layers (Pellegrini et al., 1992). In addition, ligation of a6b4 promotes progression through Gl and entry in S phase in keratinocytes treated with EGF, whereas ligation of a2bl does not exert this effect (Mainiero et al., 1997).
[6] Tumor biology studies have suggested a function for a6b4 signaling in tumor invasion. Many invasive carcinomas display elevated levels of a6b4 (Mercurio and Rabinovitz, 2001). Introduction of a6b4 in breast and colon carcinoma cells that have lost its expression activates PI-3K to Rac signaling and increases invasive ability in vitro (Shaw et al., 1997). In addition, it has been proposed that the b4 tail functions as an essential adapter and amplifier of pro-invasive signals elicited by activated Met in cells undergoing Met-induced oncogenesis (Trusolino et al., 2001). Finally, introduction of a dominant negative form of b4 impairs the survival of breast carcinoma cells, and this effect has been linked to the ability of mutant b4 to interfere with the assembly of hemidesmosomes and the establishment of a partially polarized phenotype (Weaver et al., 2002). Collectively, these results suggest the possibility that a6b4 promotes cell migration and invasion and confers resistance to apoptosis in carcinoma cells.
[7] Commonly assigned US Provisional Application No. 60/481,696, filed November
22, 2003, and PCT application PCT/US2004/039189, which are incorporated herein by reference, described the use of a6b4 inegrin in controlling pathological neogenesis. While this angiogenesis can occur in tumors, controlling angiogenesis is not the same as controlling or inhibiting tumorigenesis and tumor progression.
[8] It has been shown previously that coexpression of a6b4 and laminin and ampl- ficiation of ErbB-2 correlate with a poor prognosis in breast cancer patients (Slamon et al., 1987; Tagliabue et al., 1998). Although a significant fraction of human breast cancers show reduced expression of a6b4, a significant fraction of metastatic lymph nodes stain positive for a6b4 (Natali et al., 1992). Further, there is evidence that introduction of a6b4 increases the invasive ability of MDA-MB-435 breast carcinoma cells in in vitro assays (Shaw et al, 1997) and that the ability of b4-transfected MDA- MB-435 cells to metastasize to lung upon injection into a mouse tail vein requires the binding of a6b4 on cancer cells to Lu-ECAM-I on lung endothelial cells. (Abdel-DGhany et al., 2001). Pathological studies have shown that the expression of a6b4 declines during prostate cancer progression (Cress et al., Cancer Metastasis Rev. 14:219-228, 1995). However, the integrin is still expressed at significant levels in Prostate Intraepithelial Neoplasia (PIN), and it may play a role at this stage of tumor progression. Nothwithstanding these findings, the role, if any, of a6b4 in tumor progression is not understood in the art. For example, whether the observed variations in expression levels are cause or effect, whether reduction changes I na6b4 have any actual impact of tumor growth or invasiveness in vivo, and how a6b4 interacts with other signaling moieties are not known.
Summary of the Invention
[9] Following an investigation of the role of a6b4 in mice engineered to develop mammary tumors on expression of an activated version of ErbB-2 and on mice engineered to develop prostate cancer on expression of the S V-40 T Antigen, we have determined that a6b4 integrin signaling is necessary for the progression of breast and prostate cancer. This finding is also applicable to other tumor types that express a6b4, such as thyroid cancer, squamous carcinoma of the skin, cervix, and upper gastrointestinal tract, pancreatic cancer, colon cancer (Mercurio AM, Rabinovitz I, Towards a mechanistic understanding of tumor invasion—lessons from the alphaόbeta 4 integrin. Semin Cancer Biol. 2001 Apr;ll(2):129-41). Thus, the present invention provides methods for the inhibition of tumorigenesis in tumors of this type using inhibitors of a6b4 integrin that target beta 4. In accordance with the method of the invention, an individual in whom tumorigensis is to be inhibited is exposed to a therapeutic agent effective to reduce the amount of active a6b4 integrin in the individual, at least at locations relevant to tumorigenesis. In one embodiment of the invention, the individual is a human patient. The therapeutic agent may be an antibody or a small molecule, for example a laminin-5 analog, which binds to a6b4 integrin and inhibits its normal function. The therapeutic agent may also be a chemical species that interferes with the production of beta 4, including for example an antisense or RNAi species. The therapeutic agent is administered to the tissue or patient in a therapeutically effective amount. The therapeutic agent may be used as a single agent or in combination with other therapies, especially those directed toward suppressing the activity of RPTKs known to cooperate with a6b4, including but not limited to ErbB2, EGF-R, Met, and Ron.
Brief Description of the Drawings
[10] Fig. 1 shows a breeding strategy for introduction of MMTV-NeuNdl-YD transgene into both wild-type and b4-1355T mice.
[11] Figs. 2 A and Bshows the extent of tumor free survival in b4 mutant and wild-type breed in accordance with the scheme in Fig. 1.
[12] Fig. 3 shows the number of individual mammary tumors in individual mice.
[13] Fig. 4 shows the growth of mammary tumors in wild-type and b4-mutant mice.
[14] Figs. 5A-C shows the difference in histological progression in mammary tumors in wild-type and b4-mutant mice.
[15] Fig. 6 shows a breeding strategy for introduction of TRAMP into both wild-type and b4-1355T mice.
[16] Figs. 7A-D shows results of an MRI analysis indicative of tumor growth in b4-mutant and b4-wild-type TRAMP mice.
[17] Fig. 8 shows survival of b4-mutant and b4- wild-type TRAMP mice.
[18] Fig. 9 shows the sensitization upon loss of beta=4 siganling when MMTV-Neu
(YD) mice bearing mammary tumors were treated with Iressa or vehicle (0.1% Tween- 80).
[19] Figs. 1OA and B shows reduction in tumor volume when MMTV-Neu (YD) mice bearing mammary tumors were treated with Iressa.
[20] Figs 1 IA and B show differences in Ki-67+ cells in ducts/lobules (Fig. 1 IA) and
MIN lesions (Fig. HB).
[21] Fig. 12 shows histological grading of tumor cells. Tumors isolated from 5-month old mice were subjected to H&E staining and examined microscopically. The graph shows the percentages of tumors in each catagory (WD: well differentiated; MD: moderately differentiated, PD: poorly differentiated) in Neu(YD)/b4-WT and Neu(YD)/b4-1355T mice.
[22] Fig. 13 shows levels of spontaneous metastasis. Mice were sacrificed approximately
7.5 weeks after detection of their first palpable tumor. Sagittal lung sections (2-4 per mouse) were stained with H&E and examined microscopically. Mice were assigned to 3 groups depending on their average number of metastases per lung section (< 1, 1-5, > 5). The graph shows the percentage of mice of the indicated genotypes in each group. The P value was calculated by the Chi-squared test. The inset shows the mean cumulative tumor burden + SD in each cohort of mice at the time of euthanasia.
[23] Figs. 14A and B show results for tumor growth in 3D Matrigel. Primary tumor cells
(5 x 10 ) were seeded in 3D Matrigel and cultured. Cellular structures were released from Matrigel by dispase and dissociated with trypsin. Cells were counted at the indicated times. The graph shows the average growth curves + SEM (standard error of the mean) of Neu(YD)/b4-WT cells (W) and Neu(YD)/ b-1355T cells (T).
[24] Figs 15A-C shows results when Neu-b4-WT and Neu-b4-1355T cells were cultured on collagen I in serum-free
[25] medium (Fig. 15A) or with 10% FBS (Fig 15B) and counted at the indicated times.
The arrow indicates when cells reached confluence
[26] in FBS. In Fig 15C, the indicated cells were cultured on collagen I under sparse conditions with serumfree medium (SFM) or 10% FBS (FBS) or at confluency with 10% FBS (FBS confluent) in the presence of BrdU for 24 or 28 hrs, respectively. The graph shows the percentage (mean + SD) of BrdU+ cells.
[27] Fig. 16 shows results when Neu-b4-WT and Neu-b4-1355T cells treated with Iressa
(10 μM) or vehicle alone (DMSO) were subjected to Matrigel invasion assay in response to FBS. The graph shows the mean number of invaded cells + SD per microscopic field in triplicate.
[28] Fig. 17 shows results when Neu-b4-WT and Neu-b4-1355T cells were injected in the tail vein. Percentages of lung section areas occupied by metastases (mean + standard deviation) were quantified 30 days later by image analysis with Metamorph software.
[29] Figs. 18A shows results when tumor-bearing Neu(YD)/b4-WT (b4-WT) and
Neu(YD)/b4-1355T (b4-1355T) mice were treated with Iressa (100 mg/Kg/day) or vehicle control (0.1% Tween-80) for 24 days or with a single dose of Doxorubicin (10 mg/Kg). The graph shows the mean change in tumor volume + SEM at day 24 for Iressa or vehicle alone and day 21 for Doxorubicin.
[30] Fig. 18B shows resyults when tumor-bearing Neu(YD)/b4-WT (b4-WT) and
Neu(YD)/b4-1355T (b4-1355T) mice were treated with Iressa (100 mg/Kg/day) or vehicle control (0.1% Tween-80) for at least 7 days. Tumor sections were stained by IHC with anti-Ki-67 followed by counterstaining with hematoxylin. Bar = 100 μM. The graph shows the mean number of Ki-67+ cells + SD per field.
Detailed Description of the Invention
[31] As used in this application, the term 'tumorigenesis' refers to initiation of primary or metastatic tumor growth, and the promotion of invasive growth.
