WO2006105913A1 - Tripeptides that down regulate the activity of plasma membrane transporters including sodium-d-glucose cotransporter sglt1 - Google Patents

Tripeptides that down regulate the activity of plasma membrane transporters including sodium-d-glucose cotransporter sglt1 Download PDF

Info

Publication number
WO2006105913A1
WO2006105913A1 PCT/EP2006/002981 EP2006002981W WO2006105913A1 WO 2006105913 A1 WO2006105913 A1 WO 2006105913A1 EP 2006002981 W EP2006002981 W EP 2006002981W WO 2006105913 A1 WO2006105913 A1 WO 2006105913A1
Authority
WO
WIPO (PCT)
Prior art keywords
fragment
food
amino acid
nucleic acid
qcp
Prior art date
Application number
PCT/EP2006/002981
Other languages
French (fr)
Inventor
Hermann Koepsell
Alexandra Vernaleken
Original Assignee
Julius-Maximillians-Universität Würzburg
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Julius-Maximillians-Universität Würzburg filed Critical Julius-Maximillians-Universität Würzburg
Priority to US11/910,594 priority Critical patent/US9155778B2/en
Priority to EP06723941.8A priority patent/EP1896049B1/en
Priority to CA002603452A priority patent/CA2603452A1/en
Priority to AU2006231071A priority patent/AU2006231071B2/en
Publication of WO2006105913A1 publication Critical patent/WO2006105913A1/en

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/04Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/06Tripeptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/04Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/08Peptides having 5 to 11 amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis

Definitions

  • the present invention relates to the use of a regulatory protein RS1 fragment or a nucleic acid molecule encoding said regulatory protein RS1 fragment for the preparation of a pharmaceutical composition for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a (pathological) modification of homeostasis, wherein said RS1 fragment is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine-Cysteine-Proline) or derivatives thereof.
  • Q-C-P Glutamine-Cysteine-Proline
  • the present invention relates to a method for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a (pathological) modification of homeostasis, said method comprising administering to a patient in need of such amelioration, prevention and/or treatment a pharmaceutically active amount of a regulatory protein RS1 fragment or a nucleic acid molecule encoding a regulatory protein RS1 fragment, wherein said RS1 fragment is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine-Cysteine-Proline) or derivatives thereof.
  • the present invention relates to the use of a regulatory protein RS1 fragment or a nucleic acid molecule encoding said regulatory protein RS1 fragment for the preparation of food, feeds and/or food supplements.
  • nutrition-dependent diseases e. g. obesity/adipositas, hypercholesterolemia, diabetes, hyperglycaemia, diarrhoea, various bile disorders, various renal disorders like hypertension and various disorders related to the deposition of sodium urate crystals like gout
  • nutrition-dependent diseases are secondary diseases and pathological consequences caused by obesity as a consequence of ovemutrition.
  • pathological consequences of increased glucose concentrations in the blood due to diabetes are retinopathia and renal failures.
  • overweight and diabetes are risk factors for diseases such as hypertension, heart attack, biliary stones, e.g.
  • Obesity or "adipositas” is a complex disorder of appetite regulation and/or energy metabolism controlled by specific biological factors. Besides severe risks of illness such as diabetes, hypertension and heart disease, individuals suffering from obesity are often isolated socially.
  • Obesity is defined as a Body Mass Index (BMI) of 30 kg/m 2 or more. BMI is calculated by dividing the weight in kg by the height in metres squared. Overweight" is defined as a BMI between 25 and 30 kg/m 2 . A person is considered obese if he or she has 20 percent (or more) extra body fat for his/her age, height, sex, and bone structure.
  • BMI Body Mass Index
  • Obesity has a major impact on a person's physical, social and emotional well-being.
  • obesity can lead to an increased risk of illness including type 2 diabetes and high blood pressure (hypertension) that can lead to other cardiovascular diseases and stroke.
  • Obesity can also play a role in cancer, problems with sexual- function, muscle and bone disorders and dyslipidaemia.
  • Leptin acts on nerve cells in the brain and modulates this function.
  • NPY neuropeptide Y
  • AGRP agouti-related protein
  • ⁇ -MSH ⁇ -melanocyte-stimulating hormone
  • CART cocaine - and amphetamine - regulated transcript
  • Neuronal circuits furthermore regulate further effector molecules which have recently been identified (for review see Lowell (2000), Nature 404, 652-660).
  • effector molecules comprise uncoupling proteins (UCP1 , UCP2 and/or UCP3; Lowell (2000), loc. cit.) and peroxisome proliferator-activated receptor- ⁇ (PPAR- ⁇ ) co-activator (PGC-I), a key regulator of the genes that regulate thermogenesis (Puigserver (1998), Cell 92, 829-839).
  • POMC proopiomelanocortin
  • obesity is not to be considered as a single disorder but a heterogeneous group of conditions with (potential) multiple causes. Therefore, obesity is also characterized by elevated fasting plasma insulin and an exaggerated insulin response to oral glucose intake (Kolterman (1980), J. Clin. Invest 65, 1272-1284) and a clear involvement of obesity in type 2 diabetes mellitus can be confirmed (Kopelman (2000), loc. cit.; Colditz (1995), Arch. Int. Med. 122, 481-486). As with other complex diseases, rare obesity mutations have been described which have been identified by mendelian pattern of inheritance and position mapping (see Barsh (2000), Nature 404, 644-650).
  • map positions of obesity loci identified by quantitative studies do not correspond to defined (mouse) obesity mutations such as ob (leptin), fat (carboxypeptidase E) or tubby (tubby protein).
  • Map positions have been determined for some clinical syndromes, like Prader-Willi, Cohen, Alstrom, Bardet-Biedl or Borjeson-Forssman-Lehman, but the causative genes have not yet been isolated (see Barsh (2000), loc. cit.; Ohta (1999), Am. J. Hum. Gen. 64, 397-413; Kolehmainen (1997), Eur. J. Hum. Gen.
  • the "human obesity gene map” contains entries for more than 40 genes and 15 chromosomal regions in which published studies indicate a possible relationship to adiposity or a related phenotype (Barsh (2000), loc. cit., Perusse (1999), Obes. Res. 7, 111-129).
  • Said "obesity gene map” comprises, however, mainly large chromosomal areas and does not provide for distinct genes involved in obesity.
  • Known therapies for obese patients comprise in particular physical activity, diet as well as drug therapy. Many drugs tested as an appetite suppressant interfere with monoamine- neurotransmitters (serotonin, noradrenalin, dopamine, histamine).
  • 5-HT (5- hydroxytryptamine) is released in various sites of the hypothalamus, a brain region believed to be involved in the regulation of food intake.
  • D-fenfluramine is a 5-HT releaser and reuptake inhibitor mostly used in combination with Phentermine (Fen- Phen) to treat obesity. Fen-Phen was withdrawn from the market due to potential heart valve defects (Wadden (1999), Obes. Res. 7, 309-310).
  • sibutramine a 5- HT and noradrenalin reuptake inhibitor (Knoll Pharma; Bray (1999), Obes. Res 7, 189-198) was shown to support weight loss when used to support a low calorie diet.
  • Orlistat prevents the absorption of some fat in the intestine. Just under a third of the fat that would otherwise have been absorbed passes straight through the bowel and is excreted in the faeces.
  • appetite depressants and/or appetite suppressants comprise sympathomimetic drugs, canthine hydrochloride, phenylpropanolamine hydrochloride, ampfepramone hydrochloride, as well as serotonin-norepinephrine reuptake-inhibitor, like simbutramine hydrochloride. All of these substances modify appetite, but as they do not specifically target nucleus arcuate neurones and solely modify their function e.g., via NMDA receptors, antiobesity drugs also effect other than arcuate nucleus structures. This might explain the variety of (side) effects of these substances, apart from just modulating satiety.
  • PPH Primary Pulmonary Hypertension
  • Topiramate has recently been proposed in the treatment of obesity. Topiramate demonstrated appetite suppressant properties. Topiramate belongs to a class of medications called anticonvulsants. Usually it is used with other medications to treat certain types of seizures in patients with epilepsy or Lennox-Gastaut syndrome (a disorder that causes seizures and developmental delays). Accordingly, topiramate, marketed as an anti-epileptic drug, is now being evaluated for other indications like obesity, neuropathic pain and management of bipolar mania (The Pharmaceutical Journal (1999), Vol. 263, No 7064, page 475).
  • Obes. Res. Suppl. 2, 116S-123S topiramate is a structurally and pharmacologically novel anticonvulsant agent that was approved in 1996 for treatment of epilepsy. Unlike most antiepileptic agents, topiramate seems to lead to appetite suppression. Yet, it has several other actions, including as an antagonist of voltage-gated sodium channels and modulation of alpha-aminobutyric acid-A activity.
  • therapeutical forms like various special diets (having extreme ratios of nutritients), psychopharmacological drugs and an ⁇ -glucosidase inhibitor (acarbose, Glucobay®, Bayer-Vital, Leverkusen) that inhibits the degradation of disaccharides in small intestine, have been proposed. All known therapeutical forms exhibit the major disadvantage to have severe side effects.
  • SGLT1 and SGLT2 mediate the first step in the absorption of D-glucose in small intestine and in reabsorption of D-glucose in renal proximal tubules.
  • These attempts been the treatment of nutrition related diseases are based on the development of non-transported substrate analogues that act as competitive inhibitors (Oku (1999), Diabetes 48, 1794-1800; Dudash (2004), Bioorg. Med. Chem. Lett. 14, 5121-5125).
  • the inhibition of glucose transport by such compounds requires their continuous presence at the binding site at high concentrations. This permanent presence can cause side effects in organs which are not desired to be affected (e.g. severe detrimental effects in brain or heart).
  • RS1 is a regulatory protein well known in the art (see, e.g. Veyhl (1993), J. Biol. Chem. 268, 25041- 25053.; Koepsell (1994), J. Membrane Biol.
  • the human RS1 (Ace. No. NM_006511 , X82877; Lambotte (1996), DNA and Cell Biology 15, 9, 769-777.) consists of 617 amino acids with 74% amino acid identity to RS1 from pig (Ace. No.
  • RS 1 proteins are from rabbit (Ace. No. X82876) or mouse (Ace. No. Y11917).
  • RS1 Since RS1 , inter alia, inhibits the uptake of glucose within the small intestine and its reabsorption within the renal proximal tubules (see, e. g. Veyhl (2003), J. Membrane Biol. 196, 71-81 ; Osswald (2005), MoI Cell Biol. 25, 78-87), the provision of antagonists of this regulatory protein can not be considered for the treatment, amelioration and/or prevention of high glucose peaks in the blood, for example of glucose peaks in diabetic patients.
  • the RSC1A1 gene codes for RS1.
  • RS1 (/) inhibits the human sodium-D-glucose cotransporter hSGLTI and some other plasma membrane transporters posttranscriptionally (Veyhl (2003), J. Membrane Biol. 196, 71-81), (H) is located within the cytosol as well as within nuclei (Osswald (2005), MoI Cell Biol. 25, 78-87), and (//) inhibits transcription of SGLT1 (Korn (2001), J. Biol. Chem. 276, 45330- 45340).
  • RS 1 was also identified as a protein interacting with the ischemia/reperfusion-inducible protein (IRIP) and it was proposed that RS1 may be involved in an IRIP-dependent regulation of ion transporters, like the organic cation transporter 2 (OCT2; Jiang (2005), MoI Cell Biol. 25 (15), 6496-508).
  • IRIP ischemia/reperfusion-inducible protein
  • RS1 As a molecule or as an RS1 encoding gene, was proposed to be used in the treatment of adipositas or hypercholesterolemia; see EP-A1 1 444 890.
  • the technical problem underlying this invention was to provide for simple means and methods for modulating (pathological) homeostatic conditions, in particular adipositas/obesity and/or energy homeostatic circuits.
  • the solution to said technical problem is achieved by providing the embodiments characterized in the claims, whereby said solution is not only applicable to pathological conditions, but may also be useful in non-pathological situations, like in non-obese individuals.
  • the present invention relates to the use of (a) regulatory protein RS 1 fragment(s) or a nucleic acid molecule encoding such (a) regulatory protein RS 1 fragment(s) for the preparation of a pharmaceutical composition for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a (pathological) modification of homeostasis.
  • said RS 1 fragment is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine- Cysteine-Proline) or derivatives of said tripeptide.
  • the present invention relates to a method for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a (pathological) modification of homeostasis, said method comprising administering to a patient in need of such amelioration, prevention and/or treatment a pharmaceutically active amount of a regulatory protein RS 1 fragment or a nucleic acid molecule encoding a regulatory protein RS 1 fragment, wherein said RS 1 fragment is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine-Cysteine-Proline) or derivatives thereof.
  • Q-C-P Glutamine-Cysteine-Proline
  • the present invention relates to the use of a regulatory protein RS 1 fragment or a nucleic acid molecule encoding said regulatory protein RS 1 fragment for the preparation of food, feed and/or food supplements, wherein said RS 1 fragment is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine-Cysteine-Proline) or derivatives thereof.
  • Q-C-P Glutamine-Cysteine-Proline
  • peptide to be employed in context of the present invention, said peptide comprising at least three amino acid residues as comprised in the amino acid sequence S-D-S-D-R-I-E-P (Serine-Aspartic acid-Serine-Aspartic acid-Arginine-lsoleucine-Glutamic acid-Proline).
  • S-D-S-D-R-I-E-P Serine-Aspartic acid-Serine-Aspartic acid-Arginine-lsoleucine-Glutamic acid-Proline.
  • This peptide or a peptide/protein comprising said amino acid sequence (or comprising at least 3 consecutive amino acid residues of the same) or comprising the amino acid sequences of smaller or larger peptides (e. g.
  • I-K-P-S-D-S-D-R-I-E-P Isoleucine- Lysine-Proline-Serine-Aspartic acid-Serine-Aspartic acid-Arginine-lsoleucine- Glutamic acid-Proline
  • said derivatives of Q-C-P may be, e.g., O-S-P (Glutamine-Serine-Proline), Q-P-P (Glutamine-Proline-Proline) or Q-T-P (Glutamine- Threonine-Proline).
  • O-S-P Glutamine-Serine-Proline
  • Q-P-P Glutamine-Proline-Proline
  • Q-T-P Glutamine- Threonine-Proline
  • nucleic acid molecules encoding the herein described RS 1 fragments may be employed in context of the present invention.
  • RS 1 fragment As documented herein below and in the appended examples, it was, in accordance with this invention, surprisingly found that specific fragments of the regulatory protein RS 1 or nucleic acid molecules encoding the same, negatively influence the glucose uptake in vivo.
  • This RS 1 fragment to be employed in accordance with this invention is the herein defined "Q-C-P" fragment, also referred to as "RS 1 fragment".
  • the term "RS 1 fragment” also comprises (I-K-P-)S- D-S-D-R-I-E-P (or at least 3 consecutive amino acid residues thereof) and derivatives thereof (defined herein).
  • total RS1 protein and the smaller fragments derived therefrom and described herein are thought (without being bound by theory) to inhibit the exocytotic pathway within a short time period of less than 30 min. Inhibition of the exocytotic pathway was shown by demonstrating that the inhibitory effect on expression of hSGLTI in oocytes by total RS1 protein, by the peptide QCP or SDSDRIEP could be prevented if the exocytotic pathway was blocked by botulinum toxin B or by brefeldin
  • hOCT1 appears to be inhibited after injection of total hRS1 protein (in the presence of an intracellular AMG concentration of 0.1 mM), hOCT2 expressed [ 14 C]TEA uptake in oocytes appears not to be inhibited after injection of QCP.
  • Corresponding measurements were performed in the presence of intracellular AMG concentrations of 0.1 mM, ⁇ 0.01mM or 10 mM. Without being bound by theory, these data indicate a different specificity of the target transporter for total hRS1 compared to the RS1 fragments described herein, in particular QCP (or derivatives therof).
  • total RS1 refers to a polypeptide that has the function of the naturally occuring RSl
  • total RS 1 may be the full length hRS1 , e. g. as characterized by a polypeptide comprising the amino acid sequence of SEQ ID NO: 2 or a fragment of said amino acid sequence having the function of the naturally occurring hRS1.
  • compositions for the treatment of a metabolic disease or a secondary disorder caused by a pathological modification of homeostasis may be prepared.
  • Said pharmaceutical compositions comprise the herein defined minimal peptide (RS1 fragment) or a nucleic molecule encoding the same or even a (gene-expression) vector comprising said nucleic acid molecule.
  • RS1 fragment the herein defined minimal peptide
  • nucleic molecule encoding the same or even a (gene-expression) vector comprising said nucleic acid molecule.
  • means and methods for the medical intervention in pathological disorders relating to homeostasis, in particular over-weight, obesity/adipositas and secondary disorders provided herein and detailed below.
  • the invention also relates to food, feed, food precursors and/or food additives prepared in accordance with the herein defined methods, namely the addition of the RS 1 fragments; in particular the Q-C-P-fragment (alone or in combination with the at least three consecutive amino acid residues of the above described SDSDRIEP peptide and/or other QCP derivatives as described herein), as provided herein.
  • the present application provides for a compound that inhibits the expressed activity of SGLTs and other nutrient transporters and thereby exhibit a more prolonged inhibition of transport of glucose or other nutrients, compared to e. g. the competitive inhibitors (Oku (1999), Diabetes 48, 1794-1800.; Dudash (2004), Bioorg. Med. Chem. Lett. 14, 5121-5125). Side effects, as caused by the continuous presence of such competitive inhibitors or medicaments described above, can not occur.
  • RS1 -specific fragments of the invention down-regulate transporters posttranscriptionally is provided below and in the experimental part. Accordingly, specific functionally active domains of RS1 are identified and specific peptides from these RS1-domains as defined herein are provided. In addition, methods to introduce these inventive peptides, e. g. tripeptides, into selected groups of cells are described.
  • RS1 is not only localized at the plasma membrane and within the nucleus as previously decribed ( Kom (2001), J. Biol. Chem. 276, 45330-45340; Osswald (2005), MoI. Cell Biol. 25, 78-87) but also at the trans-Glogi network (TGN) .
  • TGN trans-Glogi network
  • Evidence is provided that RS1 at the TGN is released after treatment of cells with brefeldin A which classifies RS1 as a TGN coat-protein and suggests that RS 1 is involved in sorting at the TGN.
  • the posttranscriptional inhibition of SGLT1 expression by RS 1 is due to an inhibition of the exocytotic pathway of plasma membrane transporters, as documented below.
  • QCP Glutamine- Cysteine-Proline
  • QCP or derivatives thereof leads to posttranscriptional downregulatation of (nutrient) transporters.
  • QCP inhibits the exocytotic pathway of plasma membrane transporters from the Golgi apparatus to the plasma membrane. It was also demonstrated that QCP is translocated by the proton-peptide co-transporter PEPT1. This allows even the extra cellular application of QCP or a derivative thereof and to direct its effects to cells that express proton-peptide co-transporters. Such an extra cellular application is particularly useful in the medical and/or nutritional methods provided herein.
  • the present invention provides for the use of a regulatory protein RS 1 fragment/RS1 minimal peptide or a nucleic acid molecule encoding said regulatory protein RS1 fragment/RS1 minimal peptide for the preparation of a pharmaceutical composition for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a (pathological) modification of homeostasis, wherein said RS 1 fragment to be employed in the herein defined uses and methods is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine- Cysteine-Proline) or derivatives thereof.
  • Q-C-P Glutamine- Cysteine-Proline
  • the term "regulatory protein RS1 fragment", RS1 minimal peptide” or "RS 1 fragment” relates to an amino acid stretch of an RS 1 protein as defined herein and as illustratively shown in any of SEQ ID Nos 2, 4, 6 or 8 or as encoded by a nucleic acid molecule as shown in SEQ ID Nos. 1 , 3, 5 or 7.
  • the "amino acid stretch” to be employed in accordance with this invention is the stretch Q-C-P, QSP 1 QPP or QTP (one letter code) and the corresponding "RS 1 fragment(s)" comprise(s) these three amino acid residues in this consecutive order.
  • the reciprocal amino acid stretch i.e. P-C-Q
  • the herein defined amino acid stretch in N- to C-terminal order in the format of "Q-C-P" is to be employed.
  • the amino acid stretch/fragment of the present invention comprises (or is) at least 3 amino acid residues.
  • the "Q-C-P" comprising fragments may comprise, one additional amino acid residue, two additional amino acid residues, three additional amino acid residues, four additional amino acid residues, five additional amino acid residues, six additional amino acid residues, seven additional amino acid residues, eight additional amino acid residues, nine additional amino acid residues or ten additional amino acid residues.
  • longer amino acid stretches comprising the herein defined "RS 1 fragment", namely the Q-C-P motive/peptide" are envisaged.
  • said "RS 1 fragment” may comprise at least 3, 5, 7, 9, 11 , 13, 14, 15, 16, 17, 18, 19, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90 or at least 100 amino acid residues.
  • the additional amino acid residues are residues as also comprised in the herein defined RS 1 proteins.
  • said "RS 1 fragment” or "Q-C-P motive/peptide” as defined herein comprises at the most 150 amino acid residues, more preferably at the most 120 amino acid residues.
  • smaller peptides of 3 to 12 amino acid residues are preferred, whereby more preferred are 3 to 10 amino acid residues.
  • said amino acid stretch/fragment has a length of three amino acids, namely the amino acid stretch/fragment "Q-C-P" or derivatives thereof, like Q-S-P, Q-P-P or Q-T- P.
  • the above-described fragments are consecutive stretches of the herein defined RS1 protein.
  • Said "fragments" of RS1 protein may, in accordance with the present invention, also be comprised in fusion constructs, like fusion proteins. These "fusion proteins” and corresponding embodiments are disclosed and exemplified below.
  • peptides are employed which comprise the Q-C-P motive (or derivatives thereof) in form of repeats/tandems and the like.
  • peptides which are or which comprise motives like "Q-C-P-Q-C-P" and/or "Q-C-P-Q-C-P-Q-C-P".
  • said "Q-C-P motive" may be repeated in one fragment/amino acid stretch. Said repetitions may comprise 2, 3, 4, 5, 6, 7, 8, 9 or more repeated Q-C-P stretches. Said repeated stretches may be interrupted by spacers/linkers of other amino acid residues.
  • the repeated sequences may be of the format "Q-C-P-X-Q-C-P” or "X-Q-C-P-X-Q-C-P-X", wherein "X” represents any amino acid residue and any number of amino acid residues.
  • "X” is selected from the group consisting of the amino acid residues A (Alanine), K (Lysine) or R (Arginine) and the number of linker/spacer amino acid residues is preferably at least one. More preferably, the number of linker/spacer amino acid residues is 3.
  • the "X" of the peptides as described above may be a site, cleavable by hydrolysis (e.g. catalyzed by hydrolases).
  • "X” may be S-S.
  • the RS 1 fragments as defined herein or repeats/tandems thereof may be attached to further amino acids, heterologous peptides and/or heterologous proteins.
  • Said further or additional amino acids may also comprise the above described "further minimal RS 1 fragment", namely the peptide comprising at least 3 consecutive amino acid residues comprised in the amino acid stretch S-D-S-D-R-I-E-P.
  • Said further or additional amino acids may also comprise the above described derivatives of QCP, e.g. QSP, QPP or QTP as well as all possible combinations of the herein described RS 1 fragments.
  • said further amino acids, heterologous peptides and/or heterologous proteins may comprise, derived from and/or consisting of domains having additional functionalities, like, e. g. domains providing further pharmacological effects or specific tags for facilitating protein purification, like, e.g., His-tags.
  • the RS 1 fragments as defined herein may also be part of fusion polypeptides or fusion proteins.
  • said fusion polypeptides or fusion proteins comprising the RS 1 fragments as defined herein may also comprise more than 150 amino acids.
  • amino acid stretch which may be equally employed in the means, uses and methods of this invention, whereby this amino acid stretch is characterized in comprising at least 3 amino acid residues as comprised in the amino acid sequence S-D-S-D-R-I-E-P (Serine-Aspartic acid-Serine-Aspartic acid-Arginine-lsoleucine-Glutamic acid-Proline) or derivatives thereof.
  • the uses and methods provided herein relate mainly to the herein defined RS 1 fragment "Q-C-P" and its also defined derivatives.
  • inventive RS 1 fragment being characterized in comprising at least the amino acid sequence Q-C-P (Glutamine-Cysteine-Proline) or derivatives thereof, may be employed/used in (a) combination(s) with the above described further "minimal RS 1 fragment", namely the peptide comprising at least 3 consecutive amino acid residues comprised in the amino acid stretch S-D-S-D-R-I-E-P, and/or in (a) combination(s) with the above described QCP derivatives, e. g. QSP, QTP and/or QPP.
  • QCP derivatives e. g. QSP, QTP and/or QPP.
  • combination(s) of said further "minimal RS 1 fragment” and/or said QCP derivatives lacking particularly QCP are employed in context of the present invention.
  • Q-C-P or derivatives thereof relates preferably to tripeptides with one ore two amino acid substitutions in said three- amino-acid stretch "Q-C-P".
  • a corresponding and exemplified "Q-C-P" derivative may be of the format of QSP, QTP, QPP, QAP, QGP, NCP, DCP, ECP, NSP, DSP or ESP.
  • the useful amino acid stretch comprises or is "Q-C-P", “Q-S-P", "Q-T-P” or "Q-P-P".
  • S corresponds to "serine
  • D corresponds to "aspartic acid”
  • T corresponds to "threonine”
  • P corresponds to "proline”
  • N corresponds to "asparagine”
  • A corresponds to "alanine”
  • G corresponds to "glycine”
  • E corresponds to "glutamate”.
  • Q-C-P derivatives where the cysteine residue (C) is replaced by other amino acids, e.g. for Q-S-P, Q-T-P and Q-P-P.
  • the human RS1 sequence also contains the Q-S-P motive and the Q-P-P motive (e.g., see SEQ ID NO: 2).
  • Q-C-P or derivatives thereof also relates to Q-C-P (or QSP or Q-T-P or Q-P-P, etc; see above) derivatives having the peptide bond substituted by a covalent bond which is not proteolytically cleavable.
  • the tripeptides as defined herein are inert against further proteolytic digestion and therefore keep their functionality within the gastrointestinal tract.
  • the inventive "QCP” fragment may also be a fragment wherein several "QCP" motives are comprised and wherein said "QCP" motives are directly linked to each other (e.g.
  • the above mentioned and defined “proteolytically inert” peptide bonds are comprised between “Q” and “C” and between “C” and “P” of the herein defined “three amino acid motive Q-C-P".
  • the bond between "Q” and "X” and/or between "P” and “X” is a peptide bond which is proteolytically cleavable.
  • the longer RS1 fragments defined herein and comprising the "QCP motive" are in vivo proteolytically cleaved (for example after administration in the stomach by gastric juices, in the intestines or in the blood stream), whereby the "proteolytically inert” bonds defined above comprised between "Q” and “C” and between “C” and “P” is not cleaved in vivo, leading to a "proteolytically inert" "Q-C-P” tripeptide which is particularly useful in context of the means, methods and uses of the present invention.
  • the embodiments described herein are not restricted to the distinct "Q-C-P" tripeptide, but also to "Q-C-P derivatives", as defined above, e.g. QSP, QTP, QPP and the like.
  • Q-C-P peptides In longer peptides (which, for example, cannot be taken up by PEPT1 and/or PEPT2), "Q-C-P peptides" or derivatives thereof having such "inert bonds” are not proteolytically cleavable. Without being bound by theory, these "inert QCP peptides" remain intact, whereas the remaining amino acids flanking said tripeptide(s) are proteolytically cleaved in vivo. This may lead to Q-C-P or derivatives thereof consisting only of 3 amino acids within the gastrointestinal tract. This kind of Q-C-P tripeptide or derivatives thereof can be transported, e.g. by PEPT1 and/or PEPT2 into those cells in which they are desired to be active.
  • Q-C-P or derivatives thereof or "RS 1 fragment” relates also to secondary forms of the RS1 fragments described herein, e. g. to D- and L-isoforms, natural and unnatural salts and secondary forms with modifications like acetylation, methylation, glycosylation and/or phosphorylation and to substances with similar or the same mass-spectrometrical characteristics. It was found out that, e.g. the acetylated forms of the RS 1 fragments described herein have the same effects in context of the present invention, e.g. the same effects on sugar uptake, as the non-acetylated forms. Accordingly, also secondary modifications/forms of the herein defined peptides are part of this invention.
  • Q-C-P or derivatives thereof or "RS 1 fragment” relates to all tripeptides or other substances that can function as substrates for (human) peptide- proton symporters, e.g. PEPT1 and/or PEPT2.
  • the molecular features of said tripeptides or other substances are well known in the art and are described in e. g. Daniel (2004), Pflugers Arch. 447, 610-618.
  • Corresponding screening assays for the function of these tripeptides as substrates for PEPT1 and/or PEPT2 can easily be deduced by the skilled artesian from Daniel (2004), loc cit.
  • the "Q-C-P tripeptide" or "RS 1 fragment” as defined herein or a peptide comprising the same is made hydrophobic.
  • a hydrophobic peptide is envisaged to be able to cross (biological) membranes.
  • Q-C-P may be coupled with antennapedia proteins (or fragments thereof) in order to obtain hydrophobic derivatives of QCP; see also Derossi (1994), J. Biol. Chem. 269, 10444-10450.
  • a "Q-C-P derivative" as defined herein is characterized in comprising and/or having the same tertiary structure as the original "Q-C-P" amino acid stretch alone or as comprised in a fragment with more amino acid residues. Accordingly, and most preferably, the "QCP derivatives" have, compared to the original Q-C-P motive an unchanged tertiary structure. The same applies, mutatis mutandis, to the further defined minimal peptide as described herein and being derived from the S-D-S-D-R- I-E-P motive disclosed herein. The person skilled in the art is readily in a position to deduce corresponding three-dimensional structures and/or tertiary structures.
  • MALDI-MS protein elution and MALDI- MS or N-terminal sequencing by Edman degradation (Edman (1950), Acta Chem. Scand. 4, 283), enzymatic in-gel digestion, analysis of peptides directly in the mixture by mass spectrometry, peptide mass fingerprinting (Pappin (1993), Curr. Biol. 3, 327), ESI-MS (electrospray-ionization-MS), MALDI PMF and/or MALDI PDS (like, e.g. PSD-MALDI-MS (Spengler (1992), Rapid Commun. Mass Spectrom. 6, 105)).
  • a matrix for MALDI-MS nicotinic acid, 2,5-dihydroxy benzoic acid or alpha-cyano- 4-hydroxyciannamic acid may be used.
  • the herein defined RS 1 fragment e.g. the Q-C-P peptide
  • the cells in which the peptides are desired to be effective are most preferably the small intestine epithelial cells, the renal proximal tubular epithelial cells, endothelial cells of blood vessels, epithelial cells of the rectum or colon, and/or epithelial cells of the skin.
  • the Q-C-P peptide and the other RS 1 fragments as described herein are capable to entry those cells in which it is desired to be effective.
  • This entry may be mediated, without being bound by theory, via active transport, passive transport, endocytosis and/or via passive diffusion.
  • a transport protein like a peptide carrier.
  • said carriers are the proton peptide co-transporters PEPT1 or PEPT2, most preferably PEPT1 , as described herein.
  • a method for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a (pathological) modification of homeostasis comprises administering to a patient in need of such amelioration, prevention and/or treatment a pharmaceutically active amount of a regulatory protein RS 1 fragment or a nucleic acid molecule encoding a regulatory protein RS 1 fragment, wherein said RS 1 fragment is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine-Cysteine-Proline) or derivatives thereof.
  • Q-C-P Glutamine-Cysteine-Proline
  • the metabolic disease or secondary disorder to be treated, ameliorated and/or prevented by the inventive use and methods provided herein is preferably selected from the group consisting of obesity (adipositas), hypercholesterolemia, diabetes, hyperglycaemia, diarrhoea, a bile disorder, a renal disorder. Also envisaged, and not limiting are the amelioration, prevention and/or treatment of gout, hypertension, cancer and/or a disorder related to the deposition of urate crystals in joints, soft tissue and/or the urinary tract.
  • the most common disorder of metabolism to be treated, prevented and/or ameliorated in accordance with this invention is obesity and/or a disorder which involves higher levels of triglycerides and/or cholesterol in the blood of a patient to be treated.
  • the recommended level of triglycerides (in a normal range) are in males 40- 160 mg/dL and in females 35 to 135 mg/dL
  • the recommended level of cholesterol are 150-220 mg/100 ml.
  • the present invention provides for means and methods for the medical intervention in overweight subject, in particular human patients.
  • An "overweight" patient is often defined as having a body mass index (BMI) above 25 kg/m 2 . Accordingly, the patients to be treated in accordance with this invention have a body mass index between 25 to 30 kg/m 2 . However, it is also envisaged that patients are to be treated who have a BMI above 30 kg/m 2 . In certain medically indicated cases, it is also envisaged that patients with a BMI below 25 kg/m 2 are to be treated with the peptides and/or nucleic acid molecules encoding the name as defined herein (or a pharmaceutically acceptable salt thereof) in order to reduce their body weight.
  • the present invention provides for the use of the peptides as defined herein (or a pharmaceutically acceptable salt thereof) for preventing or treating obesity, adipositas, eating disorders leading to increased body weight/body mass. Also envisaged are disorders related to higher or pathologically high body weight due to the use of drugs (like corticosteroids, antipsychotic drugs, antidepressants, particularly tricyclic antidepressants, oral contraceptives, etc.)
  • drugs like corticosteroids, antipsychotic drugs, antidepressants, particularly tricyclic antidepressants, oral contraceptives, etc.
  • Disorders of the metabolism linked to higher body weight/body mass and to be treated (or prevented) by the administration of the peptides as defined herein (or a pharmaceutically acceptable salt thereof) may also comprise, but are not limited to, glycogen storage diseases, lipid storage diseases (like, e.g., Gaucher, Niemann Pieck), endocrine disorders (like, e.g., Cushings, hypothyroidism, insulinomas, lack of growth hormone, diabetes, adrenogenital syndrome, diseases of the adrenal cortex), tumors and metastases (such as craniophryngeomas), Prader-Willi syndrome, Down syndrome and genetic diseases and syndromes (like, e.g., hyperlipoproteinemias) or hypothalmic disorders.
  • glycogen storage diseases like, e.g., Gaucher, Niemann Pieck
  • endocrine disorders like, e.g., Cushings, hypothyroidism, insulinomas, lack of growth hormone, diabetes, adrenogenital syndrome, diseases of the adrenal
  • the invention also relates to the use of the peptides as defined herein (or a pharmaceutically acceptable salt thereof) in the amelioration, prevention and/or treatment of diseases/disorders related to, caused by or leading to higher or pathologically high body weight.
  • the peptides as defined herein are employed in the medical intervention of secondary disorders related to a (pathological) increase of body weight.
  • secondary disorders may comprise, but are not limited to diabetes type 2, high blood pressure (hypertension), cardio-vascular diseases, stroke, cancer, problems with sexual function and disorder of the muscular or bone system.
  • Said cardio-vascular disorder may comprise infarcts and/or stroke.
  • the peptides as defined herein may be used, especially when administered to the small intestine, to influence the absorption of nutrients, absorption of bile acids, level of cholesterol in the blood, absorption of nucleosides, gout, secretion and/or motor function. Without being bound to theory, this influence may be due to:
  • the peptides as defined herein may be used, especially when administered to the colon, to influence absorption of water (for example, a laxative effect is induced) and/or motor function of the gut. This influence may be related to the modifications of the corresponding transporters (e.g. solute transporters, aquaporins, SERT and organic cation transporters).
  • solute transporters e.g. solute transporters, aquaporins, SERT and organic cation transporters.
  • the peptides as defined herein may be used, especially when administered to the kidney, in particular the proximal tubules (where, e.g. PEPT1 and PEPT2 are expressed), to inhibit reabsorption of D-glucose in diabetic patients, by, e.g. inhibition of SGLT1.
  • the peptides as defined herein may be used to decrease high peaks of glucose within the serum of diabetic patients, in particularly diabetic patients being adjusted insufficiently.
  • peptides as defined herein may be used to inhibit function of transporters of endothelial cells.
  • the herein defined RS 1 fragment e.g. the Q-C-P peptide described herein, interacts, in vivo, with peptide receptors, transporters and/or channels for peptides; receptors, transporters and/or channels for nucleosides or nucleotides; receptors, transporters and/or channels for sugars or sugar phosphates; receptors, transporters and/or channels for amino acids or taurine; receptors, transporters and/or channels for neurotransmitters or monoamines; receptors, transporters and/or channels for vitamins or cofactors; receptors, transporters and/or channels for urea, creatinine or ammonium; receptors, transporters and/or channels for organic ions or zwitterions; receptors, transporters and/or channels for anorganic ions, metal ions or protons; receptors, transporters and/or channels for drugs; receptors, transporters and/or channels for bile acids or fatty acids; and water channels.
  • Said receptors, transporters and/or channels are well known in the art and, e.g. may comprise PAT1 (SLC36A1, ace. No. AF516142) PAT2 (SLC36A2 ace. no. AY162214) (Boll (2004), Pflugers Arch. 447, 776-779); EAAC1 (SLC1A1 , ace. no. NM_004170, ASCT2 (SLC1A5, ace. No. U53347 or NMJJ05628) (Kanai (2004), Pflugers Arch. 447, 469-479); rBAT (SLC3A1 ace. No. L11696), 4F2hc (SLC3A2 ace.