[32] As used in this application, the term 'inhibition' refers to a reduction of the event or activity inhibited to an extent sufficient to produce an observable result. Complete elimination of the event or activity is not required.
[33] As used in this application, the term 'amount of active a6b4 integrhϊ refers to the observable tumorigenesis-promoting activity resulting from a6b4 integrin present in a tissue. Reductions in the amount of the active a6b4 integrin can result from a reduction in the amount of a6b4 integrin, i.e, effectively a reduction in concentration; a reduction in the capacity of individual molecules of a6b4 integrin to promote tumorigenesis, i.e. effectively a change in the quality of the integrin, or combinations thereof. The first type of reduction will most commonly be achieved by limiting the production of a6b4 integrin, for example using a antisense oligonucleotide or RNAi techniques, although it could also be achieved by accelerating the decomposition of a6b4 integrin. The second type of reduction is most readily achieved through physical binding of the integrin with a ligand that competes with the normal ligand for binding to the receptor.
[34] As used in this application, the terms 'treatment' or 'treating' refer to the application of a therapeutic agent to achieve a reduction in the amount of active a6b4 integrin so as to produce a benefit to a patient being treated. Such a benefit need not be a complete or permanent cure, but may be only a lessening of the rate at which tumorigenesis is occurring, thereby delaying progression of a disease condition.
[35] As used in this application, the term 'administration' refers to any means by which a therapeutic agent can be delivered to a tissue, including without limitation oral, nasal and transdermal administration and injection, for example subcutaneous, subdermal, intramuscular, intravenous, intrathecal or peritoneal injection. For treatment of eye- associated tumorgenesis, direct injection to the eye may be used. The therapeutic agent of the invention can be used in combination with other agents used in the treatment of cancer. In particular, the therapeutic agent of the invention is suitably used in combination with kinase inhibitors such as Iressa. Use in combination entails the administration of two or more agents in a time course where the effects of at least one of the agents is improved as a result of the use of the other. Two agents need no be administered at the same time to be considered use in combination, and may be used in any order.
[36] The effective amount of a therapeutic agent to be administered varies depending on the nature of the therapeutic agent, and will frequently reflect a balancing of therapeutic benefits and side effects. However, the determination of specific amounts for a given therapeutic is routine and within the skill in the art.
[37] Therapeutic agents useful in the present invention may be antibodies, aptamers or small molecules that bind to a6b4 integrin to produce a reduction in activity. Examples include small molecules which block b4 signalling by binding to b4, and have specific functions such as inhibiting nuclear translocation of NfkB. Where an antibody therapeutic agent is used, it may be administered in the form of the antibody, or formed in situ by expression of a nucleic acid sequence encoding an a6b4 integrin-specific antibody. Such antibodies may be monoclonal, polyclonal, or modified constructs, for example single chain Fv constructs, targeting a6b4 integrin. Binding sites may be on the alpha chain, the beta chain or both chains of the a6b4 integrin. Non-antibody binding proteins could also be employed. For example, human integrin-beta-4 binding protein is known and has the sequence:
MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDΗPVVHASIA
GCRIIGRMCVGNRHGLLVPNNTTD
QELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADV
LKVEVFRQTVADQVLVGSYCVF
SNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFC
GLDTTSTELSVVESVFKLNEAQPS
TIATSMRDSLIDSLT(NM_002212). (Seq. ID. No. 1)
[38] The therapeutic agent may also be a nucleic acid that results in a reduction in the amount of active a6b4 integrin, for example an antisense oligonucleotide or an RNA molecule that works by an RNAi mechanism. The nucleic acid may target, via a sequence specific mechanism, the alpha chain or the beta chain. The coding sequence of the beta 4 chain of human integrin is known from NM_000213 to be as follows: 1 atggcagggc cacgccccag cccatgggcc aggctgctcc tggcagcctt gatcagcgtc 61 agcctctctg ggaccttggc aaaccgctgc aagaaggccc cagtgaagag ctgcacggag 121 tgtgtccgtg tggataagga ctgcgcctac tgcacagacg agatgttcag ggaccggcgc 181 tgcaacaccc aggcggagct gctggccgcg ggctgccagc gggagagcat cgtggtcatg 241 gagagcagct tccaaatcac agaggagacc cagattgaca ccaccctgcg gcgcagccag 301 atgtcccccc aaggcctgcg ggtccgtctg cggcccggtg aggagcggca ttttgagctg 361 gaggtgtttg agccactgga gagccccgtg gacctgtaca tcctcatgga cttctccaac 421 tccatgtccg atgatctgga caacctcaag aagatggggc agaacctggc tcgggtcctg 481 agccagctca ccagcgacta cactattgga tttggcaagt ttgtggacaa agtcagcgtc 541 ccgcagacgg acatgaggcc tgagaagctg aaggagccct ggcccaacag tgaccccccc 601 ttctccttca agaacgtcat cagcctgaca gaagatgtgg atgagttccg gaataaactg 661 cagggagagc ggatctcagg caacctggat gctcctgagg gcggcttcga tgccatcctg 721 cagacagctg tgtgcacgag ggacattggc tggcgcccgg acagcaccca cctgctggtc 781 ttctccaccg agtcagcctt ccactatgag gctgatggcg ccaacgtgct ggctggcatc 841 atgagccgca acgatgaacg gtgccacctg gacaccacgg gcacctacac ccagtacagg 901 acacaggact acccgtcggt gcccaccctg gtgcgcctgc tcgccaagca caacatcatc 961 cccatctttg ctgtcaccaa ctactcctat agctactacg agaagcttca cacctatttc 1021 cctgtctcct cactgggggt gctgcaggag gactcgtcca acatcgtgga gctgctggag 1081 gaggccttca atcggatccg ctccaacctg gacatccggg ccctagacag cccccgaggc 1141 cttcggacag aggtcacctc caagatgttc cagaagacga ggactgggtc ctttcacatc 1201 cggcgggggg aagtgggtat ataccaggtg cagctgcggg cccttgagca cgtggatggg 1261 acgcacgtgt gccagctgcc ggaggaccag aagggcaaca tccatctgaa accttccttc 1321 tccgacggcc tcaagatgga cgcgggcatc atctgtgatg tgtgcacctg cgagctgcaa 1381 aaagaggtgc ggtcagctcg ctgcagcttc aacggagact tcgtgtgcgg acagtgtgtg 1441 tgcagcgagg gctggagtgg ccagacctgc aactgctcca ccggctctct gagtgacatt 1501 cagccctgcc tgcgggaggg cgaggacaag ccgtgctccg gccgtgggga gtgccagtgc 1561 gggcactgtg tgtgctacgg cgaaggccgc tacgagggtc agttctgcga gtatgacaac 1621 ttccagtgtc cccgcacttc cgggttcctg tgcaatgacc gaggacgctg ctccatgggc 1681 cagtgtgtgt gtgagcctgg ttggacaggc ccaagctgtg actgtcccct cagcaatgcc 1741 acctgcatcg acagcaatgg gggcatctgt aatggacgtg gccactgtga gtgtggccgc 1801 tgccactgcc accagcagtc gctctacacg gacaccatct gcgagatcaa ctactcggcg 1861 atccacccgg gcctctgcga ggacctacgc tcctgcgtgc agtgccaggc gtggggcacc 1921 ggcgagaaga aggggcgcac gtgtgaggaa tgcaacttca aggtcaagat ggtggacgag 1981 cttaagagag ccgaggaggt ggtggtgcgc tgctccttcc gggacgagga tgacgactgc 2041 acctacagct acaccatgga aggtgacggc gcccctgggc ccaacagcac tgtcctggtg 2101 cacaagaaga aggactgccc tccgggctcc ttctggtggc tcatccccct gctcctcctc 2161 ctcctgccgc tcctggccct gctactgctg ctatgctgga agtactgtgc ctgctgcaag 2221 gcctgcctgg cacttctccc gtgctgcaac cgaggtcaca tggtgggctt taaggaagac 2281 cactacatgc tgcgggagaa cctgatggcc tctgaccact tggacacgcc catgctgcgc 2341 agcgggaacc tcaagggccg tgacgtggtc cgctggaagg tcaccaacaa catgcagcgg 2401 cctggctttg ccactcatgc cgccagcatc aaccccacag agctggtgcc ctacgggctg 2461 tccttgcgcc tggcccgcct ttgcaccgag aacctgctga agcctgacac tcgggagtgc 2521 gcccagctgc gccaggaggt ggaggagaac ctgaacgagg tctacaggca gatctccggt 2581 gtacacaagc tccagcagac caagttccgg cagcagccca atgccgggaa aaagcaagac 2641 cacaccattg tggacacagt gctgatggcg ccccgctcgg ccaagccggc cctgctgaag 2701 cttacagaga agcaggtgga acagagggcc ttccacgacc tcaaggtggc ccccggctac 2761 tacaccctca ctgcagacca ggacgcccgg ggcatggtgg agttccagga gggcgtggag 2821 ctggtggacg tacgggtgcc cctctttatc cggcctgagg atgacgacga gaagcagctg 2881 ctggtggagg ccatcgacgt gcccgcaggc actgccaccc tcggccgccg cctggtaaac 2941 atcaccatca tcaaggagca agccagagac gtggtgtcct ttgagcagcc tgagttctcg 3001 gtcagccgcg gggaccaggt ggcccgcatc cctgtcatcc ggcgtgtcct ggacggcggg 3061 aagtcccagg tctcctaccg cacacaggat ggcaccgcgc agggcaaccg ggactacatc 3121 cccgtggagg gtgagctgct gttccagcct ggggaggcct ggaaagagct gcaggtgaag 3181 ctcctggagc tgcaagaagt tgactccctc ctgcggggcc gccaggtccg ccgtttccac 3241 gtccagctca gcaaccctaa gtttggggcc cacctgggcc agccccactc caccaccatc 3301 atcatcaggg acccagatga actggaccgg agcttcacga gtcagatgtt gtcatcacag 3361 ccaccccctc acggcgacct gggcgccccg cagaacccca atgctaaggc cgctgggtcc 3421 aggaagatcc atttcaactg gctgccccct tctggcaagc caatggggta cagggtaaag 3481 tactggattc agggcgactc cgaatccgaa gcccacctgc tcgacagcaa ggtgccctca 3541 gtggagctca ccaacctgta cccgtattgc gactatgaga tgaaggtgtg cgcctacggg 3601 gctcagggcg agggacccta cagctccctg gtgtcctgcc gcacccacca ggaagtgccc 3661 agcgagccag ggcgtctggc cttcaatgtc gtctcctcca cggtgaccca gctgagctgg 3721 gctgagccgg ctgagaccaa cggtgagatc acagcctacg aggtctgcta tggcctggtc 3781 aacgatgaca accgacctat tgggcccatg aagaaagtgc tggttgacaa ccctaagaac 3841 cggatgctgc ttattgagaa ccttcgggag tcccagccct accgctacac ggtgaaggcg 3901 cgcaacgggg ccggctgggg gcctgagcgg gaggccatca tcaacctggc cacccagccc 3961 aagaggccca tgtccatccc catcatccct gacatcccta tcgtggacgc ccagagcggg 4021 gaggactacg acagcttcct tatgtacagc gatgacgttc tacgctctcc atcgggcagc 4081 cagaggccca gcgtctccga tgacactggc tgcggctgga agttcgagcc cctgctgggg 4141 gaggagctgg acctgcggcg cgtcacgtgg cggctgcccc cggagctcat cccgcgcctg 4201 tcggccagca gcgggcgctc ctccgacgcc gaggccccca cggccccccg gacgacggcg 4261 gcgcgggcgg gaagggcggc agccgtgccc cgcagtgcga cacccgggcc ccccggagag 4321 cacctggtga atggccggat ggactttgcc ttcccgggca gcaccaactc cctgcacagg 4381 atgaccacga ccagtgctgc tgcctatggc acccacctga gcccacacgt gccccaccgc 4441 gtgctaagca catcctccac cctcacacgg gactacaact cactgacccg ctcagaacac 4501 tcacactcga ccacactgcc cagggactac tccaccctca cctccgtctc ctcccacgac 4561 tctcgcctga ctgctggtgt gcccgacacg cccacccgcc tggtgttctc tgccctgggg 4621 cccacatctc tcagagtgag ctggcaggag ccgcggtgcg agcggccgct gcagggctac 4681 agtgtggagt accagctgct gaacggcggt gagctgcatc ggctcaacat ccccaaccct 4741 gcccagacct cggtggtggt ggaagacctc ctgcccaacc actcctacgt gttccgcgtg 4801 cgggcccaga gccaggaagg ctggggccga gagcgtgagg gtgtcatcac cattgaatcc 4861 caggtgcacc cgcagagccc actgtgtccc ctgccaggct ccgccttcac tttgagcact 4921 cccagtgccc caggcccgct ggtgttcact gccctgagcc cagactcgct gcagctgagc 4981 tgggagcggc cacggaggcc caatggggat atcgtcggct acctggtgac ctgtgagatg 5041 gcccaaggag gagggccagc caccgcattc cgggtggatg gagacagccc cgagagccgg 5101 ctgaccgtgc cgggcctcag cgagaacgtg ccctacaagt tcaaggtgca ggccaggacc 5161 actgagggct tcgggccaga gcgcgagggc atcatcacca tagagtccca ggatggagga 5221 cccttcccgc agctgggcag ccgtgccggg ctcttccagc acccgctgca aagcgagtac 5281 agcagcatca ccaccaccca caccagcgcc accgagccct tcctagtgga tgggctgacc 5341 ctgggggccc agcacctgga ggcaggcggc tccctcaccc ggcatgtgac ccaggagttt 5401 gtgagccgga cactgaccac cagcggaacc cttagcaccc acatggacca acagttcttc 5461 caaacttga (Seq. ID. No. 2) [39] The coding sequence of the alpha 6 chain of human integrin is known from NM_000210 to be as follows:
1 atggccgccg ccgggcagct gtgcttgctc tacctgtcgg cggggctcct gtcccggctc 61 ggcgcagcct tcaacttgga cactcgggag gacaacgtga tccggaaata tggagacccc 121 gggagcctct tcggcttctc gctggccatg cactggcaac tgcagcccga ggacaagcgg 181 ctgttgctcg tgggggcccc gcgcggagaa gcgcttccac tgcagagagc caacagaacg 241 ggagggctgt acagctgcga catcaccgcc cgggggccat gcacgcggat cgagtttgat 301 aacgatgctg accccacgtc agaaagcaag gaagatcagt ggatgggggt caccgtccag 361 agccaaggtc cagggggcaa ggtcgtgaca tgtgctcacc gatatgaaaa aaggcagcat 421 gttaatacga agcaggaatc ccgagacatc tttgggcggt gttatgtcct gagtcagaat 481 ctcaggattg aagacgatat ggatggggga gattggagct tttgtgatgg gcgattgaga 541 ggccatgaga aatttggctc ttgccagcaa ggtgtagcag ctacttttac taaagacttt 601 cattacattg tatttggagc cccgggtact tataactgga aagggattgt tcgtgtagag 661 caaaagaata acactttttt tgacatgaac atctttgaag atgggcctta tgaagttggt 721 ggagagactg agcatgatga aagtctcgtt cctgttcctg ctaacagtta cttaggtttt 781 tctttggact cagggaaagg tattgtttct aaagatgaga tcacttttgt atctggtgct 841 cccagagcca atcacagtgg agccgtggtt ttgctgaaga gagacatgaa gtctgcacat 901 ctcctccctg agcacatatt cgatggagaa ggtctggcct cttcatttgg ctatgatgtg 961 gcggtggtgg acctcaacaa ggatgggtgg caagatatag ttattggagc cccacagtat 1021 tttgatagag atggagaagt tggaggtgca gtgtatgtct acatgaacca gcaaggcaga 1081 tggaataatg tgaagccaat tcgtcttaat ggaaccaaag attctatgtt tggcattgca 1141 gtaaaaaata ttggagatat taatcaagat ggctacccag atattgcagt tggagctccg 1201 tatgatgact tgggaaaggt ttttatctat catggatctg caaatggaat aaataccaaa 1261 ccaacacagg ttctcaaggg tatatcacct tattttggat attcaattgc tggaaacatg 1321 gaccttgatc gaaattccta ccctgatgtt gctgttggtt ccctctcaga ttcagtaact 1381 attttcagat cccggcctgt gattaatatt cagaaaacca tcacagtaac tcctaacaga 1441 attgacctcc gccagaaaac agcgtgtggg gcgcctagtg ggatatgcct ccaggttaaa 1501 tcctgttttg aatatactgc taaccccgct ggttataatc cttcaatatc aattgtgggc 1561 acacttgaag ctgaaaaaga aagaagaaaa tctgggctat cctcaagagt tcagtttcga 1621 aaccaaggtt ctgagcccaa atatactcaa gaactaactc tgaagaggca gaaacagaaa 1681 gtgtgcatgg aggaaaccct gtggctacag gataatatca gagataaact gcgtcccatt 1741 cccataactg cctcagtgga gatccaagag ccaagctctc gtaggcgagt gaattcactt 1801 ccagaagttc ttccaattct gaattcagat gaacccaaga cagctcatat tgatgttcac 1861 ttcttaaaag agggatgtgg agacgacaat gtatgtaaca gcaaccttaa actagaatat 1921 aaattttgca cccgagaagg aaatcaagac aaattttctt atttaccaat tcaaaaaggt 1981 gtaccagaac tagttctaaa agatcagaag gatattgctt tagaaataac agtgacaaac 2041 agcccttcca acccaaggaa tcccacaaaa gatggcgatg acgcccatga ggctaaactg 2101 attgcaacgt ttccagacac tttaacctat tctgcatata gagaactgag ggctttccct 2161 gagaaacagt tgagttgtgt tgccaaccag aatggctcgc aagctgactg tgagctcgga 2221 aatcctttta aaagaaattc aaatgtcact ttttatttgg ttttaagtac aactgaagtc 2281 acctttgaca ccccatatct ggatattaat ctgaagttag aaacaacaag caatcaagat 2341 aatttggctc caattacagc taaagcaaaa gtggttattg aactgctttt atcggtctcg 2401 ggagttgcta aaccttccca ggtgtatttt ggaggtacag ttgttggcga gcaagctatg 2461 aaatctgaag atgaagtggg aagtttaata gagtatgaat tcagggtaat aaacttaggt 2521 aaacctctta caaacctcgg cacagcaacc ttgaacattc agtggccaaa agaaattagc 2581 aatgggaaat ggttgcttta tttggtgaaa gtagaatcca aaggattgga aaaggtaact 2641 tgtgagccac aaaaggagat aaactccctg aacctaacgg agtctcacaa ctcaagaaag 2701 aaacgggaaa ttactgaaaa acagatagat gataacagaa aattttcttt atttgctgaa 2761 agaaaatacc agactcttaa ctgtagcgtg aacgtgaact gtgtgaacat cagatgcccg 2821 ctgcgggggc tggacagcaa ggcgtctctt attttgcgct cgaggttatg gaacagcaca 2881 tttctagagg aatattccaa actgaactac ttggacattc tcatgcgagc cttcattgat 2941 gtgactgctg ctgccgaaaa tatcaggctg ccaaatgcag gcactcaggt tcgagtgact 3001 gtgtttccct caaagactgt agctcagtat tcgggagtac cttggtggat catcctagtg 3061 gctattctcg ctgggatctt gatgcttgct ttattagtgt ttatactatg gaagtgtggt 3121 ttcttcaaga gaaataagaa agatcattat gatgccacat atcacaaggc tgagatccat 3181 gctcagccat ctgataaaga gaggcttact tctgatgcat ag (Seq. ID. No. 3)
[40] Antisense and RNAi sequence are derivable from these sequences. Antisense oligonucleotides are commonly from 12 to 50 bases in length, more preferably 15-30 bases length. Effective regions for targeting of antisense sequences may be found throughout the target nucleic acid. A preferred intragenic site is the region encompassing the translation initiation or termination codon of the open reading frame (ORF) of the gene. Since, as is known in the art, the translation initiation codon is typically 5'-AUG (in transcribed mRNA molecules; 5'-ATG in the corresponding DNA molecule), the translation initiation codon is also referred to as the 'AUG codon,' the 'start codon' or the 'AUG start codon'. A minority of genes have a translation initiation codon having the RNA sequence 5'-GUG, 5'-UUG or 5'-CUG, and 5'-AUA, 5'-ACG and 5'-CUG have been shown to function in vivo. Thus, the terms 'translation initiation codon' and 'start codon' can encompass many codon sequences, even though the initiator amino acid in each instance is typically methionine (in eukaryotes) or formyl- methionine (in prokaryotes). It is also known in the art that eukaryotic and prokaryotic genes may have two or more alternative start codons, any one of which may be preferentially utilized for translation initiation in a particular cell type or tissue, or under a particular set of conditions. In the context of the invention, 'start codon' and 'translation initiation codon' refer to the codon or codons that are used in vivo to initiate translation of an mRNA molecule transcribed from a gene encoding Integrin beta 4, regardless of the sequence(s) of such codons.
[41] It is also known in the art that a translation termination codon (or 'stop codon') of a gene may have one of three sequences, i.e., 5'-UAA, 5'-UAG and 5'-UGA (the corresponding DNA sequences are 5'-TAA, 5'-TAG and 5'-TGA, respectively). The terms 'start codon region' and 'translation initiation codon region' refer to a portion of such an mRNA or gene that encompasses from about 25 to about 50 contiguous nucleotides in either direction (i.e., 5' or 3') from a translation initiation codon. Similarly, the terms 'stop codon region' and 'translation termination codon region' refer to a portion of such an mRNA or gene that encompasses from about 25 to about 50 contiguous nucleotides in either direction (i.e., 5' or 3') from a translation termination codon.
[42] The open reading frame (ORF) or 'coding region,' which is known in the art to refer to the region between the translation initiation codon and the translation termination codon, is also a region which may be targeted effectively. Other target regions include the 5' untranslated region (5'UTR), known in the art to refer to the portion of an mRNA in the 5' direction from the translation initiation codon, and thus including nucleotides between the 5' cap site and the translation initiation codon of an mRNA or corresponding nucleotides on the gene, and the 3' untranslated region (3'UTR), known in the art to refer to the portion of an mRNA in the 3' direction from the translation termination codon, and thus including nucleotides between the translation termination codon and 3' end of an mRNA or corresponding nucleotides on the gene. The 5' cap of an mRNA comprises an N7-methylated guanosine residue joined to the 5 '-most residue of the mRNA via a 5 '-5' triphosphate linkage. The 5' cap region of an mRNA is considered to include the 5' cap structure itself as well as the first 50 nucleotides adjacent to the cap. The 5' cap region may also be a preferred target region.
[43] RNAi molecules are similarly selected based on the sequence and defined parameters known for the selection of appropriate sequences. RNAi molecules may be single or double stranded, and generally have a length of 19 to 23 bases, although longer and shorter species can be used. A specific RNAi species useful in the method of the invention is based on the mouse sequence of beta-4 cDNA (Genebank Ace. # L04678): nucleotides 113 to 131, counting from the A of the ATG translational start site, having the sequence GAGCTGTACCGAGTGCATC (Seq. ID. No. 4). This molecule, and the corresponding molecule based on the human sequence, and their use form a further aspect of this invention.