  • PAT1 SLC36A1, ace. No. AF516142
  • PAT2 SLC36A2 ace. no. AY162214
  • EAAC1 SLC1A1 , ace. no. NM_004170
  • NM_000453 SGLT4 (SLC5A8 ace. no. HCT1951464) (Wright (2004), Pflugers Arch. 447, 510-518); GAT1 (SLC6A1 ace. no. NM_003042), NET (SLC6A2 ace. no. NM_001043), DAT (SLC6A3 ace. no. NM_001044), SERT (SLC6A4 ace. no. NM_001045), GLYT2 (SLC6A5 ace. no. AF085412 and NM_004211), TAUT (SLC6A6 ace. no. NM_003043) (Chen (2004), Pflugers Arch.
  • NHE2 (SLC9A2 ace. no. NM_003048), NHE3 (SLC9A3 ace. no. NM_004174), NHE4 (SLC9A4 ace. no. XM_087199) (Orlowski (2004), Pflugers Arch. 447, 549-565); ASBT (SLC10A2 ace. no. NM_000452) (Hagenbuch (2004), Pflugers Arch. 447, 566-570); NKCC2 (SLC12A1 ace. no. NM_000338), NCC (SLC12A3 ace. no. NM_000339) (Hebert (2004), Pflugers Arch.
  • NM_004696 MCT2 (SLC16A7 ace. no. NM_004731), TAT1 (SL16A10 ace. no. NM_018593) (Halestrap (2004), Pflugers Arch. 447, 619-628); NPT1 (SLC17A1 ace. no. NM_005074), NPT3 (SLC17A2 ace. no. U90544), NPT4 (SLC17A3 ace. no. NM_006632), AST (SLC17A5 ace. no. AJ387747) (Reimer (2004), Pflugers Arch. 447, 629-635); OATP4C1 (SLC21A20 ace. no.
  • hOCT1 SLC22A1 ace. no. X98332 and U77086
  • hOCT2 SLC22A2 ace. no. X98333
  • hOCT3 SLC22A3 ace. no. AJ001417)
  • hOCTNI SLC22A4 ace. no. AB007448
  • hOCTN2 SLC22A5 ace. no. AF057164
  • hOAT1 SLC22A6 ace. no. AF057039
  • hOAT2 SLC22A7 ace. no.
  • NM_003041 FATP3 (SLC27A3 ace. no. NM_024330), FATP4 (SLC27A4 ace. no. NM_005094), FATP5 (SLC27A5 ace. no. NM_012254) (Stahl (2004), Pflugers Arch. 447, 722-727); CNT1 (SLC28A1 ace. no. NM_004213), CNT2 (SLC28A2 ace. no. NM_004212), CTN3 (SLC28A3 ace. no. NM_022127) (Gray (2004), Pflugers Arch. 447, 728-734); ENT1 (SLC29A1 ace. no.
  • AF193807 RhCG (SLC42A3 ace. no. AF193809) (Nakhoul (2004), Pflugers Arch. 447, 807-812); hENaC ⁇ -subunit (ace. no. AH007622 or L29007), McDonald (1994), Am. J. Physiol. 266, L728-L734) or hENaC ⁇ -subunit (ace. no. L36593), hENaC ⁇ subunit (ace. no. L36592) (McDonald (1995), Am. J. Physiol. 268, 1157-1163).
  • the RS1 fragment as used within the present invention may interact with a receptor, transporter and/or channel in the kidney, for example the Na + -D-glucose cotransporter SGLT1 , and/or in the skin, for example the organic cation transporter hOCT3 .
  • the peptides as defined herein may be used to prevent, ameliorate and/or treat pathophysiological conditions such as stroke, myocardial infarction, acute renal failure and/or ischemia/reperfusion insury (which may or may not caused by pathophysiological conditions such as stroke, myocardial infarction and/or acute renal failure).
  • pathophysiological conditions such as stroke, myocardial infarction, acute renal failure and/or ischemia/reperfusion insury (which may or may not caused by pathophysiological conditions such as stroke, myocardial infarction and/or acute renal failure).
  • the peptides as defined herein (or pharmaceutically acceptable salts thereof) may interact with receptors, transporters and/or channels of one or more regulatory pathways.
  • these receptors, transporters and/or channels are the receptors, transporters and/or channels as defined herein, e. g.
  • receptors, transporters and/or channels for neurotransmitters, monoamines, anorganic ions or organic zwitterions, cations and anions like, e. g. receptors, transporters and/or channels for glutamate.
  • An interaction of different regulatory pathways, all or less than all of which are intended to be influenced by the peptides as defined herein (or pharmaceutically acceptable salts thereof), may also be given.
  • one of the regulatory pathways to be influenced by the peptides as defined herein may be a pathway that regulates the appetite sensation and/or the feeding/eating behaviour of a subject.
  • this pathway involves the function of RS1, the associated protein IRIP (Jiang (2005), MoI. Cell Biol. 25 (15), 6496-508), includes or is modulated by protein kinase C and requires intact dynamin (Veyhl (2003), J. Membr. Biol. 196, 71- 81).
  • the peptides as defined herein (or pharmaceutically acceptable salts thereof) may also be used for modulating appetite of a subject.
  • appetite of a subject may also arise with decreasing glucose concentration in the blood. Therefore, the peptides as defined herein (or pharmaceutically acceptable salts thereof) may also be used as appetite enhancers, e. g. for the amelioration, prevention and/or treatment of bulimia, anorexia nervosa and the like.
  • the use of the peptides as defined herein (or pharmaceutically acceptable salts thereof) as appetite supressors is also envisaged.
  • the peptides as defined herein (or pharmaceutically acceptable salts thereof) also interact with further factors.
  • factors are well known in the art and comprise factors like the factors described in Jiang (2005) MoI Cell Biol. 25 (15), 6496-508), Veyhl (2004) J Membr Biol 196, 71-81 and Osswald (2005) MoI Cell Biol 78-87.
  • the interaction with such factors may facilitate or inhibit the interaction of the peptides as defined herein (or pharmaceutically acceptable salts thereof) with the receptors, transporters and/or channels defined herein, and may also not influence said interaction.
  • the peptides as defined herein may interact with the ischemia/reperfusion-inducible protein IRIP (Jiang, 2005, MoI Cell Biol., 25(15): 6496-508; AY286019/AY286020).
  • This interaction may increase the inhibitory influence of the peptides as defined herein (or pharmaceutically acceptable salts thereof) on receptors, transporters and/or channels as defined herein.
  • said receptors, transporters and/or channels are receptors, transporters and/or channels for organic cations or anions, like, e. g. hOCT1 (SLC22A1 ace. no.
  • hOCT2 (SLC22A2 ace. no. X98333), hOCT3 (SLC22A3 ace. no. AJ001417) or hOAT1 (SLC22A6 ace. no. AF057039), hOAT2 (SLC22A7 ace. no. AF210455 and AF097518 and AY050498) and hOAT3 (SLC22A8 ace. no. AF097491), hOAT4 (SLC22A11 ace. no. AB026116) (Koepsell (2004), PfI ugers Arch. 447, 666-676).
  • receptor(s), transporter(s) and/or channel(s) relates to all kind of proteins that are capable to interact with RS 1 and/or a RS1 fragment or a derivative thereof as defined herein above. Further, this term relates to proteins that interact with a substrate to be transported or to be recognized. Those proteins are well known in the art (see, e.g. Wright (2004) Pflugers Arch., 447:510-518).
  • receptor, transporter and/or channel proteins are preferably membrane proteins that are known in the art (see e. g. Stryer, Biochemistry, Ed. 4th, 1995, chapter 11). However, they may also contain peripheral subunits or components (see e. g. Stryer, Biochemistry, Ed. 4th, 1995, page 275). It is also envisaged that the peripheral components of receptors, transporters and channels may be cytosolic or extra cellular proteins and that receptors may cytosolic in total.
  • the transporters may comprise active cotransporters like sym- or antiporters, passive transporters (e.g. like some transporters of pharmaceutical compositions or some ion-channels) or channels (e.g. like aquaporins).
  • the derivatives of the peptides as defined herein (or also pharmaceutically acceptable salts of such derivatives) that can permeate through biological membranes may be used to inhibit function of transporters within the skin. Accordingly, these peptides can be used to treat proliferative disorders of the skin as e.g. tumors/cancer.
  • hydrochloride form i.e. hydrochloride of the peptides as defined herein (or derivatives thereof).
  • Hydrochloride of the peptides as defined herein is also a preferred salt in context of this invention. Yet, also other salts are known and envisaged.
  • acid addition salts like acetate, adipate, alginate, ascorbate, aspartate, benzoate, benzenesulfonate, bisulphate, butyrate, citrate, cyclopentanepropionate, digluconate, dodecyl sulphate, ethane sulfonate, fumarate, glucoheptanoate, glycerophosphate, heptanoate, hexanoate, hydrochloride, 2-hydroxyethane sulfonate, lactate, maleate, methane sulfonate, nicotinate, nitrate, oxalate, pamoate, pectinate, persulphate, 3-phenyl sulfonate, 3- phenylpropionate, phosphate, propionate, salicylate, succinate, sulphate, sulfonate, tartrate, undecanoate, or the like
  • compositions described herein can be administered to the subject at a suitable dose.
  • Administration of the suitable compositions may be effected by different ways, e.g., by intravenous, intraperitoneal, intravesical subcutaneous, by inhalation as well as transdermal administration.
  • Preferred are oral administrations (also in form of food, feed and/or food additives as described herein).
  • another preferred administration route is (are) blood infusion(s) (like intravenous ionfusion(s)) and/or rectal administration (e.g. in form of enemas or suppositories).
  • the peptides as defined herein may, accordingly, be administered orally, parenterally, such as subcutaneously, intravenously, intramuscularly, intraperitoneally, intrathecal ⁇ , transdermal ⁇ , transmucosally, transpulmonally subdurally, locally or topically via iontopheresis, sublingually, by inhalation spray, aerosol or rectally and the like in dosage unit formulations optionally comprising conventional pharmaceutically acceptable excipients.
  • parenterally such as subcutaneously, intravenously, intramuscularly, intraperitoneally, intrathecal ⁇ , transdermal ⁇ , transmucosally, transpulmonally subdurally, locally or topically via iontopheresis, sublingually, by inhalation spray, aerosol or rectally and the like in dosage unit formulations optionally comprising conventional pharmaceutically acceptable excipients.
  • compositions comprising a peptide/RS1 fragment according to the present invention for oral use can be obtained by combining the active compound(s) with solid excipient, optionally grinding the resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores, preferably with a gastric juice resistant coating such as derivatives of cellulose, polymer of methacrylic acid and methacrylic acid esters or derivatives of polyvinyl.
  • a gastric juice resistant coating such as derivatives of cellulose, polymer of methacrylic acid and methacrylic acid esters or derivatives of polyvinyl.
  • the peptides described herein (or their derivatives) to be administered in particular in form of a pharmaceutical composition may be comprised in tablets/pills and the like.
  • said peptides are comprised in coated, e.g. film-coated tablets/pills.
  • Such a coating is particularly preferred for time- and/or location- controlled release of the peptides (or nucleic acid molecules encoding the same).
  • Corresponding coatings are known in the art, and, inter alia, described in EP-A1 0 109 320, WO 94/06416, EP-A1 0 630 646 or EP-A1 0 548 448.
  • the pharmaceutically acceptable carrier as employed herein warrants the release of the peptides as defined herein within the small intestine, the renal proximal tubules, the colon, the rectum, or the bladder and/or the blood vessels.
  • Preferred are the small intestine, the renal proximal tubules and/or the colon, most preferred is the small intestine.
  • Particularly preferred coatings in this respect are coatings which lead to a resistance to gastric juices and, accordingly, the peptide as provided herein is liberated in the gut/intestine, preferably in the small intestine and/or the colon. Accordingly, gastric juice resistant coatings may preferably be employed.
  • Such coatings are known in the art and comprise, as non-limiting examples: cellulose derivatives, like carboxymethylene ethylcellulose (Aquateric®), cellulose acetatephthalate (HP50®) or hydroxypropylene cellulose methylphthalate (HP55®); polymeric compounds derived from methacrylic acid and methacrylic acid esters, like Eutragit ® L and Eutragit ® S (for retard forms Eutragit ® RL und Eutragit ® RS).
  • cellulose derivatives like carboxymethylene ethylcellulose (Aquateric®), cellulose acetatephthalate (HP50®) or hydroxypropylene cellulose methylphthalate (HP55®)
  • polymeric compounds derived from methacrylic acid and methacrylic acid esters like Eutragit ® L and Eutragit ® S (for retard forms Eutragit ® RL und Eutragit ® RS).
  • polyvinyl derivatives may be used. These comprise, inter alia, polyvinylpyrrolidone (e.g. Kollidon®) polyvidone acetate or polyvinyl acetate phthalate (e.g. Opadry®).
  • peptides according to the present invention or salts thereof or medicaments comprising them, intended to be administered intracellulary may be administered using techniques well known to those of ordinary skill in the art.
  • agents may be encapsulated into liposomes, then administered as described above.
  • Liposomes are spherical lipid bilayers with aqueous interiors. All molecules present in an aqueous solution at the time of liposome formation are incorporated into the aqueous interior. The liposomal contents are both protected from the external microenvironment and, because liposomes fuse with cell membranes, are efficiently delivered near the cell surface.
  • transfersomes, niosomes and liposomes in pharmaceutical uses are well established, and the person skilled in the art is readily in a position to prepare corresponding transfersomes, niosomes and liposomes comprising the herein defined peptides, nucleic acid molecules encoding the same or vectors comprising said nucleic acid molecules.
  • Methods are, inter alia, provided in M ⁇ ller/Hildebrand "Pharmazeutician Technologie: Moderne Arznei", WVG. Wiss Verlag, Stuttgart (1998); Gupta (2005), Int. J. Pharm. 293, 73-82; Torchilin (2005), Nat. Rev. Drug Discov. 4,145-160.
  • Nucleic acid molecules may also be administered to patients in need of treatment via transferosomes, liposomes and/or niosomes.
  • transferosomes liposomes and/or niosomes.
  • Corresponding preparation methods are known in the art, see, inter alia, Mahoto (2005), Adv. Drug Deliv. Rev. 57, 699- 712 or Kawakami (2004), Pharmazie. 59, 405-408.
  • Nanoparticles may be used as delivery systems for the peptides as defined herein and/or nucleic acid molecules encoding the same. Nanoparticles have been developed as an important strategy to deliver peptides and more recently nucleotides. Nanoparticles and other colloidal drug delivery systems modify the kinetics, body distribution and drug release of an associated drug. Corresponding technologies are, inter alia, described and referenced in Kayser (2005), Curr. Pharm. Biotechnol. 6(1), 3-5 or Moghimi (2005), FASEB J. 19, 311-330.
  • hydrogels may be employed.
  • Corresponding methods are provided and summarized in Pappas (2004), Expert Opin. Biol. Ther. 4,881-887.
  • Hydrogels are particularly useful in the transmucosal (mostly oral) administration/delivery of therapeutic proteins or peptides, as provided herein.
  • Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions.
  • non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate.
  • Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
  • Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils.
  • Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers (such as those based on Ringer's dextrose), and the like. Preservatives and other additives may also be present such as, for example, antimicrobials, anti-oxidants, chelating agents, and inert gases and the like.
  • the pharmaceutical composition described herein may comprise further agents depending on the intended use of the pharmaceutical composition. It will be appreciated by the person of ordinary skill in the art that the peptides/RS1 fragments described herein and the additional therapeutic agent may be formulated in one single dosage form, or may be present in separate dosage forms and may be either administered concomitantly (i.e. at the same time) or sequentially.
  • compositions comprising the peptides as defined herein may be in any form suitable for the intended method of administration.
  • compositions comprising the peptides as defined herein (or a salt thereof) may comprise carriers, vehicles, diluents, solvents such as monohydric alcohols such as ethanol, isopropanol and polyhydric alcohols such as glycols and edible oils such as soybean oil, coconut oil, olive oil, safflower oil cottonseed oil, oily esters such as ethyl oleate, isopropyl myristate; binders, adjuvants, solubilizers, thickening agents, stabilizers, disintergrants, glidants, lubricating agents, buffering agents, em ⁇ lsifiers, wetting agents, suspending agents, sweetening agents, colourants, flavours, coating agents, preservatives, antioxidants, processing agents, drug delivery modifiers and enhancers such as calcium phosphate, magnesium state, talc, monosaccharides, disaccharides, starch,
  • dosage regimen of the pharmaceutical compositions as defined herein will be determined by the attending physician and clinical factors. As is well known in the medical arts, dosages for any one patient depends upon many factors, including the patient's size, body surface area, age, the particular compound to be administered, sex, time and route of administration, general health, and other drugs being administered concurrently. Dosage forms for oral administration include tablets, capsules, lozenges, pills, wafers, granules, oral liquids such as syrups, suspensions, solutions, emulsions, powder for reconstitution.
  • Dosage forms for parentral administration include aqueous or olegeous solutions or emulsions for infusion, aqueous or olegeous solutions, suspensions or emulsions for injection pre-filled syringes, and/or powders for reconstitution.
  • Dosage forms for local/topical administration comprise rectal suppositories, insufflations, aerosols, metered aerosols, transdermal therapeutic systems and/o medicated patches.
  • the amount of peptides as defined herein (or a pharmaceutically acceptable salt thereof) that may be combined with the excipients to formulate a single dosage form will vary upon the host treated and the particular mode of administration.
  • compositions of the invention can be produced in a manner known per se to the skilled person as described, for example, in Remington's Pharmaceutical Sciences, 15 th Ed., Mack Publishing Co., New Jersey (1991).
  • a (therapeutically) effective dosage of the peptides/RS1 fragments as defined herein (or a pharmaceutically acceptable salt thereof) may be a concentration of said peptides of between 2x10 "9 M to 5 M, preferably between 2x10 "7 M to 3 M, more preferably between 2x10 "6 M to 1 M, more preferably between 2x10 "6 M to 0,5 M, more preferably between 2x10 "5 M to 0,1 M, more preferably between 20-30 mM, even more preferably between 2-10 mM and most preferably between 5-10 mM.
  • concentrations between 2-3 mM are envisaged in context of the present invention.
  • the (therapeutically) effective dosage of the peptides as defined herein (or a pharmaceutically acceptable salt thereof) is a concentration of said peptides between 5-10 mM, but also the afore-mentioned other concentrations can occur in the small intestine.
  • concentrations e.g. in vivo or ex vivo.
  • Samples may be from the small intestine by a duodenal probe and the peptide(s) as described herein may be detected and their corresponding concentrations may be determined in said given sample, for example by HPLC.
  • the determination of the peptide concentration may be obtained in human patients, healthy (human) individuals as well as in animals, like laboratory animals, non-human transgenic animals (e.g. transgenic mice, rats, pigs, and the like). It is envisaged that the determination of "peptide concentrations" in the gastro-intestinal tract, e. g., the gut duodenum, may for example be deduced in healthy volunteers and corresponding administration schemes for human patients/healthy humans may be established. For example, the gut passage time, the passage of the peptide in the gastro-intestinal tract, the dosage dependencies (e.g. oral dosage given versus dosage detected in various regions of the gastro-intestinal tract) may be determined by standard methods known in the art.
  • Further methods comprise, but are not limited to, the detection of labelled peptides in vivo (e.g. by corresponding labelling techniques, like radioactive labelling, fluorescent labelling, etc.) or physiological/biochemical assays. Accordingly, the dosage of peptides to be given orally in order to obtain a desired concentration of the herein described peptides in any part of the gastro-intestinal tract, like the gut duodenum, may be deduced. These and other methods to deduce such concentrations are well known in the art.
  • the extra cellular concentrations of the peptides as defined herein (or a pharmaceutically acceptable salt thereof) may rise up to 0,5, 1 , 2, 3, 4 or 5 M.
  • said concentrations may reach those high levels.
  • the transport capacity of the herein defined peptide-transporters is saturated at a concentration of the peptides as defined herein (or a pharmaceutically acceptable salt thereof) of about 100 mM.
  • the extra cellular concentration of said peptides is, e.g., at about 100 mM.
  • compositions e.g. compositions comprised in foods and beverages, food supplements, pharmaceutical compositions, and the like should comprise the peptides as defined herein in concentrations that in vivo an extracellular concentration of the peptides (e.g. in humans) be in the range of at least 0.5 mM, 1 mM, 2 mM, 3 mM, 4 mM and in particular at least 5 mM.
  • concentration in said corresponding compositions, e.g. compositions comprised in foods and beverages, food supplements, pharmaceutical compositions (e. g. in form of tablets), and the like may be in the range of 0.1 to 3 M.
  • a detected effect e.g. glucose uptake into mucosal cells (detected, e.g., by tracing radioactively marked glucose)
  • the preparation of food, feed, "functional food”, “food supplements” as well as “food additives” is provided. Therefore, the present invention is not limited to medical and/or pharmaceutical uses.
  • the invention also relates to the use of a regulatory protein RS 1 fragment as defined herein or a nucleic acid molecule encoding said regulatory protein RS 1 fragment for the preparation of food and/or food supplements, wherein said RS 1 fragment is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine-Cysteine-Proline) or derivatives thereof (e.g. like QSP, QPP or QTP) and/or 3 consecutive amino acids as comprised in the amino acid stretch SDSDRIEP or derivatives thereof.
  • Q-C-P Glutamine-Cysteine-Proline
  • derivatives thereof e.g. like QSP, QPP or QTP
  • the preparation of food "functional food”, “food supplements” as well as “food additives” is provided.
  • the food “functional food”, “food supplements” as well as “food additives” may be carbohydrate- and/or fat-rich and/or may have a high glycemic index.lt is also envisaged that the food “functional food”, “food supplements” as well as “food additives” is carbohydrate- and/or fat-low and/or has a low glycemic index.
  • the invention provides for "functional food” and/or “functional food supplements/additives” comprising the herein defined RS1 minimal peptides (or (a) combination(s) thereof).
  • the present invention i.e. the use of the "Q-C-P peptidesTRSI fragments" as defined herein, is particularly useful in the prevention of sugar-in/uptake (for example in/uptake of monosaccharides, like glucose, fructose) in cells.
  • the RS 1 fragments as described herein e. g. the "Q-C-P-tripeptide” and derivatives thereof, like Q-S-P, Q-T-P, Q-P-P, can be employed in the physiological (in vivo) inhibition of cellular uptake of monosaccharides (e. g. glucose, fructose).
  • the present invention is particular useful in food, feed and/or food supplements being carbohydrate-rich or -low and/or fat-rich or -low and/or having a high or low glycemic index, as well as useful for the prevention/inhibition of sugar-in/uptake during diets using said food, feed and/or food supplements. Therefore, the present invention is, inter alia, useful in food, feed and/or food supplements being carbohydrate-low and/or fat-low and/or having a low glycemic index or in diets comprising said food, feed and/or food supplements.
  • the RS 1 fragments as described herein are also to be employed in food, feed and/or food supplements being carbohydrate-rich and/or fat-rich and/or having a high glycemic index or in diets comprising said food, feed and/or food supplements.
  • the present invention may also be useful for normal food, feed and/or food supplements as well as for normal diets.
  • Bakery products such as cake, cookies, biscuits, doughnuts
  • Meat products such as sausages, meat balls, Hamburgers, meat pies;
  • Cereal products such as cake mixtures, muffin mixtures
  • Milk products such as yogurts, curd cheese mixtures, junkets, ice creams, cheeses, milkshakes;
  • Cacao- und chocolate products such as chocolate bars, chocolate coatings
  • Alcoholic beverage such as liqueur, non-alcoholic beverage such as soft drinks;
  • Confectionery such as jelly bears, marzipan, chewing gum, sugar syrup, sugar mass used for stuffing, candies, dessert powders; potato products such as French fries, chips; or fat und oil containing products such as mayonnaise, oleomargarine.
  • RS 1 fragments in fast food such as frozen foods, canned products or fried products.
  • the present invention also provides for dietetics, "novel food”, “functional food” (foods with components whose positive effects can be regarded as physiological or even healthy), dietary supplements and/or wellness products (products with beneficial effects) comprising the herein defined “Q-C-P peptidesTRSI fragments” and/or peptides derived from the additional minimal RS 1 stretch defined herein (SDSDRIEP peptide).
  • dietetics "novel food”, “functional food” (foods with components whose positive effects can be regarded as physiological or even healthy), dietary supplements and/or wellness products (products with beneficial effects) comprising the herein defined “Q-C-P peptidesTRSI fragments” and/or peptides derived from the additional minimal RS 1 stretch defined herein (SDSDRIEP peptide).
  • such "novel food”, “functional food”, dietary supplements and/or wellness products are in form of shakes, like, e. g. protein shakes.
  • such shakes may be carbohydrate-rich or -low and/or fat-rich or -low and/or may have a high or low glycemic index.
  • the herein defined "Q-C-P peptides"/"RS1 fragments” are comprised in "functional food", food products, food supplements and/or wellness products with low carbohydrate and low fat content or in corresponding products with low glycemic index.
  • Q-C-P peptidesVRSI fragments are comprised in "functional food", food products, food supplements and/or wellness products with high carbohydrate and high fat content or in corresponding products with high glycemic index.
  • the invention also provides for a method of preparation of food and/or food supplements/additives, comprising the step of admixing an RS 1 fragment/"Q-C-P peptide" as defined herein above, a nucleic acid molecule as defined herein below and encoding for a RS 1 fragment of the invention (comprising the Q-C-P motive or a herein defined derivative) and/or a vector comprising such a nucleic acid molecule with food basics and/or foodstuff.
  • Food basics and “foodstuff” are known in the art.
  • the terms "feed”, “foods”, “foodstuff” and/or “food basics” encompasses all eatable and drinkable food and drinks. Accordingly, the herein defined “Q-C-P- peptide” may be included in a food or drink. These may, for example be, gum, spray, beverage, candies, infant formula, ice cream, frozen dessert, sweet salad dressing, milk preparations, cheese, quark, lactose-free yogurt, acidified milk, coffee cream or whipped cream and the like.
  • Milk-based products are envisaged within the framework of the invention.
  • Milk is however understood to mean that of animal origin, such as cow, goat, sheep, buffalo, zebra, horse, donkey, or camel, and the like.
  • the milk may be in the native state, a reconstituted milk, a skimmed milk or a milk supplemented with compounds necessary for the growth of the bacteria or for the subsequent processing of fermented milk, such as fat, proteins of a yeast extract, peptone and/or a surfactant, for example.
  • milk also applies to what is commonly called vegetable milk, that is to say extracts of plant material which have been treated or otherwise, such as leguminous plants (soya bean, chick pea, lentil and the like) or oilseeds (colza, soya bean, sesame, cotton and the like), which extract contains proteins in solution or in colloidal suspension, which are coagulable by chemical action, by acid fermentation and/or by heat.
  • vegetable milk that is to say extracts of plant material which have been treated or otherwise, such as leguminous plants (soya bean, chick pea, lentil and the like) or oilseeds (colza, soya bean, sesame, cotton and the like), which extract contains proteins in solution or in colloidal suspension, which are coagulable by chemical action, by acid fermentation and/or by heat.
  • the food, drink or feed comprising the RS1 fragments as defined herein can be produced by a general method for producing foods and drinks or feeds, including adding the active ingredient to a raw or cooked material of the food, drink or feed.
  • the food, drink or feed in accordance with the present invention can be molded and granulated in the same manner as generally used for foods, drinks or feeds.
  • the molding and granulating method includes granulation methods such as fluid layer granulation, agitation granulation, extrusion granulation, rolling granulation, gas stream granulation, compaction molding granulation, cracking granulation, spray granulation, and injection granulation, coating methods such as pan coating, fluid layer coating, and dry coating, puff dry, excess steam method, foam mat method, expansion methods such as microwave incubation method, and extrusion methods with extrusion granulation machines and extruders.
  • granulation methods such as fluid layer granulation, agitation granulation, extrusion granulation, rolling granulation, gas stream granulation, compaction molding granulation, cracking granulation, spray granulation, and injection granulation
  • coating methods such as pan coating, fluid layer coating, and dry coating, puff dry, excess steam method, foam mat method, expansion methods such as microwave incubation method, and extrusion methods with extrusion granulation machines and extruders.
  • the food, drink or feed according to the present invention includes foods, drinks or feeds comprising the active ingredient, namely the RS 1 fragments as provided and described herein.
  • the food, drink or feed to be used in the present invention includes any food, drink or feed.
  • the concentration of the active ingredient, namely the RS1 peptide fragment as defined herein is preferably 0.001 to 100 % by weight, more preferably 0.01 to 50 % by weight, even more preferably 0.1 to 25 % by weight and most preferably 1 to 25 % by weight of the food, drink or feed comprising such active ingredient.
  • the concentration of the active ingredient, namely the RS 1 peptide fragment as defined herein may also be 5 % by weight of the food, drink or feed comprising such active ingredient.
  • a drink containing 100 ml with 5 g of the active ingredient, namely the RS 1 fragments as provided and described herein is employed in accordance with the present invention.
  • Specific foods or drinks include, for example, juices, refreshing drinks, shakes, like e. g. protein shakes, soups, teas, sour milk beverages, dairy products such as fermented milks, ices, butter, cheese, processed milk and skim milk, meat products such as ham, sausage, and hamburger, fish meat, cake products, egg products such as seasoned egg rolls and egg curd, confectioneries such as cookie, jelly, snacks, and chewing gum, breads, noodles, pickles, smoked products, dried fishes and seasonings.
  • the form of the food or drink includes, for example, powder foods, sheet-like foods, bottled foods, canned foods, retort foods, capsule foods, tablet foods and fluid foods.
  • the food or drink with the RS 1 fragments as provided and described herein may be also a food or drink, comprising e.g milk, chocolate, beer, vine, butter, cheese and the like.
  • the food or drink with the RS 1 fragments as provided and described herein may be also ingested by infants.
  • Such nutritious composition for infants includes modified milk prepared for infants, protein-decomposed milk, specific nutritionally modified milk or baby foods and foods prepared for toddlers.
  • the form of the nutritious composition for infants includes but is not specifically limited to powder milks dried and pulverized and baby foods and also include general foods such as ice cream, fermented milk, and jelly for infantile ingestion.
  • the nutritious composition in accordance with the present invention is principally composed of protein, lipid, saccharide, vitamins and/or minerals.
  • the active ingredient is blended with these components.
  • the protein includes milk proteins such as skim milk, casein, cheese whey, whey protein concentrate and whey protein isolates and their fractions such as alpha s - casein, beta-casein, alpha-lactoalbumin and beta-lactoglobulin.
  • egg protein such as egg yolk protein, egg white protein, and ovalbumin, or soybean protein such as defatted soybean protein, separated soybean protein, and concentrated soybean protein can be used.
  • proteins such as wheat gluten, fish meat protein, cattle meat protein and collagen may also be used satisfactorily.
  • fractions of these proteins, peptides from the acid or enzyme treatment thereof, or free no acids maybe used satisfactorily as well.
  • the free amino acids can serve as nitrogen sources and can additionally be used to give specific physiological actions.
  • Such free amino acids include, for example, taurine, arginine, cysteine, cysteine and glutamine.
  • the lipid includes animal fats and oils such as milk, fat, lard, beef fat and fish oil, vegetable oils such as soybean oil.
  • rapeseed oil corn oil, coconut oil, palm oil, palm kernel oil, safflower oil, perilla oil, linseed oil, evening primrose oil, medium chain fatty acid triglyceride, and cotton seed oil, bacterially generated fats and oils, and fractionated oils thereof, hydrogenated oils thereof, and ester exchange oils thereof.
  • the amount of lipid to be blended varies depending on the use.
  • the saccharide/sugars includes, for example, one or more of starch, soluble polysaccharides, dextrin, monosaccharides such as sucrose, lactose as described herein, maltose, glucose, and fructose and other oligosaccharides.
  • the total amount of such saccharide may be 10 to 80% by weight to the total solid in the nutritious composition.
  • artificial sweeteners such as aspartame may be used satisfactorily.
  • the amount of an artificial sweetener is appropriately 0.05 to 1.0% by weight per the total solid in the nutritious composition.
  • the vitamins include, but are not limited to, lycopene as an essential component and additionally include, for example, vitamins such as vitamin A, vitamin B group, vitamins C, D, and E and vitamin K group, folic acid, pantothenic acid, nicotinamide, carnitine, choline, inositol and biotin as long as such vitamins can be administered to infants.
  • vitamins are preferably from 10 mg to 5 g by weight per the total solid in the nutritious composition.
  • the minerals include calcium, magnesium, potassium, sodium, iron, copper, zinc, phosphorus, chlorine, manganese, selenium and iodine. Such minerals are preferably from 1 mg to 5 g by weight per the total solid in the nutritious composition.
  • the foods, drinks, nutritious composition for of the present invention may be blended with any component desirably blended in nutritious compositions, for example, dietary fiber, nucleotides, nucleic acids, flavors, and colorants.
  • the food or drink of the present invention can be used as a health food or drink or a functional food or drink to prevent and/or treat caries.
  • the amount to be ingested is not specifically limited.
  • the amount to be ingested is generally 0.1 to 50 g, preferably 0.5 g to 20 g daily, based on the total amount of active ingredient.
  • the food or drink is continuously ingested at this amount for a period from a single day up to 5 years, preferably from 2 weeks to one year.
  • the amount ingested can be adjusted to an appropriate range depending on the severity of the symptom of the individual ingesting the food or drink, the age and body weight thereof, and the like.
  • the feed of the present invention maybe any feed comprising the active ingredient.
  • the feed includes, for example, pet feed for dogs, cats and rats, cattle feed for cows and pigs, chicken feed for chicken and turkeys, and fish cultivation feed for porgy and yellowtail.
  • the food, feed and nutrients can be produced by appropriately blending the active ingredient of the present invention in a raw feed material including, for example, cereals, brans, oil-seed meals, animal-derived raw feed materials, other raw feed materials and purified products.
  • a raw feed material including, for example, cereals, brans, oil-seed meals, animal-derived raw feed materials, other raw feed materials and purified products.
  • the cereals include, for example, mile, wheat, barley, oats, rye, brown rice, buckwheat, fox-tail millet, Chinese millet, Deccan grass, corn, and soybean.
  • the brans include, far example, rice bran, defatted rice bran, bran, lowest-grade flour, wheat germ, barley bran, screening pellet, corn bran, and corn germ.
  • the oil-seed meals include, for example, soybean meal, soybean powder, linseed meal, cottonseed meal, peanut meal, safflower meal, coconut meal, palm meal, sesame meal, sunflower meal, rapeseed meal, kapok seed meal and mustard meal.
  • the animal-derived raw feed materials include, for example, fish powders, import meal, whole meal, and coast meal, fish soluble, meat powder, meat and bone powder, blood powder, decomposed hair, bone powder, byproducts from butchery, feather meal, silkworm pupa, skim milk, casein, dry whey and krill.
  • raw feed materials include, for example, plant stems and leaves such as alfalfa, hey cube, alfalfa leaf meal, and locust leaf powder, byproducts from corn processing industries, such as corn gluten meal, corn gluten feed and com steep liquor, starch, sugar, yeast, byproducts from fermentation industry such as beer residue, malt root, liquor residue and soy sauce residue, and agricultural byproducts such as citrus processed residue, soybean curd residue, coffee residue, and cocoa residue, cassava, horse bean, guar meal, seaweed, spirulina and chlorella.
  • corn processing industries such as corn gluten meal, corn gluten feed and com steep liquor, starch, sugar, yeast, byproducts from fermentation industry such as beer residue, malt root, liquor residue and soy sauce residue
  • agricultural byproducts such as citrus processed residue, soybean curd residue, coffee residue, and cocoa residue
  • cassava horse bean, guar meal, seaweed, spirulina and chlorella.
  • the purified products include, for example, proteins such as casein and albumin, amino acids, starch, cellulose, saccharides such as sucrose and glucose, minerals and vitamins, Furthermore, the present invention relates to an additive for food, drinks and feed, which, due to the presence of the RS1 fragment as defined herein, inter alia, capable of specifically modifying, inter alia, glucose and/or amino acid transport.
  • the additive for food can be produced by a general method for producing additives for food, drinks or feed.
  • additives for general use in food, drinks or feed for example, additives described in Food Additive Handbook (The Japan Food Additives Association; issued on January 6, 1997) may be added satisfactorily, including sweeteners, colorants, preservatives, thickeners and stabilizers, anti-oxidants, color fixing agents, bleaches, antiseptics, gum base, bitters, enzymes, brightening agents, acidifier, seasonings, emulsifiers, enhancers, agents for manufacture, flavors, and spice extracts.
  • conventional saccharides, starch, inorganic materials, plant powders, excipients, disintegrators, lubricants, binders, surfactants, and plasticizers mentioned previously for pharmaceutical tablets may be added satisfactorily.
  • the additives include the following additives.
  • the sweeteners include aspartame, licorice, stevia, xylose and rakanka (Momordica grosvenori fruit).
  • the colorants include carotenoid and turmeric oleoresin, flavonold, caramel color, spirulina color, chlorophyll, purple sweet potato color, purple yam color, perilla color, and blueberry color.
  • the preservatives include, for example, sodium sulfite, benzoates, benzoin extract, sorbates, and propionates.
  • the thickeners and stabilizers include, for example, gums such as gum arable and xanthan gum, alginates, chitin, chitosan, aloe extract, guar gum, hydroxypropyl cellulose, sodium casein, corn starch, carboxymethyl cellulose, gelatin, agar, dextrin, methyl cellulose, polyvinyl alcohol, microfiber cellulose, microcrystalline cellulose, seaweed cellulose, sodium polyacrylate, sodium polyphosphate, carrageenan or yeast cell wall.