[44] In one embodiment of the invention, the therapeutic agent is in combination with other therapy directed toward suppressing the activity of RPTKs known to cooperate with a6b4, including but not limited to ErbB2 (Her2), EGF-R, Met, and Ron. Specific examples of such inhibitors include the Her2 inhibitor trastuzumab (Herceptin™), and PPAR gamma ligands as described in US Patent No. 6,291,496, which is incorporated herein by reference
[45] The invention and the evidence that established the efficacy and utility of the invention will now be further described with reference to the following non-limiting examples.
[46] Example 1
[47] The MMTV-NeuNdl- YD transgene was introduced into both wild-type and b4-1355T mice of FVB background using the breeding strategy outlined in Fig. 1 (asterick points to Neu mutant. Tumor onset was evaluated by palpation, and mice carrying palpable mammary nodules considered affect. As shown in Fig. 2A, the b4 mutant mice lived free of tumors significantly longer than the corresponding control mice. In addition, the b4 mutant mice developed, on average, a smaller number of individual tumors in their mammary glands. (Fig. 3). In a second set of experiments, the test was repeated with a larger number of mice in each group. As reflected in Fig. 2B, the same t was observed. The dotted line in Fig. 2B corresponds to heterozygous MMTV-Neu(YD); b4+ mice. These results indicate that a6b4 signalling promotes tumorigenesis in this model of breast cancer.
[48] Example 2
[49] Tumor growth was evaluated at 6 to 8 weeks after initial detection of tumors. As shown in Fig. 4, the mmary carcinomas of b4 mutant mice grew at a slower rate than those of the control mice, indicating that a6b4 signalling promotes tumor growth. Histological analysis indicated that tumors arising in the b4 mutants background were significantly more differentiated (mostly adenocarcinomas) that those arising in the the wild-type background (mostly undifferentiated invasive carcinomas). (Figs. 5A-C) Furthermore, immunohistochemistry showed that the b4 mutant retained an apparently intact laminin-containing basement membrane, whereas the wildtype had disrupted the basement membrane and progressed to a frankly invasive stage.
[50] Example 3
[51] To begin to examine the mechanism by which a6b4 signalling promotes tumor progression, we isolated mammary tumor cell lines from both wild-type and b4 mutant mice. Upon plating on a 2-D matrix, control and b4 mutant tumor cells grew at similar rates. However, when suspended in a Matrigel (a 3-D gel containing basement membrane components) the wild-type tumors proliferated rapidly, producing disorganized aggregates. In contrast, the b4 mutant cells gave rise to small cystic structures resembling normal mammary acini. Taken together, these results provide, for the first time, genetic evidence that a4b6 signalling accelerates breast cancer progression by promoting the transition from adenocarcinoma in situ to invasive and metastatic carcinoma and by promoting tumor growth.
[52] Example 4
[53] Transgenic mice expressing an SV-40-Tag oncogene from the prostate-specific promoter of Probasin (TRAMP mice) develop prostate cancer with complete pentrance (Gingrich et al., 1992). To example the role of a6b4 signalling in prostate carcinoma progression, we introduced the Probasin-SV-40-Tag trfansgene in both wild-type and b4-mutant mice following the breeding strategy outlined in Fig. 6. MRI analysis indicated that tumor onset and growth were delaying in mice carrying the b4 mutation as compared to mice expressing mild-type b4. (Fig. 7A-D). In addition, the overall survival of the b4 mutant TRAMP mice was observed to be longer than that of the b4-wild-type TRAMP mice. (Fig. 8).
[54] Example 5
[55] Consistent with the results in mammary tumors, histological analysis of prostate tumors from b4-mutant and b4- wild-type TRAMP mice indicated that the tumors arising in the b4-mutant background were considerably more differentiated than those arising in the b4- wild-type background. Anti-Ki67 staining, which marks the nuclei of proliferating cells, revealed that b4-mutant tumors have a significantly reduced prol- liferative index as compared to the b4-wild-type tumors. Furthermore, b4 was polarized in correspondence of the basement membrane in the tumors of b4-mutant but not b4-wild-type background. Taken together, these findings demonstrate that in the prostate, as in the mammary gland, a6b4 signalling promotes the transition from well differentiated adenocarcinoma with intact basement membrane to invasive carcinoma.
[56] Example 6
[57] We have treated with the kinase inhibitor IRESSA, which inhibits both the EGF-R and Neu (de Bono and Rowinsky, 2002), wild-type and b4-mutant mice carrying MMTV-Neu tumors. The results indicated that IRESSA causes a much larger inhibition of tumor cell proliferation in b4-mutant mice than it does in wild-type mice (Figure 9). About 80 % of the IRESSA-treated tumors arising in b4-mutant mice regress, compared to about only 20 % in the control group (Figure 2). This striking result indicates that blockage of a6b4 increases the effectiveness of cancer therapy with RTK inhibitors, a group which includes all tumor types expressing a6b4 and carrying amplified or activated versions of Neu, EGF-R, and Met RTKs (Bacus et al., 1994; Longati et al., 2001; Sawyers, 2002).
[58] MMTV-Neu (YD) mice bearing mammary tumors (>0.5 cm in diameter) were treated with Iressa (100 mg/Kg/day) or vehicle (0.1% Tween-80) by gastric gavage for 1 month or 7 days. Tumor sections were stained with anti-Ki-67 Mab, which labels proliferating cells. There is no significant difference in Ki-67 staining between mice treated for 1 month or 7 days. Unpaired, two-tailed t-test showed: P<0.01 between WT- vehicle and 1355T- vehicle; P<0.001 between WT-Iressa and 1355T-Iressa; P=0.016 between 1355T- vehicle and 1355T-Iressa. (Fig. 9)
[59] MMTV-Neu (YD) mice bearing mammary tumors (>0.5cm in diameter) were treated with Iressa (100 mg/Kg/day) by gastric gavage for 24 days. Tumor volumes were measured by caliper. Fig. 1OA shows the fold changes in tumor volume from day
0 to day 24, with each line representing one mouse (N=IO for each group, P<0.01). Fig. 1OB shows the percentage of mice with regressed tumors in each group.
[60] Example 7
[61] In the normal mammary gland, basal myoepithelial cells express significant levels of a6b4, whereas luminal epithelial cells express lower amounts of this integrin. The neoplastic cells of MEN lesions in Neu(YD)/b4-WT mice did not express the myoepithelial marker smooth muscle alpha-actin but exhibited significantly elevated levels of b4 as compared to normal luminal cells. b4 was no longer concentrated at the basement membrane junction but was instead diffusely distributed over the cell surface. In contrast, the levels of its matrix ligand, laminin-5, in the basement membrane were severely reduced. As MIN lesions progressed to invasive carcinomas, laminin- 5 became undetectable, but the levels of b4 remained elevated. The tumors in Neu(YD)/b4-1355T mice exhibited a similar up-regulation of b4 and down-regulation of laminin-5. However, the mutant b4 integrin remained in part concentrated at the basement membrane junction in MIN lesions of these mice, indicating that b4 signaling may contribute to disruption of epithelial polarity. Since individual tumors of Neu(YD)/b4-1355T mice grew only at a modestly reduced rate (approximately 70% of control value) and contained a number of microvessels similar to that of control Neu(YD)/b4-WT mice, we examined if loss of b4 signaling inhibits mammary tumor induction or initial growth. Histological analysis revealed that Neu(YD)/b4-1355T mice exhibit a severely diminished number of mammary intraepithelial neoplasia (MIN) lesions at 13 weeks of age (2.1+ 2.4 per median longitudinal section, n=7 mice) as compared to Neu(YD)/b4-WT mice (10.1 + 6.6, n=8 mice; P=0.01), indicating that loss of b4 signaling inhibits mammary tumor onset and initial growth.
[62] To dissect the mechanism by which loss of b4 signaling suppresses mammary tu- morigenesis, we examined preneoplastic and MIN lesions. Anti-Ki-67 staining showed that activated ErbB2 induces robust epithelial cell proliferation prior to overt morphological transformation in the ducts and lobules of Neu(YD)/b4-WT mice. (Fig.
1 IA) Mammary glands from age-matched wild-type mice contained only scattered Ki- 67-positive cells. By contrast, cell proliferation was only modestly increased in the ducts and lobules of Neu(YD)/b4-1355T mice (Fig. HA). Furthermore, MEN lesions from Neu(YD)/b4-WT mice contained a significantly higher proportion of proliferating tumor cells (approximately 40%) than those from Neu(YD)/b4b-1355T mice (approximately 20%) (Fig. 1 IB). Staining with antibodies to cleaved caspase-3 indicated modest apoptotic rates in most MEN lesions from Neu(YD)/b4-WT mice. However, a subset of early MIN lesions with a pervious lumen in Neu(YD)/b4-1355T mice contained a significant number of apoptotic cells (8.9 ± 4.4 %, n=4). In- terestingly, these lesions had a high proliferative index, suggesting that aberrant cell proliferation contributes to apoptosis in these lesions. By contrast, early MIN lesions with a similarly high proliferative rate in Neu(YD)/b4-WT mice exhibited only modest apoptosis (1.8 + 0.7 %, n=4, P=0.02). These results indicate that b4 signaling promotes cell proliferation throughout the pre-neoplastic and the MEN stage and suppresses oncogene-induced apoptosis prior to luminal filling.
[63] Example 8
[64] ErbB2 mammary tumors progress from MIN to invasive carcinoma through steps characterized by increasing degrees of de-differentiation. At 5 months of age, Neu(YD)/b4-1355T mice exhibited a high proportion of well and moderately differentiated tumors characterized by a glandular appearance. By contrast, Neu(YD)/b4-WT mice had developed predominantly poorly differentiated tumors (Fig, 12), further indicating that deletion of the b4 signaling domain inhibits histological progression. As they progress, mammary tumors of MMTV-Neu(YD) mice retain expression of E-cadherin but lose the tight junction component Zonula Occludens 1 (ZO-I) like their human counterpart. To further examine the effect of b4 signaling on tumor progression, we studied the expression of these adhesion components in moderately differentiated tumors from Neu(YD)/b4-WT and Neu(YD)/b4- 1355T mice. Both types of tumors retained expression of E-cadherin at the cell surface. However, tumors from Neu(YD)/b4-WT mice exhibited severely decreased ZO-I staining. Tight junction strands were not apparent, and most of the ZO-I reactivity was located ectopically in intracellular granules. By contrast, tumors from Neu(YD)/b4-1355T mice contained clear tight junction strands between adjacent cells. Within pseudo-glandular structures, these strands formed a continuous collar surrounding the apical pole of cells. These observations indicate that loss of b4 signaling opposes disassembly of tight junctions and internalization of their components.
[65] Example 9
[66] Since mammary tumors of MMTV-Neu(YD) mice primarily metastasize to the lung, we examined the lungs of both types of mice 7.5 weeks after primary tumor onset. We found that most of the Neu(YD)/b4-WT mice had developed a large number of metastases, but most of the Neu(YD)/b4-1355T mice exhibited either no metastases or only a few of them (Fig. 13). Cumulative primary tumor burden was similar in the two types of mice (Fig. 13, inset). This result indicates that loss of b4 signaling inhibits spontaneous metastasis to the lung.
[67] Example 10
[68] Tight junctions have emerged as key regulators of mammalian epithelial polarity and adhesion. Prompted by the observation that deletion of the b4 signaling domain increases the organization of tight junctions in mammary tumors, we used an ex vivo approach to examine the effect of b4 signaling on epithelial adhesion and polarity. Primary ErbB2-transformed cells isolated from Neu(YD)/b4-WT and Neu(YD)/b4-1355T mice were found to express similar levels of ErbB2. However, tumor cells expressing wild-type b4 exhibited a spindle-like morphology and their margins tended to overlap, whereas those expressing b4- 355T had polygonal shapes and their margins appeared closely apposed. Anti-ZO-1 staining revealed that cells expressing wild-type b4 had severely disrupted tight junctions. Anti-E-cadherin and anti-beta-catenin staining showed that they also had disorganized adherens junctions. Strikingly, tumor cells expressing b4-1355T exhibited well-organized adherens and tight junctions, indicating that loss of b4 signaling restores epithelial adhesion in ErbB2-transformed MECs. Gefitinib (Iressa), which was developed to block the EGF- R but also inhibits activated ErbB2 with an IC50 of approximately 1 μM, promoted reassembly of both adherens and tight junctions in tumor cells expressing wild-type b4. Since ErbB2-transformed mouse mammary epithelial cells do not express detectable levels of the EGF-R in vitro, it is likely that Iressa exerts its effect in these cells by inhibiting ErbB2. These results suggest that the b4 integrin cooperates with ErbB2 to induce disruption of epithelial adhesion.
[69] In 3D Matrigel, normal MECs form monolayered acinar structures and undergo growth arrest. By contrast, tumorigenic MECs form disorganized solid aggregates and continue to proliferate. Consistent with their neoplastic nature, tumor cells expressing wild-type b4 formed expansive solid spheroids in 3D Matrigel. Immunofluorecent staining showed that these structures were profoundly disorganized. Laminin-5 was deposited both around and inside tumor cell aggregates and the b4 integrin was diffusely distributed over the cell surface. In addition, E-cadherin and beta-catenin were not concentrated at adherens junctions and ZO-I was present in intracellular granules. In striking contrast, most tumor cells expressing b4-1355T assembled pseudo-acinar structures. These structures possessed a lumen and exhibited a distinctive epithelial organization and polarity. Moreover, the mutant integrin was concentrated at the basal cell surface and laminin-5 was deposited exclusively underneath this surface. E-cadherin and beta-catenin were partially localized at cell-to-cell junctions and ZO-I was concentrated in tight junction strands at the apical junctional complex. These findings indicate that loss of b4 signaling restores a significant degree of epithelial polarity to ErbB2-transformed MECs.
[70] To examine the effect of b4 signaling on growth control, we monitored tumor growth in 3D Matrigel. Over an 11-day period, the disorganized aggregates formed by tumor cells expressing wild-type b4 expanded continuously. By contrast, the pseudoacinar spheroids formed by cells expressing mutant b4 underwent a very limited expansion (Figs. 14A and B), indicating that b4 signaling is required for ErbB2-i nduced epithelial overproliferation in 3D Matrigel. Together, these findings suggest that the b4 integrin cooperates with ErbB2 to coordinately disrupt epithelial organization and growth control.
[71] Example 11
[72] The analysis of tumor progression in genetically engineered mice is complicated by the accumulation of secondary mutations. Because b4 signaling promotes tumor cell proliferation at the MIN stage, it may favor the accumulation of such mutations. To examine if the b4 integrin disrupts epithelial adhesion by a direct signaling mechanism, we generated isogenic Neu-transformed mammary tumor cells expressing either wildtype or mutant b4 by using an RNAi-reconstitution strategy.
[73] To construct retroviral vectors encoding human b4-WT or b4-13355T in combination with a shRNA to mouse b4, we first ligated an oligonucleotide encoding a shRNA targeting the mouse b4 sequence 5'GAGCTGTACCGAGTGCATCS' (SEQ ID No.: 5) into the Bgiπ and BamHI sites of LTRHl. We then replaced the CD4 coding sequence in LTRHl with an IRES-hygromycin resistance cassette. Finally, we subcloned human b4-WT or b4-1355T cDNAs into the EcoRI site immediately upstream of this cassette. The resulting vectors were named LTRHl-b4-WT and LTRHl-b4-1355T. To construct a retroviral vector encoding TAM67, the TAM67 cDNA was subcloned in pBMN-IRES-EGFP (from Gary Nolan, Stanford University). The Stat3-beta vector was constructed by subcloning the Stat3-beta cDNA into pMSCV-IRES-EGFP and provided by Jackie Bromberg (Department of Medicine, MSKCC). pLVTH lentiviral vectors encoding a control shRNA containing a scrambled anti-ALK sequence and a shRNA targeting STAT3 were previously described (Chatterjee et al., 2004). The pLKOl vector encoding a shRNA targeting c-Jun (5'-CCGGGAAGCGCAT GAGGAACCGCATCTCGAGATGCGGTTCCTCAT- GCGCTTCTTTTTG-3') Seq ID. No: 6 was obtained from Open Biosystems. It incorporates an iRNA sequence that mediates efficient and specific knock down of c- Jun.
[74] The Neu-b4-1355T cells assembled well-organized adherens and tight junctions in culture. By contrast, the Neu-b4-WT cells failed to organize both types of junctions, unless they were treated with Iressa. These results indicate that the b4 integrin induces disruption of cell junctions by a direct signaling mechanism.
[75] Example 12
[76] Constitutively active RTKs and SFKs can induce disassembly of adherens junctions through SNAIL/Slug-mediated repression of E-cadherin or tyrosine phosphorylation and endocytosis of the E-cadherin/beta-catenin complex. Studies with inhibitors suggested that SFK signaling contributes to disruption of epithelial adhesion in Neu-b4-WT cells, but PI-3K and MMP 1, 2, 3, and 9 do not. We did not, however, detect reduced expression or tyrosine phosphorylation of E-cadherin in Neu-b4-WT cells. In addition, beta-catenin was phosphorylated on tyrosine to similar levels in Neu- b4-WT and Neu-b4-1355T cells. These experiments indicate that b4 enables ErbB2 to disrupt epithelial adhesion through a novel mechanism.
[77] To examine the effect of b4 signaling on mammary tumor architecture in its physiological context, we implanted Neu-b4-WT and Neu-b4-1355T cells in the mammary fat pad of athymic nude mice. Over a 3-week period, the Neu-b4-WT cells formed tumors approximately two-fold larger than those generated by Neu-b4-1355T cells. The tumors expressing wild-type b4 had a solid histological appearance and lacked signs of tissue organization. Immunofluorescent staining detected scattered, short fibrils of laminin-5 and collagen IV. Beta-catenin was diffusely distributed near the cell surface but ZO-I was predominantly present in intracellular vesicles. By contrast, the tumors expressing mutant b4 exhibited a striking pseudo-glandular organization. The epithelial cells surrounding the lumens of glandular structures were supported by a continuous, albeit partially disorganized, basement membrane containing laminin-5 and collagen IV. They exhibited many seemingly normal beta-catenin-containing junctions and assembled ZO-I -containing tight junctions toward their apical pole. These results provide evidence that b4 signaling exerts a direct effect on epithelial adhesion, polarity, and organization in vivo.