  • the anti-oxidants include, for example, vitamin C group, sodium ethylenediaminetetraacetate, calcium ethylenediaminetetraacetate, erythorbic acid, oryzanol, catechin, quercetin, clove extract, enzyme-treated rutin, apple extract, sesame seed extract, dibutylhydroxytoluene, fennel extract, horseradish extract, water celery extract, tea extract, tocopherols, rapeseed extract, coffee bean extract, sunflower seed extract, ferulio acid, butylhydroxyanisole, blueberry leaf extract. propolis extract, pepper extract, garden balsam extract, gallic acid, eucalyptus extract, and rosemary extract.
  • the color fixing agents include, for example, sodium nitrite.
  • the bleaches include, for example, sodium sulfite.
  • the antiseptics include, for example, o-phenyl phenol.
  • the gum base includes, for example, acetylricinoleate methyl, urushi wax, ester gum, elemi resin, urucury wax, kaurigum, camaubawax, glycerin fatty acid ester, spermaceti wax, copaibabalsam, copal resin, rubber, rice bran wax, cane wax, shellac, jelutong, sucrose fatty acid ester, depolymerized natural rubber, paraffin wax, fir balsam, propylene glycol fatty acid ester, powdered pulp, powdered rice hulls, jojoba oil, polyisobutylene, polybutene, microcrystalline wax, mastic gum, bees wax and calcium phosphate.
  • the bitters include, for example, iso-alpha-bitter acid, caffeine, kawaratake (Coriolus versieolor) extract, redbark cinchona extract, Phellodendron bark extract, gentian root extract, spice extracts, enzymatically modified naringin, Jamaica cassia extract, theabromine, naringin, cassia extract, absinth extract, isodonis extract, olive tea, bitter orange (Citrus aurantium) extract, hop extract and wormwood extract.
  • the seasonings include, for example, amino acids such as asparagine, aspartic acid, glutamic acid, glutamine, alanine, isoleucine, glycine, serine, cystine, tyrosine, leucine, and praline, nucleic acids such as sodium inosinate, sodium uridinate, sodium guanylate, sodium cytidylate, calcium ribonucleotide and sodium ribonucleotide, organic acids such as citric acid and succinic acid, potassium chloride, sodium chloride-decreased brine, crude potassium chloride, whey salt, tripotassium phosphate, dipotassium hydrogen phosphate, potassium dihydrogen phosphate, disodium hydrogen phosphate, sodium dihydrogen phosphate, trisodium phosphate and chlorella extract.
  • amino acids such as asparagine, aspartic acid, glutamic acid, glutamine, alanine, isoleucine, glycine, se
  • microorganism express the "RS1 peptide(s) fragments" described herein and that these microorganism are employed in functional food and/or as pharmaceutical composition.
  • the probiotic microorganism expressing the RS 1 fragment described herein is useful for treating and/or preventing metabolic disorders and/or secondary disorders mentioned herein.
  • the amount of said probiotic microorganism is high enough to significantly positively modify the condition to be treated, preferably obesity, diabetes and the like, but low enough to avoid serious side effects (at a reasonable benefit/risk ratio), within the scope of sound medical judgment.
  • an effective amount of said probiotic microorganism will vary with the particular goal to be achieved, the age and physical condition of the patient being treated, the severity of the underlying disease, the duration of treatment, the nature of concurrent therapy and the specific microorganism employed.
  • a decided practical advantage is that the probiotic organism may be administered in a convenient manner such as by the oral route.
  • the active ingredients which comprise said probiotic organisms may be required to be coated in a material to protect said organisms from the action of enzymes, acids and other natural conditions which may inactivate said organisms.
  • they should be coated by, or administered with, a material to prevent inactivation.
  • probiotic organisms may be co-administered with enzyme inhibitors or in liposomes.
  • Enzyme inhibitors include pancreatic trypsin inhibitor, diisopropylfluorophosphate (DFP) and trasylol.
  • Liposomes include water-in-oil-in-water P40 emulsions as well as conventional and specifically designed liposomes which transport lactobacilli or their by-products to the urogenital surface.
  • Dispersions can also be prepared, for example, in glycerol, liquid polyethylene glycols, and mixtures thereof, and in oils.
  • dispersions are prepared by incorporating the various sterilized probiotic organisms into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
  • a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
  • the preferred methods of preparation are vacuum-drying and the freeze-drying technique which yield a powder of the active ingredient plus any additional desired ingredient from previously sterile- filtered solution thereof. Additional preferred methods of preparation include but are not limited to lyophilization and heat-drying.
  • the active compound may be orally administered, for example, with an inert diluent or with an assimilable edible carrier, or it may be enclosed in hard or soft shell gelatin capsule, or it may be compressed into tablets designed to pass through the stomach (i.e., enteric coated), or it may be incorporated directly with the food, drink or a diet, e. g. a diet described herein.
  • the probiotic organisms may be incorporated with excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like.
  • the probiotic organism is compounded for convenient and effective administration in effective amounts with a suitable pharmaceutically or food acceptable carrier in dosage unit form as disclosed herein.
  • organisms express the "RS 1 peptide(s) fragmentsTRSI fragments" described herein and that these organisms or parts thereof are employed as or for the preparation of food, feed, "functional food", “food supplements” as well as “food additives” and/or as or for the preparation of pharmaceutical compositions.
  • organisms to express the "RS 1 peptide(s) fragmentsTRSI fragments” described herein are plants, animals, algae or fungi.
  • said food, feed and/or food supplement as employed according to the present invention is carbohydrate-rich and/or fat-rich and/or has a high glycemic index.
  • the food, feed and/or food supplement as employed according to the present invention is carbohydrate-low and/or fat-low and/or has a low glycemic index, as discussed above.
  • the herein defined RS1 fragments, food, feed and/or food supplements comprising said fragments are employed during/as (special) diets, e. g. diets for patients in need of an amelioration, prevention and/or treatment of obesity.
  • the diets include, for example, carbohydrate-low diets, like sugar-low diets and/or starch-low diets, and/or fat-low diets and/or diets with a low glycemic index.
  • herein defined RS 1 fragments, food, feed and/or food supplements comprising said fragments are employed in, to support and/or accompany (special) diets.
  • the herein defined RS 1 fragments, food, feed and/or food supplements comprising said fragments are employed in a diet- supporting and/or diet-accompanying therapy/diet.
  • Said therapy/diet may be, for example, a therapy/diet supporting and/or accompanying specific diets of patients in need of said specific diets.
  • Said patients include, for example patients suffering from obesity, hypercholesterolemia, diabetes (like diabetes 2), hyperglycaemia, diarrhoea, a bile disorder, a renal disorder and/or a disorder related to the deposition of urate crystals in joints, soft tissue and/or the urinary tract.
  • the herein defined RS 1 fragments, food, feed and/or food supplements comprising said fragments are employed during carbohydrate-low diets and/or diets having a low glycemic index of diabetes 2 patients as a therapy/diet accompanying said carbohydrate-low diets and/or diets having a low glycemic index for the amelioration, prevention and/or treatment of obesity (Brand-Miller (2002) Am J Nutrition 76(suppl):281S-285S; Parillo and Riccardi (2004) Bitish Journal of Nutrition 92:7-19; Bjorck and Elmstahl (2003) Proceedings of Nutrition Society 62,201-206).
  • the sugars to be lowered or increased in the diets and food, feed and/or food supplement to be employed within the present invention are, e.g., glucose, galactose saccharose, lactose and/or maltose.
  • compositions e.g. the content of monosaccharides, disaccharides, digestable polysaccharides, protein and fat
  • carbohydrate-rich or -low, sugar-rich or -low, starch-rich or -low and fat-rich or -low diets and food, feed and/or food supplements, as well as diets and food, feed and/or food supplements having a high or low glycemic index are well known in the art.
  • such compositions are described in Bjorck and Elmstahl (2003) Proceedings of Nutrition Society 62,201-206 and Kennedy (2001) J. Am. Diet. Assoc. 101 (4):411-420.
  • An example of a carbohydrate- low diet/diet with low glycemic index is also shown in the experimental part.
  • Carbohydrate-low for example, means that less than 30% energy within the diet and food, feed and/or food supplement are due to carbohydrates.
  • a low glycemic index for example, is a glycemic index of less than 70.
  • the glycemic index is a ranking of carbohydrates based on their immediate effect on blood glucose (blood sugar) levels. It compares foods gram for gram of carbohydrate. Carbohydrates that breakdown quickly during digestion have the highest glycemic indexes. The blood glucose response is fast and high. Carbohydrates that break down slowly, releasing glucose gradually into the blood stream, have low glycemic indexes.
  • the glycemic index is a ranking of carbohydrates on a scale from 0 to 100 according to the extent to which they raise blood sugar levels after eating. Foods with a high Gl are those which are rapidly digested and absorbed and result in marked fluctuations in blood sugar levels. Low-GI foods, by virtue of their slow digestion and absorption, produce gradual rises in blood sugar and insulin levels, and have proven benefits for health. Low Gl diets have been shown to improve both glucose and lipid levels in people with diabetes (type 1 and type 2). They have benefits for weight control because they help control appetite and delay hunger. Low GI diets also reduce insulin levels and insulin resistance.
  • the area under the curve (AUC) is calculated to reflect the total rise in blood glucose levels after eating the test food.
  • the Gl rating (%) is calculated by dividing the AUC for the test food by the AUC for the reference food (same amount of glucose) and multiplying by 100.
  • the use of a standard food is essential for reducing the confounding influence of differences in the physical characteristics of the subjects.
  • the average of the Gl ratings from all ten subjects is published as the Gl of that food. Accordingly, the glycemic index can be easily determined by the person skilled in the art for any given food, feed and/or food supplements and the like.
  • Carbohydrate-rich for example, means that more than 55% of the energy within the diet and food, feed and/or food supplement is due to carbohydrates.
  • “Fat-rich” means, for example, that more than 35% of the energy within the diet and food, feed and/or food supplement is due to fat.
  • “Sugar-rich”, for example, means that the diet and the food, feed and/or food supplement contains more than 5% by weight monosaccharides plus disaccharides.
  • a high glycemic index for example, is a glycemic index of more than 90.
  • sugar for example, means all nutrition- relevant sugars and sugar derivatives. These sugars and sugar derivatives are well known in the art. As mentioned before, it is exemplarily envisaged that glucose, galactose, saccharose, lactose and/or maltose are to be employed in accordance with the present invention. Fructose and/or mannose may also be employed.
  • the RS 1 fragment as defined herein is preferably a fragment derived from a polypeptide selected from the group consisting of:
  • a polypeptide encoded by a nucleic acid molecule being at least 55% homologous to a nucleic acid molecule as shown in SEQ ID NO: 1 , 3, 5, 7 and encoding at least the amino acid stretch Q-C-P, Q-S-P, Q-P-P or Q-T-P;
  • said peptide is an RS 1 fragment, preferably comprising the Q-C-P motive, is derived from a polypeptide selected from the group consisting of the human RS1 (hRS1), Ace. No. NM_006511 or X82877; the porcine RS1 , Ace. No. NM_213793 or X64315; the mouse RS1, Ace. No. Y11917 and the rabbit RS1 , Ace. No. X82876.
  • said QCP motive is from amino acid position 410 to 412
  • the SDSDRIEP motive as mentioned herein is from amino acid position 43 to 50
  • the QSP motive as mentioned herein is apparent in the hRS1 two times, namely from amino acid positions 19-21 and 91-93
  • the QPP motive as mentioned herein is from amino acid position 311-313 (e. g., see, SEQ ID No. 2).
  • the inventive "Q-C-P peptide" to be employed in accordance with this invention comprises the Q-C-P motive and additional (e.g. neighbouring) amino acid residues as comprised in the herein defined natural RS 1 polypeptides.
  • the maximal length of an "Q-C-P peptide" as defined herein is about 150, preferably of at most 120 amino acids. Most preferred are, however, short peptides, comprising 13, 12, 11 , 10, 9, 8, 6 and most preferably 3 amino acid residues.
  • the RS 1 fragments as defined herein may be attached to further amino acids, heterologous peptides and/or heterologous proteins. Said further amino acids, heterologous peptides and/or heterologous proteins may comprise, derived from and/or consisting of domains having additional functionalities, like, e. g. further pharmacological effects or specific tags for facilitating purification.
  • the RS 1 fragments as defined herein may also be part of fusion polypeptides or fusion proteins.
  • said fusion polypeptides or fusion proteins comprising the RS 1 fragments as defined herein may also comprise more than 150 amino acids.
  • RS1 minimal fragments to be employed in accordance with this invention are Q-N-E-Q-C-P-Q-V-S-F, preferably Q-N-E-Q-C-P- Q-V-S, more preferably Q-N-E-Q-C-P or Q-C-P-Q-V-S and most preferably Q-C-P.
  • the nucleic acid molecule encoding the herein defined "Q-C-P peptideTRSI fragments" may be any type of nucleic acid, e.g. DNA, RNA or PNA (peptide nucleic acid).
  • a peptide nucleic acid is a polyamide type of DNA analog and the monomeric units for adenine, guanine, thymine and cytosine are available commercially (Perceptive Biosystems).
  • the DNA may, for example, be cDNA. In a preferred embodiment it is a fragment of genomic DNA encoding the herein defined RS1 fragment.
  • the RNA may be, e.g., mRNA.
  • the nucleic acid molecule may be natural, synthetic or semisynthetic or it may be a derivative, such as peptide nucleic acid (Nielsen (1991), Science 254, 1497-1500) or phosphorothioates.
  • the nucleic acid molecule may be a recombinantly produced chimeric nucleic acid molecule comprising any of the aforementioned nucleic acid molecules either alone or in combination.
  • the nucleic acid molecule(s) encoding the "RS 1 fragment” as defined herein is part of a vector. Therefore, the present invention relates in another embodiment of the use, method and means to a vector comprising the nucleic acid molecule encoding the "RS 1 fragment" as defined herein.
  • a vector may be, e.g., a plasmid, cosmid, virus, bacteriophage or another vector used, e.g. conventionally in genetic engineering, and may comprise further genes such as marker genes which allow for the selection of said vector in a suitable host cell and under suitable conditions.
  • the nucleic acid molecules encoding the "RS 1 fragment" as defined herein may be inserted into several commercially available vectors.
  • Nonlimiting examples include plasmid vectors compatible with mammalian cells, such as pUC, pBluescript (Stratagene), pET (Novagen), pREP (Invitrogen), pCRTopo (Invitrogen), pcDNA3 (Invitrogen), pCEP4 (Invitrogen), pMC1 neo (Stratagene), pXT1 (Stratagene), pSG5 (Stratagene), EBO-pSV2neo, pBPV-1, pdBPVMMTneo, pRSVgpt, pRSVneo, pSV2- dhfr, pUCTag, plZD35, pLXIN and pSIR (Clontech) and plRES-EGFP (Clontech).
  • Baculovirus vectors such as pBlueBac, BacPacz Baculovirus Expression System (CLONTECH), and MaxBacTM Baculovirus Expression System, insect cells and protocols (Invitrogen) are available commercially and may also be used to produce high yields of biologically active protein, (see also, Miller (1993), Curr. Op. Genet. Dev. 3, 9 ; O'Reilly, Baculovirus Expression Vectors: A Laboratory Manual, p. 127).
  • prokaryotic vectors such as pcDNA2; and yeast vectors such as pYes2 are nonlimiting examples of other vectors suitable for use with the present invention.
  • Vectors can contain one or more replication and inheritance systems for cloning or expression, one or more markers for selection in the host, e.g., antibiotic resistance, and one or more expression cassettes.
  • the coding sequences inserted in the vector can be synthesized by standard methods, isolated from natural sources, or prepared as hybrids. Ligation of the coding sequences to transcriptional regulatory elements (e.g., promoters, enhancers, and/or insulators) and/or to other amino acid encoding sequences can be carried out using established methods.
  • transcriptional regulatory elements e.g., promoters, enhancers, and/or insulators
  • the vectors may, in addition to the nucleic acid sequences encoding for the "RS 1 fragment" defined herein, comprise expression control elements, allowing proper expression of the coding regions in suitable hosts.
  • control elements are known to the artisan and may include a promoter, translation initiation codon, translation and insertion site or internal ribosomal entry sites (IRES) (Owens (2001), Proc. Natl. Acad. Sd. USA 98, 1471-1476) for introducing an insert into the vector.
  • the nucleic acid molecule encoding for the "Q-C-P peptide" defined herein is operatively linked to said expression control sequences allowing expression in eukaryotic or prokaryotic cells.
  • Control elements ensuring expression in eukaryotic and prokaryotic cells are well known to those skilled in the art. As mentioned above, they usually comprise regulatory sequences ensuring initiation of transcription and optionally poly-A signals ensuring termination of transcription and stabilization of the transcript. Additional regulatory elements may include transcriptional as well as translational enhancers, and/or naturally-associated or heterologous promoter regions. Possible regulatory elements permitting expression in for example mammalian host cells comprise the CMV-HSV thymidine kinase promoter, SV40, RSV-promoter (Rous sarcome virus), human elongation factor 1 ⁇ -promoter, CMV enhancer, CaM-kinase promoter or SV40-enhancer.
  • promoters including, for example, the tac-lac-promoter, the lacUV ⁇ or the trp promoter.
  • Beside elements which are responsible for the initiation of transcription such regulatory elements may also comprise transcription termination signals, such as SV40-poly-A site or the tk-poly-A site, downstream of the polynucleotide.
  • suitable expression vectors are known in the art such as Okayama-Berg cDNA expression vector pcDV1 (Pharmacia), pRc/CMV, pcDNAI , pcDNA3 (In- Vitrogene, as used, inter alia in the appended examples), pSPORTI (GIBCO BRL) or pGEMHE (Promega), or prokaryotic expression vectors, such as lambda gt11.
  • An expression vector according to this invention is at least capable of directing the replication, and preferably the expression, of the nucleic acids and protein of this invention.
  • Suitable origins of replication include, for example, the CoI E1 , the SV40 viral and the M 13 origins of replication.
  • Suitable promoters include, for example, the cytomegalovirus (CMV) promoter, the lacZ promoter, the gal 10 promoter and the Autographa californica multiple nuclear polyhedrosis virus (AcMNPV) polyhedral promoter.
  • Suitable termination sequences include, for example, the bovine growth hormone, SV40, IacZ and AcMNPV polyhedral polyadenylation signals.
  • Specifically- designed vectors allow the shuttling of DNA between different host cells, such as bacteria-yeast, or bacteria-animal cells, or bacteria-fungal cells, or bacteria or invertebrate cells.
  • Q-C-P peptide in prokaryotic cells may be particularly useful in the preparation of pharmaceutical compositions or food additives defined herein. It is, e.g. envisaged that bacterial hosts are employed which are capable of expressing a "Q-C-P peptide" as defined herein. It is also envisaged that these bacteria are administered and/or given to humans in form of pharmaceutical compositions and/or food-additives; e.g. as "probiotic food-additives”.
  • the vector may further comprise nucleic acid sequences encoding secretion signals.
  • nucleic acid sequences are well known to the person skilled in the art.
  • leader sequences capable of directing the expressed polypeptide to a cellular compartment may be added to the coding sequence of the nucleic acid molecules of the invention and are well known in the art.
  • the leader sequence(s) is (are) assembled in appropriate phase with translation, initiation and termination sequences, and preferably, a leader sequence capable of directing secretion of translated protein, or a part thereof, into, inter alia, the extracellular membrane.
  • the heterologous sequence can encode a fusion protein including an C- or N-terminal identification peptide imparting desired characteristics, e.g., stabilization or simplified purification of expressed recombinant product.
  • the vector Once the vector has been incorporated into the appropriate host, the host is maintained under conditions suitable for high level expression of the nucleotide sequences, and, as desired, the collection and purification of the proteins, antigenic fragments or fusion proteins of the invention may follow.
  • the vector can also comprise regulatory regions from pathogenic organisms.
  • the invention also provides for a method of preparation of a pharmaceutical composition for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a pathological modification of homeostasis, comprising the step of admixing an RS 1 fragment/"Q-C-P peptide" as described herein, a nucleic acid molecule encoding the same and/or a vector comprising said nucleic acid molecule with a pharmaceutically acceptable carrier.
  • Corresponding carrier are illustratively mentioned above.
  • the metabolic disease or secondary disorder to be treated and/or ameliorated or even prevented within this embodiment is preferably obesity, hypercholesterolemia, diabetes, hyperglycaemia, diarrhoea, a bile disorder, a renal disorder and/or a disorder related to the deposition of sodium urate crystals in joints, soft tissue and/or the urinary tract.
  • metabolic diseases or secondary disorders as given in the corresponding embodiments herein above, apply here, mutatis mutandis.
  • Also provided in context of this invention is a method of screening for a receptor, transporter and/or channel that (specifically) interacts with an RS1 fragment as defined herein, comprising the steps of: (a) introducing said RS 1 fragment into a system allowing for a candidate receptor, transporter and/or channel to be active, under conditions which allow said RS 1 fragment to be active/interact with said candidate receptor, transporter and/or channel, and
  • the RS 1 fragment as defined herein may be introduced into a system in which the candidate receptor, transporter and/or channel is expressed or overexpressed. Also envisaged is the introduction of the RS 1 fragment into a system where the expression of endogeneous RS 1 protein is suppressed. It is furthermore envisaged that the RS 1 fragment ("Q-C-P peptide" or derivatives thereof as described herein) is introduced into a system in which the candidate receptor, transporter and/or channel is overexpressed together with a transporter that mediates uptake of said RS 1 fragment.
  • said candidate receptor, transporter and/or channel may be a peptide transporter (e. g. PEPT1 or PEPT2).
  • said system allows additionally for a peptide transporter (preferably PEPT1 or PEPT2), to be active within said system.
  • a method of screening for a target and/or an interacting partner of an RS 1 fragment as defined in the present invention comprising the steps of:
  • the RS 1 fragments (or derivatives thereof) to be tested in this embodiment may also be able to inhibit the expressed activity of all the receptors, transporters and/or channels mentioned herein above, preferably of SGLT1.
  • the system to be employed in the above recited screening system may be a human cell line, e. g. a cell line derived of kidney or gut, which expresses one or more of said proton-peptide cotransporters, optionally together with one ore more of the above discussed receptors, transporters and/or channels.
  • a human cell line e. g. a cell line derived of kidney or gut
  • the affinity of the candidate RS1 fragments or derivatives to be screened to the proton-peptide cotransporters can be evaluated, optionally together with the impact, said candidate RS1 fragments or derivatives may have on the coexpressed receptors, transporters and/or channels.
  • human cell lines from kidney or gut are used as screening systems.
  • Said cell lines may coexpress the human PEPT1 and PEPT2 together with the human SGLT1.
  • the uptake and impact of candidate RS1 fragments or derivatives, added outside to the system may evaluated by measuring the sodium-dependent transport of glucose via an uptake of radioactively labelled ⁇ -methyl-D-glucoside (AMG).
  • AMG radioactively labelled ⁇ -methyl-D-glucoside
  • Said SGLT1 may be a SGLT1 variant that can be easily localised in the plasma membrane and can be detected by a cell-sorting apparatus.
  • such SGLT1 variant may be a SGLT1 protein coupled with a fluorescent dye.
  • oocytes in particularly Xenopus oocytes
  • said oocytes are capable of heterologously expressing proteins, in particularly receptors, transporters and/or channels as defined herein.
  • oocytes in particularly Xenopus oocytes
  • said oocytes are capable of heterologously expressing proteins, in particularly receptors, transporters and/or channels as defined herein.
  • RS 1 minimal peptides described herein. Accordingly, specific interaction and/or functional partners may be deduced, validated and/or characterized. It is, e.g.
  • a potential candidate "interaction partner” in a homologous or heterologous system (like in the oocyte system described and used in the experimental part, or in human test cells, like cells derived from gut or kidneys) and to contact said interaction partner with a "Q-C-P- peptide" as described herein.
  • Activity of the potential interaction partner may be measured and evaluated by methods provided in the appended examples, e.g. the transport rate of the peptide itself or e.g. glucose or amino acid residue uptake can be measured. It is also envisaged that the expression rate of the potential candidate molecule be assessed. Again, experimental and exemplifying details are given herein below.
  • Subconfluent LLC-PK1 cells grown on cover slips. Cells were incubated for 1 min (b, e) or for 5 min (c, f) with 2 ⁇ g/ml Brefeldin A (BRE). Cell metabolism was stopped by transfer of the cells on ice and superfusion with cold washing buffer. After paraformaldehyde fixation and permeabilization, control cells (a, d) or cells incubated with Brefeldin A (b,c,e,f) were immunostained with an affinity purified antibody against SGLT1 (a-c) or with an affinity purified antibody against RS 1 (d-f). lmmunstaining was visualized using secondary antibody directed against rabbit IgG that was coupled to AlexaFluor 555. Bar 1 ⁇ m.
  • FIG. 2 Inhibition of hSGLTI expressed T 14 ClAMG uptake by injection of purified hRS1 protein in the absence and presence of botulinustoxin B.
  • Oocytes were injected with 2.5 ng SGLT1-cRNA and incubated for 3 days.
  • 50 nl of KOri buffer, KOri buffer plus 5 ng of purified hRS1 , KOri buffer containing 1.7 ng botulinum toxin B (BTXB), or KOri buffer plus 5 ng of purified hRS1 and 1.7 ng BTXB were injected. After 30 min incubation at room temperature, uptake of 50 ⁇ M [ 14 C]AMG was measured. Mean values of 7-10 oocytes + standard deviations of the mean are shown. *P ⁇ 0.05 for effect of hRS1 protein on AMG uptake. One typical experiment out of 3 independent experiments is shown.
  • Figure 3 Identification of a domain in the middle part of hRS1 that inhibits glucose uptake expressed by hSGLTI .
  • Oocytes were injected with 2.5 ng SGLT1-cRNA alone (amino acids 1 to 617, control), with 2.5 ng SGLT1-cRNA plus 7.5 ng hRS1-cRNA, or with 2.5 ng SGLT1-cRNA plus 7.5 ng cRNAs encoding the indicated fragments of hRS1 (numbering see Lambotte (1996), DNA Cell Biol., 15, 769-777.).
  • uptake of 50 ⁇ M [ 14 C]AMG was measured.
  • [ 14 C]AMG uptake in non-injected oocytes was always less than 5% compared to the uptake observed after injection of SGLTI-cRNA.
  • FIG. 4 Inhibition of hSGLTI expressed glucose transport activity in oocytes by injection of tripeptide QCP derived from hRS1. Oocytes were injected with 2.5 ng SGLT1-cRNA, incubated for 3 days, and the uptake of 50 ⁇ M [ 14 C]AMG was measured (control). In some experiments 50 nl KOri buffer per oocyte containing 1.5 mM of the indicated peptides were injected 30 min before the uptake measurements were started. A representative experiment out of four experiments is shown. Mean of 7-10 oocytes and standard deviations of the means are shown. *P ⁇ 0.05 for difference to control.
  • FIG. 5 High affinity inhibition of hSGLTI expressed glucose transport by QCP.
  • Oocytes were injected with 2.5 ng SGLT1-cRNA, incubated for 3 days and 50 nl of KOri buffer (control) or 50 nl of KOri buffer containing the indicated peptide concentrations were injected. After 30 min uptake of 50 ⁇ M [ 14 C]AMG was measured. For each concentration of injected peptide 3-7 individual experiments with 7-10 non-injected control oocytes and 7-10 peptide-injected oocytes were perfomed. [ 14 C]AMG uptake is presented as percentage of uptake observed in control oocytes that were injected with buffer. Mean and standard deviations of the means of these experiments are presented. The numbers of independent experiments are indicated in brackets. * P ⁇ 0.05, * *P ⁇ 0.01 for difference between buffer-injected oocytes and oocytes injected with peptide.
  • Oocytes were injected with 30 ng hPEP1-cRNA and incubated for 3 days in Ori buffer.
  • oocytes were superfused with acid Ori buffer (pH 6.5), clamped to -40 mV, and superfused with acid Ori buffer, acid Ori buffer containing 5 mM of the control peptide GQ or 5 mM of QCP. With both peptides significant inward currents were induced.
  • Figure 7 Inhibition of expressed glucose transport in oocytes expressing hPEPTI by addition of QCP to the medium.
  • Non-injected oocytes and oocytes injected with 2.5 ng hSGLTI cRNA plus 10 ng hPEPTI cRNA were incubated for 3 days in Ori buffer (pH.7.5).
  • the oocytes were incubated for 30 min with acid Ori buffer (pH 6.5), with acid Ori buffer containing 3 mM QCP, or with acid Ori buffer containing 5 mM PCQ. After washing with Ori buffer (pH 7.5), uptake of 50 ⁇ M [ 14 C]AMG was measured. A representative experiment out of 3 is indicated. ** P ⁇ 0.01 for difference to oocytes expressing hSSLTI plus PEPT1.
  • Figure 8 Time course of inhibition of hSGLTI expressed AMG uptake in oocytes after injection of 1 mM QCP.
  • Oocytes were injected with 2.5 ng hSGLTI -cRNA, incubated for 3 days and 50 nl of KOri buffer (control) or 50 nl of KOri buffer containing 3 mM QCP. After the indicated time periods uptake of 50 ⁇ M [ 14 C]AMG was measured. For each time point [ 14 C]AMG uptake was measured in 7-10 oocytes injected with buffer and in 7-10 oocytes injected QCP. For each time point mean values + standard deviations of the means were calculated considering the propagation of error. An exponential decay curve is fitted to the data.
  • Oocytes were injected with 2.5 ng SGLT1-cRNA and incubated for 3 days.
  • 50 nl of KOri buffer control for SGLT1 mediated AMG uptake in the absence of botulinum toxin B
  • 50 nl of KOri buffer containing 1.7 ng BTXB control for SGLT mediated AMG uptake in the presence of BTXB
  • 50 nl KOri buffer plus 50 nM PCQ or 50 nl KOri buffer plus 1.7 ng BTXB and either 50 nM or 1.5 mM QCP.
  • Figure 10 Identification of a domain in the N-terminal part of hRS1 that inhibits glucose uptake expressed by hSGLTI .
  • hSGLTI alone (control)
  • hSGLTI plus hRS1 amino acids 1-617
  • hSGLTI plus fragments of hRS1 encoding the indicated amino acids of hRS1 were expressed by injection of the respective cRNAs. The experiment was performed and is presented as in Fig. 3.
  • Figure 11 Inhibition of hSGLTI expressed glucose transport activity by intracellular injection of a unodecapeptide or a octapeptide derived from the N-terminal part hRS1.
  • Oocytes expressing hSGLTI were injected with 50 nl KOri buffer containing 3 mM of the tripeptide QCP, 3 mM the unodecapeptide IKPSDSDRIEP, 3 mM of the octapeptide SDSDRIEP, 3 mM QCP plus 3 mM IKPSDSDRIEP, or 3 mM of the reverse tripeptide plus 3 mM of the reverse unodecapeptide.
  • Experiment was performed and is presented as in Fig. 4.
  • Oocytes expressing rbSGLTI were injected with 50 nl containing 3 mM QCP or 3 mM IKPSDSDRIEP or 3 mM QCP plus 3 mM IKPSDSDRIEP or 3 mM of the reverse tripeptide plus 3 mM of the reverse unodecapeptide.
  • the experiment was performed and is presented as in Fig. 4.
  • FIG. 13 Inhibition of SGLT1 in human epithelial cells by QCP.
  • SGLT1 mediated uptake was measured in the absence (-) or precence (QCP) of QCP by subtracting the uptake in the presence of phlorizin from the uptake without phlorizin. Mean values with standard deviation of 5 meaurements are indicated. * indicates PO.05 for difference, calculated by Student ' s t-test.
  • Figure 14 Glucose dependence of inhibition of SGLT1 mediated AMG uptake by QCP.
  • Figure 15 Inhibition of hSGLTI expressed glucose transport activity in oocytes by QCP and QCP derived tripeptides.
  • cDNAs of hRS1 fragments were cloned using the overlap-extension method as described earlier (Gorboulev (1999), MoI. Pharmacol., 56, 1254-1261; Lambotte (1996), DNA Cell Biol., 15, 769-777).
  • cRNAs of hRS1 and of hRS1 fragments were synthesized in vitro as described (Veyhl (2003), J. Membrane Biol., 196, 71-81) .
  • hSGLTI human SGLT1
  • rbSGLTI rabbit SGLT1
  • hPEPTI human PEPT1
  • co-expression of hSGLTI or rbSGLTI with hRS1 or hRS1 fragments were performed as described earlier (Veyhl (2003), J. Membrane Biol., 196, 71-81).
  • cRNAs of hSGLT or rbSGLTI 2.5 ng per oocyte
  • cRNA of hRS1 or of hRSt fragments 7.5 ng per oocyte
  • the oocytes were incubated for three days at 16 0 C in ORi buffer (in mM: 5 HEPES-Tris, pH 7.4, 100 NaCI, 3 KCI, 2 CaCI 2 , and 1 MgCI 2 ). Then, the uptake of [ 14 C]AMG expressed by hSGLTI was measured at pH 7.4 as described (Veyhl (2003), J. Membrane Biol., 196, 71-81). Transport by expressed hPEPTI was measured using the two-electrode voltage clamp technique (Veyhl (2003), J. Membrane Biol., 196, 71-81).
  • the oocytes were superfused with Ori buffer titrated to pH 6.5, the membrane potential of the oocytes was clamped to -40 mV, and inward current induced by superfusion with Ori buffer (pH 6.5) containing 5 mM of a control dipeptide or 5 mM of the tested tripeptide was measured.
  • Oocytes were injected with cRNA of hRS1 containing six histidine residues at the C-terminus. 3 days after expression, oocytes were homogenized and the nuclei and lipids removed by differential centrifugation as described (Valentin (2000), Biochim. Biophys. Acta, 1468, 367-380). Then, hRS1 was affinity- purified on nickel(ll)-charged nitrilotriacetic acid-agarose from QIAGEN GmbH (Hilden, Germany) as described (Valentin (2000), Biochim. Biophys. Acta, 1468, 367-380). Purified hRS1 was dialysed against KOri buffer (in mM: 5 HEPES-Tris, pH 7.4, 100 KCI, 3 NaCI, 2 CaCI 2 , and 1 MgCI 2 ) .
  • KOri buffer in mM: 5 HEPES-Tris, pH 7.4, 100 KCI, 3 NaCI, 2 CaCI 2 , and 1 M
  • Oocytes were injected with hSGLTI cRNA (2.5 ng per oocyte) and incubated for 3 days in ORi buffer (16 0 C). Thereafter, the ocytes were injected with 50 nl/oocyte of KOri buffer plus hRS1 protein or various concentrations of peptides derived from hRS1. Oocytes were incubated for 30 min or longer time periods at room temperature and uptake of [ 14 C]AMG was measured.
  • oocytes were injected with SGLT1 cRNA (2.5 ng per oocyte) or with hSGLTI cRNA (2.5 ng per oocyte) plus hPEPTI cRNA (10 ng per oocyte) and the oocytes were incubated 3 days for expression. Thereafter the oocytes were incubated 30 min with Ori buffer adjusted to pH 6.5 or with Ori buffer adjusted to pH 6.5 containing 3 mM of the tested tripeptide. Thereafter oocytes were washed with Ori buffer (pH 7.4) and uptake of [ 14 C]AMG was measured.
  • Ori buffer pH 7.4
  • Uptake measurements were performed as described (Veyhl (2003), J. Membrane Biol., 196, 71-81). Oocytes were incubated for 15 min at room temperature in ORi buffer containing 50 ⁇ M [ 14 C]AMG without or with 100 ⁇ M of the SGLT1 inhibitor phlorizin. The uptake was blocked and oocytes were washed with ice cold Ori buffer containing 100 ⁇ M phlorizin. Radioactivity in the oocytes was measured by liquid scintillation counting. Uptake measurements were performed in 7 to 10 individual oocytes and mean values + standard deviations of the means are indicated. Experiments were performed in triplicates or more often. Statistical significance of AMG uptake after coinjection of hRS1 derived cRNAs or after injection of hRS1 derived peptides was determined by Anova test and post hoc Tukey comparison.
  • LLC-PKi cells were grown on coverslips to about 50% confluence. The cells were washed twice with washing buffer (5 mM 3-(N- morpholino)propanesulfonic acid-NaOH, pH 7.4, 100 mM NaCI, 3 mM KCI, 2 mM CaCI 2 , and 1 mM MgCI 2 ), fixed for 12 min with 4% (w/v) paraformaldehyde diluted in washing buffer, and washed twice again. Free aldehyde groups were quenched by 10 min incubation with washing buffer containing 40 mM glycine.
  • washing buffer 5 mM 3-(N- morpholino)propanesulfonic acid-NaOH, pH 7.4, 100 mM NaCI, 3 mM KCI, 2 mM CaCI 2 , and 1 mM MgCI 2 .
  • washed cells were permeabilized by a 10-min incubation with washing buffer containing 0.25% (w/v) TritonX-114, and incubated over night at 4 0 C with primary antibodies diluted in washing buffer.
  • the dilutions of primary antibodies were as follows: rabbit-anti-RS1-Ab 1 :50 (Valentin (2000), Biochim. Biophys. Acta, 1468, 367-380); QIS30 directed against SGLT1 1 :400 (Kipp (2003), Am. J. Physiol., 285, C737-C749), sheep- anti-TGN46 1 :125 (from Diagnostic International, Schriesheim, Germany).
  • the specificity of the antibodies was controlled as follows. The immunoreaction with affinity purified pRS1-ab was abolished after preabsorption with the antigen by incubating pRS1-ab for 60 min at 37 0 C with 0.1 mg/ml of recombinant pRS1 protein. No antibody reaction with secondary antibodies was observed when the incubation with primary antibodies was omitted. In controls, no cross-reactivity of the used secondary antibodies with false primary antibodies used in the same experiment was detected.