[78] To examine if b4 signaling directly affects tumor cell proliferation and survival in vivo, we stained tumor sections with antibodies to Ki-67 and to cleaved caspase-3. The Neu-b4-1355T tumors contained significantly fewer proliferating cells as compared to Neu-b4-WT tumors. In addition, whereas Neu-b4-WT tumors had only scattered apoptotic cells, Neu-b4-1355T tumors contained a significant number of apoptotic cells. Notably, these cells were concentrated in the lumens of pseudo-glandular structures, indicating that b4 signaling suppresses anoikis. These results illustrate the ability of b4 signaling to coordinately disrupt epithelial polarity and growth control in the mammary gland.
[79] Example 13
[80] To further examine the effect of b4 signaling on ErbB2-mediated proliferation, we examined the ability of Neu-b4-WT and Neu-b4-1355T cells to proliferate in vitro. In the absence of serum, the Neu-b4-1355T cells proliferated at a dramatically reduced rate in comparison to Neu-b4-WT cells (Figs. 15A-C). In the presence of serum, both types of cells proliferated at similar rates during the logarithmic phase of growth. However, upon reaching confluency, the Neu-b4-1355T cells proliferated less rapidly as compared to control Neu-b4-WT cells. These results indicate that b4 signaling enables activated ErbB2 to promote growth factor-independent mitogenesis and contributes to a certain extent to its ability to disrupt contact inhibition.
[81] We next examined the effect of b4 signaling on mammary tumor cell invasion and metastasis. Consistent with their inability to form cell-to-cell junctions, Neu-b4-WT cells scattered extensively in culture. In contrast, the Neu-b4-1355T cells grew as clusters of tightly adhering cells (Figure 4C). When subjected to Matrigel invasion assay, the Neu-b4-WT cells invaded efficiently and Iressa prevented their invasion. In contrast, the Neu-b4-1355T cells invaded poorly through Matrigel (Fig. 16). Finally, upon intravenous injection in athymic nude mice, Neu-b4-WT cells produced numerous, large metastases in the lung, but Neu-b4-1355T formed only a few micro- metastases (Fig. 17). Together with the observation that Neu(YD)-b4-1355T mice progress to lung metastasis less efficiently than Neu(YD)-b4-WT mice, these results indicate that b4 signaling promotes mammary tumor invasion and metastasis.
[82] Example 14
[83] Biochemical studies were performed to study the molecular mechanism by which b4 signaling promotes mammary tumorigenesis. Co-immunoprecipitation analysis revealed that ErbB2 forms a complex with a6b4 and induces tyrosine phosphorylation of b4. Formation of the complex and tyrosine phosphorylation of b4 did not require ligand binding to a6b4 or the kinase activity of ErbB2 or SFKs. Whereas Iressa suppressed tyrosine phosphorylation of both ErbB2 and b4, PP2 suppressed phosphorylation of b4 but only partially inhibited phosphorylation of ErbB2, suggesting that ErbB2 induces phosphorylation of b4 through activation of SFKs. Iressa suppressed phosphorylation of ErbB2 at its major autophosphorylation site, which mediates recruitment of She and Grb2, but did not affect activation of SFKs. In contrast, PP2 exerted the opposite effects. These results indicate that ErbB2 forms a complex with a6b4 and suggest that ErbB2 induces phosphorylation of b4 through SFKs.
[84] We next studied the effect of deletion of the b4 signaling domain on the assembly and function of the b4-ErbB2 complex. Co-immunoprecipitation analysis showed that deletion of the b4 signaling domain uncouples a6b4 from ErbB2 and inhibits activation of integrin-associated SFKs. In addition, it reduces the amount of SFKs associated with ErbB2. These results indicate that the b4 signaling domain is required for assembly of the b4-ErbB2 complex and promotes SFK association with ErbB2.
[85] Since SFKs can phosphorylate Y845 in the P-loop of the EGF-R, we examined the effect of SFK inhibition on phosphorylation of the corresponding tyrosine in the P-loop of ErbB2. Immunoblotting of total lysates showed that PP2 and Iressa inhibit phosphorylation of the P-loop of ErbB2 to a significant extent and, when used in combination, completely suppress phosphorylation of this site . Similar results were obtained upon replacing PP2 with Dasatinib, which inhibits SFKs at nanomolar con- centrations. Notably, deletion of the b4 signaling domain suppressed phosphorylation of the P-loop but not the major autophosphorylation site of ErbB2. These results indicate that the 4 signaling domain contributes to phosphorylation of the P-loop of ErbB2 by promoting SFK association with the RTK. Thus, b4 functions both upstream and downstream of ErbB2 and deletion of the b4 signaling domain uncouples b4 from ErbB2, suppressing joint signaling.
[86] Example 15
[87] ErbB2 activates Ras, PI-3K, and JAK-STAT signaling . To examine the effect of b4 on ErbB2 signaling, we compared the levels of activation of ERK, JNK, and Akt in Neu-b4-WT and Neu-b4-1355T cells stably adhering to laminin-5 or collagen I, as a control. These kinases were activated to similar levels in both types of cells on either substrate. Since b4 signaling controls translocation of activated MAP kinases to the nucleus in EGF-treated keratinocytes, we next monitored nuclear accumulation of activated ERK and JNK in Neu-b4-WT and Neu-b4-1355T cells. Using im- munofluorescent staining, we did not detect significant differences in nuclear accumulation of activated ERK between the two types of cells. However, we found P- JNK concentrated in the nucleus in Neu-b4-WT cells but diffusely distributed in the cytoplasm in Neu-b4-1355T cells, suggesting that b4 signaling controls nuclear accumulation of activated JNK. In agreement with this conclusion, phosphorylation of c- Jun at its JNK phosphorylation site, S63, was substantially suppressed in Neu- b4-1355T cells plated on either laminin-5 or collagen I. Iressa inhibited phosphorylation of c-Jun in Neu-b4-WT cells, but at concentrations higher than those required to suppress activation of ERK, suggesting that b4 signaling sustains ErbB2-dependent activation of c-Jun. Biochemical fractionation and imaging studies have demonstrated that a6b4 and bl integrins control nuclear translocation of MAP kinases. Our results are consistent with these findings and indicate that b4 contributes to ErbB2 signaling by promoting nuclear translocation of JNK and therefore phosphorylation of c-Jun.
[88] Prior studies have linked SFK-mediated phosphorylation of the P-loop of ErbB receptors to JAK-STAT signaling. Since deletion of the b4 signaling domain reduces SFK activation and association with ErbB2 and decreases phosphorylation of the P- loop of ErbB-2, we examined the effect of this deletion on STAT3 activation. Phosphorylation at Y705 is essential for dimerization and activation of STAT3. We found STAT3 constitutively phosphorylated at Y705 in Neu-b4-WT cells plated on laminin-5 or collagen I. In contrast, phosphorylation of this residue was almost undetectable in Neu-b4-1355T cells on either matrix ligand. As observed for c-Jun, Iressa inhibited phosphorylation of STAT3 in Neu-b4-WT cells at concentrations higher than those necessary to suppress activation of ERK, suggesting that b4 signaling sustains ErbB2-mediated activation of STAT3. STAT3 S727, which is targeted by ERK, was phosphorylated at similar levels in both types of cells. Together, these results indicate that deletion of the b4 signaling domain impairs ErbB2-mediated activation of STAT3.
[89] To examine if the b4-ErbB2 complex induces phosphorylation of c-Jun and activates STAT3 in vivo, we stained sections of mammary glands from 13- week old Neu(YD)/b4-WT and Neu(YD)/b4-1355T mice with anti-P-c-Jun and anti-PY-STAT3 antibodies. Most pre-neoplastic cells and tumor cells in MEN lesions of Neu(YD)/b4-WT mice exhibited prominent nuclear staining for activated c-Jun and STAT3. In contrast, most epithelial cells in similar lesions of Neu(YD)/b4-1355T mice displayed either weak staining or no staining, and only a few cells exhibited strong nuclear staining . Immunoblotting on mammary fat pad lysates confirmed the reduction of c-Jun phosphorylation in the lesions of Neu(YD)/b4-1355T mice. Immunoblotting with anti-PY-STAT3 yielded inconclusive results, presumably because of the prominent activation of STAT3 in stromal cells. Together, these results indicate that the b4 integrin enables ErbB2 to activate c-Jun and STAT3.
[90] Example 16
[91] JNK-mediated phosphorylation of c-Jun contributes to transcriptional activation and to oncogenesis. To examine the role of c-Jun during ErbB2- driven mammary tu- morigenesis, we used a dominant negative form of c-Jun (TAM67), which has been shown to suppress breast cancer cell proliferation by specifically interfering with API-dependent transcription. Neu-b4-WT cells were transduced with a retroviral vector encoding TAM67 or GFP, as a control. Expression of TAM67 inhibited mammary tumor cell proliferation in vitro and tumorigenicity in vivo. This mutant, however, did not restore assembly of tight or adherens junctions in Neu-b4-WT cells, and it did not suppress the ability of these cells to invade through Matrigel in vitro. These results suggest that c-Jun is necessary for ErbB2-mediated hyperproliferation but not for disruption of epithelial adhesion.