  • RS1 is a brefeldin A-sens ⁇ tive coat protein at the TGN.
  • brefeldin A The most striking effects of brefeldin A are the release of various coat proteins from the Golgi apparatus and morphological changes of intracellular tubulovesicular compartments that reflect changes in membrane traffic pathways.
  • Targets of brefeldin A are guanosine nucleotide exchange factors (GEFs) that catalyse the conversion of inactive (ARF-GDP) into active ADP-ribosylation factors (ARF-GTP) (Helms JB and Rothman JE (1992) Nature 360, 352-354; Jackson CL and Casanova JE (2000) Cell Biology 10, 60-67).
  • GEFs guanosine nucleotide exchange factors
  • ARFs are Ras-like GTPases that are central to many vesicular transport processes in eucraryotic cells.
  • RS1 belongs to the group of ARF dependent coat proteins at the TGN
  • subconfluent LLC-PKi cells were incubated for various time periods with 2 ⁇ g/ml BFA and immunostaining for SGLT1 and RS1 was performed (Fig. 1). After 1 min or 5 min incubation of subconfluent LLC-PKi cells with brefeldin A distinct morphology changes of the tubulovesicluar compartments with SGLT1 immunoreactivity were observed.
  • Oocytes were injected with hSGLT1-cRNA and incubated for three days for expression. Then, 50 nl of KOri buffer was injected without addition, with 1.7 ng botulinustoxin B (BTXB), with 5 ng purified hRS1 protein, or with 5 ng of purified hRS1 plus 1.7 ng of BTXB. After 30 min incubation at room temperature uptake of 50 ⁇ M [ 14 C]AMG was measured (Fig. 2). In the absence of butolinustoxin, hRS1 inhibited hSGLTI expressed AMG uptake by 50 %. Under the employed experimental conditions the concentration of injected BTXB inhibited the expression of AMG uptake also by about 50%.
  • BTXB botulinustoxin B
  • Example 4 A cRNA fragment from the middle part of hRS1 encoding the amino acids QNEQCPQVS exhibits post-transcriptional inhibition of hSGLTI mediated glucose uptake.
  • Non-injected oocytes, oocytes injected with hSGLTI -cRNA, oocytes injected with hSGLT1-cRNA plus hRS1-cRNA, or oocytes injected with hSGLT1-cRNA plus cRNAs encoding fragments of hRS1 were incubated for three days and the uptake of 50 ⁇ M [ 14 C]AMG was measured (Fig. 3).
  • the uptake expressed by hSGLTI was significantly inhibited by 50- 70 % if hRS1 or fragments of hRS1 were co-expressed with hSGLTI .
  • Inhibition was obtained by a N-terminal and C-terminal cRNA fragments that overlap by 27 nucleotides (positions 1366-1392, see data bank accession no. X82877; Lambotte S et al., (1996) DNA Cell Biol. 15, 769-777). These nucleotides encode the amino acids QNEQCPQVS. Inhibition of [ 14 C]AMG uptake expressed by hSGLTI was also observed when a cRNA containing this overlapping part was co-expressed (nucleotides 1366-1392 of hRS1 expressing amino acids 407- 415) with hSGLTI . The data indicate that glucose transport expressed by hSGLTI is inhibited by a 27-nucleotide long cRNA fragment of hRS1 encoding the nonapeptide QNEQCPQVS.
  • Example 5 Expression of hSGLTI mediated glucose transport is inhibited bythe tripeptide QCP from the middle part of hRS1.
  • hSGLTI was expressed in oocytes, the indicated peptides were injected into the oocytes, and uptake measurements were started 30 min later.
  • hSGLTI was expressed by injection of 2.5 ng of hSGLTI -cRNA per oocyte and incubation of the oocytes was performed for 3 days.
  • Example 6 Demonstration of high-affintiy inhibition of hSGLTI by QCP.
  • hSGLTI was expressed by injection of SGLT1-cRNA into oocytes and an incubation of the injected oocytes for 3 days. Then, 50 nl Ori buffer per oocyte (control) or 50 nl Ori buffer containing various concentrations of the tripeptide QCP or the reverse tripeptide PCQ were injected. 30 min later, the uptake of 50 ⁇ M [ 14 C]AMG was measured (Fig. 5). 35-40% inhibition of hSGLTI expressed AMG uptake was obtained after injection of 50 ni with a QCP concentration of 50 nM.
  • Example 7 QCP is transported by the human H + -peptide cotransporter hPEPTI.
  • hPEPTI human peptide transporter hPEPTI that is expressed in the brush-border membrane of small intestinal enterocytes
  • hPEPTI was expressed in Xenopus oocytes
  • the oocyte was superfused with acid Ori buffer (pH 6.5)
  • the membrane potential of the oocytes was clamped to -40 mV
  • the oocyte was superfused with acid Ori buffer (pH 6.5) containing 5 mM of well transported control dipeptide glycylglutamine (GC) or 5 mM of QCP.
  • Example 8 QCP added to the extracellular fluid can inhibit hSGLTI in cells that express hPEPTI.
  • hSGLTI human small intestine
  • hSGLTI and hPEPTI are located in the brush-border membrane of enterocytes (Wright and Turk (2004), Pflugers Arch, 447, 510-518; Daniel and Kottra (2004), Pflugers Arch, 447, 610-618).
  • hSGLTI was expressed alone or SGLT1 together with hPEPTI in Xenopus oocytes, incubated the oocytes for 30 min acid Ori buffer (pH 6.5), with acid Ori buffer containing 3 mM QCP or inactive reverse peptide PCQ.
  • Example 9 QCP inhibits the expression of hSGLTI for a time period of several hours.
  • hSGLTI was expressed by injection of SGLT1-cRNA into oocytes and incubation of the injected oocytes for 3 days. Then 50 nl Ori buffer or 50 nl Ori buffer containing 3 mM QCP were injected per oocyte. 3-11 h after the injections uptake of 50 ⁇ M [ 14 C]AMG was measured. Fig. 8 shows that the hSGLTI expressed uptake of AMG was inhibited 60% after 3 h, about 40% after 5 h and 20-30% after 10h.
  • Example 10 Posttranscriptional inhibition of the expression of hSGLTI by QCP can be inhibited by botulinum toxin B.
  • hSGLTI was expressed in oocytes and measured the effect of injected QCP in the absence and presence of botulinum toxin B (BTXB) (Fig. 9).
  • BTXB botulinum toxin B
  • hSGLTI was expressed, KOri buffer as control, KOri buffer containing QCP, KOri buffer containing the reversed control peptide PCQ, KOri buffer containing BTXB or KOri buffer containing BTXB plus QCP was injected. After 30 min incubation, uptake of 50 ⁇ M [ 14 C] AMG was measured.
  • Fig. 9 shows that in the absence of BTXB AMG uptake was inhibited by QCP but not by the reversed control peptide PCQ as shown in Figs. 4 and 5. However, no significant inhibition of AMG uptake by QCP could be observed in the presence of BTXB. Because BTXB inhibits exocytotic fusion of intracellular vesicles with the plasma membrane QCP acts probably on the exocytotic pathway of hSGLTI . The location of hRS1 at the TGN suggests that QCP inhibits SGLT1 expression at the TGN.
  • Example 11 QCP inhibits the small intestinal D-glucose reabsorption by SGLT1 in vivo. Walls of small intestinal mucosa from mice are inserted into an Ussing chamber and the SGLT1 mediated transepitehila currents are measured that are induced by addition of 0.1 mM D-glucose to the mucosal side. The intestinal walls are pre- incubated for 60 min with buffer at pH 6.5 containing 0.1 mM D-glucose or with buffer at pH 6.5 containing 0.1 mM D-glucose plus 3 mM of QCP. After washing glucose- induced transepithelial currents are measured. The data will document that QCP inhibits transepithelial glucose flux in vivo.
  • Example 12 QCP inhibits the small intestinal reabsorption of amino acids mediated by sodium dependent amino acid transporters in vivo.
  • Walls of small intestinal mucosa from mice are inserted into an Ussing chamber and transepitehial currents are measured that are induced by addition of 10 mM of various amino acids to the mucosal side.
  • the intestinal walls are incubated for 60 min with buffer at pH 6.5 containing 0.1 mM D-glucose or with buffer at pH 6.5 containing 0.1 mM D-glucose plus 3 mM of QCP. After washing, amino acid induced transepithelial currents without and with preteatment with QCP are compared. The data would document that QCP inhibits transepithelial flux of amino acids in vivo.
  • Example 13 The peptides IKPSDSDRIEP and SDSDRIEP from the N-terminal part of hRS1 exhibit post-transcriptional inhibition of hSGLTI mediated glucose uptake.
  • hSGLTI cRNA was injected with cRNAs encoding various N- terminal fragments of hRS1 (data not shown).
  • Fig. 10 presents an experiment showing that an N-terminal fragment of hRS1 encoding an unodecapeptide inhibits the expression of hSGLTI .
  • Coexpression of hRS1 cRNA encoding amino acids 40- 50 of hRS1 resulted in a significant inhibition of hSGLTI expressed of glucose uptake by more than 50%. The same level of inhibition was obtained when hSGLTI was coexpressed with total hRS1.
  • Example 14 Inhibitory peptides QCP and IKPSDSDRIEP derived from hRS1 exhibit species independent inhibition of SGLT1.
  • Rabbit SGLT1 (rbSGLTI) was expressed in oocytes by injection of rbSGLTI cRNA, the oocytes were incubated for 3 days, and 50 nl KOri buffer/oocyte containing 3 mM QCP, 3 mM IKPSDSDRIEP, 3 mM QCP plus 3 mM IKPSDSDRIEP, or 3 mM of the reverse tripeptide PCQ plus 3 mM of the reverse peptide PEIRDSDSPKI were injected, the oocytes were incubated for 30 min, and the uptake of 50 ⁇ M [ 14 C]AMG was measured (Fig. 12).
  • mice are fed with standard chow (Altromin C1000 containing 32% polysaccharides, 5.5% disaccharides, 19 % protein, 6% fiber, 4% fat, obtained from Altromin GmbH Lü, Germany) or sugar low diet (modified Altromin C 1000 containing 10% polysaccharides, no disaccharides, 19% protein, 6% fiber, increased amount of fat so that the energy content of both diets was identical) and the supplied drinking water is acidified to pH 6.0 and contains 10 mM QCP.
  • the body weight development with and without peptide treatment is compared over 2 months.
  • intestinal motility is compared by measuring the passage time as described in Chen, 2001 (The Journal of Neurosciences, 21 , 6348-6361). The data should document that body weight is reduced after feeding with QCP. In corresponding experiments, rabbits are to be employed.
  • Example 16 Inhibition of SGLT1 in human epithelial cells by QCP.
  • CaCo-2 cells were grown 13 days after seeding as described (M ⁇ ller, J. et al. (2005) Biochem. Pharmacol. 70, 1851-1860). 3 days after seeding cells reached confluence. Cells were detached by incubation in PBS (pH. 7.4) containing 2 mM EDTA. They were washed two times by incubation with PBS that was adjusted to pH 6.5 and contained 10 mM AMG, and centrifugation at 1000 x g. Cells were incubated for 30 min with PBS (pH 6.5) containing 10 mM AMG (control) or PBS (pH 6.5) containing 10 mM AMG plus 1 mM QCP.
  • Example 17 Glucose dependence of inhibition of SGLT1 mediated AMG uptake by QCP.
  • hSGLTI was expressed in oocytes by cRNA injection and incubation for 3 days as in Fig. 3/Example 1.
  • Per oocyte 25 nl Ori buffer (injected sugar 0 M), 25 nl Ori buffer containing 2 mM (injected sugar 10 "4 M), 20 mM (injected sugar 10 "3 M) or 200 mM (injected sugar 10 '2 M) of AMG (o), D-glucose ( ⁇ ) or D-fuctose ( ⁇ ) were injected.
  • 25 nl Ori buffer or 25 nl Ori buffer containing 3 mM QCP were injected.
  • the oocytes were incubated for 30 min and uptake of 50 ⁇ M [ 14 C]AMG was measured. Inhibition by QCP in the presence of different concentrations of intracellular monosaccharides was measured. The data indicate that QCP inhibits hSGLTI at low or high concentrations of intracellular monosaccharides (see Fig. 14).
  • Example 18 Inhibition of hSGLTI expressed glucose transport activity in oocytes by QCP and QCP derived tripeptides
  • Oocytes were injected with 2.5 ng hSGLTI -cRNA, incubated for 3 days and 50 nl of buffer (control) or 50 nl of buffer containing 1.5 mM of the indicated peptides (resulting in approximately 75 pmoles of peptides per oocyte) were injected.
  • control control
  • 50 nl of buffer containing 1.5 mM of the indicated peptides resulting in approximately 75 pmoles of peptides per oocyte
  • 3 individual experiments with 7-10 buffer-injected control oocytes and 7-10 peptide injected oocytes were performed.
  • the uptake measurements were performed with 50 ⁇ M [14C]AMG. The corresponding results are shown in Fig. 15.
  • the present invention refers to the following nucleotide and amino acid sequences:
  • hRS1 human RS1
  • Nucleotide sequence encoding for pig RS1 (pRS1) (sodium-glucose cotransporter regulatory chain RS 1 - pig (Sus scrofa domestica).
  • pRS1 pig RS1
  • pRS1 sodium-glucose cotransporter regulatory chain RS 1 - pig (Sus scrofa domestica).
  • pRS1 sodium-glucose cotransporter regulatory chain RS 1 - pig (Sus scrofa domestica).
  • pRS1 sodium-glucose cotransporter regulatory chain RS1 - pig (Sus scrofa domestica).
  • mRS1 mouse RS1
  • SGLT1 mouse RS1
  • mRS1 mouse RS1
  • SGLT1 human sarcoma
  • rbRS1 rabbit RS 1
  • rbRS1 rabbit RS 1
  • Oryctolagus cuniculus Amino acid sequence of rabbit RS 1 (rbRS1) (regulatory subunit of sodium-D-glucose cotransporter (Oryctolagus cuniculus)).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Diabetes (AREA)
  • Hematology (AREA)
  • Organic Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Obesity (AREA)
  • Endocrinology (AREA)
  • Emergency Medicine (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)

Abstract

The present invention relates to the use of a regulatory protein RS1 fragment or a nucleic acid molecule encoding said regulatory protein RS1 fragment for the preparation of a pharmaceutical composition for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a (pathological) modification of homeostasis, wherein said RS1 fragment is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine-Cysteine-Proline) or derivatives thereof. Furthermore, the present invention relates to a method for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a (pathological) modification of homeostasis, said method comprising administering to a patient in need of such amelioration, prevention and/or treatment a pharmaceutically active amount of a regulatory protein RS1 fragment or a nucleic acid molecule encoding a regulatory protein RS1 fragment, wherein said RS1 fragment is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine-Cysteine-Proline) or derivatives thereof. Moreover, the present invention relates to the use of a regulatory protein RS1 fragment or a nucleic acid molecule encoding said regulatory protein RS1 fragment for the preparation of food and/or food supplements.

Description

Tripeptides that down regulate the activity of plasma membrane transporters including sodium-D-glucose cotransporter SGLT1
The present invention relates to the use of a regulatory protein RS1 fragment or a nucleic acid molecule encoding said regulatory protein RS1 fragment for the preparation of a pharmaceutical composition for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a (pathological) modification of homeostasis, wherein said RS1 fragment is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine-Cysteine-Proline) or derivatives thereof. Furthermore, the present invention relates to a method for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a (pathological) modification of homeostasis, said method comprising administering to a patient in need of such amelioration, prevention and/or treatment a pharmaceutically active amount of a regulatory protein RS1 fragment or a nucleic acid molecule encoding a regulatory protein RS1 fragment, wherein said RS1 fragment is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine-Cysteine-Proline) or derivatives thereof. Moreover, the present invention relates to the use of a regulatory protein RS1 fragment or a nucleic acid molecule encoding said regulatory protein RS1 fragment for the preparation of food, feeds and/or food supplements.
In the affluent industrial nations, the increased occurrence of nutrition-dependent diseases (e. g. obesity/adipositas, hypercholesterolemia, diabetes, hyperglycaemia, diarrhoea, various bile disorders, various renal disorders like hypertension and various disorders related to the deposition of sodium urate crystals like gout) is a serious problem. In many cases, such nutrition-dependent diseases are secondary diseases and pathological consequences caused by obesity as a consequence of ovemutrition. For instance, pathological consequences of increased glucose concentrations in the blood due to diabetes are retinopathia and renal failures. Further, overweight and diabetes are risk factors for diseases such as hypertension, heart attack, biliary stones, e.g. bile disorders and gout etc. Especially obesity has risen to alarming levels world-wide (McLellan (2002), Lancet 359, 1412). For Example, the average weight of German conscripts now increases by almost 400 g/year. Similar data were obtained in Austria, Norway and the UK.
Obesity or "adipositas" is a complex disorder of appetite regulation and/or energy metabolism controlled by specific biological factors. Besides severe risks of illness such as diabetes, hypertension and heart disease, individuals suffering from obesity are often isolated socially.
Human obesity is strongly influenced by environmental and genetic factors, whereby the environmental influence is often a hurdle for the identification of (human) obesity genes.
Obesity is defined as a Body Mass Index (BMI) of 30 kg/m2 or more. BMI is calculated by dividing the weight in kg by the height in metres squared. Overweight" is defined as a BMI between 25 and 30 kg/m2. A person is considered obese if he or she has 20 percent (or more) extra body fat for his/her age, height, sex, and bone structure.
Obesity has a major impact on a person's physical, social and emotional well-being.
Besides this, obesity can lead to an increased risk of illness including type 2 diabetes and high blood pressure (hypertension) that can lead to other cardiovascular diseases and stroke. Obesity can also play a role in cancer, problems with sexual- function, muscle and bone disorders and dyslipidaemia.
Major advances have recently been made in identifying components of the homeostatic system(s) that regulate body weight/mass. Several candidate genes have been associated with mammalian/human obesity or its metabolic complications (Kopelman, Nature 404 (2000), 634-643). For instance, one key element of the homeostatic system regulating body weight/mass is the hormone leptin (Friedman (1998), Nature 395, 763-770; Friedman (2000), Nature 404, 632-634; Chicurel (2000), Nature 404, 538-540). Leptin is produced by fat tissue and reports nutritional information to key regulatory centers in the hypothalamus. A decrease in body fat leads to a decreased level of leptin, which in turn stimulates food intake. Furthermore, decreased leptin levels activate a hormonal response that is characteristic of a starvation state (Ahima (1996), Nature 382, 250-252). Leptin acts on nerve cells in the brain and modulates this function. Several neuropeptides are implicated in the control of energy homeostasis, inter alia, neuropeptide Y (NPY) and agouti-related protein (AGRP), α-melanocyte-stimulating hormone (α-MSH) and cocaine - and amphetamine - regulated transcript (CART); see Friedman (2000), loc. cit.; Schwartz (2000), Nature 404, 661-671 ; Erickson (1996), Science 274, 1704- 1707; Fan (1997), Nature 385, 165-168. Neuronal circuits furthermore regulate further effector molecules which have recently been identified (for review see Lowell (2000), Nature 404, 652-660). These effector molecules comprise uncoupling proteins (UCP1 , UCP2 and/or UCP3; Lowell (2000), loc. cit.) and peroxisome proliferator-activated receptor-γ (PPAR-γ) co-activator (PGC-I), a key regulator of the genes that regulate thermogenesis (Puigserver (1998), Cell 92, 829-839).
Furthermore, energy balance and thereby body weight/mass is modulated by the above mentioned neuropeptides and further (neurogenic) factors, like proopiomelanocortin (POMC), the precursor of α-MSH (Elias (1999), Neuron 23, 775- 786). Mutations in POMC are implicated in obesity (Krude (1998), Nature Genetics 19, 155).
Additional mutations are described which cause modified and/or altered leptin responses. For example, in 3-5% of extreme obese individuals, mutations in the MSH receptor (MC4R), leading to leptin resistance, have been described (Friedman (2000), loc. cit.; Vaisse (1998), Nature Gen. 20, 113-114). Mutations in the leptin receptor itself are also associated with extreme obesity (Clement (1998), Nature 392, 398-401).
Accordingly, obesity is not to be considered as a single disorder but a heterogeneous group of conditions with (potential) multiple causes. Therefore, obesity is also characterized by elevated fasting plasma insulin and an exaggerated insulin response to oral glucose intake (Kolterman (1980), J. Clin. Invest 65, 1272-1284) and a clear involvement of obesity in type 2 diabetes mellitus can be confirmed (Kopelman (2000), loc. cit.; Colditz (1995), Arch. Int. Med. 122, 481-486). As with other complex diseases, rare obesity mutations have been described which have been identified by mendelian pattern of inheritance and position mapping (see Barsh (2000), Nature 404, 644-650). With one or two notable exceptions, the map positions of obesity loci identified by quantitative studies do not correspond to defined (mouse) obesity mutations such as ob (leptin), fat (carboxypeptidase E) or tubby (tubby protein). Map positions have been determined for some clinical syndromes, like Prader-Willi, Cohen, Alstrom, Bardet-Biedl or Borjeson-Forssman-Lehman, but the causative genes have not yet been isolated (see Barsh (2000), loc. cit.; Ohta (1999), Am. J. Hum. Gen. 64, 397-413; Kolehmainen (1997), Eur. J. Hum. Gen. 5, 206-213; Russell-Eggitt (1998), Ophtalmology 105, 1274-1280; Mathews (1989), Am. J. Med. Gen. 34, 470-474; Bruford (1997), Genomics 41, 93-99). The "human obesity gene map" contains entries for more than 40 genes and 15 chromosomal regions in which published studies indicate a possible relationship to adiposity or a related phenotype (Barsh (2000), loc. cit., Perusse (1999), Obes. Res. 7, 111-129). Said "obesity gene map" comprises, however, mainly large chromosomal areas and does not provide for distinct genes involved in obesity. Lately (2003), Snyder has published an extended version of the "obesity gene map" and more than 430 genes, markers, chromosomal regions have been associated or linked with human obesity phenotypes; Snyder (2004), Obes. Res. 12, 369-439.
Much effort has been spent to understand the pathophysiology of obesity. Apart from the rare monogenic causes for severe disturbances of the eating regulation - genetic alterations of the ob gene (leptin) (Zhang (1996), Nature 372, 425-32; Strobel (1998), Nat. Tenet. 18, 213-215), the leptin receptor (Clement (1998), Nature 392, 398-401), a mutation of the melanocortin 4 receptor (MC4R) gene (Farooqi (2000), J. Clin. Invest. 106, 271-279), and mutations in the proopiomelanocortin (POMC) gene (Krude (1998), Nat. Genet. 19, 155-157) - obesity appears to show a multifactorial etiopathogenesis.
Known therapies for obese patients comprise in particular physical activity, diet as well as drug therapy. Many drugs tested as an appetite suppressant interfere with monoamine- neurotransmitters (serotonin, noradrenalin, dopamine, histamine). 5-HT (5- hydroxytryptamine) is released in various sites of the hypothalamus, a brain region believed to be involved in the regulation of food intake. D-fenfluramine is a 5-HT releaser and reuptake inhibitor mostly used in combination with Phentermine (Fen- Phen) to treat obesity. Fen-Phen was withdrawn from the market due to potential heart valve defects (Wadden (1999), Obes. Res. 7, 309-310). Also sibutramine, a 5- HT and noradrenalin reuptake inhibitor (Knoll Pharma; Bray (1999), Obes. Res 7, 189-198) was shown to support weight loss when used to support a low calorie diet.
Orlistat (Xenical) prevents the absorption of some fat in the intestine. Just under a third of the fat that would otherwise have been absorbed passes straight through the bowel and is excreted in the faeces.
Also in the treatment of obesity, appetite depressants and/or appetite suppressants have been proposed. These comprise sympathomimetic drugs, canthine hydrochloride, phenylpropanolamine hydrochloride, ampfepramone hydrochloride, as well as serotonin-norepinephrine reuptake-inhibitor, like simbutramine hydrochloride. All of these substances modify appetite, but as they do not specifically target nucleus arcuate neurones and solely modify their function e.g., via NMDA receptors, antiobesity drugs also effect other than arcuate nucleus structures. This might explain the variety of (side) effects of these substances, apart from just modulating satiety.
The popular appetite suppressant drug fenfluramine and dexfenfluramine have been withdrawn from the market. The FDA stated that these two drugs are linked to heart valve disease and Primary Pulmonary Hypertension (PPH). PPH is a rare disease which causes the progressive narrowing of the blood vessels of the lungs and mostly results in death.
Also topiramate has recently been proposed in the treatment of obesity. Topiramate demonstrated appetite suppressant properties. Topiramate belongs to a class of medications called anticonvulsants. Usually it is used with other medications to treat certain types of seizures in patients with epilepsy or Lennox-Gastaut syndrome (a disorder that causes seizures and developmental delays). Accordingly, topiramate, marketed as an anti-epileptic drug, is now being evaluated for other indications like obesity, neuropathic pain and management of bipolar mania (The Pharmaceutical Journal (1999), Vol. 263, No 7064, page 475).
As stated in Fujioka (2002), Obes. Res. Suppl. 2, 116S-123S topiramate is a structurally and pharmacologically novel anticonvulsant agent that was approved in 1996 for treatment of epilepsy. Unlike most antiepileptic agents, topiramate seems to lead to appetite suppression. Yet, it has several other actions, including as an antagonist of voltage-gated sodium channels and modulation of alpha-aminobutyric acid-A activity.
However, topiramate is known to provide for side effects in brain regions. Kaminski (2004) showed that topiramate selectively inhibits postsynaptic responses mediated by GluR5 kinate receptors.
Also in the treatment of obesity, diabetes and/or the corresponding secondary disorders, therapeutical forms like various special diets (having extreme ratios of nutritients), psychopharmacological drugs and an α-glucosidase inhibitor (acarbose, Glucobay®, Bayer-Vital, Leverkusen) that inhibits the degradation of disaccharides in small intestine, have been proposed. All known therapeutical forms exhibit the major disadvantage to have severe side effects.
As further means for the treatment of nutrition-related diseases, the development of inhibitors of the sodium-D-glucose cotransporters SGLT1 and SGLT2 are proposed. SGLT1 and SGLT2 mediate the first step in the absorption of D-glucose in small intestine and in reabsorption of D-glucose in renal proximal tubules. These attempts been the treatment of nutrition related diseases are based on the development of non-transported substrate analogues that act as competitive inhibitors (Oku (1999), Diabetes 48, 1794-1800; Dudash (2004), Bioorg. Med. Chem. Lett. 14, 5121-5125). The inhibition of glucose transport by such compounds requires their continuous presence at the binding site at high concentrations. This permanent presence can cause side effects in organs which are not desired to be affected (e.g. severe detrimental effects in brain or heart).
Beside the problem of side effects of pharmacological options for the treatment of nutrition related diseases, diets comprising a sharp reduction of food uptake over a long period of time are often not accepted by the patients and a change in nutritient habits is often refused.
Attempts were also made to provide therapies for the treatment of nutrition-related diseases, like diabetes and hyperglycaemia, by the provision of antagonists (for example antibodies, anti-sense molecules, ribozymes and the like) of the regulatory protein RS 1 (see DE-A1 10006887). In DE-A1 10006887, it is thought that the in vivo level of RS1 is to be reduced in order to treat, e. g. diabetes. RS1 is a regulatory protein well known in the art (see, e.g. Veyhl (1993), J. Biol. Chem. 268, 25041- 25053.; Koepsell (1994), J. Membrane Biol. 138, 1-11.; Lambotte (1996), DNA and Cell Biology 15, 9, 769-777.; Valentin (2000), Biochimica et Biophysica 1468, 367- 380.; Korn (2001), J. of Biological Chemistry 276, 48, 45330-45340; Veyhl (2003), J. Membrane Biol. 196, 71-81.; Osswald (2005), MoI Cell Biol. 25, 78-87.). The human RS1 (Ace. No. NM_006511 , X82877; Lambotte (1996), DNA and Cell Biology 15, 9, 769-777.) consists of 617 amino acids with 74% amino acid identity to RS1 from pig (Ace. No. NM_213793, X64315, Veyhl (1993), J. Biol. Chem. 268, 25041-25053.). Other homolog RS 1 proteins are from rabbit (Ace. No. X82876) or mouse (Ace. No. Y11917).
Since RS1 , inter alia, inhibits the uptake of glucose within the small intestine and its reabsorption within the renal proximal tubules (see, e. g. Veyhl (2003), J. Membrane Biol. 196, 71-81 ; Osswald (2005), MoI Cell Biol. 25, 78-87), the provision of antagonists of this regulatory protein can not be considered for the treatment, amelioration and/or prevention of high glucose peaks in the blood, for example of glucose peaks in diabetic patients.
The RSC1A1 gene codes for RS1. RS1 (/) inhibits the human sodium-D-glucose cotransporter hSGLTI and some other plasma membrane transporters posttranscriptionally (Veyhl (2003), J. Membrane Biol. 196, 71-81), (H) is located within the cytosol as well as within nuclei (Osswald (2005), MoI Cell Biol. 25, 78-87), and (//) inhibits transcription of SGLT1 (Korn (2001), J. Biol. Chem. 276, 45330- 45340). Recently, RS 1 was also identified as a protein interacting with the ischemia/reperfusion-inducible protein (IRIP) and it was proposed that RS1 may be involved in an IRIP-dependent regulation of ion transporters, like the organic cation transporter 2 (OCT2; Jiang (2005), MoI Cell Biol. 25 (15), 6496-508).
In an animal model it was previously shown that the removal of RS1 leads to a post- transcriptional upregulation of SGLT1, to an increase of serum cholesterol and to obesity. Regulation of RSC1A1 gene (expression and/or activity) can be used to influence obesity and the concentration of cholesterol in the blood. RS1 , as a molecule or as an RS1 encoding gene, was proposed to be used in the treatment of adipositas or hypercholesterolemia; see EP-A1 1 444 890. An RS 1 -knock-out animal model, the alternation of the activity of RS 1 in influencing body weight and the possibility to diagnose obesity via testing the expression or activity of RS 1 has been described in EP-A1 1 444 890 and in US 10/771 ,151.
Unfortunately, until now, no useful concept for changing/modifying the situation of overweight, fat/sugar-related malnutrition and even obesity has been provided. Merely insufficient therapeutic options for nutrition-related diseases with severe side- effects have been proposed in the prior art.
Even if several candidate genes have been associated with human obesity or its metabolic complications and even the provision that down-regulation of RS 1 may lead to increased body weight, the identification of additional and/or concise factors that influence obesity and/or adiposity is necessary. Strategies to treat and/or prevent pathological body-weight/body mass regulations are desired.
Therefore, the technical problem underlying this invention was to provide for simple means and methods for modulating (pathological) homeostatic conditions, in particular adipositas/obesity and/or energy homeostatic circuits. The solution to said technical problem is achieved by providing the embodiments characterized in the claims, whereby said solution is not only applicable to pathological conditions, but may also be useful in non-pathological situations, like in non-obese individuals.
Accordingly, the present invention relates to the use of (a) regulatory protein RS 1 fragment(s) or a nucleic acid molecule encoding such (a) regulatory protein RS 1 fragment(s) for the preparation of a pharmaceutical composition for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a (pathological) modification of homeostasis. E. g., said RS 1 fragment is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine- Cysteine-Proline) or derivatives of said tripeptide.
Furthermore, the present invention relates to a method for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a (pathological) modification of homeostasis, said method comprising administering to a patient in need of such amelioration, prevention and/or treatment a pharmaceutically active amount of a regulatory protein RS 1 fragment or a nucleic acid molecule encoding a regulatory protein RS 1 fragment, wherein said RS 1 fragment is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine-Cysteine-Proline) or derivatives thereof.
Moreover, the present invention relates to the use of a regulatory protein RS 1 fragment or a nucleic acid molecule encoding said regulatory protein RS 1 fragment for the preparation of food, feed and/or food supplements, wherein said RS 1 fragment is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine-Cysteine-Proline) or derivatives thereof.
In the experimental part, also a further peptide to be employed in context of the present invention is described, said peptide comprising at least three amino acid residues as comprised in the amino acid sequence S-D-S-D-R-I-E-P (Serine-Aspartic acid-Serine-Aspartic acid-Arginine-lsoleucine-Glutamic acid-Proline). This peptide or a peptide/protein comprising said amino acid sequence (or comprising at least 3 consecutive amino acid residues of the same) or comprising the amino acid sequences of smaller or larger peptides (e. g. I-K-P-S-D-S-D-R-I-E-P (Isoleucine- Lysine-Proline-Serine-Aspartic acid-Serine-Aspartic acid-Arginine-lsoleucine- Glutamic acid-Proline)) may also be employed in accordance with this invention. In context of the present invention, said derivatives of Q-C-P may be, e.g., O-S-P (Glutamine-Serine-Proline), Q-P-P (Glutamine-Proline-Proline) or Q-T-P (Glutamine- Threonine-Proline). The effectiveness of such derivatives in context of the present invention is also demonstrated in the appended examples.
It is also envisaged for the uses, means and methods provided herein that combinations of the herein described RS 1 fragments (or derivatives thereof) are employed in context of the present invention. E. g. it is envisaged that all possible combinations of peptides/proteins consisting of or comprising the amino acid sequences O-C-P, O-S-P, Q-T-P, Q-P-P, Q-T-P and/ or S-D-S-D-R-I-E-P (or consisting of or comprising at least 3 consecutive amino acid residues of S-D-S-D-R- I-E-P) are employed. Corresponding "combination experiments" are also provided in the appended, non-limiting examples. However, it is also envisaged in context of the present invention that only one particular RS 1 fragment or derivative thereof is employed alone and not in combination with any other RS 1 fragment or derivative thereof.
It is of note that also nucleic acid molecules encoding the herein described RS 1 fragments may be employed in context of the present invention.
As documented herein below and in the appended examples, it was, in accordance with this invention, surprisingly found that specific fragments of the regulatory protein RS 1 or nucleic acid molecules encoding the same, negatively influence the glucose uptake in vivo. This RS 1 fragment to be employed in accordance with this invention is the herein defined "Q-C-P" fragment, also referred to as "RS 1 fragment". However, in context of the present invention, the term "RS 1 fragment" also comprises (I-K-P-)S- D-S-D-R-I-E-P (or at least 3 consecutive amino acid residues thereof) and derivatives thereof (defined herein).
It was further surprisingly found that there are distinct differences between the effect of total RS1 protein on the one hand and of the RS1 fragments described herein, e.g. the tripeptide QCP (or the derivatives thereof) or the peptide SDSDRIEP (or at least 3 consecutive amino acid residues thereof) (or the derivatives thereof), on the other hand.
Apparently both, total RS1 protein and the smaller fragments derived therefrom and described herein are thought (without being bound by theory) to inhibit the exocytotic pathway within a short time period of less than 30 min. Inhibition of the exocytotic pathway was shown by demonstrating that the inhibitory effect on expression of hSGLTI in oocytes by total RS1 protein, by the peptide QCP or SDSDRIEP could be prevented if the exocytotic pathway was blocked by botulinum toxin B or by brefeldin
A.
However, the following differences between total hRS1 protein and the said peptides were observed and, inter alia, documented in the appended examples:
Whereas the inhibition of hSGLTI expressed AMG uptake in oocytes by injection of total hRS1 protein was increased after stimulation of protein kinase C (PKC) using s/7-1 ,2-dioctanoyl-glycerol (DOG) or phorbol-12-myristate-13-acetate (PMA), the inhibition of hSGLTI expressed AMG uptake in oocytes by injection of the peptide
QCP or SDSDRIEP was not changed. Therefore, and not being bound by theory, the effect of the herein described peptides does not depend on PKC. This is in sharp contrast to the effect of total hRS1.
In addition, whereas the inhibition of hSGLTI expressed AMG uptake in oocytes by injection of total hRS1 protein was reduced when a dominant negative mutant of dynamin I was coexpressed, the inhibition of hSGLTI expressed AMG uptake in oocytes by injection of the peptide QCP or SDSDRIEP was not changed after coexpression of dominant negative mutant of dynamin I. Therefore, the effect of the peptides as described herein may not dependent on the function of dynamin I.
Unexpectedly, this is a further distinct difference to the effects observed with total hRS1.
Furthermore, whereas the expression of the uptake of radioactively labeled tetraethylammonium [14C]TEA in oocytes by the human organic cation transporter 1
(hOCT1) appears to be inhibited after injection of total hRS1 protein (in the presence of an intracellular AMG concentration of 0.1 mM), hOCT2 expressed [14C]TEA uptake in oocytes appears not to be inhibited after injection of QCP. Corresponding measurements were performed in the presence of intracellular AMG concentrations of 0.1 mM, <0.01mM or 10 mM. Without being bound by theory, these data indicate a different specificity of the target transporter for total hRS1 compared to the RS1 fragments described herein, in particular QCP (or derivatives therof).
In context of the present invention, the term "total RS1" refers to a polypeptide that has the function of the naturally occuring RSl For instance, such "total RS 1" may be the full length hRS1 , e. g. as characterized by a polypeptide comprising the amino acid sequence of SEQ ID NO: 2 or a fragment of said amino acid sequence having the function of the naturally occurring hRS1.
Due to the simplicity of the herein defined minimal peptide structures, pharmaceutical composition for the treatment of a metabolic disease or a secondary disorder caused by a pathological modification of homeostasis may be prepared. Said pharmaceutical compositions comprise the herein defined minimal peptide (RS1 fragment) or a nucleic molecule encoding the same or even a (gene-expression) vector comprising said nucleic acid molecule. Also provided are, accordingly, means and methods for the medical intervention in pathological disorders relating to homeostasis, in particular over-weight, obesity/adipositas and secondary disorders provided herein and detailed below. Also provided are means and methods for the preparation of food, feed and/or food additives, said method(s) comprising the addition of the herein defined specific functional "Q-C-P" fragments (or derivatives thereof) of RS 1 to food, feed and/or food precursors.
Accordingly, the invention also relates to food, feed, food precursors and/or food additives prepared in accordance with the herein defined methods, namely the addition of the RS 1 fragments; in particular the Q-C-P-fragment (alone or in combination with the at least three consecutive amino acid residues of the above described SDSDRIEP peptide and/or other QCP derivatives as described herein), as provided herein.
The present application, inter alia, provides for a compound that inhibits the expressed activity of SGLTs and other nutrient transporters and thereby exhibit a more prolonged inhibition of transport of glucose or other nutrients, compared to e. g. the competitive inhibitors (Oku (1999), Diabetes 48, 1794-1800.; Dudash (2004), Bioorg. Med. Chem. Lett. 14, 5121-5125). Side effects, as caused by the continuous presence of such competitive inhibitors or medicaments described above, can not occur.
Accordingly, the technical problem of the current invention was solved by the development of medicaments and/or "functional food" that employ mechanism for posttranscriptional inhibition of nutrient-transporters by specific RS 1 fragments. The mechanism by which RS1 -specific fragments of the invention down-regulate transporters posttranscriptionally is provided below and in the experimental part. Accordingly, specific functionally active domains of RS1 are identified and specific peptides from these RS1-domains as defined herein are provided. In addition, methods to introduce these inventive peptides, e. g. tripeptides, into selected groups of cells are described.
In the experimental part it is shown that RS1 is not only localized at the plasma membrane and within the nucleus as previously decribed (Kom (2001), J. Biol. Chem. 276, 45330-45340; Osswald (2005), MoI. Cell Biol. 25, 78-87) but also at the trans-Glogi network (TGN) . Evidence is provided that RS1 at the TGN is released after treatment of cells with brefeldin A which classifies RS1 as a TGN coat-protein and suggests that RS 1 is involved in sorting at the TGN. In addition, the posttranscriptional inhibition of SGLT1 expression by RS 1 is due to an inhibition of the exocytotic pathway of plasma membrane transporters, as documented below.
Most importantly, specific peptides, in particular peptides being or comprising Q-C-P residues (or derivatives thereof) are described, which influence negatively specific nutrient transporters/receptors in vivo. In particular, the tripeptide QCP (Glutamine- Cysteine-Proline) or derivatives thereof are provided in accordance with this invention. As shown in the appended examples, QCP or derivatives thereof (and also (IKP)SDSDRIEP) leads to posttranscriptional downregulatation of (nutrient) transporters. QCP inhibits the exocytotic pathway of plasma membrane transporters from the Golgi apparatus to the plasma membrane. It was also demonstrated that QCP is translocated by the proton-peptide co-transporter PEPT1. This allows even the extra cellular application of QCP or a derivative thereof and to direct its effects to cells that express proton-peptide co-transporters. Such an extra cellular application is particularly useful in the medical and/or nutritional methods provided herein.
Accordingly, the present invention provides for the use of a regulatory protein RS 1 fragment/RS1 minimal peptide or a nucleic acid molecule encoding said regulatory protein RS1 fragment/RS1 minimal peptide for the preparation of a pharmaceutical composition for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a (pathological) modification of homeostasis, wherein said RS 1 fragment to be employed in the herein defined uses and methods is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine- Cysteine-Proline) or derivatives thereof.
Within the present application, the term "regulatory protein RS1 fragment", RS1 minimal peptide" or "RS 1 fragment" relates to an amino acid stretch of an RS 1 protein as defined herein and as illustratively shown in any of SEQ ID Nos 2, 4, 6 or 8 or as encoded by a nucleic acid molecule as shown in SEQ ID Nos. 1 , 3, 5 or 7. The "amino acid stretch" to be employed in accordance with this invention is the stretch Q-C-P, QSP1 QPP or QTP (one letter code) and the corresponding "RS 1 fragment(s)" comprise(s) these three amino acid residues in this consecutive order. As shown in the appended examples, it was surprisingly found that the reciprocal amino acid stretch, i.e. P-C-Q, is not functional and, accordingly, that the herein defined amino acid stretch (in N- to C-terminal order) in the format of "Q-C-P" is to be employed.
The amino acid stretch/fragment of the present invention comprises (or is) at least 3 amino acid residues. However even long and longer fragments/amino acid stretches may be employed and used in accordance with this invention. The "Q-C-P" comprising fragments may comprise, one additional amino acid residue, two additional amino acid residues, three additional amino acid residues, four additional amino acid residues, five additional amino acid residues, six additional amino acid residues, seven additional amino acid residues, eight additional amino acid residues, nine additional amino acid residues or ten additional amino acid residues. However, also longer amino acid stretches, comprising the herein defined "RS 1 fragment", namely the Q-C-P motive/peptide", are envisaged. Accordingly, said "RS 1 fragment" may comprise at least 3, 5, 7, 9, 11 , 13, 14, 15, 16, 17, 18, 19, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90 or at least 100 amino acid residues. Most preferably, the additional amino acid residues are residues as also comprised in the herein defined RS 1 proteins. Preferably, said "RS 1 fragment" or "Q-C-P motive/peptide" as defined herein comprises at the most 150 amino acid residues, more preferably at the most 120 amino acid residues. However, in accordance with this invention, smaller peptides of 3 to 12 amino acid residues are preferred, whereby more preferred are 3 to 10 amino acid residues. Most preferably, said amino acid stretch/fragment has a length of three amino acids, namely the amino acid stretch/fragment "Q-C-P" or derivatives thereof, like Q-S-P, Q-P-P or Q-T- P. It is envisaged that the above-described fragments are consecutive stretches of the herein defined RS1 protein. Said "fragments" of RS1 protein may, in accordance with the present invention, also be comprised in fusion constructs, like fusion proteins. These "fusion proteins" and corresponding embodiments are disclosed and exemplified below. In accordance with this invention, it is also envisaged that peptides are employed which comprise the Q-C-P motive (or derivatives thereof) in form of repeats/tandems and the like. Accordingly, also (synthetic or recombinant) peptides are envisaged which are or which comprise motives like "Q-C-P-Q-C-P" and/or "Q-C-P-Q-C-P-Q-C-P". Accordingly, said "Q-C-P motive" may be repeated in one fragment/amino acid stretch. Said repetitions may comprise 2, 3, 4, 5, 6, 7, 8, 9 or more repeated Q-C-P stretches. Said repeated stretches may be interrupted by spacers/linkers of other amino acid residues. Accordingly, the repeated sequences may be of the format "Q-C-P-X-Q-C-P" or "X-Q-C-P-X-Q-C-P-X", wherein "X" represents any amino acid residue and any number of amino acid residues. However, preferably "X" is selected from the group consisting of the amino acid residues A (Alanine), K (Lysine) or R (Arginine) and the number of linker/spacer amino acid residues is preferably at least one. More preferably, the number of linker/spacer amino acid residues is 3.
Further more, the "X" of the peptides as described above may be a site, cleavable by hydrolysis (e.g. catalyzed by hydrolases). In particular, "X" may be S-S. Furthermore, "X" may be an ester bond which, for instance, may be cleavable by esterases.lt is envisaged, that the peptides consisting of or comprising repeats/tandems of the RS1 fragments as defined herein may also comprise more than 150 amino acids. Moreover, in accordance with the present invention, it is envisaged that the RS 1 fragments as defined herein or repeats/tandems thereof may be attached to further amino acids, heterologous peptides and/or heterologous proteins. Said further or additional amino acids may also comprise the above described "further minimal RS 1 fragment", namely the peptide comprising at least 3 consecutive amino acid residues comprised in the amino acid stretch S-D-S-D-R-I-E-P. Said further or additional amino acids may also comprise the above described derivatives of QCP, e.g. QSP, QPP or QTP as well as all possible combinations of the herein described RS 1 fragments. Furthermore, said further amino acids, heterologous peptides and/or heterologous proteins may comprise, derived from and/or consisting of domains having additional functionalities, like, e. g. domains providing further pharmacological effects or specific tags for facilitating protein purification, like, e.g., His-tags. Accordingly the RS 1 fragments as defined herein may also be part of fusion polypeptides or fusion proteins. In accordance with the present invention, said fusion polypeptides or fusion proteins comprising the RS 1 fragments as defined herein may also comprise more than 150 amino acids.
As documented in the appended examples, besides the herein identified and claimed minimal peptide Q-C-P, also a further minimal peptide was identified which comprises the amino acid residues S-D-S-D-R-I-E-P (Serine-Aspartic acid-Serine-Aspartic acid- Arginine-lsoleucine-Glutamic acid-Proline). Also this peptide may comprise additional amino acid residues, preferably as comprised in the herein defined RS 1 protein, as documented in the appended examples, e.g. the amino acid residues "I-K-P" (as non- limiting example).
Accordingly, also provided is, in accordance with this invention, a further amino acid stretch which may be equally employed in the means, uses and methods of this invention, whereby this amino acid stretch is characterized in comprising at least 3 amino acid residues as comprised in the amino acid sequence S-D-S-D-R-I-E-P (Serine-Aspartic acid-Serine-Aspartic acid-Arginine-lsoleucine-Glutamic acid-Proline) or derivatives thereof. The embodiments provided for the herein defined "Q-C-P" minimal stretch apply, mutatis mutandis, for the additional amino acid "RS1 fragment" provided herein and comprising at least 3 amino acid residues as comprised in the amino acid sequence S-D-S-D-R-I-E-P. Again said S-D-S-D-R-I-E-P is provided in the orientation "N-terminus" to "C-terminus" and the reciprocal amino acid stretch ("P- E-I-R-D-S-D-S") may not be employed in accordance with this invention. However, the "minimal 3 amino acid fragment "S-D-S" and/or "DSD" is/are also envisaged in accordance with this invention.
It is of note that the uses and methods provided herein, relate mainly to the herein defined RS 1 fragment "Q-C-P" and its also defined derivatives. However, in the herein provided uses, means and methods it is also envisaged that the inventive RS 1 fragment, being characterized in comprising at least the amino acid sequence Q-C-P (Glutamine-Cysteine-Proline) or derivatives thereof, may be employed/used in (a) combination(s) with the above described further "minimal RS 1 fragment", namely the peptide comprising at least 3 consecutive amino acid residues comprised in the amino acid stretch S-D-S-D-R-I-E-P, and/or in (a) combination(s) with the above described QCP derivatives, e. g. QSP, QTP and/or QPP. However, it is also envisaged that (a) combination(s) of said further "minimal RS 1 fragment" and/or said QCP derivatives lacking particularly QCP are employed in context of the present invention.
Within the present application, the term "Q-C-P or derivatives thereof relates preferably to tripeptides with one ore two amino acid substitutions in said three- amino-acid stretch "Q-C-P". Accordingly, a corresponding and exemplified "Q-C-P" derivative may be of the format of QSP, QTP, QPP, QAP, QGP, NCP, DCP, ECP, NSP, DSP or ESP. However, in accordance with this invention, it is preferred that the useful amino acid stretch comprises or is "Q-C-P", "Q-S-P", "Q-T-P" or "Q-P-P". As pointed out above, "S" corresponds to "serine", "D" corresponds to "aspartic acid", "T" corresponds to "threonine", "P" corresponds to "proline", "N" corresponds to "asparagine", "A" corresponds to "alanine", "G" corresponds to "glycine" and "E" corresponds to "glutamate".
It is to be understood, that the embodiments characterized herein for the "Q-C-P" peptide are also applicable for the herein defined "Q-C-P derivatives", in particular the exemplified "Q-C-P derivatives" in the format of QSP, QTP1 QPP, QAP, QGP, NCP, DCP, ECP, NSP, DSP or ESP, like, in particular "Q-S-P", "Q-T-P" or "Q-P-P". In this context, it is also referred to the appended examples providing experimental data not only for the "Q-C-P" tripeptide, but also for "Q-C-P derivatives", e.g. for "Q-C-P derivatives" where the cysteine residue (C) is replaced by other amino acids, e.g. for Q-S-P, Q-T-P and Q-P-P. It is of note that the human RS1 sequence also contains the Q-S-P motive and the Q-P-P motive (e.g., see SEQ ID NO: 2).
Moreover, the term "Q-C-P or derivatives thereof" or "RS 1 fragments" also relates to Q-C-P (or QSP or Q-T-P or Q-P-P, etc; see above) derivatives having the peptide bond substituted by a covalent bond which is not proteolytically cleavable. Such covalent bound may be, for instance, selected from the group consisting of -CH2- CH2-, -CH(OH)-CH2-, -CH2-CH(OH)-, -CH(OH)-CH(OH)-, -C=O-CH2-, -CH2-C=O-, - CH(OH)-C=O-, -CH=CH-, -C(OH)=CH2-, -CH=C(OH)-, C(OH)=C(OH)-, -N=CH-, - N=C(OH)-. Preferably, such covalent bound may be, for instance, selected from the group consisting of -CH2-C=0-, -CH(OH)-C=O-, -CH=CH-, -CH=C(OH)-, C(OH)=C(OH)-, -N=C(OH)-. Having such bonds, the tripeptides as defined herein are inert against further proteolytic digestion and therefore keep their functionality within the gastrointestinal tract. As pointed out above, the inventive "QCP" fragment may also be a fragment wherein several "QCP" motives are comprised and wherein said "QCP" motives are directly linked to each other (e.g. in the format "(...)Q-C-P-Q-C- P(...)" or wherein said "QCP motives" are separated by linker structures and/or additional amino acid residues, e.g. in the format "(...)Q-C-P-X-Q-C-P(...)", wherein "X" denotes at least one additional amino acid residue. Preferably, the above mentioned and defined "proteolytically inert" peptide bonds are comprised between "Q" and "C" and between "C" and "P" of the herein defined "three amino acid motive Q-C-P". Preferably, the bond between "Q" and "X" and/or between "P" and "X" is a peptide bond which is proteolytically cleavable. Accordingly, and in a most preferred embodiment of the present invention, the longer RS1 fragments defined herein and comprising the "QCP motive" are in vivo proteolytically cleaved (for example after administration in the stomach by gastric juices, in the intestines or in the blood stream), whereby the "proteolytically inert" bonds defined above comprised between "Q" and "C" and between "C" and "P" is not cleaved in vivo, leading to a "proteolytically inert" "Q-C-P" tripeptide which is particularly useful in context of the means, methods and uses of the present invention. As mentioned above, the embodiments described herein are not restricted to the distinct "Q-C-P" tripeptide, but also to "Q-C-P derivatives", as defined above, e.g. QSP, QTP, QPP and the like.
In longer peptides (which, for example, cannot be taken up by PEPT1 and/or PEPT2), "Q-C-P peptides" or derivatives thereof having such "inert bonds" are not proteolytically cleavable. Without being bound by theory, these "inert QCP peptides" remain intact, whereas the remaining amino acids flanking said tripeptide(s) are proteolytically cleaved in vivo. This may lead to Q-C-P or derivatives thereof consisting only of 3 amino acids within the gastrointestinal tract. This kind of Q-C-P tripeptide or derivatives thereof can be transported, e.g. by PEPT1 and/or PEPT2 into those cells in which they are desired to be active.
The term "Q-C-P or derivatives thereof or "RS 1 fragment" relates also to secondary forms of the RS1 fragments described herein, e. g. to D- and L-isoforms, natural and unnatural salts and secondary forms with modifications like acetylation, methylation, glycosylation and/or phosphorylation and to substances with similar or the same mass-spectrometrical characteristics. It was found out that, e.g. the acetylated forms of the RS 1 fragments described herein have the same effects in context of the present invention, e.g. the same effects on sugar uptake, as the non-acetylated forms. Accordingly, also secondary modifications/forms of the herein defined peptides are part of this invention.
Moreover, the term "Q-C-P or derivatives thereof or "RS 1 fragment" relates to all tripeptides or other substances that can function as substrates for (human) peptide- proton symporters, e.g. PEPT1 and/or PEPT2. The molecular features of said tripeptides or other substances are well known in the art and are described in e. g. Daniel (2004), Pflugers Arch. 447, 610-618. Corresponding screening assays for the function of these tripeptides as substrates for PEPT1 and/or PEPT2 can easily be deduced by the skilled artesian from Daniel (2004), loc cit.
In context of the present invention, it is also possibly that the "Q-C-P tripeptide" or "RS 1 fragment" as defined herein or a peptide comprising the same is made hydrophobic. Such a hydrophobic peptide is envisaged to be able to cross (biological) membranes. For instance, Q-C-P may be coupled with antennapedia proteins (or fragments thereof) in order to obtain hydrophobic derivatives of QCP; see also Derossi (1994), J. Biol. Chem. 269, 10444-10450.
A "Q-C-P derivative" as defined herein is characterized in comprising and/or having the same tertiary structure as the original "Q-C-P" amino acid stretch alone or as comprised in a fragment with more amino acid residues. Accordingly, and most preferably, the "QCP derivatives" have, compared to the original Q-C-P motive an unchanged tertiary structure. The same applies, mutatis mutandis, to the further defined minimal peptide as described herein and being derived from the S-D-S-D-R- I-E-P motive disclosed herein. The person skilled in the art is readily in a position to deduce corresponding three-dimensional structures and/or tertiary structures.
Accordingly, in order to further identify and/or verify useful Q-C-P derivatives or derivatives derived from the S-D-S-D-R-I-E-P motive, several techniques which are known in the art may be employed. These techniques comprise, but are not limited to, in-gel digestions, electroelution procedures, microsequencing, amino acid analysis, Edman-sequencing or mass spectroscopy. Also crystalographic methods known in the art may be employed. For example, some techniques start directly from gel(s), others need a transfer to membranes by blotting. To the first group belong, inter alia, coelectrophoresis, internet comparison of position, peptide mapping by SDS-PAGE (Cleveland (1977), J. Biol. Chem. 252, 1102), protein elution and MALDI- MS or N-terminal sequencing by Edman degradation (Edman (1950), Acta Chem. Scand. 4, 283), enzymatic in-gel digestion, analysis of peptides directly in the mixture by mass spectrometry, peptide mass fingerprinting (Pappin (1993), Curr. Biol. 3, 327), ESI-MS (electrospray-ionization-MS), MALDI PMF and/or MALDI PDS (like, e.g. PSD-MALDI-MS (Spengler (1992), Rapid Commun. Mass Spectrom. 6, 105)). As a matrix for MALDI-MS, nicotinic acid, 2,5-dihydroxy benzoic acid or alpha-cyano- 4-hydroxyciannamic acid may be used.
In context of the present invention it is intended that the herein defined RS 1 fragment, e.g. the Q-C-P peptide, can be taken up into those cells in which it is desired to be active/effective. The cells in which the peptides are desired to be effective are most preferably the small intestine epithelial cells, the renal proximal tubular epithelial cells, endothelial cells of blood vessels, epithelial cells of the rectum or colon, and/or epithelial cells of the skin. Accordingly, the Q-C-P peptide and the other RS 1 fragments as described herein are capable to entry those cells in which it is desired to be effective. This entry may be mediated, without being bound by theory, via active transport, passive transport, endocytosis and/or via passive diffusion. Also envisaged is the translocation in said cells via a transport protein like a peptide carrier. Preferably, said carriers are the proton peptide co-transporters PEPT1 or PEPT2, most preferably PEPT1 , as described herein.
In a further embodiment of the present invention a method for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a (pathological) modification of homeostasis is provided. Said method comprises administering to a patient in need of such amelioration, prevention and/or treatment a pharmaceutically active amount of a regulatory protein RS 1 fragment or a nucleic acid molecule encoding a regulatory protein RS 1 fragment, wherein said RS 1 fragment is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine-Cysteine-Proline) or derivatives thereof. The embodiments provided above for the inventive use of the herein defined RS 1 peptide(s)/fragment(s) apply, mutatis mutandis, for this inventive method for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a (pathological) modification of homeostasis.
The metabolic disease or secondary disorder to be treated, ameliorated and/or prevented by the inventive use and methods provided herein is preferably selected from the group consisting of obesity (adipositas), hypercholesterolemia, diabetes, hyperglycaemia, diarrhoea, a bile disorder, a renal disorder. Also envisaged, and not limiting are the amelioration, prevention and/or treatment of gout, hypertension, cancer and/or a disorder related to the deposition of urate crystals in joints, soft tissue and/or the urinary tract. The most common disorder of metabolism to be treated, prevented and/or ameliorated in accordance with this invention is obesity and/or a disorder which involves higher levels of triglycerides and/or cholesterol in the blood of a patient to be treated. The recommended level of triglycerides (in a normal range) are in males 40- 160 mg/dL and in females 35 to 135 mg/dL The recommended level of cholesterol (in a normal range) are 150-220 mg/100 ml.
Inter alia, the present invention provides for means and methods for the medical intervention in overweight subject, in particular human patients.
An "overweight" patient is often defined as having a body mass index (BMI) above 25 kg/m2. Accordingly, the patients to be treated in accordance with this invention have a body mass index between 25 to 30 kg/m2. However, it is also envisaged that patients are to be treated who have a BMI above 30 kg/m2. In certain medically indicated cases, it is also envisaged that patients with a BMI below 25 kg/m2 are to be treated with the peptides and/or nucleic acid molecules encoding the name as defined herein (or a pharmaceutically acceptable salt thereof) in order to reduce their body weight.
Accordingly, the present invention provides for the use of the peptides as defined herein (or a pharmaceutically acceptable salt thereof) for preventing or treating obesity, adipositas, eating disorders leading to increased body weight/body mass. Also envisaged are disorders related to higher or pathologically high body weight due to the use of drugs (like corticosteroids, antipsychotic drugs, antidepressants, particularly tricyclic antidepressants, oral contraceptives, etc.)
Disorders of the metabolism linked to higher body weight/body mass and to be treated (or prevented) by the administration of the peptides as defined herein (or a pharmaceutically acceptable salt thereof) may also comprise, but are not limited to, glycogen storage diseases, lipid storage diseases (like, e.g., Gaucher, Niemann Pieck), endocrine disorders (like, e.g., Cushings, hypothyroidism, insulinomas, lack of growth hormone, diabetes, adrenogenital syndrome, diseases of the adrenal cortex), tumors and metastases (such as craniophryngeomas), Prader-Willi syndrome, Down syndrome and genetic diseases and syndromes (like, e.g., hyperlipoproteinemias) or hypothalmic disorders.
Therefore, the invention also relates to the use of the peptides as defined herein (or a pharmaceutically acceptable salt thereof) in the amelioration, prevention and/or treatment of diseases/disorders related to, caused by or leading to higher or pathologically high body weight.
In accordance with this invention it is also envisaged that the peptides as defined herein (or a pharmaceutically acceptable salt thereof) are employed in the medical intervention of secondary disorders related to a (pathological) increase of body weight. These "secondary disorders" may comprise, but are not limited to diabetes type 2, high blood pressure (hypertension), cardio-vascular diseases, stroke, cancer, problems with sexual function and disorder of the muscular or bone system. Said cardio-vascular disorder may comprise infarcts and/or stroke.
Accordingly, the peptides as defined herein (or pharmaceutically acceptable salts thereof) may be used, especially when administered to the small intestine, to influence the absorption of nutrients, absorption of bile acids, level of cholesterol in the blood, absorption of nucleosides, gout, secretion and/or motor function. Without being bound to theory, this influence may be due to:
(a) Inhibition of the sodium-serotonin cotransporter SERT (see, e.g. Chen (2004), Pflugers Arch. 447, 519-531.; Ace. No.: NM 001045) which is expressed in enteric ganglia cells and causes the termination of the serotonin induced activation of the enteric system (Chen (2001), The Journal of Neurosciences 21 , 6348-6361.);
(b) Inhibition of organic cation transporters which are also expressed in enteric ganglia cells and which support the function of SERT (Chen (2001), The Journal of Neurosciences 21 , 6348-6361);
(c) Inhibition of SGLT3 which controls secretion in the gut and motor function of the gut (Dies-Sampedro (2003), Proc. Natl. Acad. Sci. USA 100, 11753- 11758.); and (d) Influencing organic cation transporters (e.g. SLC22A1/hOCT1 , Ace. No X98332, U77086; SLC22A2/hOCT2, Ace. No X98333; SLC22A3/hOCT3/hEMZ, Ace. No. AJ001417; Koepsell (2004), Pflugers Arch. 447, 666-676.)
Furthermore, the peptides as defined herein (or pharmaceutically acceptable salts thereof) may be used, especially when administered to the colon, to influence absorption of water (for example, a laxative effect is induced) and/or motor function of the gut. This influence may be related to the modifications of the corresponding transporters (e.g. solute transporters, aquaporins, SERT and organic cation transporters).
Moreover, the peptides as defined herein (or pharmaceutically acceptable salts thereof) may be used, especially when administered to the kidney, in particular the proximal tubules (where, e.g. PEPT1 and PEPT2 are expressed), to inhibit reabsorption of D-glucose in diabetic patients, by, e.g. inhibition of SGLT1. As a consequence, there is an increased excretion of D-glucose, especially when high concentrations of D-glucose occur in the blood. Accordingly, the peptides as defined herein (or pharmaceutically acceptable salts thereof) may be used to decrease high peaks of glucose within the serum of diabetic patients, in particularly diabetic patients being adjusted insufficiently.
(
Additionally, the peptides as defined herein (or pharmaceutically acceptable salts thereof) may be used to inhibit function of transporters of endothelial cells.
It is envisaged that the herein defined RS 1 fragment, e.g. the Q-C-P peptide described herein, interacts, in vivo, with peptide receptors, transporters and/or channels for peptides; receptors, transporters and/or channels for nucleosides or nucleotides; receptors, transporters and/or channels for sugars or sugar phosphates; receptors, transporters and/or channels for amino acids or taurine; receptors, transporters and/or channels for neurotransmitters or monoamines; receptors, transporters and/or channels for vitamins or cofactors; receptors, transporters and/or channels for urea, creatinine or ammonium; receptors, transporters and/or channels for organic ions or zwitterions; receptors, transporters and/or channels for anorganic ions, metal ions or protons; receptors, transporters and/or channels for drugs; receptors, transporters and/or channels for bile acids or fatty acids; and water channels. Said receptors, transporters and/or channels are well known in the art and, e.g. may comprise PAT1 (SLC36A1, ace. No. AF516142) PAT2 (SLC36A2 ace. no. AY162214) (Boll (2004), Pflugers Arch. 447, 776-779); EAAC1 (SLC1A1 , ace. no. NM_004170, ASCT2 (SLC1A5, ace. No. U53347 or NMJJ05628) (Kanai (2004), Pflugers Arch. 447, 469-479); rBAT (SLC3A1 ace. No. L11696), 4F2hc (SLC3A2 ace. no.NM_002394) Palacin (2004), Pflugers Arch. 447, 490-494); AE3 (SLC4A3 ace. No. NM_005070), NBCeI (SLC4A4 ace. no. NM_003759), NBCnI (SLC4A7 ace. no. NM_003615) (Rmero (2004), Pflugers Arch. 447, 495-509); SGLT1 (SLC5A1 ace. no. NM_000343), SGLT2 (SLC5A2 ace. no. NMJD03041), SGLT3 (SLC5A4 ace. no. NM_14227), NIS (SLC5A5 ace. no. NM_000453), SGLT4 (SLC5A8 ace. no. HCT1951464) (Wright (2004), Pflugers Arch. 447, 510-518); GAT1 (SLC6A1 ace. no. NM_003042), NET (SLC6A2 ace. no. NM_001043), DAT (SLC6A3 ace. no. NM_001044), SERT (SLC6A4 ace. no. NM_001045), GLYT2 (SLC6A5 ace. no. AF085412 and NM_004211), TAUT (SLC6A6 ace. no. NM_003043) (Chen (2004), Pflugers Arch. 447, 519-531); CAT-1 (SLC7A1 ace. no. NM_004513 or NM_003045), y+LAT2 (SLC7A6 ace. no. D87432 or NM_003983), y+LAT1 (SLC7A7 ace. no. AF092032 or NM_003982), LAT2 (SLC7A8 ace. no. Y18483 or NM_012244), b0,+AT (SLC7A9 ace. no. AF141289 or NM_014270), Asc-1 (SLC7A10 ace. no. AB037670 or NM_019849) (Verrey (2004), Pflugers Arch. 447, 532-542); NHE2 (SLC9A2 ace. no. NM_003048), NHE3 (SLC9A3 ace. no. NM_004174), NHE4 (SLC9A4 ace. no. XM_087199) (Orlowski (2004), Pflugers Arch. 447, 549-565); ASBT (SLC10A2 ace. no. NM_000452) (Hagenbuch (2004), Pflugers Arch. 447, 566-570); NKCC2 (SLC12A1 ace. no. NM_000338), NCC (SLC12A3 ace. no. NM_000339) (Hebert (2004), Pflugers Arch. 447, 580-593); NaS1 (SLC13A1 ace. no. AF260824), NaC1 (SLC13A2 ace. no. U26209), NaC2 (SLC13A3 ace. no. AF154121) (Markovich (2004), Pflugers Arch. 447, 594-602); UT-B1 (SLC14A1 ace. no. NM_015865), UT- A1 (SLC14A2 ace. no. AF349446), UT-A2 (SLC14A2 ace. no. NM_007163) (Shayakul (2004), Pflugers Arch. 447, 603-609); MCT5 (SLC16A4 ace. no. NM_004696), MCT2 (SLC16A7 ace. no. NM_004731), TAT1 (SL16A10 ace. no. NM_018593) (Halestrap (2004), Pflugers Arch. 447, 619-628); NPT1 (SLC17A1 ace. no. NM_005074), NPT3 (SLC17A2 ace. no. U90544), NPT4 (SLC17A3 ace. no. NM_006632), AST (SLC17A5 ace. no. AJ387747) (Reimer (2004), Pflugers Arch. 447, 629-635); OATP4C1 (SLC21A20 ace. no. AY273896) (Hagenbuch (2004), Pflugers Arch. 447, 653-665); hOCT1 (SLC22A1 ace. no. X98332 and U77086), hOCT2 (SLC22A2 ace. no. X98333), hOCT3 (SLC22A3 ace. no. AJ001417), hOCTNI (SLC22A4 ace. no. AB007448), hOCTN2 (SLC22A5 ace. no. AF057164), hOAT1 (SLC22A6 ace. no. AF057039), hOAT2 (SLC22A7 ace. no. AF210455 and AF097518 and AY050498), hOAT3 (SLC22A8 ace. no. AF097491), hOAT4 (SLC22A11 ace. no. AB026116) (Koepsell (2004), Pflugers Arch. 447, 666-676); Sat- 1 (SLC26A1 ace. no. AF297659), DRA (SLC26A3 ace. no. NM_000111), Pendrin (SLC26A4 ace. no. NM_000441), SLC26A7 ace. no. AF331521 (Mount (2004), Pflugers Arch. 447, 710-721); FATP2 (SLC27A2 ace. no. NM_003041), FATP3 (SLC27A3 ace. no. NM_024330), FATP4 (SLC27A4 ace. no. NM_005094), FATP5 (SLC27A5 ace. no. NM_012254) (Stahl (2004), Pflugers Arch. 447, 722-727); CNT1 (SLC28A1 ace. no. NM_004213), CNT2 (SLC28A2 ace. no. NM_004212), CTN3 (SLC28A3 ace. no. NM_022127) (Gray (2004), Pflugers Arch. 447, 728-734); ENT1 (SLC29A1 ace. no. NM_004955), ENT2 (SLC29A2 ace. no. NM_001532) (Baldwin (2004), Pflugers Arch. 447, 735-743); NaPi-IIa (SLC34A1 ace. no. NM_003052), NaPi-IIb (SLC34A2 ace. no. NM_006424), NaPi-IIc (SLC34A3 ace. no. NM_080877) (Murer (2004), Pflugers Arch. 447, 763-767); SNAT2 (SLC38A2 ace. no. NM_018976), SNAT3 (SLC38A3 ace. no. NM_006841), SNAT4 (SLC38A4 ace. no. NM_018018), SNAT5 (SLC38A5 ace. no. NM_033518) (Mackenzie (2004), Pflugers Arch. 447, 784-795); hZIP4 (SLC39A4 ace. no. NM_017767), SLC39A5 ace. no, NM_173596 (Eide (2004) Pflugers Arch., 447:796-800); IREG1 (SLC40 ace. no. NMJ300342) (McKie (2004), Pflugers Arch. 447, 801-806); RhBG (SLC42A2 ace. no. AF193807), RhCG (SLC42A3 ace. no. AF193809) (Nakhoul (2004), Pflugers Arch. 447, 807-812); hENaC α-subunit (ace. no. AH007622 or L29007), McDonald (1994), Am. J. Physiol. 266, L728-L734) or hENaC β-subunit (ace. no. L36593), hENaC γ~ subunit (ace. no. L36592) (McDonald (1995), Am. J. Physiol. 268, 1157-1163).
Moreover, the RS1 fragment as used within the present invention may interact with a receptor, transporter and/or channel in the kidney, for example the Na+-D-glucose cotransporter SGLT1 , and/or in the skin, for example the organic cation transporter hOCT3 .
In accordance with the present invention, it is also envisaged that the peptides as defined herein (or pharmaceutically acceptable salts thereof) may be used to prevent, ameliorate and/or treat pathophysiological conditions such as stroke, myocardial infarction, acute renal failure and/or ischemia/reperfusion insury (which may or may not caused by pathophysiological conditions such as stroke, myocardial infarction and/or acute renal failure). Thereby, and by other uses, the peptides as defined herein (or pharmaceutically acceptable salts thereof) may interact with receptors, transporters and/or channels of one or more regulatory pathways. E. g. these receptors, transporters and/or channels are the receptors, transporters and/or channels as defined herein, e. g. the afore mentioned receptors, transporters and/or channels for neurotransmitters, monoamines, anorganic ions or organic zwitterions, cations and anions, like, e. g. receptors, transporters and/or channels for glutamate. An interaction of different regulatory pathways, all or less than all of which are intended to be influenced by the peptides as defined herein (or pharmaceutically acceptable salts thereof), may also be given.
Without being bound by theory, one of the regulatory pathways to be influenced by the peptides as defined herein (or pharmaceutically acceptable salts thereof) may be a pathway that regulates the appetite sensation and/or the feeding/eating behaviour of a subject. E. g. this pathway involves the function of RS1, the associated protein IRIP (Jiang (2005), MoI. Cell Biol. 25 (15), 6496-508), includes or is modulated by protein kinase C and requires intact dynamin (Veyhl (2003), J. Membr. Biol. 196, 71- 81).
Again, without being bound by theory, it is also envisaged that the peptides as defined herein (or pharmaceutically acceptable salts thereof) may also be used for modulating appetite of a subject. Without bound to theory, appetite of a subject may also arise with decreasing glucose concentration in the blood. Therefore, the peptides as defined herein (or pharmaceutically acceptable salts thereof) may also be used as appetite enhancers, e. g. for the amelioration, prevention and/or treatment of bulimia, anorexia nervosa and the like. However, the use of the peptides as defined herein (or pharmaceutically acceptable salts thereof) as appetite supressors is also envisaged.
It is also envisaged that the peptides as defined herein (or pharmaceutically acceptable salts thereof) also interact with further factors. Such factors are well known in the art and comprise factors like the factors described in Jiang (2005) MoI Cell Biol. 25 (15), 6496-508), Veyhl (2004) J Membr Biol 196, 71-81 and Osswald (2005) MoI Cell Biol 78-87. The interaction with such factors may facilitate or inhibit the interaction of the peptides as defined herein (or pharmaceutically acceptable salts thereof) with the receptors, transporters and/or channels defined herein, and may also not influence said interaction. For instance, the peptides as defined herein (or pharmaceutically acceptable salts thereof) may interact with the ischemia/reperfusion-inducible protein IRIP (Jiang, 2005, MoI Cell Biol., 25(15): 6496-508; AY286019/AY286020). This interaction may increase the inhibitory influence of the peptides as defined herein (or pharmaceutically acceptable salts thereof) on receptors, transporters and/or channels as defined herein. For example, said receptors, transporters and/or channels are receptors, transporters and/or channels for organic cations or anions, like, e. g. hOCT1 (SLC22A1 ace. no. X98332 and U77086), hOCT2 (SLC22A2 ace. no. X98333), hOCT3 (SLC22A3 ace. no. AJ001417) or hOAT1 (SLC22A6 ace. no. AF057039), hOAT2 (SLC22A7 ace. no. AF210455 and AF097518 and AY050498) and hOAT3 (SLC22A8 ace. no. AF097491), hOAT4 (SLC22A11 ace. no. AB026116) (Koepsell (2004), PfI ugers Arch. 447, 666-676).
As used herein, the term "receptor(s), transporter(s) and/or channel(s)" relates to all kind of proteins that are capable to interact with RS 1 and/or a RS1 fragment or a derivative thereof as defined herein above. Further, this term relates to proteins that interact with a substrate to be transported or to be recognized. Those proteins are well known in the art (see, e.g. Wright (2004) Pflugers Arch., 447:510-518).
These receptor, transporter and/or channel proteins are preferably membrane proteins that are known in the art (see e. g. Stryer, Biochemistry, Ed. 4th, 1995, chapter 11). However, they may also contain peripheral subunits or components (see e. g. Stryer, Biochemistry, Ed. 4th, 1995, page 275). It is also envisaged that the peripheral components of receptors, transporters and channels may be cytosolic or extra cellular proteins and that receptors may cytosolic in total.