[92] STAT3 is frequently activated in human breast cancer samples. In addition, recent studies have indicated that STAT3 activation is sufficient to transform mammary epit helial cells in vitro. Expression of a dominant negative mutant form of STAT3 (STAT3-beta) did not inhibit mammary tumor cell proliferation in vitro and tumorigenicity in vivo. However, it restored assembly of tight junctions to a significant extent and formation of adherens junctions partially. In addition, STAT3-beta inhibited Matrigel invasion and experimental metastasis. These results suggest that STAT3 is necessary for ErbB2-mediated disruption of cell junctions and invasion but not for hy- perproliferation.
[93] To obtain additional evidence that the b4-ErbB2 complex promotes disruption of epithelial adhesion and hyperproliferation through activation of STAT3 and c-Jun, we used lentiviral vectors encoding shRNAs targeting each one of the two transcription factors. Neu-b4-WT cells transduced with each of these vectors exhibited significant knock down of the corresponding target protein. Knock down of c-Jun suppressed tumor cell hyperproliferation but did not restore assembly of tight junctions. By contrast, knock down of STAT3 partially restored assembly of tight junctions without affecting proliferative rates. Collectively, these data indicate that the b4-ErbB-2 complex promotes hyperproliferation through activation of c-Jun and it disrupts epithelial adhesion largely through activation of STAT3.
[94] Example 17
[95] As shown in Example 6, treatment with Iressa was more effective in Neu-b4-1355T mutant mice than in b4-WT mice. We further compared this chainge in effectiveness to the effectiveness of doxorubicin in the two types of mice, effectiveness. Iressa induced regression of Neu(YD)/b4-1355T tumors. In contrast, it only reduced the rate of growth of Neu(YD)/b4-WT tumors. Iressa suppressed activation of ErbB2 in both types of tumors, consistent with its equal apparent IC50 in Neu-b4-WT and Neu- b4-1355T cells in vitro. However, whereas Iressa inhibited tumor cell proliferation in Neu(YD)/b4-1355T mice, it exerted a more modest inhibitory effect in Neu(YD)/b4-WT mice. In addition, the drug increased tumor apoptosis in Neu(YD)/b4-1355T mice to a larger extent than it did in Neu(YD)/b4-WT mice, although overall apoptotic rates were in both cases very low (less than 1%).
[96] To examine the specificity of the increased response of Neu(YD)/b4-1355T tumors to anti-ErbB2 therapy, we treated tumor-bearing Neu(YD)/b4-WT and Neu(YD)/b4-1355T mice with the chemotherapeutic drug Doxorubicin. Unlike Iressa, Doxorubicin reduced the growth rate of tumors in Neu(YD)/b4-WT and Neu(YD)/b4-1355T mice by a similar extent, and it failed to induce tumor regression in either type of mouse. These results indicate that b4 signaling specifically promotes resistance to anti-ErbB2 therapy.
[97] Example 18
[98] To examine the potential molecular basis of the differential effect of Iressa on tumors expressing wild type or mutant b4, we examined the activation of c-Jun, STAT3, ERK, and Akt in tumor lysates. c-Jun and STAT3 were activated in Neu(YD)/b4-WT tumors to levels higher than in Neu(YD)/b4-1355T tumors. Importantly, Iressa did not suppress but seemed to increase to a small extent activation of the two transcription factors in both types of tumors. It is possible that this apparent increase reflects the elimination of tumor cells exhibiting low levels of activated c-Jun and STAT3. Furthermore, Iressa inhibited activation of ERK and Akt in Neu(YD)/b4-1355T tumors by an extent larger than it did in Neu(YD)/b4-WT tumors. In agreement with these observations, Iressa inhibited activation of ERK and Akt in Neu-b4-1355T cells in vitro at doses lower than in Neu-b4-WT cells . Together, these observations indicate that the b4 integrin sustains ErbB2-dependent mammary oncogenesis in vivo through activation of c-Jun and STAT3 and enhancement of signaling to ERK and Akt. [99] References
[100] The following references are cited herein, and are incorporated herein by reference in their entirety. [101] Abdel-Ghany M, Cheng HC, Elble RC, Pauli BU1 The breast cancer beta 4 integrin and endothelial human CLC A2 mediate lung metastasis. J Biol Chem. 2001 JuI
6;276(27):25438-46. [102] Borradori, L., and Sonnenberg, A. (1999). Structure and function of hemidesmosomes: more than simple adhesion complexes. J. Invest. Dermatol. 112,
411-418. [103] Chatterjee, M., Stuhmer, T., Herrmann, P., Bommert, K., Dorken, B., and Bargou,
R. C. (2004). Combined disruption of both the MEK/ERK and the IL-6R/STAT3 pathways is required to induce apoptosis of multiple myeloma cells in the presence of bone marrow stromal cells. Blood 104, 712-3721. [104] Dans, M., Gagnoux-Palacios, L., Blaikie, P., Klein, S., Mariotti, A., and Giancotti,
F. G. (2001). Tyrosine phosphorylation of the b4 integrin cytoplasmic domain mediates She signaling to extracellular signal-regulated kinase and antagonizes formation of hemidesmosomes. J. Biol. Chem. 276, 1494-1502. [105] de Bono, J.S., and E.K. Rowinsky. 2002. The ErbB receptor family: a therapeutic target for cancer. Trends MoI Med. 8:S 19-26. [106] Fuchs, E., Dowling, J., Segre, J., Lo, S. H., and Yu, Q. C. (1997). Integrators of epidermal growth and differentiation: distinct functions for bl and b4 integrins. Curr.
Opin. Genet. Dev. 7, 672-682. [107] Gagnoux-Palacios, L., Dans, M., van't Hof, W., Mariotti, A., Meneguzzi, G., Resh
M.D., and Giancotti, F. G. (2003). Integrin a6b4 signaling requires compartmen- talization in lipid rafts. J. Cell Biol. 162, 1189-1196. [108] Geiger, B., Bershadsky, A., Pankov, R., and Yamada, K. M. (2001).
Transmembrane crosstalk between the extracellular matrix and the cytoskeleton. Nat.
Rev. MoI. Cell Biol. 2, 793-805. [109] Giancotti, F. G., and Tarone, G. (2003). Positional Control of Cell Fate through
Joint Integrin/Receptor Protein Tyrosine Kinase Signaling. Ann. Rev. Cell Dev. Biol.
19:173-206. [110] Giancotti, F. G., and Ruoslahti, E. (1999). Integrin signaling. Science 285,
1028-1032. [Ill] Hynes, R. O. (2002). A reevaluation of integrins as regulators of angiogenesis. Nat. Med. 8, 918-921. [112] Hynes, R. O. (2003). Metastatic potential: generic predisposition of the primary tumor or rare, metastatic variants-or both? Cell 113 821-823. [113] Mainiero, F., Murgia, C, Wary, K. K., Curatola, A. M., Pepe, A., Blumemberg, M.,
Westwick, J. K., Der, C. J., and Giancotti, F. G. (1997). The coupling of a6b4 integrin to Ras-MAP kinase pathways mediated by She controls keratinocyte proliferation.
EMBO J. 16, 2365-2375. [114] Mainiero, F., Pepe, A., Wary, K. K., Spinardi, L., Mohammadi, M., Schlessinger, J., and Giancotti, F. G. (1995). Signal transduction by the a6b4 integrin: distinct b4 subunit sites mediate recruitment of Shc/Grb2 and association with the cytoskeleton of hemidesmosomes. EMBO J. 14, 4470-4481. [115] Miranti, C. K., and Brugge, J. S. (2002). Sensing the environment: a historical perspective on integrin signal transduction. Nat. Cell Biol. 4, E83-90. [116] Murgia, C, Blaikie, P., Kim, N., Dans, M., Petrie, H. T., and Giancotti, F. G.
(1998). Cell cycle and adhesion defects in mice carrying a targeted deletion of the integrin b4 cytoplasmic domain. EMBO J. 17, 3940-3951. [117] Natali PG, Nicotra MR, Botti C, Mottolese M, Bigotti A, Segatto Oanges in expression of alpha 6/beta 4 integrin heterodimer in primary and metastatic breast cancer. Br J Cancer. 1992 Aug;66(2):318-22 [118] Pellegrini, G., De Luca, M., Orecchia, G., Balzac, F., Cremona, O . Ch ., Savoia,
P., Cancedda, R., and Marchisio, P. C. (1992). Expression, topography, and function of integrin receptors are severely altered in keratinocytes from involved and uninvolved psoriatic skin. J. Clin. Invest. 89, 1783-1795.
[119] Schlaepfer, D. D., and Hunter, T. (1998). Integrin signalling and tyrosine phosphorylation: just the FAKs? Trends Cell Biol. 8, 151-157. [120] Shaw, L. M. (2001). Identification of Insulin Receptor Substrate 1 (IRS-I) and IRS-
2 as Signaling Intermediates in the a6b4 Integrin-Dependent Activation of PI3-K and
Promotion of Invasion. MoI. Cell Biol. 21, 5082-5093. [121] Shaw, L. M., Rabinovitz, I., Wang, H. H., Toker, A., and Mercurio, A. M. (1997).
Activation of PI3-K by the a6b4 integrin promotes carcinoma invasion. Cell 91,
949-960. [122] Slamon DJ, Clark GM, Wong SG, Levin WJ, Ullrich A, McGuire WL. Human breast cancer: correlation of relapse and survival with amplification of the HER-2/neu oncogene. Science. 1987 Jan 9;235(4785): 177-82. [123] Spinardi, L., Einheber, S., Cullen, T., Milner, T. A., and Giancotti, F. G. (1995). A recombinant tail-less integrin b4 subunit disrupts hemidesmosomes, but does not suppress a6b4-mediated cell adhesion to laminins. J. Cell Biol. 129, 473-487. [124] Tagliabue E, Ghirelli C, Squicciarini P, Aiello P, Colnaghi MI, Menard S. Prognostic value of alpha 6 beta 4 integrin expression in breast carcinomas is affected by laminin production from tumor cells. Clin Cancer Res. 1998 Feb;4(2):407-10.
[125] Trusolino, L., Bertotti, A., and Comoglio, P. M. (2001). A signaling adapter function for a6b4 integrin in the control of HGF-dependent invasive growth. Cell 107, 643-654.
[126] Wary, K. K., Mariotti, A., Zurzolo, C, and Giancotti, F. G. (1998). A requirement for caveolin-1 and associated kinase Fyn in integrin signaling and anchorage- dependent cell growth. Cell 94, 625-634.
[127] Weaver, V. M., Lelievre, S., Lakins, J. N., Chrenek, M. A., Jones, J. C, Giancotti,
F., Werb, Z., and Bissell, M. J. (2002). b4 integrin-dependent formation of polarized three-dimensional architecture confers resistance to apoptosis in normal and malignant mammary epithelium. Cancer Cell 2, 205-216.