The transporters may comprise active cotransporters like sym- or antiporters, passive transporters (e.g. like some transporters of pharmaceutical compositions or some ion-channels) or channels (e.g. like aquaporins).
The derivatives of the peptides as defined herein (or also pharmaceutically acceptable salts of such derivatives) that can permeate through biological membranes may be used to inhibit function of transporters within the skin. Accordingly, these peptides can be used to treat proliferative disorders of the skin as e.g. tumors/cancer.
The most common pharmaceutical salt employed in patients, in particular human patients is the hydrochloride form, i.e. hydrochloride of the peptides as defined herein (or derivatives thereof). Hydrochloride of the peptides as defined herein is also a preferred salt in context of this invention. Yet, also other salts are known and envisaged. These comprise, but are not limited to acid addition salts, like acetate, adipate, alginate, ascorbate, aspartate, benzoate, benzenesulfonate, bisulphate, butyrate, citrate, cyclopentanepropionate, digluconate, dodecyl sulphate, ethane sulfonate, fumarate, glucoheptanoate, glycerophosphate, heptanoate, hexanoate, hydrochloride, 2-hydroxyethane sulfonate, lactate, maleate, methane sulfonate, nicotinate, nitrate, oxalate, pamoate, pectinate, persulphate, 3-phenyl sulfonate, 3- phenylpropionate, phosphate, propionate, salicylate, succinate, sulphate, sulfonate, tartrate, undecanoate, or the like.
The pharmaceutical compositions described herein can be administered to the subject at a suitable dose. Administration of the suitable compositions may be effected by different ways, e.g., by intravenous, intraperitoneal, intravesical subcutaneous, by inhalation as well as transdermal administration. Preferred are oral administrations (also in form of food, feed and/or food additives as described herein). However, in patients and in particular medical uses, another preferred administration route is (are) blood infusion(s) (like intravenous ionfusion(s)) and/or rectal administration (e.g. in form of enemas or suppositories).
The peptides as defined herein may, accordingly, be administered orally, parenterally, such as subcutaneously, intravenously, intramuscularly, intraperitoneally, intrathecal^, transdermal^, transmucosally, transpulmonally subdurally, locally or topically via iontopheresis, sublingually, by inhalation spray, aerosol or rectally and the like in dosage unit formulations optionally comprising conventional pharmaceutically acceptable excipients.
Pharmaceutical compositions comprising a peptide/RS1 fragment according to the present invention for oral use can be obtained by combining the active compound(s) with solid excipient, optionally grinding the resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores, preferably with a gastric juice resistant coating such as derivatives of cellulose, polymer of methacrylic acid and methacrylic acid esters or derivatives of polyvinyl.
In accordance with this invention, the peptides described herein (or their derivatives) to be administered in particular in form of a pharmaceutical composition (or also in form of a food supplement) may be comprised in tablets/pills and the like. In a preferred embodiment, said peptides are comprised in coated, e.g. film-coated tablets/pills. Such a coating is particularly preferred for time- and/or location- controlled release of the peptides (or nucleic acid molecules encoding the same). Corresponding coatings are known in the art, and, inter alia, described in EP-A1 0 109 320, WO 94/06416, EP-A1 0 630 646 or EP-A1 0 548 448.
It is envisaged within the present invention, that the pharmaceutically acceptable carrier as employed herein warrants the release of the peptides as defined herein within the small intestine, the renal proximal tubules, the colon, the rectum, or the bladder and/or the blood vessels. Preferred are the small intestine, the renal proximal tubules and/or the colon, most preferred is the small intestine. Particularly preferred coatings in this respect are coatings which lead to a resistance to gastric juices and, accordingly, the peptide as provided herein is liberated in the gut/intestine, preferably in the small intestine and/or the colon. Accordingly, gastric juice resistant coatings may preferably be employed. Such coatings are known in the art and comprise, as non-limiting examples: cellulose derivatives, like carboxymethylene ethylcellulose (Aquateric®), cellulose acetatephthalate (HP50®) or hydroxypropylene cellulose methylphthalate (HP55®); polymeric compounds derived from methacrylic acid and methacrylic acid esters, like Eutragit ® L and Eutragit ® S (for retard forms Eutragit ® RL und Eutragit ® RS).
Also polyvinyl derivatives may be used. These comprise, inter alia, polyvinylpyrrolidone (e.g. Kollidon®) polyvidone acetate or polyvinyl acetate phthalate (e.g. Opadry®).
The peptides according to the present invention (or salts thereof) or medicaments comprising them, intended to be administered intracellulary may be administered using techniques well known to those of ordinary skill in the art. For example, such agents may be encapsulated into liposomes, then administered as described above. Liposomes are spherical lipid bilayers with aqueous interiors. All molecules present in an aqueous solution at the time of liposome formation are incorporated into the aqueous interior. The liposomal contents are both protected from the external microenvironment and, because liposomes fuse with cell membranes, are efficiently delivered near the cell surface.
Delivery systems involving transfersomes, niosomes and liposomes in pharmaceutical uses are well established, and the person skilled in the art is readily in a position to prepare corresponding transfersomes, niosomes and liposomes comprising the herein defined peptides, nucleic acid molecules encoding the same or vectors comprising said nucleic acid molecules. Methods are, inter alia, provided in Mϋller/Hildebrand "Pharmazeutische Technologie: Moderne Arznei", WVG. Wiss Verlag, Stuttgart (1998); Gupta (2005), Int. J. Pharm. 293, 73-82; Torchilin (2005), Nat. Rev. Drug Discov. 4,145-160. Nucleic acid molecules may also be administered to patients in need of treatment via transferosomes, liposomes and/or niosomes. Corresponding preparation methods are known in the art, see, inter alia, Mahoto (2005), Adv. Drug Deliv. Rev. 57, 699- 712 or Kawakami (2004), Pharmazie. 59, 405-408.
Also nanoparticles may be used as delivery systems for the peptides as defined herein and/or nucleic acid molecules encoding the same. Nanoparticles have been developed as an important strategy to deliver peptides and more recently nucleotides. Nanoparticles and other colloidal drug delivery systems modify the kinetics, body distribution and drug release of an associated drug. Corresponding technologies are, inter alia, described and referenced in Kayser (2005), Curr. Pharm. Biotechnol. 6(1), 3-5 or Moghimi (2005), FASEB J. 19, 311-330.
Furthermore, in particular when peptides or protein stretches are to be administered in accordance with this invention, hydrogels may be employed. Corresponding methods are provided and summarized in Pappas (2004), Expert Opin. Biol. Ther. 4,881-887. Hydrogels are particularly useful in the transmucosal (mostly oral) administration/delivery of therapeutic proteins or peptides, as provided herein.
Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media. Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils. Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers (such as those based on Ringer's dextrose), and the like. Preservatives and other additives may also be present such as, for example, antimicrobials, anti-oxidants, chelating agents, and inert gases and the like. Furthermore, the pharmaceutical composition described herein may comprise further agents depending on the intended use of the pharmaceutical composition. It will be appreciated by the person of ordinary skill in the art that the peptides/RS1 fragments described herein and the additional therapeutic agent may be formulated in one single dosage form, or may be present in separate dosage forms and may be either administered concomitantly (i.e. at the same time) or sequentially.
The pharmaceutical compositions comprising the peptides as defined herein may be in any form suitable for the intended method of administration.
Pharmaceutically useful excipients that may be used in the formulation of the pharmaceutical compositions comprising the peptides as defined herein (or a salt thereof) may comprise carriers, vehicles, diluents, solvents such as monohydric alcohols such as ethanol, isopropanol and polyhydric alcohols such as glycols and edible oils such as soybean oil, coconut oil, olive oil, safflower oil cottonseed oil, oily esters such as ethyl oleate, isopropyl myristate; binders, adjuvants, solubilizers, thickening agents, stabilizers, disintergrants, glidants, lubricating agents, buffering agents, emύlsifiers, wetting agents, suspending agents, sweetening agents, colourants, flavours, coating agents, preservatives, antioxidants, processing agents, drug delivery modifiers and enhancers such as calcium phosphate, magnesium state, talc, monosaccharides, disaccharides, starch, gelatine, cellulose, methylcellulose, sodium carboxymethyl cellulose, dextrose, hydroxypropyl-β-cyclodextrin, polyvinylpyrrolidone, low melting waxes, ion exchange resins. Other suitable pharmaceutically acceptable excipients are described in Remington's Pharmaceutical Sciences, 15th Ed., Mack Publishing Co., New Jersey (1991).
The dosage regimen of the pharmaceutical compositions as defined herein will be determined by the attending physician and clinical factors. As is well known in the medical arts, dosages for any one patient depends upon many factors, including the patient's size, body surface area, age, the particular compound to be administered, sex, time and route of administration, general health, and other drugs being administered concurrently. Dosage forms for oral administration include tablets, capsules, lozenges, pills, wafers, granules, oral liquids such as syrups, suspensions, solutions, emulsions, powder for reconstitution. Dosage forms for parentral administration include aqueous or olegeous solutions or emulsions for infusion, aqueous or olegeous solutions, suspensions or emulsions for injection pre-filled syringes, and/or powders for reconstitution. Dosage forms for local/topical administration comprise rectal suppositories, insufflations, aerosols, metered aerosols, transdermal therapeutic systems and/o medicated patches.
The amount of peptides as defined herein (or a pharmaceutically acceptable salt thereof) that may be combined with the excipients to formulate a single dosage form will vary upon the host treated and the particular mode of administration.
The pharmaceutical compositions of the invention can be produced in a manner known per se to the skilled person as described, for example, in Remington's Pharmaceutical Sciences, 15th Ed., Mack Publishing Co., New Jersey (1991).
For the purpose of the present invention, a (therapeutically) effective dosage of the peptides/RS1 fragments as defined herein (or a pharmaceutically acceptable salt thereof) may be a concentration of said peptides of between 2x10"9 M to 5 M, preferably between 2x10"7 M to 3 M, more preferably between 2x10"6 M to 1 M, more preferably between 2x10"6 M to 0,5 M, more preferably between 2x10"5 M to 0,1 M, more preferably between 20-30 mM, even more preferably between 2-10 mM and most preferably between 5-10 mM. However, also concentrations between 2-3 mM are envisaged in context of the present invention. E.g., in the small intestine, the (therapeutically) effective dosage of the peptides as defined herein (or a pharmaceutically acceptable salt thereof) is a concentration of said peptides between 5-10 mM, but also the afore-mentioned other concentrations can occur in the small intestine. The person skilled in the art is readily in a position to deduce such concentrations, e. g. in vivo or ex vivo. Samples may be from the small intestine by a duodenal probe and the peptide(s) as described herein may be detected and their corresponding concentrations may be determined in said given sample, for example by HPLC. The determination of the peptide concentration may be obtained in human patients, healthy (human) individuals as well as in animals, like laboratory animals, non-human transgenic animals (e.g. transgenic mice, rats, pigs, and the like). It is envisaged that the determination of "peptide concentrations" in the gastro-intestinal tract, e. g., the gut duodenum, may for example be deduced in healthy volunteers and corresponding administration schemes for human patients/healthy humans may be established. For example, the gut passage time, the passage of the peptide in the gastro-intestinal tract, the dosage dependencies (e.g. oral dosage given versus dosage detected in various regions of the gastro-intestinal tract) may be determined by standard methods known in the art. Further methods comprise, but are not limited to, the detection of labelled peptides in vivo (e.g. by corresponding labelling techniques, like radioactive labelling, fluorescent labelling, etc.) or physiological/biochemical assays. Accordingly, the dosage of peptides to be given orally in order to obtain a desired concentration of the herein described peptides in any part of the gastro-intestinal tract, like the gut duodenum, may be deduced. These and other methods to deduce such concentrations are well known in the art.
It is envisaged that, for example, the extra cellular concentrations of the peptides as defined herein (or a pharmaceutically acceptable salt thereof) may rise up to 0,5, 1 , 2, 3, 4 or 5 M. Especially in the gut (where, e.g. very high concentration of sugars (for example after consumption of sweets) may occur), said concentrations may reach those high levels. Without bond to theory, the transport capacity of the herein defined peptide-transporters is saturated at a concentration of the peptides as defined herein (or a pharmaceutically acceptable salt thereof) of about 100 mM. Accordingly, it is envisaged that the extra cellular concentration of said peptides is, e.g., at about 100 mM. However, as documented in the appended examples, physiological effects of the peptides defined herein could be deduced at concentrations of about 5 mM in the extracellular medium. Accordingly, corresponding compositions, e.g. compositions comprised in foods and beverages, food supplements, pharmaceutical compositions, and the like should comprise the peptides as defined herein in concentrations that in vivo an extracellular concentration of the peptides (e.g. in humans) be in the range of at least 0.5 mM, 1 mM, 2 mM, 3 mM, 4 mM and in particular at least 5 mM. E. g., said concentration in said corresponding compositions, e.g. compositions comprised in foods and beverages, food supplements, pharmaceutical compositions (e. g. in form of tablets), and the like, may be in the range of 0.1 to 3 M.
It will be appreciated, however, that specific dose level of the "Q-C-P peptide"/"RS1 fragment" as defined herein for any particular patient will depend on a variety of factors such as age, sex, body weight, general health condition, diet, individual response of the patient to be treated time of administration, severity of the disease to be treated, the activity of particular compound applied, dosage form, mode of application and concomitant medication. The therapeutically effective amount for a given situation will readily be determined by routine experimentation and is within the skills and judgement of the ordinary clinician or physician. For example, a certain (relatively high) amount of peptide (e.g. 5 g) could be applied to a subject, the (relatively lowered) corresponding peptide concentration (e.g. 5-10 mM) occurring in the subject (e.g. in the blood or mucosa of the small intestine) could be measured and, optionally, said corresponding peptide concentration could be compared with a detected effect (e.g. glucose uptake into mucosal cells (detected, e.g., by tracing radioactively marked glucose)).
As pointed out above, in a further aspect and in another embodiment of the present invention, the preparation of food, feed, "functional food", "food supplements" as well as "food additives" is provided. Therefore, the present invention is not limited to medical and/or pharmaceutical uses. The invention also relates to the use of a regulatory protein RS 1 fragment as defined herein or a nucleic acid molecule encoding said regulatory protein RS 1 fragment for the preparation of food and/or food supplements, wherein said RS 1 fragment is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine-Cysteine-Proline) or derivatives thereof (e.g. like QSP, QPP or QTP) and/or 3 consecutive amino acids as comprised in the amino acid stretch SDSDRIEP or derivatives thereof. Again, the description of the Q- C-P peptides and/or derivatives provided in context of the above recited methods and uses apply here mutatis mutandis.
In accordance with this embodiment of the invention, the preparation of food "functional food", "food supplements" as well as "food additives" is provided. The food "functional food", "food supplements" as well as "food additives" may be carbohydrate- and/or fat-rich and/or may have a high glycemic index.lt is also envisaged that the food "functional food", "food supplements" as well as "food additives" is carbohydrate- and/or fat-low and/or has a low glycemic index. Accordingly, the invention provides for "functional food" and/or "functional food supplements/additives" comprising the herein defined RS1 minimal peptides (or (a) combination(s) thereof). These "functional food" and/or "functional food supplements/additives" are particularly useful since the sugar and/or fat intake/uptake is inhibited or at least downregulated due to the use of the herein defined "Q-C-P peptidesTRSI fragments".
As documented in the appended examples, the present invention, i.e. the use of the "Q-C-P peptidesTRSI fragments" as defined herein, is particularly useful in the prevention of sugar-in/uptake (for example in/uptake of monosaccharides, like glucose, fructose) in cells. As is shown in the appended examples, the RS 1 fragments as described herein, e. g. the "Q-C-P-tripeptide" and derivatives thereof, like Q-S-P, Q-T-P, Q-P-P, can be employed in the physiological (in vivo) inhibition of cellular uptake of monosaccharides (e. g. glucose, fructose). It was, inter alia, found that the corresponding biological/physiological effect is particular striking in cells with either low (e.g less than 50 μM) or high (e.g more than 5 mM) intra-cellular concentration of sugar, e.g. glucose or fructose.
Accordingly, as mentioned herein, the present invention is particular useful in food, feed and/or food supplements being carbohydrate-rich or -low and/or fat-rich or -low and/or having a high or low glycemic index, as well as useful for the prevention/inhibition of sugar-in/uptake during diets using said food, feed and/or food supplements. Therefore, the present invention is, inter alia, useful in food, feed and/or food supplements being carbohydrate-low and/or fat-low and/or having a low glycemic index or in diets comprising said food, feed and/or food supplements. As also demonstrated in the appended examples, the RS 1 fragments as described herein are also to be employed in food, feed and/or food supplements being carbohydrate-rich and/or fat-rich and/or having a high glycemic index or in diets comprising said food, feed and/or food supplements. However, it is of note that the present invention may also be useful for normal food, feed and/or food supplements as well as for normal diets.
It is envisaged, but not limited that the following "foods" or "food supplements/additives" being prepared in accordance with this invention are:
Bakery products such as cake, cookies, biscuits, doughnuts;
Meat products such as sausages, meat balls, Hamburgers, meat pies;
Cereal products such as cake mixtures, muffin mixtures;
Milk products such as yogurts, curd cheese mixtures, junkets, ice creams, cheeses, milkshakes;
Cacao- und chocolate products such as chocolate bars, chocolate coatings;
Alcoholic beverage such as liqueur, non-alcoholic beverage such as soft drinks;
Fruit products such as jams, jellies;
Confectionery such as jelly bears, marzipan, chewing gum, sugar syrup, sugar mass used for stuffing, candies, dessert powders; potato products such as French fries, chips; or fat und oil containing products such as mayonnaise, oleomargarine.
Also envisaged is the use of the herein defined "RS 1 fragments" in fast food such as frozen foods, canned products or fried products.
Accordingly, the present invention also provides for dietetics, "novel food", "functional food" (foods with components whose positive effects can be regarded as physiological or even healthy), dietary supplements and/or wellness products (products with beneficial effects) comprising the herein defined "Q-C-P peptidesTRSI fragments" and/or peptides derived from the additional minimal RS 1 stretch defined herein (SDSDRIEP peptide). E. g., such "novel food", "functional food", dietary supplements and/or wellness products are in form of shakes, like, e. g. protein shakes. In accordance with the present invention, such shakes, but also the other "novel food", "functional food", dietary supplements and/or wellness products, may be carbohydrate-rich or -low and/or fat-rich or -low and/or may have a high or low glycemic index. It is, for example, envisaged that the herein defined "Q-C-P peptides"/"RS1 fragments" are comprised in "functional food", food products, food supplements and/or wellness products with low carbohydrate and low fat content or in corresponding products with low glycemic index. However, it is also envisaged that the herein defined "Q-C-P peptidesVRSI fragments" are comprised in "functional food", food products, food supplements and/or wellness products with high carbohydrate and high fat content or in corresponding products with high glycemic index.
Corresponding "foods" or "food supplements/additives" are well known in the art (e.g. Belitz, Grosch, Scheiberle, Lehrbuch der Lebensmittelchemie, 5. Auflage, Springer.)
Therefore, the invention also provides for a method of preparation of food and/or food supplements/additives, comprising the step of admixing an RS 1 fragment/"Q-C-P peptide" as defined herein above, a nucleic acid molecule as defined herein below and encoding for a RS 1 fragment of the invention (comprising the Q-C-P motive or a herein defined derivative) and/or a vector comprising such a nucleic acid molecule with food basics and/or foodstuff. "Food basics" and "foodstuff" are known in the art.
In accordance with the present invention, the terms "feed", "foods", "foodstuff" and/or "food basics" encompasses all eatable and drinkable food and drinks. Accordingly, the herein defined "Q-C-P- peptide" may be included in a food or drink. These may, for example be, gum, spray, beverage, candies, infant formula, ice cream, frozen dessert, sweet salad dressing, milk preparations, cheese, quark, lactose-free yogurt, acidified milk, coffee cream or whipped cream and the like.
Milk-based products are envisaged within the framework of the invention. Milk is however understood to mean that of animal origin, such as cow, goat, sheep, buffalo, zebra, horse, donkey, or camel, and the like. The milk may be in the native state, a reconstituted milk, a skimmed milk or a milk supplemented with compounds necessary for the growth of the bacteria or for the subsequent processing of fermented milk, such as fat, proteins of a yeast extract, peptone and/or a surfactant, for example. The term milk also applies to what is commonly called vegetable milk, that is to say extracts of plant material which have been treated or otherwise, such as leguminous plants (soya bean, chick pea, lentil and the like) or oilseeds (colza, soya bean, sesame, cotton and the like), which extract contains proteins in solution or in colloidal suspension, which are coagulable by chemical action, by acid fermentation and/or by heat. Finally, the word milk also denotes mixtures of animal milks and of vegetable milks.
The food, drink or feed comprising the RS1 fragments as defined herein can be produced by a general method for producing foods and drinks or feeds, including adding the active ingredient to a raw or cooked material of the food, drink or feed. The food, drink or feed in accordance with the present invention can be molded and granulated in the same manner as generally used for foods, drinks or feeds. The molding and granulating method includes granulation methods such as fluid layer granulation, agitation granulation, extrusion granulation, rolling granulation, gas stream granulation, compaction molding granulation, cracking granulation, spray granulation, and injection granulation, coating methods such as pan coating, fluid layer coating, and dry coating, puff dry, excess steam method, foam mat method, expansion methods such as microwave incubation method, and extrusion methods with extrusion granulation machines and extruders.
The food, drink or feed according to the present invention includes foods, drinks or feeds comprising the active ingredient, namely the RS 1 fragments as provided and described herein. The food, drink or feed to be used in the present invention includes any food, drink or feed. The concentration of the active ingredient, namely the RS1 peptide fragment as defined herein is preferably 0.001 to 100 % by weight, more preferably 0.01 to 50 % by weight, even more preferably 0.1 to 25 % by weight and most preferably 1 to 25 % by weight of the food, drink or feed comprising such active ingredient. The concentration of the active ingredient, namely the RS 1 peptide fragment as defined herein may also be 5 % by weight of the food, drink or feed comprising such active ingredient. For example, a drink containing 100 ml with 5 g of the active ingredient, namely the RS 1 fragments as provided and described herein, is employed in accordance with the present invention.
Specific foods or drinks, to which the active ingredient is added, include, for example, juices, refreshing drinks, shakes, like e. g. protein shakes, soups, teas, sour milk beverages, dairy products such as fermented milks, ices, butter, cheese, processed milk and skim milk, meat products such as ham, sausage, and hamburger, fish meat, cake products, egg products such as seasoned egg rolls and egg curd, confectioneries such as cookie, jelly, snacks, and chewing gum, breads, noodles, pickles, smoked products, dried fishes and seasonings. The form of the food or drink includes, for example, powder foods, sheet-like foods, bottled foods, canned foods, retort foods, capsule foods, tablet foods and fluid foods.
The food or drink with the RS 1 fragments as provided and described herein may be also a food or drink, comprising e.g milk, chocolate, beer, vine, butter, cheese and the like.
The food or drink with the RS 1 fragments as provided and described herein may be also ingested by infants. Such nutritious composition for infants includes modified milk prepared for infants, protein-decomposed milk, specific nutritionally modified milk or baby foods and foods prepared for toddlers. The form of the nutritious composition for infants includes but is not specifically limited to powder milks dried and pulverized and baby foods and also include general foods such as ice cream, fermented milk, and jelly for infantile ingestion.
The nutritious composition in accordance with the present invention is principally composed of protein, lipid, saccharide, vitamins and/or minerals. In the nutritious composition, the active ingredient is blended with these components. The protein includes milk proteins such as skim milk, casein, cheese whey, whey protein concentrate and whey protein isolates and their fractions such as alpha s - casein, beta-casein, alpha-lactoalbumin and beta-lactoglobulin. Further, egg protein such as egg yolk protein, egg white protein, and ovalbumin, or soybean protein such as defatted soybean protein, separated soybean protein, and concentrated soybean protein can be used. Other than these, proteins such as wheat gluten, fish meat protein, cattle meat protein and collagen may also be used satisfactorily. Further, fractions of these proteins, peptides from the acid or enzyme treatment thereof, or free no acids maybe used satisfactorily as well. The free amino acids can serve as nitrogen sources and can additionally be used to give specific physiological actions. Such free amino acids include, for example, taurine, arginine, cysteine, cysteine and glutamine. The lipid includes animal fats and oils such as milk, fat, lard, beef fat and fish oil, vegetable oils such as soybean oil. rapeseed oil, corn oil, coconut oil, palm oil, palm kernel oil, safflower oil, perilla oil, linseed oil, evening primrose oil, medium chain fatty acid triglyceride, and cotton seed oil, bacterially generated fats and oils, and fractionated oils thereof, hydrogenated oils thereof, and ester exchange oils thereof. The amount of lipid to be blended varies depending on the use. The saccharide/sugars includes, for example, one or more of starch, soluble polysaccharides, dextrin, monosaccharides such as sucrose, lactose as described herein, maltose, glucose, and fructose and other oligosaccharides. The total amount of such saccharide may be 10 to 80% by weight to the total solid in the nutritious composition. Further, artificial sweeteners such as aspartame may be used satisfactorily. The amount of an artificial sweetener is appropriately 0.05 to 1.0% by weight per the total solid in the nutritious composition.
The vitamins include, but are not limited to, lycopene as an essential component and additionally include, for example, vitamins such as vitamin A, vitamin B group, vitamins C, D, and E and vitamin K group, folic acid, pantothenic acid, nicotinamide, carnitine, choline, inositol and biotin as long as such vitamins can be administered to infants. Such vitamins are preferably from 10 mg to 5 g by weight per the total solid in the nutritious composition.
Further, the minerals include calcium, magnesium, potassium, sodium, iron, copper, zinc, phosphorus, chlorine, manganese, selenium and iodine. Such minerals are preferably from 1 mg to 5 g by weight per the total solid in the nutritious composition. Other than those components described above, the foods, drinks, nutritious composition for of the present invention may be blended with any component desirably blended in nutritious compositions, for example, dietary fiber, nucleotides, nucleic acids, flavors, and colorants.
The food or drink of the present invention can be used as a health food or drink or a functional food or drink to prevent and/or treat caries.
When the food or drink according to the present invention is ingested, the amount to be ingested is not specifically limited. The amount to be ingested is generally 0.1 to 50 g, preferably 0.5 g to 20 g daily, based on the total amount of active ingredient. The food or drink is continuously ingested at this amount for a period from a single day up to 5 years, preferably from 2 weeks to one year. Herein, the amount ingested can be adjusted to an appropriate range depending on the severity of the symptom of the individual ingesting the food or drink, the age and body weight thereof, and the like.
The feed of the present invention maybe any feed comprising the active ingredient.
The feed includes, for example, pet feed for dogs, cats and rats, cattle feed for cows and pigs, chicken feed for chicken and turkeys, and fish cultivation feed for porgy and yellowtail.
The food, feed and nutrients can be produced by appropriately blending the active ingredient of the present invention in a raw feed material including, for example, cereals, brans, oil-seed meals, animal-derived raw feed materials, other raw feed materials and purified products.
The cereals include, for example, mile, wheat, barley, oats, rye, brown rice, buckwheat, fox-tail millet, Chinese millet, Deccan grass, corn, and soybean.
The brans include, far example, rice bran, defatted rice bran, bran, lowest-grade flour, wheat germ, barley bran, screening pellet, corn bran, and corn germ.
The oil-seed meals include, for example, soybean meal, soybean powder, linseed meal, cottonseed meal, peanut meal, safflower meal, coconut meal, palm meal, sesame meal, sunflower meal, rapeseed meal, kapok seed meal and mustard meal.
The animal-derived raw feed materials include, for example, fish powders, import meal, whole meal, and coast meal, fish soluble, meat powder, meat and bone powder, blood powder, decomposed hair, bone powder, byproducts from butchery, feather meal, silkworm pupa, skim milk, casein, dry whey and krill.
Other raw feed materials include, for example, plant stems and leaves such as alfalfa, hey cube, alfalfa leaf meal, and locust leaf powder, byproducts from corn processing industries, such as corn gluten meal, corn gluten feed and com steep liquor, starch, sugar, yeast, byproducts from fermentation industry such as beer residue, malt root, liquor residue and soy sauce residue, and agricultural byproducts such as citrus processed residue, soybean curd residue, coffee residue, and cocoa residue, cassava, horse bean, guar meal, seaweed, spirulina and chlorella.
The purified products include, for example, proteins such as casein and albumin, amino acids, starch, cellulose, saccharides such as sucrose and glucose, minerals and vitamins, Furthermore, the present invention relates to an additive for food, drinks and feed, which, due to the presence of the RS1 fragment as defined herein, inter alia, capable of specifically modifying, inter alia, glucose and/or amino acid transport. The additive for food can be produced by a general method for producing additives for food, drinks or feed. If necessary, additives for general use in food, drinks or feed, for example, additives described in Food Additive Handbook (The Japan Food Additives Association; issued on January 6, 1997) may be added satisfactorily, including sweeteners, colorants, preservatives, thickeners and stabilizers, anti-oxidants, color fixing agents, bleaches, antiseptics, gum base, bitters, enzymes, brightening agents, acidifier, seasonings, emulsifiers, enhancers, agents for manufacture, flavors, and spice extracts. Further, conventional saccharides, starch, inorganic materials, plant powders, excipients, disintegrators, lubricants, binders, surfactants, and plasticizers mentioned previously for pharmaceutical tablets may be added satisfactorily. The additives include the following additives.
The sweeteners include aspartame, licorice, stevia, xylose and rakanka (Momordica grosvenori fruit). The colorants include carotenoid and turmeric oleoresin, flavonold, caramel color, spirulina color, chlorophyll, purple sweet potato color, purple yam color, perilla color, and blueberry color.
The preservatives include, for example, sodium sulfite, benzoates, benzoin extract, sorbates, and propionates. The thickeners and stabilizers include, for example, gums such as gum arable and xanthan gum, alginates, chitin, chitosan, aloe extract, guar gum, hydroxypropyl cellulose, sodium casein, corn starch, carboxymethyl cellulose, gelatin, agar, dextrin, methyl cellulose, polyvinyl alcohol, microfiber cellulose, microcrystalline cellulose, seaweed cellulose, sodium polyacrylate, sodium polyphosphate, carrageenan or yeast cell wall.
The anti-oxidants include, for example, vitamin C group, sodium ethylenediaminetetraacetate, calcium ethylenediaminetetraacetate, erythorbic acid, oryzanol, catechin, quercetin, clove extract, enzyme-treated rutin, apple extract, sesame seed extract, dibutylhydroxytoluene, fennel extract, horseradish extract, water celery extract, tea extract, tocopherols, rapeseed extract, coffee bean extract, sunflower seed extract, ferulio acid, butylhydroxyanisole, blueberry leaf extract. propolis extract, pepper extract, garden balsam extract, gallic acid, eucalyptus extract, and rosemary extract.
The color fixing agents include, for example, sodium nitrite. The bleaches include, for example, sodium sulfite.
The antiseptics include, for example, o-phenyl phenol. The gum base includes, for example, acetylricinoleate methyl, urushi wax, ester gum, elemi resin, urucury wax, kaurigum, camaubawax, glycerin fatty acid ester, spermaceti wax, copaibabalsam, copal resin, rubber, rice bran wax, cane wax, shellac, jelutong, sucrose fatty acid ester, depolymerized natural rubber, paraffin wax, fir balsam, propylene glycol fatty acid ester, powdered pulp, powdered rice hulls, jojoba oil, polyisobutylene, polybutene, microcrystalline wax, mastic gum, bees wax and calcium phosphate. The bitters include, for example, iso-alpha-bitter acid, caffeine, kawaratake (Coriolus versieolor) extract, redbark cinchona extract, Phellodendron bark extract, gentian root extract, spice extracts, enzymatically modified naringin, Jamaica cassia extract, theabromine, naringin, cassia extract, absinth extract, isodonis extract, olive tea, bitter orange (Citrus aurantium) extract, hop extract and wormwood extract. The seasonings include, for example, amino acids such as asparagine, aspartic acid, glutamic acid, glutamine, alanine, isoleucine, glycine, serine, cystine, tyrosine, leucine, and praline, nucleic acids such as sodium inosinate, sodium uridinate, sodium guanylate, sodium cytidylate, calcium ribonucleotide and sodium ribonucleotide, organic acids such as citric acid and succinic acid, potassium chloride, sodium chloride-decreased brine, crude potassium chloride, whey salt, tripotassium phosphate, dipotassium hydrogen phosphate, potassium dihydrogen phosphate, disodium hydrogen phosphate, sodium dihydrogen phosphate, trisodium phosphate and chlorella extract.
As discussed herein, it is also envisaged that microorganism express the "RS1 peptide(s) fragments" described herein and that these microorganism are employed in functional food and/or as pharmaceutical composition. Namely, in addition to the probiotic effect, the probiotic microorganism expressing the RS 1 fragment described herein is useful for treating and/or preventing metabolic disorders and/or secondary disorders mentioned herein. The amount of said probiotic microorganism is high enough to significantly positively modify the condition to be treated, preferably obesity, diabetes and the like, but low enough to avoid serious side effects (at a reasonable benefit/risk ratio), within the scope of sound medical judgment. An effective amount of said probiotic microorganism will vary with the particular goal to be achieved, the age and physical condition of the patient being treated, the severity of the underlying disease, the duration of treatment, the nature of concurrent therapy and the specific microorganism employed. A decided practical advantage is that the probiotic organism may be administered in a convenient manner such as by the oral route. Depending on the route of administration, the active ingredients which comprise said probiotic organisms may be required to be coated in a material to protect said organisms from the action of enzymes, acids and other natural conditions which may inactivate said organisms. In order to administer probiotic organisms by other than parenteral administration, they should be coated by, or administered with, a material to prevent inactivation. For example, probiotic organisms may be co-administered with enzyme inhibitors or in liposomes. Enzyme inhibitors include pancreatic trypsin inhibitor, diisopropylfluorophosphate (DFP) and trasylol. Liposomes include water-in-oil-in-water P40 emulsions as well as conventional and specifically designed liposomes which transport lactobacilli or their by-products to the urogenital surface. Dispersions can also be prepared, for example, in glycerol, liquid polyethylene glycols, and mixtures thereof, and in oils. Generally, dispersions are prepared by incorporating the various sterilized probiotic organisms into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum-drying and the freeze-drying technique which yield a powder of the active ingredient plus any additional desired ingredient from previously sterile- filtered solution thereof. Additional preferred methods of preparation include but are not limited to lyophilization and heat-drying.
When the probiotic organisms are suitably protected as described above, the active compound may be orally administered, for example, with an inert diluent or with an assimilable edible carrier, or it may be enclosed in hard or soft shell gelatin capsule, or it may be compressed into tablets designed to pass through the stomach (i.e., enteric coated), or it may be incorporated directly with the food, drink or a diet, e. g. a diet described herein. For oral therapeutic administration, the probiotic organisms may be incorporated with excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like. The probiotic organism is compounded for convenient and effective administration in effective amounts with a suitable pharmaceutically or food acceptable carrier in dosage unit form as disclosed herein.
In accordance with the present invention, it is also envisaged, that other organisms express the "RS 1 peptide(s) fragmentsTRSI fragments" described herein and that these organisms or parts thereof are employed as or for the preparation of food, feed, "functional food", "food supplements" as well as "food additives" and/or as or for the preparation of pharmaceutical compositions. E. g., organisms to express the "RS 1 peptide(s) fragmentsTRSI fragments" described herein are plants, animals, algae or fungi.
For example, it is envisaged that said food, feed and/or food supplement as employed according to the present invention is carbohydrate-rich and/or fat-rich and/or has a high glycemic index. Yet, it is also envisaged that the food, feed and/or food supplement as employed according to the present invention is carbohydrate-low and/or fat-low and/or has a low glycemic index, as discussed above.
In one embodiment of the present Invention, the herein defined RS1 fragments, food, feed and/or food supplements comprising said fragments, e. g. the dietetics, "novel food", "functional food" and dietary supplements, are employed during/as (special) diets, e. g. diets for patients in need of an amelioration, prevention and/or treatment of obesity. The diets include, for example, carbohydrate-low diets, like sugar-low diets and/or starch-low diets, and/or fat-low diets and/or diets with a low glycemic index.
For instance, it is envisaged that herein defined RS 1 fragments, food, feed and/or food supplements comprising said fragments are employed in, to support and/or accompany (special) diets. E. g., the herein defined RS 1 fragments, food, feed and/or food supplements comprising said fragments are employed in a diet- supporting and/or diet-accompanying therapy/diet. Said therapy/diet may be, for example, a therapy/diet supporting and/or accompanying specific diets of patients in need of said specific diets. Said patients include, for example patients suffering from obesity, hypercholesterolemia, diabetes (like diabetes 2), hyperglycaemia, diarrhoea, a bile disorder, a renal disorder and/or a disorder related to the deposition of urate crystals in joints, soft tissue and/or the urinary tract.
For instance, it is envisaged that the herein defined RS 1 fragments, food, feed and/or food supplements comprising said fragments are employed during carbohydrate-low diets and/or diets having a low glycemic index of diabetes 2 patients as a therapy/diet accompanying said carbohydrate-low diets and/or diets having a low glycemic index for the amelioration, prevention and/or treatment of obesity (Brand-Miller (2002) Am J Nutrition 76(suppl):281S-285S; Parillo and Riccardi (2004) Bitish Journal of Nutrition 92:7-19; Bjorck and Elmstahl (2003) Proceedings of Nutrition Society 62,201-206).