Claims

Claims
[I] L A method for inhibition of tumorigenesis in an individual suffering from or at risk for a tumor type that expresses a6b4 integrin, comprising the steps of administering to the individual a therapeutic agent effective to reduce the amount of active a6b4 integrin at least in a portion of the individual where tumorigenesis may occur by targeting the beta 4 portion of the integrin.
[2] 2. The method of claim 1, wherein the individual is human.
[3] 3. The method of claim 1 or 2, wherein the therapeutic agent is an antibody.
[4] 4. The method of claim 1 or 2, wherein the therapeutic agent is an antisense oligonucleotide.
[5] 5. The method of claim 1 or 2, wherein the therapeutic agent is an RNAi species.
[6] 6. The method of any one of claims 1 to 5, wherein the individual is suffering from or at risk for a tumor type selected from the group consiting of thyroid, breast, prostate and cervical cancers, cancer of the upper gastrointestinal tract and squamous carcinoma of the skin
[7] 7. The method of any of claims 1 to 6, further comprising the step of administering to the individual an inhibitor of a receptor protein tyrosine kinase such as ErbB2, EGF-R. Met and Ron.
[8] 8. Use of an inhibitor of a6b4 integrin that targets beta 4 in the preparation of a pharmaceutical composition for inhibition of tumorigenesis.
[9] 9. Use of claim 8, wherein wherein the therapeutic agent is an antibody.
[10] 10. Use of claim 8, wherein the therapeutic agent is an antisense oligonucleotide.
[II] 11. Use of claim 8, wherein the therapeutic agent is an RNAi species.
[12] 12. Use of any of claims 8 to 11, wherein the pharmaceutical composition is suitable for human administration.
PCT/IB2006/051199 2005-04-18 2006-04-18 Inhibition of tumorigenesis by inhibition of a6b4 integrin Ceased WO2006111925A2 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US10/596,364 US20080317752A1 (en) 2005-04-18 2006-04-18 Inhibition of Tumorigenesis by Inhibition of a6b4 Integrin

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US67290005P 2005-04-18 2005-04-18
US60/672,900 2005-04-18

Publications (2)

Publication Number Publication Date
WO2006111925A2 true WO2006111925A2 (en) 2006-10-26
WO2006111925A3 WO2006111925A3 (en) 2007-03-08

Family

ID=37115542

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2006/051199 Ceased WO2006111925A2 (en) 2005-04-18 2006-04-18 Inhibition of tumorigenesis by inhibition of a6b4 integrin

Country Status (2)

Country Link
US (1) US20080317752A1 (en)
WO (1) WO2006111925A2 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN102223915A (en) * 2008-11-20 2011-10-19 默克专利有限公司 New therapy and medicament using integrin ligands for treating cancer
US10030071B2 (en) * 2013-09-05 2018-07-24 University Of Miyazaki Antibody which specifically reacts with human integrin A6B4

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3661536A4 (en) * 2017-08-03 2021-07-21 Asclepix Therapeutics, Inc. PROCESSES FOR IDENTIFYING AND PREPARING PHARMACEUTICAL AGENTS TO ACTIVATE THE TIE2 RECEPTOR

Family Cites Families (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5981478A (en) * 1993-11-24 1999-11-09 La Jolla Cancer Research Foundation Integrin-binding peptides
US5753230A (en) * 1994-03-18 1998-05-19 The Scripps Research Institute Methods and compositions useful for inhibition of angiogenesis
WO2000078317A1 (en) * 1999-06-23 2000-12-28 Merck & Co., Inc. Integrin receptor antagonists
DE19939980A1 (en) * 1999-08-24 2001-03-01 Merck Patent Gmbh Inhibitors of the integrin alphavbeta¶3¶
US6291496B1 (en) * 1999-12-27 2001-09-18 Andrew J. Dannenberg Treating cancers associated with overexpression of class I family of receptor tyrosine kinases
US8613907B2 (en) * 2000-10-12 2013-12-24 University Of Rochester Compositions that inhibit proliferation of cancer cells
DE50214799D1 (en) * 2002-03-25 2011-01-13 Peter Geiger WALL STONE SET
US20070104716A1 (en) * 2003-11-22 2007-05-10 Sloan-Kettering Institute For Cancer Research Methods for controlling pathological angiogenesis by inhibition of a6b4 integrin

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN102223915A (en) * 2008-11-20 2011-10-19 默克专利有限公司 New therapy and medicament using integrin ligands for treating cancer
US10030071B2 (en) * 2013-09-05 2018-07-24 University Of Miyazaki Antibody which specifically reacts with human integrin A6B4

Also Published As

Publication number Publication date
WO2006111925A3 (en) 2007-03-08
US20080317752A1 (en) 2008-12-25

Similar Documents

Publication Publication Date Title
Mukhopadhyay et al. Increased levels of α6 integrins are associated with the metastatic phenotype of human breast cancer cells
EP3802922B1 (en) Novel immune checkpoint inhibitors
KR100931976B1 (en) A pharmaceutical composition for treating cholangiocarcinoma, a method for inhibiting growth or invasion of cholangiocarcinoma and a method for treating cholangiocarcinoma
Solovey et al. Identification and functional assessment of endothelial P1H12
Lipscomb et al. Use of RNA interference to inhibit integrin (α6β4)-mediated invasion and migration of breast carcinoma cells
US12140594B2 (en) Early and non invasive method for assessing a subject&#39;s risk of having pancreatic ductal adenocarcinoma and methods of treatment of such disease
AU2010306899A1 (en) Biomarker for identification of melanoma tumor cells
AU2001293030B2 (en) Screening assays for agonists or antagonists of receptor activat or of NF-kB
CN107249636A (en) Antitumor agents targeting CKAP4
Shinmura et al. Primary Cilia Are Frequently Present in Small Cell Lung Carcinomas but Not in Non–Small Cell Lung Carcinomas or Lung Carcinoids
US8969020B2 (en) Peptide sequence that promotes tumor invasion
CA2568806C (en) Methods for detecting and treating cancer using podocalyxin and/or endoglycan
ITCH20120008A1 (en) USE OF TROP-2 AS A PREDICTIVE MARKER FOR ANSWERING ANTI-TUMOR THERAPY BASED ON INHIBITORS OF CD9, AKT AND RELATED SIGNAL PATHWAYS
KR101875935B1 (en) A Biomarker of the resistance about HER2 inhibitor
KR102074559B1 (en) Biomarker for diagnosis of anticancer drug resistance of gastric cancer and use thereof
AU2005219322B2 (en) Pharmaceutical Composition Comprising CXCR3 Inhibitor
JP2011520781A (en) Methods involving MS4A12 for treatment, diagnosis and testing, and agents targeting MS4A12
US20080317752A1 (en) Inhibition of Tumorigenesis by Inhibition of a6b4 Integrin
Salo et al. Antibodies blocking adhesion and matrix binding domains of laminin‐332 inhibit tumor growth and metastasis in vivo
KR101974509B1 (en) Use of complement proteins for liver cancer diagnosis
Kalimutho et al. CD155/PVR as a determinant of anti-HER2 therapy sensitivity in breast cancer
CN120847399A (en) ICAM1 as a predictive biomarker for the efficacy of PD-1 monoclonal antibody therapy in glioblastoma and its application in combined therapy
CN117947158A (en) MLCK1 as a biomarker for predicting sensitivity to fluorouracil therapy in colorectal cancer
WO2020115261A1 (en) Methods and compositions for treating melanoma
US20110027801A1 (en) EphA KINASE CANCER DIAGNOSTIC

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 10596364

Country of ref document: US

121 Ep: the epo has been informed by wipo that ep was designated in this application
NENP Non-entry into the national phase

Ref country code: DE

NENP Non-entry into the national phase

Ref country code: RU

WWW Wipo information: withdrawn in national office

Country of ref document: RU

122 Ep: pct application non-entry in european phase

Ref document number: 06727962

Country of ref document: EP

Kind code of ref document: A2