In accordance with the present invention it is envisaged that the sugars to be lowered or increased in the diets and food, feed and/or food supplement to be employed within the present invention are, e.g., glucose, galactose saccharose, lactose and/or maltose.
The compositions (e.g. the content of monosaccharides, disaccharides, digestable polysaccharides, protein and fat) of carbohydrate-rich or -low, sugar-rich or -low, starch-rich or -low and fat-rich or -low diets and food, feed and/or food supplements, as well as diets and food, feed and/or food supplements having a high or low glycemic index, are well known in the art. E. g., such compositions are described in Bjorck and Elmstahl (2003) Proceedings of Nutrition Society 62,201-206 and Kennedy (2001) J. Am. Diet. Assoc. 101 (4):411-420. An example of a carbohydrate- low diet/diet with low glycemic index is also shown in the experimental part.
"Carbohydrate-low", for example, means that less than 30% energy within the diet and food, feed and/or food supplement are due to carbohydrates. "Fat-low", for example, means that less than 15% of energy within the diet and food, feed and/or food supplement is due to fat. "Sugar-low", for example, means that the diet and food, feed and/or food supplement contains less than 2% by weight monosaccharides plus disaccharides. With respect to the present invention, a low glycemic index, for example, is a glycemic index of less than 70. The glycemic index is a ranking of carbohydrates based on their immediate effect on blood glucose (blood sugar) levels. It compares foods gram for gram of carbohydrate. Carbohydrates that breakdown quickly during digestion have the highest glycemic indexes. The blood glucose response is fast and high. Carbohydrates that break down slowly, releasing glucose gradually into the blood stream, have low glycemic indexes.
The glycemic index (Gl) is a ranking of carbohydrates on a scale from 0 to 100 according to the extent to which they raise blood sugar levels after eating. Foods with a high Gl are those which are rapidly digested and absorbed and result in marked fluctuations in blood sugar levels. Low-GI foods, by virtue of their slow digestion and absorption, produce gradual rises in blood sugar and insulin levels, and have proven benefits for health. Low Gl diets have been shown to improve both glucose and lipid levels in people with diabetes (type 1 and type 2). They have benefits for weight control because they help control appetite and delay hunger. Low GI diets also reduce insulin levels and insulin resistance.
Recent studies from Harvard School of Public Health indicate that the risks of diseases such as type 2 diabetes and coronary heart disease are strongly related to the Gl of the overall diet. In 1999, the World Health Organisation (WHO) and Food and Agriculture Organisation (FAO) recommended that people in industrialised countries base their diets on low-GI foods in order to prevent the most common diseases of affluence, such as coronary heart disease, diabetes and obesity. To determine a food's Gl rating, measured portions of the food containing 10 - 50 grams of carbohydrate are fed to for example 10 healthy people after an overnight fast. Finger-prick blood samples are taken at 15-30 minute intervals over the next two hours. These blood samples are used to construct a blood sugar response curve for the two hour period. The area under the curve (AUC) is calculated to reflect the total rise in blood glucose levels after eating the test food. The Gl rating (%) is calculated by dividing the AUC for the test food by the AUC for the reference food (same amount of glucose) and multiplying by 100. The use of a standard food is essential for reducing the confounding influence of differences in the physical characteristics of the subjects. The average of the Gl ratings from all ten subjects is published as the Gl of that food. Accordingly, the glycemic index can be easily determined by the person skilled in the art for any given food, feed and/or food supplements and the like. Also available are lists and tables with the values of glycemic indices, for example in Brand-Miller, "The new glucose revolution" or in Brand-Miller, "The Glucose Revolution Top 100 Low Glycemic Foods", both published in 2003, Marlow and Company, New York, US.
"Carbohydrate-rich", for example, means that more than 55% of the energy within the diet and food, feed and/or food supplement is due to carbohydrates. "Fat-rich" means, for example, that more than 35% of the energy within the diet and food, feed and/or food supplement is due to fat. "Sugar-rich", for example, means that the diet and the food, feed and/or food supplement contains more than 5% by weight monosaccharides plus disaccharides. With respect to the present invention, a high glycemic index, for example, is a glycemic index of more than 90.
In accordance with the present invention, "sugar", for example, means all nutrition- relevant sugars and sugar derivatives. These sugars and sugar derivatives are well known in the art. As mentioned before, it is exemplarily envisaged that glucose, galactose, saccharose, lactose and/or maltose are to be employed in accordance with the present invention. Fructose and/or mannose may also be employed.
In the uses, means, methods provided herein, as well as in the preparation of the food, feed, "functional food", "food supplements" as well as "food additives" of the present invention, the RS 1 fragment as defined herein (Q-C-P or derivatives thereof, e.g. QSP, QPP, QTP) is preferably a fragment derived from a polypeptide selected from the group consisting of:
(a) a polypeptide encoded by a nucleic acid molecule as shown in SEQ ID NO: 1 , 3, 5, 7;
(b) a polypeptide encoded by a nucleic acid molecule being at least 55% homologous to a nucleic acid molecule as shown in SEQ ID NO: 1 , 3, 5, 7 and encoding at least the amino acid stretch Q-C-P, Q-S-P, Q-P-P or Q-T-P; and
(c) a polypeptide as shown in any one of SEQ ID NO: 2, 4, 6, 8. Most preferably, said peptide is an RS 1 fragment, preferably comprising the Q-C-P motive, is derived from a polypeptide selected from the group consisting of the human RS1 (hRS1), Ace. No. NM_006511 or X82877; the porcine RS1 , Ace. No. NM_213793 or X64315; the mouse RS1, Ace. No. Y11917 and the rabbit RS1 , Ace. No. X82876. Within the human RS 1 , said QCP motive is from amino acid position 410 to 412, the SDSDRIEP motive as mentioned herein is from amino acid position 43 to 50, the QSP motive as mentioned herein is apparent in the hRS1 two times, namely from amino acid positions 19-21 and 91-93, and the QPP motive as mentioned herein is from amino acid position 311-313 (e. g., see, SEQ ID No. 2). The inventive "Q-C-P peptide" to be employed in accordance with this invention comprises the Q-C-P motive and additional (e.g. neighbouring) amino acid residues as comprised in the herein defined natural RS 1 polypeptides. As pointed out above, the maximal length of an "Q-C-P peptide" as defined herein is about 150, preferably of at most 120 amino acids. Most preferred are, however, short peptides, comprising 13, 12, 11 , 10, 9, 8, 6 and most preferably 3 amino acid residues. As already mentioned before, it is also envisaged, that the RS 1 fragments as defined herein may be attached to further amino acids, heterologous peptides and/or heterologous proteins. Said further amino acids, heterologous peptides and/or heterologous proteins may comprise, derived from and/or consisting of domains having additional functionalities, like, e. g. further pharmacological effects or specific tags for facilitating purification. Accordingly the RS 1 fragments as defined herein may also be part of fusion polypeptides or fusion proteins. In accordance with the present invention, said fusion polypeptides or fusion proteins comprising the RS 1 fragments as defined herein may also comprise more than 150 amino acids.
Accordingly, particular preferred RS1 minimal fragments to be employed in accordance with this invention are Q-N-E-Q-C-P-Q-V-S-F, preferably Q-N-E-Q-C-P- Q-V-S, more preferably Q-N-E-Q-C-P or Q-C-P-Q-V-S and most preferably Q-C-P. However, also envisaged to be employed in context of the present invention are the RS1 fragments Q-S-P, S-S-G-Q-S-P, Q-S-P-D-V-G, S-S-G-Q-S-P-D-V-G, P-T-D-Q- S-P, Q-S-P-A-M-P, P-T-D-Q-S-P-A-M-P, Q-P-P, Q-D-L-Q-P-P, Q-P-P-E-T-N, Q-D-L- Q-P-P-E-T-N and/or Q-T-P. The nucleic acid molecule encoding the herein defined "Q-C-P peptideTRSI fragments" may be any type of nucleic acid, e.g. DNA, RNA or PNA (peptide nucleic acid).
For the purposes of the present invention, a peptide nucleic acid (PNA) is a polyamide type of DNA analog and the monomeric units for adenine, guanine, thymine and cytosine are available commercially (Perceptive Biosystems).
The DNA may, for example, be cDNA. In a preferred embodiment it is a fragment of genomic DNA encoding the herein defined RS1 fragment. The RNA may be, e.g., mRNA. The nucleic acid molecule may be natural, synthetic or semisynthetic or it may be a derivative, such as peptide nucleic acid (Nielsen (1991), Science 254, 1497-1500) or phosphorothioates. Furthermore, the nucleic acid molecule may be a recombinantly produced chimeric nucleic acid molecule comprising any of the aforementioned nucleic acid molecules either alone or in combination.
Preferably, the nucleic acid molecule(s) encoding the "RS 1 fragment" as defined herein is part of a vector. Therefore, the present invention relates in another embodiment of the use, method and means to a vector comprising the nucleic acid molecule encoding the "RS 1 fragment" as defined herein. Such a vector may be, e.g., a plasmid, cosmid, virus, bacteriophage or another vector used, e.g. conventionally in genetic engineering, and may comprise further genes such as marker genes which allow for the selection of said vector in a suitable host cell and under suitable conditions.
The nucleic acid molecules encoding the "RS 1 fragment" as defined herein may be inserted into several commercially available vectors. Nonlimiting examples include plasmid vectors compatible with mammalian cells, such as pUC, pBluescript (Stratagene), pET (Novagen), pREP (Invitrogen), pCRTopo (Invitrogen), pcDNA3 (Invitrogen), pCEP4 (Invitrogen), pMC1 neo (Stratagene), pXT1 (Stratagene), pSG5 (Stratagene), EBO-pSV2neo, pBPV-1, pdBPVMMTneo, pRSVgpt, pRSVneo, pSV2- dhfr, pUCTag, plZD35, pLXIN and pSIR (Clontech) and plRES-EGFP (Clontech). Baculovirus vectors such as pBlueBac, BacPacz Baculovirus Expression System (CLONTECH), and MaxBacTM Baculovirus Expression System, insect cells and protocols (Invitrogen) are available commercially and may also be used to produce high yields of biologically active protein, (see also, Miller (1993), Curr. Op. Genet. Dev. 3, 9 ; O'Reilly, Baculovirus Expression Vectors: A Laboratory Manual, p. 127). In addition, prokaryotic vectors such as pcDNA2; and yeast vectors such as pYes2 are nonlimiting examples of other vectors suitable for use with the present invention. For vector modification techniques, see Sambrook and Russel (2001), loc. cit. Vectors can contain one or more replication and inheritance systems for cloning or expression, one or more markers for selection in the host, e.g., antibiotic resistance, and one or more expression cassettes.
The coding sequences inserted in the vector can be synthesized by standard methods, isolated from natural sources, or prepared as hybrids. Ligation of the coding sequences to transcriptional regulatory elements (e.g., promoters, enhancers, and/or insulators) and/or to other amino acid encoding sequences can be carried out using established methods.
Furthermore, the vectors may, in addition to the nucleic acid sequences encoding for the "RS 1 fragment" defined herein, comprise expression control elements, allowing proper expression of the coding regions in suitable hosts. Such control elements are known to the artisan and may include a promoter, translation initiation codon, translation and insertion site or internal ribosomal entry sites (IRES) (Owens (2001), Proc. Natl. Acad. Sd. USA 98, 1471-1476) for introducing an insert into the vector. Preferably, the nucleic acid molecule encoding for the "Q-C-P peptide" defined herein is operatively linked to said expression control sequences allowing expression in eukaryotic or prokaryotic cells.
Control elements ensuring expression in eukaryotic and prokaryotic cells are well known to those skilled in the art. As mentioned above, they usually comprise regulatory sequences ensuring initiation of transcription and optionally poly-A signals ensuring termination of transcription and stabilization of the transcript. Additional regulatory elements may include transcriptional as well as translational enhancers, and/or naturally-associated or heterologous promoter regions. Possible regulatory elements permitting expression in for example mammalian host cells comprise the CMV-HSV thymidine kinase promoter, SV40, RSV-promoter (Rous sarcome virus), human elongation factor 1 α-promoter, CMV enhancer, CaM-kinase promoter or SV40-enhancer. For the expression in prokaryotic cells, a multitude of promoters including, for example, the tac-lac-promoter, the lacUVδ or the trp promoter, has been described. Beside elements which are responsible for the initiation of transcription such regulatory elements may also comprise transcription termination signals, such as SV40-poly-A site or the tk-poly-A site, downstream of the polynucleotide. In this context, suitable expression vectors are known in the art such as Okayama-Berg cDNA expression vector pcDV1 (Pharmacia), pRc/CMV, pcDNAI , pcDNA3 (In- Vitrogene, as used, inter alia in the appended examples), pSPORTI (GIBCO BRL) or pGEMHE (Promega), or prokaryotic expression vectors, such as lambda gt11. An expression vector according to this invention is at least capable of directing the replication, and preferably the expression, of the nucleic acids and protein of this invention. Suitable origins of replication include, for example, the CoI E1 , the SV40 viral and the M 13 origins of replication. Suitable promoters include, for example, the cytomegalovirus (CMV) promoter, the lacZ promoter, the gal 10 promoter and the Autographa californica multiple nuclear polyhedrosis virus (AcMNPV) polyhedral promoter. Suitable termination sequences include, for example, the bovine growth hormone, SV40, IacZ and AcMNPV polyhedral polyadenylation signals. Specifically- designed vectors allow the shuttling of DNA between different host cells, such as bacteria-yeast, or bacteria-animal cells, or bacteria-fungal cells, or bacteria or invertebrate cells. The expression of the herein defined "Q-C-P peptide" in prokaryotic cells may be particularly useful in the preparation of pharmaceutical compositions or food additives defined herein. It is, e.g. envisaged that bacterial hosts are employed which are capable of expressing a "Q-C-P peptide" as defined herein. It is also envisaged that these bacteria are administered and/or given to humans in form of pharmaceutical compositions and/or food-additives; e.g. as "probiotic food-additives".
Beside the nucleic acid molecules encoding the "Q-C-P peptideTRSI fragment" as defined herein, the vector may further comprise nucleic acid sequences encoding secretion signals. Such sequences are well known to the person skilled in the art. Furthermore, depending on the expression system used leader sequences capable of directing the expressed polypeptide to a cellular compartment may be added to the coding sequence of the nucleic acid molecules of the invention and are well known in the art. The leader sequence(s) is (are) assembled in appropriate phase with translation, initiation and termination sequences, and preferably, a leader sequence capable of directing secretion of translated protein, or a part thereof, into, inter alia, the extracellular membrane. Optionally, the heterologous sequence can encode a fusion protein including an C- or N-terminal identification peptide imparting desired characteristics, e.g., stabilization or simplified purification of expressed recombinant product. Once the vector has been incorporated into the appropriate host, the host is maintained under conditions suitable for high level expression of the nucleotide sequences, and, as desired, the collection and purification of the proteins, antigenic fragments or fusion proteins of the invention may follow. Of course, the vector can also comprise regulatory regions from pathogenic organisms.
The invention also provides for a method of preparation of a pharmaceutical composition for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a pathological modification of homeostasis, comprising the step of admixing an RS 1 fragment/"Q-C-P peptide" as described herein, a nucleic acid molecule encoding the same and/or a vector comprising said nucleic acid molecule with a pharmaceutically acceptable carrier. Corresponding carrier are illustratively mentioned above.
The metabolic disease or secondary disorder to be treated and/or ameliorated or even prevented within this embodiment is preferably obesity, hypercholesterolemia, diabetes, hyperglycaemia, diarrhoea, a bile disorder, a renal disorder and/or a disorder related to the deposition of sodium urate crystals in joints, soft tissue and/or the urinary tract.
The definitions of metabolic diseases or secondary disorders, as given in the corresponding embodiments herein above, apply here, mutatis mutandis.
Also provided in context of this invention is a method of screening for a receptor, transporter and/or channel that (specifically) interacts with an RS1 fragment as defined herein, comprising the steps of: (a) introducing said RS 1 fragment into a system allowing for a candidate receptor, transporter and/or channel to be active, under conditions which allow said RS 1 fragment to be active/interact with said candidate receptor, transporter and/or channel, and
(b) evaluating changes in activity of said candidate receptor, transporter and/or channel in said system.
As illustrated in the appended examples, the RS 1 fragment as defined herein may be introduced into a system in which the candidate receptor, transporter and/or channel is expressed or overexpressed. Also envisaged is the introduction of the RS 1 fragment into a system where the expression of endogeneous RS 1 protein is suppressed. It is furthermore envisaged that the RS 1 fragment ("Q-C-P peptide" or derivatives thereof as described herein) is introduced into a system in which the candidate receptor, transporter and/or channel is overexpressed together with a transporter that mediates uptake of said RS 1 fragment. As illustrated in the appended examples, said candidate receptor, transporter and/or channel may be a peptide transporter (e. g. PEPT1 or PEPT2).Accordingly, in a preferred embodiment of said method of screening for a receptor, transporter and/or channel, said system allows additionally for a peptide transporter (preferably PEPT1 or PEPT2), to be active within said system.
Also envisaged, in accordance with this invention, is a method of screening for a target and/or an interacting partner of an RS 1 fragment as defined in the present invention, comprising the steps of:
(a) contacting said RS 1 fragment with a candidate target and/or a candidate interacting partner under conditions allowing for interaction of said candidate target and/or said candidate interacting partner with said RS1 fragment; and
(b) evaluating the degree of affinity between said candidate target and/or said candidate interacting partner and said RS1 fragment.
Also provided is a method of screening for RS 1 fragments (or derivatives thereof) that can act as substrates for proton-peptide cotransporters, preferably human PEPT1 and/or human PEPT2, comprising the steps of: (a) contacting candidate RS1 fragments (or derivatives thereof) with a system allowing for said proton-peptide cotransporters to be active; and
(b) evaluating the uptake of said candidate RS1 fragments or derivatives into said system.
The RS 1 fragments (or derivatives thereof) to be tested in this embodiment may also be able to inhibit the expressed activity of all the receptors, transporters and/or channels mentioned herein above, preferably of SGLT1.
As an example, the system to be employed in the above recited screening system may be a human cell line, e. g. a cell line derived of kidney or gut, which expresses one or more of said proton-peptide cotransporters, optionally together with one ore more of the above discussed receptors, transporters and/or channels. In such a system, the affinity of the candidate RS1 fragments or derivatives to be screened to the proton-peptide cotransporters can be evaluated, optionally together with the impact, said candidate RS1 fragments or derivatives may have on the coexpressed receptors, transporters and/or channels.
In a preferred embodiment or the screening method provided herein, human cell lines from kidney or gut are used as screening systems. Said cell lines may coexpress the human PEPT1 and PEPT2 together with the human SGLT1. In these systems, the uptake and impact of candidate RS1 fragments or derivatives, added outside to the system, may evaluated by measuring the sodium-dependent transport of glucose via an uptake of radioactively labelled α-methyl-D-glucoside (AMG). Said SGLT1 may be a SGLT1 variant that can be easily localised in the plasma membrane and can be detected by a cell-sorting apparatus. For example, such SGLT1 variant may be a SGLT1 protein coupled with a fluorescent dye.
As shown in the appended examples, also other cells are, however, useful in the screening methods provided herein. These cells comprise, but are not limited to, oocytes (in particularly Xenopus oocytes). Preferably, said oocytes are capable of heterologously expressing proteins, in particularly receptors, transporters and/or channels as defined herein. Corresponding embodiments can easily be deduced from the following experimental part The herein provided screening methods are in particular useful to deduce and/or characterize specific receptors, transporters and/or channels for the RS 1 minimal peptides described herein. Accordingly, specific interaction and/or functional partners may be deduced, validated and/or characterized. It is, e.g. envisaged to express a potential candidate "interaction partner" in a homologous or heterologous system (like in the oocyte system described and used in the experimental part, or in human test cells, like cells derived from gut or kidneys) and to contact said interaction partner with a "Q-C-P- peptide" as described herein. Activity of the potential interaction partner may be measured and evaluated by methods provided in the appended examples, e.g. the transport rate of the peptide itself or e.g. glucose or amino acid residue uptake can be measured. It is also envisaged that the expression rate of the potential candidate molecule be assessed. Again, experimental and exemplifying details are given herein below.
Furthermore, conditions which allow said RS 1 fragment to be active/interact with said candidate receptor, transporter and/or channel, conditions allowing for interaction of said candidate target and/or said candidate interacting partner with said RS 1 fragment as well as systems allowing for said proton-peptide cotransporters to be active are exemplified in the appended examples and are well known in the art.
The present invention is further described by reference to the following non-limiting figures and examples.
The Figures show:
Figure 1 Brefeldin A induces disappearance of RS 1 from the TGN in LLC-PK^ cells.
Subconfluent LLC-PK1 cells grown on cover slips. Cells were incubated for 1 min (b, e) or for 5 min (c, f) with 2 μg/ml Brefeldin A (BRE). Cell metabolism was stopped by transfer of the cells on ice and superfusion with cold washing buffer. After paraformaldehyde fixation and permeabilization, control cells (a, d) or cells incubated with Brefeldin A (b,c,e,f) were immunostained with an affinity purified antibody against SGLT1 (a-c) or with an affinity purified antibody against RS 1 (d-f). lmmunstaining was visualized using secondary antibody directed against rabbit IgG that was coupled to AlexaFluor 555. Bar 1 μm.
Figure 2 Inhibition of hSGLTI expressed T14ClAMG uptake by injection of purified hRS1 protein in the absence and presence of botulinustoxin B. Oocytes were injected with 2.5 ng SGLT1-cRNA and incubated for 3 days. 50 nl of KOri buffer, KOri buffer plus 5 ng of purified hRS1 , KOri buffer containing 1.7 ng botulinum toxin B (BTXB), or KOri buffer plus 5 ng of purified hRS1 and 1.7 ng BTXB were injected. After 30 min incubation at room temperature, uptake of 50 μM [14C]AMG was measured. Mean values of 7-10 oocytes + standard deviations of the mean are shown. *P<0.05 for effect of hRS1 protein on AMG uptake. One typical experiment out of 3 independent experiments is shown.
Figure 3 Identification of a domain in the middle part of hRS1 that inhibits glucose uptake expressed by hSGLTI .
Oocytes were injected with 2.5 ng SGLT1-cRNA alone (amino acids 1 to 617, control), with 2.5 ng SGLT1-cRNA plus 7.5 ng hRS1-cRNA, or with 2.5 ng SGLT1-cRNA plus 7.5 ng cRNAs encoding the indicated fragments of hRS1 (numbering see Lambotte (1996), DNA Cell Biol., 15, 769-777.). After three days incubation of oocytes, uptake of 50 μM [14C]AMG was measured. [14C]AMG uptake in non-injected oocytes was always less than 5% compared to the uptake observed after injection of SGLTI-cRNA. In the presence of 100 μM phlorizin, an inhibitor of SGLT transporters, [14C]AMG uptake in hSGLTI expressing oocytes was inhibited by at least 90%. A representative experiments out of four experiments is shown. Mean of 7-10 oocytes and standard deviations of the means are shown. *P<0.05 for difference to control.
Figure 4 Inhibition of hSGLTI expressed glucose transport activity in oocytes by injection of tripeptide QCP derived from hRS1. Oocytes were injected with 2.5 ng SGLT1-cRNA, incubated for 3 days, and the uptake of 50 μM [14C]AMG was measured (control). In some experiments 50 nl KOri buffer per oocyte containing 1.5 mM of the indicated peptides were injected 30 min before the uptake measurements were started. A representative experiment out of four experiments is shown. Mean of 7-10 oocytes and standard deviations of the means are shown. *P<0.05 for difference to control.
Figure 5 High affinity inhibition of hSGLTI expressed glucose transport by QCP. Oocytes were injected with 2.5 ng SGLT1-cRNA, incubated for 3 days and 50 nl of KOri buffer (control) or 50 nl of KOri buffer containing the indicated peptide concentrations were injected. After 30 min uptake of 50 μM [14C]AMG was measured. For each concentration of injected peptide 3-7 individual experiments with 7-10 non-injected control oocytes and 7-10 peptide-injected oocytes were perfomed. [14C]AMG uptake is presented as percentage of uptake observed in control oocytes that were injected with buffer. Mean and standard deviations of the means of these experiments are presented. The numbers of independent experiments are indicated in brackets. *P<0.05, **P<0.01 for difference between buffer-injected oocytes and oocytes injected with peptide.
Figure 6 Demonstration that the small intestinal peptide transporter hPEPTI translocates QCP.
Oocytes were injected with 30 ng hPEP1-cRNA and incubated for 3 days in Ori buffer. For measurement of electrogenic peptide uptake by two-electrode voltage clamp, oocytes were superfused with acid Ori buffer (pH 6.5), clamped to -40 mV, and superfused with acid Ori buffer, acid Ori buffer containing 5 mM of the control peptide GQ or 5 mM of QCP. With both peptides significant inward currents were induced. A representative experiment out of 5 experiments using 3 different batches of oocytes is shown. Figure 7 Inhibition of expressed glucose transport in oocytes expressing hPEPTI by addition of QCP to the medium.
Non-injected oocytes and oocytes injected with 2.5 ng hSGLTI cRNA plus 10 ng hPEPTI cRNA were incubated for 3 days in Ori buffer (pH.7.5). The oocytes were incubated for 30 min with acid Ori buffer (pH 6.5), with acid Ori buffer containing 3 mM QCP, or with acid Ori buffer containing 5 mM PCQ. After washing with Ori buffer (pH 7.5), uptake of 50 μM [14C]AMG was measured. A representative experiment out of 3 is indicated. ** P<0.01 for difference to oocytes expressing hSSLTI plus PEPT1.
Figure 8 Time course of inhibition of hSGLTI expressed AMG uptake in oocytes after injection of 1 mM QCP.
Oocytes were injected with 2.5 ng hSGLTI -cRNA, incubated for 3 days and 50 nl of KOri buffer (control) or 50 nl of KOri buffer containing 3 mM QCP. After the indicated time periods uptake of 50 μM [14C]AMG was measured. For each time point [14C]AMG uptake was measured in 7-10 oocytes injected with buffer and in 7-10 oocytes injected QCP. For each time point mean values + standard deviations of the means were calculated considering the propagation of error. An exponential decay curve is fitted to the data.
Figure 9 Inhibition of hSGLTI expressed [14C]AMG uptake by injection of QCP in the absence and presence of botulinum toxin B.
Oocytes were injected with 2.5 ng SGLT1-cRNA and incubated for 3 days. 50 nl of KOri buffer (control for SGLT1 mediated AMG uptake in the absence of botulinum toxin B), 50 nl of KOri buffer containing 1.7 ng BTXB (control for SGLT mediated AMG uptake in the presence of BTXB), 50 nl KOri buffer plus 50 nM or 1.5 mM QCP, 50 nl KOri buffer plus 50 nM PCQ, or 50 nl KOri buffer plus 1.7 ng BTXB and either 50 nM or 1.5 mM QCP. After 30 min incubation at room temperature uptake of 50 μM [14C]AMG was measured. The inhibition of AMG uptake by the addition of tripeptides in the absence or in the presence of BTXB is indicated. Mean values + standard deviations of the mean are shown that were derived from 7-10 oocytes without injection of peptides and 7-10 oocytes with injected peptides. *P<0.05 for difference between uptake rates measured in the presence QCP measured in the absence and presence of BTXB.
Figure 10 Identification of a domain in the N-terminal part of hRS1 that inhibits glucose uptake expressed by hSGLTI .
In Xenopus oocytes hSGLTI alone (control), hSGLTI plus hRS1 (amino acids 1-617) or hSGLTI plus fragments of hRS1 encoding the indicated amino acids of hRS1 were expressed by injection of the respective cRNAs. The experiment was performed and is presented as in Fig. 3.
Figure 11 Inhibition of hSGLTI expressed glucose transport activity by intracellular injection of a unodecapeptide or a octapeptide derived from the N-terminal part hRS1.
Oocytes expressing hSGLTI were injected with 50 nl KOri buffer containing 3 mM of the tripeptide QCP, 3 mM the unodecapeptide IKPSDSDRIEP, 3 mM of the octapeptide SDSDRIEP, 3 mM QCP plus 3 mM IKPSDSDRIEP, or 3 mM of the reverse tripeptide plus 3 mM of the reverse unodecapeptide. Experiment was performed and is presented as in Fig. 4.
Figure 12 Inhibition by QCP and IKPSDSDRIEP of glucose transport expressed by rabbit SGLT1.
Oocytes expressing rbSGLTI were injected with 50 nl containing 3 mM QCP or 3 mM IKPSDSDRIEP or 3 mM QCP plus 3 mM IKPSDSDRIEP or 3 mM of the reverse tripeptide plus 3 mM of the reverse unodecapeptide. The experiment was performed and is presented as in Fig. 4.
Figure 13 Inhibition of SGLT1 in human epithelial cells by QCP. SGLT1 mediated uptake was measured in the absence (-) or precence (QCP) of QCP by subtracting the uptake in the presence of phlorizin from the uptake without phlorizin. Mean values with standard deviation of 5 meaurements are indicated. * indicates PO.05 for difference, calculated by Student's t-test.
Figure 14 Glucose dependence of inhibition of SGLT1 mediated AMG uptake by QCP.
Inhibition by QCP in the presence of different concentrations of intracellular monosaccharides was measured. Mean values with standard deviations from 25-30 measurements without QCP and 25-30 measurements with QCP from three different batches of oocytes are indicated. *** indicates PO.001 for difference between AMG uptake in the presence of the indicated intracellular sugar concentration in the absence and presence of QCP.
Figure 15 Inhibition of hSGLTI expressed glucose transport activity in oocytes by QCP and QCP derived tripeptides.
For each injected peptide 3 individual experiments with 7-10 buffer- injected control oocytes and 7-10 peptide injected oocytes were performed. Means and standard deviations of these experiments are presented. * indicates P<0.05, ** indicates P<0.01 for difference between buffer-injected oocytes and oocytes injected with peptide.
The Examples illustrate the invention.
Example 1: General methods
(A) Materials
[14C] labelled methyl-α-D-glucopyranoside (AMG) containing 5.7 GBq/mmole) and all other materials were obtained as described earlier (Lambotte (1996), DNA Cell Biol., 15, 769-777; Veyhl (2003), J. Membrane Biol., 196, 71-81). (B) cDNA cloning and preparation of cRNAs
cDNAs of hRS1 fragments were cloned using the overlap-extension method as described earlier (Gorboulev (1999), MoI. Pharmacol., 56, 1254-1261; Lambotte (1996), DNA Cell Biol., 15, 769-777). cRNAs of hRS1 and of hRS1 fragments were synthesized in vitro as described (Veyhl (2003), J. Membrane Biol., 196, 71-81) .
(C) Expression of transporters and hRS1 or fragments of hRS1 in Xenopus oocytes.
Expression to human SGLT1 (hSGLTI), rabbit SGLT1 (rbSGLTI), human PEPT1 (hPEPTI) and co-expression of hSGLTI or rbSGLTI with hRS1 or hRS1 fragments were performed as described earlier (Veyhl (2003), J. Membrane Biol., 196, 71-81). cRNA of hPEPTI (30 ng per oocyte), cRNAs of hSGLT or rbSGLTI (2.5 ng per oocyte) plus cRNA of hRS1 or of hRSt fragments (7.5 ng per oocyte) were injected into oocytes. The oocytes were incubated for three days at 16 0C in ORi buffer (in mM: 5 HEPES-Tris, pH 7.4, 100 NaCI, 3 KCI, 2 CaCI2, and 1 MgCI2). Then, the uptake of [14C]AMG expressed by hSGLTI was measured at pH 7.4 as described (Veyhl (2003), J. Membrane Biol., 196, 71-81). Transport by expressed hPEPTI was measured using the two-electrode voltage clamp technique (Veyhl (2003), J. Membrane Biol., 196, 71-81). The oocytes were superfused with Ori buffer titrated to pH 6.5, the membrane potential of the oocytes was clamped to -40 mV, and inward current induced by superfusion with Ori buffer (pH 6.5) containing 5 mM of a control dipeptide or 5 mM of the tested tripeptide was measured.
(D) Expression and purification of hRS1
Oocytes were injected with cRNA of hRS1 containing six histidine residues at the C-terminus. 3 days after expression, oocytes were homogenized and the nuclei and lipids removed by differential centrifugation as described (Valentin (2000), Biochim. Biophys. Acta, 1468, 367-380). Then, hRS1 was affinity- purified on nickel(ll)-charged nitrilotriacetic acid-agarose from QIAGEN GmbH (Hilden, Germany) as described (Valentin (2000), Biochim. Biophys. Acta, 1468, 367-380). Purified hRS1 was dialysed against KOri buffer (in mM: 5 HEPES-Tris, pH 7.4, 100 KCI, 3 NaCI, 2 CaCI2, and 1 MgCI2) .
(E) Inhibition of hSGLTI expressed F14CIAMG uptake by hRS1 protein and peptides of hRS1
Oocytes were injected with hSGLTI cRNA (2.5 ng per oocyte) and incubated for 3 days in ORi buffer (160C). Thereafter, the ocytes were injected with 50 nl/oocyte of KOri buffer plus hRS1 protein or various concentrations of peptides derived from hRS1. Oocytes were incubated for 30 min or longer time periods at room temperature and uptake of [14C]AMG was measured. In a different experimental setup, oocytes were injected with SGLT1 cRNA (2.5 ng per oocyte) or with hSGLTI cRNA (2.5 ng per oocyte) plus hPEPTI cRNA (10 ng per oocyte) and the oocytes were incubated 3 days for expression. Thereafter the oocytes were incubated 30 min with Ori buffer adjusted to pH 6.5 or with Ori buffer adjusted to pH 6.5 containing 3 mM of the tested tripeptide. Thereafter oocytes were washed with Ori buffer (pH 7.4) and uptake of [14C]AMG was measured.
(F) Measurements of T14CIAMG uptake
Uptake measurements were performed as described (Veyhl (2003), J. Membrane Biol., 196, 71-81). Oocytes were incubated for 15 min at room temperature in ORi buffer containing 50 μM [14C]AMG without or with 100 μM of the SGLT1 inhibitor phlorizin. The uptake was blocked and oocytes were washed with ice cold Ori buffer containing 100 μM phlorizin. Radioactivity in the oocytes was measured by liquid scintillation counting. Uptake measurements were performed in 7 to 10 individual oocytes and mean values + standard deviations of the means are indicated. Experiments were performed in triplicates or more often. Statistical significance of AMG uptake after coinjection of hRS1 derived cRNAs or after injection of hRS1 derived peptides was determined by Anova test and post hoc Tukey comparison.
Immunostaininq
For immunostaining, LLC-PKi cells were grown on coverslips to about 50% confluence. The cells were washed twice with washing buffer (5 mM 3-(N- morpholino)propanesulfonic acid-NaOH, pH 7.4, 100 mM NaCI, 3 mM KCI, 2 mM CaCI2, and 1 mM MgCI2), fixed for 12 min with 4% (w/v) paraformaldehyde diluted in washing buffer, and washed twice again. Free aldehyde groups were quenched by 10 min incubation with washing buffer containing 40 mM glycine. For immunoreactions, washed cells were permeabilized by a 10-min incubation with washing buffer containing 0.25% (w/v) TritonX-114, and incubated over night at 4 0C with primary antibodies diluted in washing buffer. The dilutions of primary antibodies were as follows: rabbit-anti-RS1-Ab 1 :50 (Valentin (2000), Biochim. Biophys. Acta, 1468, 367-380); QIS30 directed against SGLT1 1 :400 (Kipp (2003), Am. J. Physiol., 285, C737-C749), sheep- anti-TGN46 1 :125 (from Diagnostic International, Schriesheim, Germany). After incubation with primary antibodies, cells were washed 3 times with washing buffer and incubated for 1 h at room temperature with fluorochrome linked secondary antibodies (goat antibody against rabbit IgG linked to AlexaFluor 488 Molecular Probes, Leiden, Netherlands, and donkey anti- sheep IgG coupled to Cy2 from Dianova, Hamburg, Germany). Cells were washed 6 times with washing buffer, rinsed shortly with double-distilled water and embedded in Fluorescent-Mounting Medium from DAKO Diagnostika GmbH (Hamburg, Germany) containing 1 μl of 4',6'-diamidino-2-phenylindole (DAPI, Molecular Probes, Leiden, Netherlands) per specimen for staining of the nuclei.
The specificity of the antibodies was controlled as follows. The immunoreaction with affinity purified pRS1-ab was abolished after preabsorption with the antigen by incubating pRS1-ab for 60 min at 370C with 0.1 mg/ml of recombinant pRS1 protein. No antibody reaction with secondary antibodies was observed when the incubation with primary antibodies was omitted. In controls, no cross-reactivity of the used secondary antibodies with false primary antibodies used in the same experiment was detected.
Example 2: RS1 is a brefeldin A-sensϊtive coat protein at the TGN.
Colocalization experiments in human embryonic kidney 293 cells using specific antibodies against RS1 and the TGN marker protein TGN46 (Luzio (1990), Biochem. J., 270, 97-102; Banting and Ponnambalam (1997), Biochim. Biophys. Acta, 1355, 209-217) showed perfect colocalization of TGN46 and RS1 (data not shown). This indicated that RS1 is located at the TGN. brefeldin A is a fungal metabolite that has been extensively used to decipher vesicular transport processes in eukaryotic cells (Klaus (1992), J. Cell. Biol., 116, 1071-1080). The most striking effects of brefeldin A are the release of various coat proteins from the Golgi apparatus and morphological changes of intracellular tubulovesicular compartments that reflect changes in membrane traffic pathways. Targets of brefeldin A are guanosine nucleotide exchange factors (GEFs) that catalyse the conversion of inactive (ARF-GDP) into active ADP-ribosylation factors (ARF-GTP) (Helms JB and Rothman JE (1992) Nature 360, 352-354; Jackson CL and Casanova JE (2000) Cell Biology 10, 60-67). ARFs are Ras-like GTPases that are central to many vesicular transport processes in eucraryotic cells. They regulate the assembly of vesicle coat complexes on the TGN (Roth (1999), Cell, 97, 149-152). To determine whether RS1 belongs to the group of ARF dependent coat proteins at the TGN, subconfluent LLC-PKi cells were incubated for various time periods with 2 μg/ml BFA and immunostaining for SGLT1 and RS1 was performed (Fig. 1). After 1 min or 5 min incubation of subconfluent LLC-PKi cells with brefeldin A distinct morphology changes of the tubulovesicluar compartments with SGLT1 immunoreactivity were observed. The relatively close packing of tubulovesiclar compartments with SGLT1 observed in many cells became more dissociated and increasing numbers of single tubules with extensive ramification became apparent (Fig. 1 a-c). SGLT1 remained associated with the intracellular membranes. In contrast, the immunoreactivity of RS1 at the perinuclear compartment disappeared within several minutes after incubation of the LLC-PKi cells with brefeldin A. The data show that RS1 protein is released from the TGN by brefeldin A and suggest that RS1 is a GEF dependent coating protein at the TGN. Example 3: Posttranscriptional inhibition of the expression of hSGLTI by hRS1 is due to an effect on the exocytotic pathway.
Oocytes were injected with hSGLT1-cRNA and incubated for three days for expression. Then, 50 nl of KOri buffer was injected without addition, with 1.7 ng botulinustoxin B (BTXB), with 5 ng purified hRS1 protein, or with 5 ng of purified hRS1 plus 1.7 ng of BTXB. After 30 min incubation at room temperature uptake of 50 μM [14C]AMG was measured (Fig. 2). In the absence of butolinustoxin, hRS1 inhibited hSGLTI expressed AMG uptake by 50 %. Under the employed experimental conditions the concentration of injected BTXB inhibited the expression of AMG uptake also by about 50%. In the presence of BTXB no inhibition of AMG uptake by injected hRS1 protein could be observed (Fig. 2). Because BTXB inhibits fusion of intracellular vesicles with the plasma membrane, the data suggest that the posttranscriptional inhibition of hSGLTI by hRS1 is due to the inhibition of an exocytotic pathway. This interpretation was supported by experiments showing that inhibition of hSGLTI expression by hRS1 protein in oocytes was independent of endocytotic pathways. Inhibition of hSGLTI expressed AMG by injection of hRS1 protein was unchanged when endocytosis of hSGLTI was inhibited by the inhibitors of endocytosis clorpromazin, imipramin or filipin (data not shown).
Example 4: A cRNA fragment from the middle part of hRS1 encoding the amino acids QNEQCPQVS exhibits post-transcriptional inhibition of hSGLTI mediated glucose uptake.
Non-injected oocytes, oocytes injected with hSGLTI -cRNA, oocytes injected with hSGLT1-cRNA plus hRS1-cRNA, or oocytes injected with hSGLT1-cRNA plus cRNAs encoding fragments of hRS1 were incubated for three days and the uptake of 50 μM [14C]AMG was measured (Fig. 3). The uptake expressed by hSGLTI was significantly inhibited by 50- 70 % if hRS1 or fragments of hRS1 were co-expressed with hSGLTI . Inhibition was obtained by a N-terminal and C-terminal cRNA fragments that overlap by 27 nucleotides (positions 1366-1392, see data bank accession no. X82877; Lambotte S et al., (1996) DNA Cell Biol. 15, 769-777). These nucleotides encode the amino acids QNEQCPQVS. Inhibition of [14C]AMG uptake expressed by hSGLTI was also observed when a cRNA containing this overlapping part was co-expressed (nucleotides 1366-1392 of hRS1 expressing amino acids 407- 415) with hSGLTI . The data indicate that glucose transport expressed by hSGLTI is inhibited by a 27-nucleotide long cRNA fragment of hRS1 encoding the nonapeptide QNEQCPQVS.
Example 5: Expression of hSGLTI mediated glucose transport is inhibited bythe tripeptide QCP from the middle part of hRS1.
To determine whether the observed inhibition of hSGLTI by co-injection of hRS1- cRNA fragments occurs at the protein level, and to identify the minimal inhibitory peptide, hSGLTI was expressed in oocytes, the indicated peptides were injected into the oocytes, and uptake measurements were started 30 min later. hSGLTI was expressed by injection of 2.5 ng of hSGLTI -cRNA per oocyte and incubation of the oocytes was performed for 3 days. By injection of 50 nl/oocyte containing 1.5 mM of nonapeptide QNEQCPQVS, of the hexapeptides QNEQCP or QCPQVS, and of the tripeptide QCP, uptake of 50 μM [14C]AMG was inhibited by 40-50% (Fig.4). No inhibition was observed with the reverse nonapeptide SVQPCQENQ and with the reversed tripeptide PCQ. The data indicate that glucose uptake by hSGLTI can be inhibited from intracellular by the tripeptide QCP.
Example 6: Demonstration of high-affintiy inhibition of hSGLTI by QCP.
To determine the affinity of QCP to inhibit glucose uptake by hSGLTI, hSGLTI was expressed by injection of SGLT1-cRNA into oocytes and an incubation of the injected oocytes for 3 days. Then, 50 nl Ori buffer per oocyte (control) or 50 nl Ori buffer containing various concentrations of the tripeptide QCP or the reverse tripeptide PCQ were injected. 30 min later, the uptake of 50 μM [14C]AMG was measured (Fig. 5). 35-40% inhibition of hSGLTI expressed AMG uptake was obtained after injection of 50 ni with a QCP concentration of 50 nM. Since the volume of an oocyte is about 1 μl, 35-40% inhibition of hSGLTI expressed glucose uptake was obtained at an intracellular concentration of QCP below 5 nM. With the reverse tripeptide PCQ no inhibition of hSGLTI was observed.
Example 7: QCP is transported by the human H+-peptide cotransporter hPEPTI.
To determine whether QCP is transported by the human peptide transporter hPEPTI that is expressed in the brush-border membrane of small intestinal enterocytes (Daniel and Kottra (2004), Pflugers Arch, 447, 610-618; Liang (1995), J Biol Chem, 270, 6456-6463) hPEPTI was expressed in Xenopus oocytes, the oocyte was superfused with acid Ori buffer (pH 6.5), the membrane potential of the oocytes was clamped to -40 mV and the oocyte was superfused with acid Ori buffer (pH 6.5) containing 5 mM of well transported control dipeptide glycylglutamine (GC) or 5 mM of QCP. In oocytes expressing hPEPTI , both the control peptide GC and the dipeptide QCP induced significant inward currents (Fig. 6). In control oocytes that had not been injected with hPEP1-cRNA, no inward currents could be induced by GC or QCP (data not shown). The data indicate electrogenic transport of QCP by hPEPTI .
Example 8: QCP added to the extracellular fluid can inhibit hSGLTI in cells that express hPEPTI.
It was furthermore elucidated whether in human small intestine the expression of hSGLTI can be inhibited by oral ingestion of QCP. In human small intestine both, hSGLTI and hPEPTI are located in the brush-border membrane of enterocytes (Wright and Turk (2004), Pflugers Arch, 447, 510-518; Daniel and Kottra (2004), Pflugers Arch, 447, 610-618). hSGLTI was expressed alone or SGLT1 together with hPEPTI in Xenopus oocytes, incubated the oocytes for 30 min acid Ori buffer (pH 6.5), with acid Ori buffer containing 3 mM QCP or inactive reverse peptide PCQ. Thereafter the oocytes were washed with neutral Ori buffer and the hSGLTI expressed uptake of 50 μM [14C]AMG was measured (Fig. 7). QCP had no effect in oocytes in which hSGLTI but not hPEPTI was expressed (data not shown). However, in oocytes expressing hSGLTI plus hPEPTI , [14C]AMG uptake was inhibited by about 50% when the oocytes had been incubated with QCP (Fig. 7). Incubation of oocytes expressing hSGLTI plus hPEPTI with PCQ had no effect on the expressed uptake of [14C]AMG.
Example 9: QCP inhibits the expression of hSGLTI for a time period of several hours.
hSGLTI was expressed by injection of SGLT1-cRNA into oocytes and incubation of the injected oocytes for 3 days. Then 50 nl Ori buffer or 50 nl Ori buffer containing 3 mM QCP were injected per oocyte. 3-11 h after the injections uptake of 50 μM [14C]AMG was measured. Fig. 8 shows that the hSGLTI expressed uptake of AMG was inhibited 60% after 3 h, about 40% after 5 h and 20-30% after 10h.
Example 10: Posttranscriptional inhibition of the expression of hSGLTI by QCP can be inhibited by botulinum toxin B.
To distinguish whether QCP inhibits expression of hSGLTI by blocking an exocytotic pathway at the TGN or whether QCP stimulates endocytosis of SGLT1 containing vesicles at the plasma membrane, hSGLTI was expressed in oocytes and measured the effect of injected QCP in the absence and presence of botulinum toxin B (BTXB) (Fig. 9). hSGLTI was expressed, KOri buffer as control, KOri buffer containing QCP, KOri buffer containing the reversed control peptide PCQ, KOri buffer containing BTXB or KOri buffer containing BTXB plus QCP was injected. After 30 min incubation, uptake of 50 μM [14C] AMG was measured. Fig. 9 shows that in the absence of BTXB AMG uptake was inhibited by QCP but not by the reversed control peptide PCQ as shown in Figs. 4 and 5. However, no significant inhibition of AMG uptake by QCP could be observed in the presence of BTXB. Because BTXB inhibits exocytotic fusion of intracellular vesicles with the plasma membrane QCP acts probably on the exocytotic pathway of hSGLTI . The location of hRS1 at the TGN suggests that QCP inhibits SGLT1 expression at the TGN.
Example 11: QCP inhibits the small intestinal D-glucose reabsorption by SGLT1 in vivo. Walls of small intestinal mucosa from mice are inserted into an Ussing chamber and the SGLT1 mediated transepitehila currents are measured that are induced by addition of 0.1 mM D-glucose to the mucosal side. The intestinal walls are pre- incubated for 60 min with buffer at pH 6.5 containing 0.1 mM D-glucose or with buffer at pH 6.5 containing 0.1 mM D-glucose plus 3 mM of QCP. After washing glucose- induced transepithelial currents are measured. The data will document that QCP inhibits transepithelial glucose flux in vivo.
Example 12: QCP inhibits the small intestinal reabsorption of amino acids mediated by sodium dependent amino acid transporters in vivo.
Walls of small intestinal mucosa from mice are inserted into an Ussing chamber and transepitehial currents are measured that are induced by addition of 10 mM of various amino acids to the mucosal side. The intestinal walls are incubated for 60 min with buffer at pH 6.5 containing 0.1 mM D-glucose or with buffer at pH 6.5 containing 0.1 mM D-glucose plus 3 mM of QCP. After washing, amino acid induced transepithelial currents without and with preteatment with QCP are compared. The data would document that QCP inhibits transepithelial flux of amino acids in vivo.
Example 13: The peptides IKPSDSDRIEP and SDSDRIEP from the N-terminal part of hRS1 exhibit post-transcriptional inhibition of hSGLTI mediated glucose uptake.
In Oocytes of Xenopus laevis inhibition of expressed glucose transport was also observed when hSGLTI cRNA was injected with cRNAs encoding various N- terminal fragments of hRS1 (data not shown). Fig. 10 presents an experiment showing that an N-terminal fragment of hRS1 encoding an unodecapeptide inhibits the expression of hSGLTI . Coexpression of hRS1 cRNA encoding amino acids 40- 50 of hRS1 (IKPSDSDRIEP) resulted in a significant inhibition of hSGLTI expressed of glucose uptake by more than 50%. The same level of inhibition was obtained when hSGLTI was coexpressed with total hRS1. It was tested, whether glucose transport expressed by hSGLTI in oocytes could be also inhibited by injection of the unodecapeptide IKPSDSDRIEP and the octapeptide SDSDRIEP. After hSGLTI cRNA injection into oocytes and incubation for 3 days, 50 nl/oocyte of KOri buffer without peptides or of KOri buffer containing 3 mM QCP, 3 mM IKPSDSDRIEP, 3 mM SDSDRIEP, 3 mM QCP plus 3 mM IKPSDSDRIEP or 3 mM of the reverse tripeptide PCQ plus 3 mM of the reverse peptide PEIRDSDSPKI were injected. After injection of peptides the oocytes were incubated for 30 min and the uptake of 50 μM [14C]AMG was measured (Fig. 11). With the unodecapeptide IKPSDSDRIEP and the octapeptide SDSDRIEP, about 50% inhibition of glucose uptake was observed as with QCP. The data show that two peptides of hRS1 are capable to inhibit hSGLTI . Since coinjection of both peptides QCP and IKPSDSDRIEP did not lead to a lower uptake as the injection of each individual peptide, both peptides are supposed to act on the same intracellular regulation process.
Example 14: Inhibitory peptides QCP and IKPSDSDRIEP derived from hRS1 exhibit species independent inhibition of SGLT1.
To develop drugs on the basis of the identified peptides animal models are required. Since the peptides QCP and IKPSDSDRIEP are derived from human RS1 and are not conserved in RS 1 proteins of other species it was tested whether these peptides are capable to inhibit SGLT1 in rabbits that could be used as an animal model for drug development. Rabbit SGLT1 (rbSGLTI) was expressed in oocytes by injection of rbSGLTI cRNA, the oocytes were incubated for 3 days, and 50 nl KOri buffer/oocyte containing 3 mM QCP, 3 mM IKPSDSDRIEP, 3 mM QCP plus 3 mM IKPSDSDRIEP, or 3 mM of the reverse tripeptide PCQ plus 3 mM of the reverse peptide PEIRDSDSPKI were injected, the oocytes were incubated for 30 min, and the uptake of 50 μM [14C]AMG was measured (Fig. 12). Both peptides showed the same effect on glucose uptake expressed by rbSGLTI compared to glucose uptake expressed by hSGLTI (Fig. 11). Injection of both peptides together revealed the same inhibition as injection of each peptide alone. No inhibition of rbSGLTI expressed glucose uptake was observed when both reverse peptides were injected. Example 15: Inhibition of nutrient transporters in small intestine lead to reduction of body weight.
Mice are fed with standard chow (Altromin C1000 containing 32% polysaccharides, 5.5% disaccharides, 19 % protein, 6% fiber, 4% fat, obtained from Altromin GmbH Lage, Germany) or sugar low diet (modified Altromin C 1000 containing 10% polysaccharides, no disaccharides, 19% protein, 6% fiber, increased amount of fat so that the energy content of both diets was identical) and the supplied drinking water is acidified to pH 6.0 and contains 10 mM QCP. The body weight development with and without peptide treatment is compared over 2 months. In addition intestinal motility is compared by measuring the passage time as described in Chen, 2001 (The Journal of Neurosciences, 21 , 6348-6361). The data should document that body weight is reduced after feeding with QCP. In corresponding experiments, rabbits are to be employed.
Example 16: Inhibition of SGLT1 in human epithelial cells by QCP.
CaCo-2 cells were grown 13 days after seeding as described (Mϋller, J. et al. (2005) Biochem. Pharmacol. 70, 1851-1860). 3 days after seeding cells reached confluence. Cells were detached by incubation in PBS (pH. 7.4) containing 2 mM EDTA. They were washed two times by incubation with PBS that was adjusted to pH 6.5 and contained 10 mM AMG, and centrifugation at 1000 x g. Cells were incubated for 30 min with PBS (pH 6.5) containing 10 mM AMG (control) or PBS (pH 6.5) containing 10 mM AMG plus 1 mM QCP. Thereafter the cells were washed three times with PBS (pH 7.5) and AMG uptake was measured by incubation for 2.5 min in PBS (pH 7.5) containing 10 μM [14C]AMG without or with 1 mM phlorizin. SGLT1 mediated uptake was measured by subtracting the uptake in the presence of phlorizin from the uptake without phlorizin. The data indicate that QCP inhibits AMG uptake by SGLT1 in human epithelial cells in the presence of a high intracellular concentration of glucose (see Fig. 13).
Example 17: Glucose dependence of inhibition of SGLT1 mediated AMG uptake by QCP. hSGLTI was expressed in oocytes by cRNA injection and incubation for 3 days as in Fig. 3/Example 1. Per oocyte 25 nl Ori buffer (injected sugar 0 M), 25 nl Ori buffer containing 2 mM (injected sugar 10"4 M), 20 mM (injected sugar 10"3 M) or 200 mM (injected sugar 10'2 M) of AMG (o), D-glucose (Δ) or D-fuctose (□) were injected. In addition 25 nl Ori buffer or 25 nl Ori buffer containing 3 mM QCP were injected. The oocytes were incubated for 30 min and uptake of 50 μM [14C]AMG was measured. Inhibition by QCP in the presence of different concentrations of intracellular monosaccharides was measured. The data indicate that QCP inhibits hSGLTI at low or high concentrations of intracellular monosaccharides (see Fig. 14).
Example 18: Inhibition of hSGLTI expressed glucose transport activity in oocytes by QCP and QCP derived tripeptides,
Oocytes were injected with 2.5 ng hSGLTI -cRNA, incubated for 3 days and 50 nl of buffer (control) or 50 nl of buffer containing 1.5 mM of the indicated peptides (resulting in approximately 75 pmoles of peptides per oocyte) were injected. For each injected peptide, 3 individual experiments with 7-10 buffer-injected control oocytes and 7-10 peptide injected oocytes were performed. The uptake measurements were performed with 50 μM [14C]AMG. The corresponding results are shown in Fig. 15.
The present invention refers to the following nucleotide and amino acid sequences:
SEQ ID No. 1 :
Nucleotide sequence encoding for human RS1 (hRS1) (regulatory solute carrier protein, family 1 , member 1 (Homo sapiens)). atgagcagcctgccgaccagcgatggctttaaccatccggcgcgcagcagcggccagagcccggatgtgggcaac ccgatgagcctggcgcgcagcgtgagcgcgagcgtgtgcccgattaaaccgagcgatagcgatcgcattgaaccg aaagcggtgaaagcgctgaaagcgagcgcggaatttcagctgaacagcgaaaaaaaagaacatctgagcctgcag gatctgagcgatcatgcgagcagcgcggatcatgcgccgaccgatcagagcccggcgatgccgatgcagaacagc agcgaagaaattaccgtggcgggcaacctggaaaaaagcgcggaacgcagcacccagggcctgaaatttcatctg catacccgccaggaagcgagcctgagcgtgaccagcacccgcatgcatgaaccgcagatgtttctgggcgaaaaa gattggcatccggaaaaccagaacctgagccaggtgagcgatccgcagcagcatgaagaaccgggcaacgaacag tatgaagtggcgcagcagaaagcgagccatgatcaggaatatctgtgcaacattggcgatctggaactgccggaa gaacgccagcagaaccagcataaaattgtggatctggaagcgaccatgaaaggcaacggcctgccgcagaacgtg gatccgccgagcgcgaaaaaaagcattccgagcagcgaatgcagcggctgcagcaacagcgaaacctttatggaa attgataccgcgcagcagagcctggtgaccctgctgaacagcaccggccgccagaacgcgaacgtgaaaaacatt ggcgcgctggatctgaccctggataacccgctgatggaagtggaaaccagcaaatgcaacccgagcagcgaaatt ctgaacgatagcattagcacccaggatctgcagccgccggaaaccaacgtggaaattccgggcaccaacaaagaa tatggccattatagcagcccgagcctgtgcggcagctgccagccgagcgtggaaagcgcggaagaaagctgcccg agcattaccgcggcgctgaaagaactgcatgaactgctggtggtgagcagcaaaccggcgagcgaaaacaccagc gaagaagtgatttgccagagcgaaaccattgcggaaggccagaccagcattaaagatctgagcgaacgctggacc cagaacgaacatctgacccagaacgaacagtgcccgcaggtgagctttcatcaggcgattagcgtgagcgtggaa accgaaaaactgaccggcaccagcagcgataccggccgcgaagcggtggaaaacgtgaactttcgcagcctgggc gatggcctgagcaccgataaagaaggcgtgccgaaaagccgcgaaagcattaacaaaaaccgcagcgtgaccgtg accagcgcgaaaaccagcaaccagctgcattgcaccctgggcgtggaaattagcccgaaactgctggcgggcgaa gaagatgcgctgaaccagaccagcgaacagaccaaaagcctgagcagcaactttattctggtgaaagatctgggc cagggcattcagaacagcgtgaccgatcgcccggaaacccgcgaaaacgtgtgcccggatgcgagccgcccgctg ctggaatatgaaccgccgaccagccatccgagcagcagcccggcgattctgccgccgctgatttttccggcgacc gatattgatcgcattctgcgcgcgggctttaccctgcaggaagcgctgggcgcgctgcatcgcgtgggcggcaac gcggatctggcgctgctggtgctgctggcgaaaaacattgtggtgccgacc
SEQ ID No. 2:
Amino acid sequence of human RS1 (hRS1) (regulatory solute carrier protein, family
1 , member 1 (Homo sapiens)).
MSSLPTSDGFNHPARSSGQSPDVGNPMSLARSVSASVCPIKPSDSDRIEPKAVKALKASAEFQLNSEKKEHLSLQ DLSDHASSADHAPTDQSPAMPMQNSSEEITVAGNLEKSAERSTQGLKFHLHTRQEASLSVTSTRMHEPQMFLGEK DWHPENQNLSQVSDPQQHEEPGNEQYEVAQQKASHDQEYLCNIGDLELPEERQQNQHKIVDLEATMKGNGLPQNV DPPSAKKSIPSSECSGCSNSETFMEIDTAQQSLVTLLNSTGRQNANVKNIGALDLTLDNPLMEVETSKCNPSSEI LNDSISTQDLQPPETNVEIPGTNKEYGHYSSPSLCGSCQPSVESAEESCPSITAALKELHELLWSSKPASENTS EEVICQSETIAEGQTSIKDLSERWTQNEHLTQNEQCPQVSFHQAISVSVETEKLTGTSSDTGREAVENVNFRSLG DGLSTDKEGVPKSRESINKNRSVTVTSAKTSNQLHCTLGVEISPKLLAGEEDALNQTSEQTKSLSSNFILVKDLG QGIQNSVTDRPETRENVCPDASRPLLEYEPPTSHPSSSPAILPPLIFPATDIDRILRAGFTLQEALGALHRVGGN ADLALLVLLAKNIWPT
SEQ ID No.3:
Nucleotide sequence encoding for pig RS1 (pRS1) (sodium-glucose cotransporter regulatory chain RS 1 - pig (Sus scrofa domestica). atgagcagcctgccgaccagcgatggctttaaccatcaggcgcatccgagcggccagcgcccggaaattggcagc ccgccgagcctggcgcatagcgtgagcgcgagcgtgtgcccgtttaaaccgagcgatccggatagcattgaaccg aaagcggtgaaagcggtgaaagcgctgaaagcgagcgcggaatttcagattacctttgaacgcaaagaacagctg ccgctgcaggatccgagcgattgcgcgagcagcgcggataacgcgccggcgaaccagaccccggcgattccgctg cagaacagcctggaagaagcgattgtggcggataacctggaaaaaagcgcggaaggcagcacccagggcctgaaa agccatctgcatacccgccaggaagcgagcctgagcgtgaccaccacccgcatgcaggaaccgcagcgcctgatt ggcgaaaaaggctggcatccggaatatcaggatccgagccaggtgaacggcctgcagcagcatgaagaaccgcgc aacgaacagcatgaagtggtgcagcagaacgcgccgcatgatccggaacatctgtgcaacaccggcgatctggaa ctgctgggcgaacgccagcagaaccagccgaaaagcgtgggcctggaaaccgcggtgcgcggcgatcgcccgcag caggatgtggatctgccgggcaccgaaaaaaacattctgccgtatggctgctttggctgcagcagcagcgaaacc tttatggaaattgataccgtggaacagagcctggtggcggtgctgaacagcgcgggcggccagaacaccagcgtg cgcaacattagcgcgagcgatctgaccgtggataacccgctgatggaagtggaaaccctgaaatgcaacccgagc agcgaatttctgagcaacccgaccagcacccagaacctgcagctgccggaaagcagcgtggaaatgagcggcacc aacaaagaatatggcaaccatccgagcagcctgagcctgtgcggcacctgccagccgagcgtggaaagcgcggaa gaaagctgcagcagcattaccgcggcgctgaaagaactgcatgaactgctggtgattagcagcaaaccggcgctg gaaaacaccagcgaagaagtgacctgccgcagcgaaattgtgaccgaaggccagaccgatgtgaaagatctgagc gaacgctggacccagagcgaacatctgaccgcggcgcagaacgaacagtgcagccaggtgagcttttatcaggcg accagcgtgagcgtgaaaaccgaagaactgaccgataccagcaccgatgcgggcaccgaagatgtggaaaacatt accagcagcggcccgggcgatggcctgctggtggataaagaaaacgtgccgcgcagccgcgaaagcgtgaacgaa agcagcctggtgaccctggatagcgcgaaaaccagcaaccagccgcattgcaccctgggcgtggaaattagcccg ggcctgctggcgggcgaagaaggcgcgctgaaccagaccagcgaacagaccgaaagcctgagcagcagctttatt ctggtgaaagatctgggccagggcacccagaacccggtgaccaaccgcccggaaacccgcgaaaacgtgtgcccg gaagcggcgggcctgcgccaggaatttgaaccgccgaccagccatccgagcagcagcccgagctttctggcgccg ctgatttttccggcggcggatattgatcgcattctgcgcgcgggctttaccctgcaggaagcgctgggcgcgctg catcgcgtgggcggcaacgcggatctggcgctgctggtgctgctggcgaaaaacattgtggtgccgacc
SEQ ID No.4:
Amino acid sequence of pig RS1 (pRS1) (sodium-glucose cotransporter regulatory chain RS1 - pig (Sus scrofa domestica).
MSSLPTSDGFNHQAHPSGQRPEIGSPPSLAHSVSASVCPFKPSDPDSIEPKAVKΆVKΆLKASAEFQITFERKEQL PLQDPSDCASSADNAPANQTPAIPLQNSLEEAIVADNLEKSAEGSTQGLKSHLHTRQEASLSVTTTRMQEPQRLI GEKGWHPEYQDPSQVNGLQQHEEPRNEQHEWQQNAPHDPEHLCNTGDLELLGERQQNQPKSVGLETAVRGDRPQ QDVDLPGTEKNILPYGCFGCSSSETFMEIDTVEQSLVAVLNSAGGQNTSVRNISASDLTVDNPLMEVETLKCNPS SEFLSNPTSTQNLQLPESSVEMSGTNKEYGNHPSSLSLCGTCQPSVESAEESCSSITAALKELHELLVISSKPAL ENTSEEVTCRSEIVTEGQTDVKDLSERWTQSEHLTAAQNEQCSQVSFYQATSVSVKTEELTDTSTDAGTEDVENI TSSGPGDGLLVDKENVPRSRESVNESSLVTLDSAKTSNQPHCTLGVEISPGLLAGEEGALNQTSEQTESLSSSFI LVKDLGQGTQNPVTNRPETRENVCPEAAGLRQEFEPPTSHPSSSPSFLAPLIFPAADIDRILRAGFTLQEALGAL
HRVGGNADLALLVLLAKNIWPT
SEQ ID No. 5:
Nucleotide sequence encoding for mouse RS1 (mRS1) (regulatory subunit of SGLT1
(Mus musculus)). atgagcagcctgccgaccagcgatggctttgatcatccggcgccgagcggccagagcccggaagtgggcagcccg accagcctggcgcgcagcgtgagcgcgagcgcgtgcgcgattaaaccgggcgatccgaacagcattgaaagcctg gcgatgcaggcgaccaaagcgagcgcggaatttcagaccaacagcaaaaaaaccgatccgccgccgctgcaggtg ctgccggatctggcgagcagcgcggaacagagcctggcgatgccgtttcataaaagcagcaaagaagcggtggtg gcgggcaacctggaaaaaagcgtggaaaaaggcacccagggcctgcgcgtgtatctgcatacccgccaggatgcg agcctgaccctgaccaccaccggcatgcgcgaaccgcagatttttgcggaagaaaaaagctggcatccggaaaac cagaccccgagcccggtgaacggcctgcagcagcatcgcgaaaccggcagcgtgcagcgcgaagcgggccagcag agcgtgccgcaggatcagggctgcctgtgcgatgcggaagatctggaactgcatgaagaagtggtgagcctggaa gcgctgcgcaaaggcgaactgcagcgccatgcgcatctgccgagcgcggaaaaaggcctgccggcgagcggcctg tgcagctgcccgtgcagcgaagcgctgatggaagtggataccgcggaacagagcctggtggcgatgtgcagcagc accggccgccaggatgcggtgattaaaagcccgagcgtggcgcatctggcgagcgataacccgaccatggaagtg gaaaccctgcagagcaacccgagctgcgaaccggtggaacatagcattctgacccgcgaactgcagctgccggaa gataacgtggatatgagcaccatggataacaaagatgataacagcagcagcctgctgagcggccatggccagccg agcgtggaaagcgcggaagaattttgcagcagcgtgaccgtggcgctgaaagaactgcatgaactgctggtgatt agctgcaaaccggcgagcgaagaaagcccggaacatgtgacctgccagagcgaaattggcgcggaaagccagccg agcgtgagcgatctgagcggccgccgcgtgcagagcgtgcatctgaccccgagcgatcagtatagccagggcagc tgccatcaggcgaccagcgaaagcggcaaaaccgaaattgtgggcaccgcgccgtgcgcggcggtggaagatgaa gcgagcaccagctttgaaggcctgggcgatggcctgagcccggatcgcgaagatgtgcgccgcagcaccgaaagc gcgcgcaaaagctgcagcgtggcgattaccagcgcgaaactgagcgaacagctgccgtgcaccctgggcgtggaa attgcgccggaactggcggcgagcgaaggcgcgcatagccagccgagcgaacatgtgcataacccgggcccggat cgcccggaaaccagcagcgtgtgcccgggcgcgggcctgccgcgcagcggcctggatcagccgccgacccagagc ctgagcaccccgagcgtgctgccgccgtttatttttccggcggcggatgtggatcgcattctgggcgcgggcttt accctgcaggaagcgctgggcgcgctgcatcgcgtgggcggcaacgcggatctggcgctgctggtgctgctggcg aaaaacattgtggtgccgacc
SEQ ID No. 6:
Amino acid sequence of mouse RS1 (mRS1) (regulatory subunit of SGLT1 (Mus musculus)).
MSSLPTSDGFDHPAPSGQSPEVGSPTSLARSVSASACAIKPGDPNSIESLAMQATKASAEFQTNSKKTDPPPLQV LPDLASSAEQSLAMPFHKSSKEAWAGNLEKSVEKGTQGLRVYLHTRQDASLTLTTTGMREPQIFAEEKSWHPEN QTPSPVNGLQQHRETGSVQREAGQQSVPQDQGCLCDAEDLELHEEWSLEALRKGELQRHAHLPSAEKGLPASGL CSCPCSEALMEVDTAEQSLVAMCSSTGRQDAVIKSPSVAHLASDNPTMEVETLQSNPSCEPVEHSILTRELQLPE DNVDMSTMDNKDDNSSSLLSGHGQPSVESAEEFCSSVTVALKELHELLVISCKPASEESPEHVTCQSEIGAESQP SVSDLSGRRVQSVHLTPSDQYSQGSCHQATSESGKTEIVGTAPCAAVEDEASTSFEGLGDGLSPDREDVRRSTES ARKSCSVAITSAKLSEQLPCTLGVEIAPELAASEGAHSQPSEHVHNPGPDRPETSSVCPGAGLPRSGLDQPPTQS LSTPSVLPPFIFPAADVDRILGAGFTLQEALGALHRVGGNADLALLVLLAKNIWPT
SEQ ID No. 7:
Nucleotide sequence encoding for rabbit RS 1 (rbRS1) (regulatory subunit of sodium-
D-glucose cotransporter (Oryctolagυs cuniculus)). atgagcagcagcccgccgctggatggcagcgatcatccggcgcatagcagcggccagagcccggaagcgggcaac ccgaccagcctggcgcgcagcgtgagcgcgagcgtgtgcccggtgaaaccggataacccggatagcaccgaaccg gaagcggtgaccgcgctggaagcgagcgatggctttcagattaacagcaaacagaccgatcgcctgccgctgcag ggccatagcccgtgcgcggcggcggcggcgccgagcagcgcgatgccgctgcgccatagcagcgaagcggcgggc gtggcggatagcctggaagcgagcgcggaacgccgcacccagggcctgcgctttcatctgcatacccgccaggaa gtgaacctgagcattaccaccacccgcatgcatgaaccgcagatgtttgcgggcgaagaaggctggcatccggaa aaccagaacccgagccaggtgaacgatctgcagcagcatcaggaaccggaaaacgcgcgccatgaagcgggcccg cgcgatgcgccgagcgataccggcgatctggaactgccgggcgaacgccagcagaaacatgaagtggcggatcgc gaagcgaccatgcgcggcggccgcctgcagcaggatgcgggcctgccggatccgggcaaaggcgcgctgccgagc ggccattgcggccgcccggatagcgaaaccctgatggaagtggatgcggcggaacagagcctggtggcggtgctg agcagcagcgtgggcaacggcagcgcgagcggcctgaccctgggcaacccgctgatggaagtggaactgccgacc tgcagcccgagcagcgaaattctgaacggcagcattccgattcaggatctgcagccgccggaaggcagcgtggaa atgccgggcaccgatcgcgcgtatggcggccgcgcgagcagcagcagcgtgtgcggcagcagccagccgccggcg gaaagcgcggaagaaagctgcagcagcattaccaccgcgctgaaagaactgcatgaactgctggtgattagcagc aaaccggcgagcgaagcggcgtatgaagaagtgacctgccagagcgaaggcaccgcgtggggccagacccgcgtg aacccgagcgaacgctggaccgaaagcgaacgccgcacccaggatgaagatcgcccgcaggtgagccatgcgatt ccggaatgcgtgaaaaccgaaaaactgaccgatgcgagcccggatacccgcattgaagatggcgaaaacgcgacc tttcagggcccgggcggcggcctgagcaccgatcatggcgcgccgcgcagccgcggcagcgtgcatgaaagccgc agcgtgaccgtgaccagcgcggaaaccagcaaccagagccatcgcaccctgggcgtggaaattagcccgcgcctg ctgaccggcgaaggcgatgcgctgagccagacctgcgaacagaccaaaagcctgctggtgaaagatctgggccag ggcacccagaacccggcgccggatcgcccggcgacccgcgaagatgtgtgccgcgatgcggcgcgcccgagcctg gaagtggaagcgccgccgagccatagcagcggcccgtgcattctgccgccgctgggctttccggcggcggatatt gatcgcattctgcgcgcgggctttaccctgcaggaagcgctgggcgcgctgcatcgcgtgggcggcaacgcggat ctggcgctgctggtgctgctggcgaaaaacattgtggtgccgacc
SEQ ID No. 8:
Amino acid sequence of rabbit RS 1 (rbRS1) (regulatory subunit of sodium-D-glucose cotransporter (Oryctolagus cuniculus)).
MSSSPPLDGSDHPAHSSGQSPEAGNPTSLARSVSASVCPVKPDNPDSTEPEAVTALEASDGFQINSKQTDRLPLQ GHSPCAAAAAPSSAMPLRHSSEAAGVADSLEASAERRTQGLRFHLHTRQEVNLSITTTRMHEPQMFAGEEGWHPE
NQNPSQVNDLQQHQEPENARHEAGPRDAPSDTGDLELPGERQQKHEVADREATMRGGRLQQDAGLPDPGKGALPS GHCGRPDSETLMEVDAAEQSLVAVLSSSVGNGSASGLTLGNPLMEVELPTCSPSSEILNGSIPIQDLQPPEGSVE
MPGTDRAYGGRASSSSVCGSSQPPAESAEESCSSITTALKELHELLVISSKPASEAAYEEVTCQSEGTAWGQTRV NPSERWTESERRTQDEDRPQVSHAIPECVKTEKLTDASPDTRIEDGENATFQGPGGGLSTDHGAPRSRGSVHESR SVTVTSAETSNQSHRTLGVEISPRLLTGEGDALSQTCEQTKSLLVKDLGQGTQNPAPDRPATREDVCRDAARPSL EVEAPPSHSSGPCILPPLGFPAADIDRILRAGFTLQEALGALHRVGGNADLALLVLLAKNIWPT

Claims

1. Use of a regulatory protein RS1 fragment or a nucleic acid molecule encoding said regulatory protein RS 1 fragment for the preparation of a pharmaceutical composition for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a pathological modification of homeostasis, wherein said RS1 fragment is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine-Cysteine-Proline) or derivatives thereof.
2. A method for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a pathological modification of homeostasis, said method comprising administering to a patient in need of such amelioration, prevention and/or treatment a pharmaceutically active amount of a regulatory protein RS 1 fragment or a nucleic acid molecule encoding a regulatory protein RS1 fragment, wherein said RS1 fragment is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine-Cysteine-Proline) or derivatives thereof.
3. The use of claim 1 or the method of claim 2, wherein said metabolic disease or secondary disorder is obesity, hypercholesterolemia, diabetes, hyperglycaemia, diarrhoea, a bile disorder, a renal disorder and/or a disorder related to the deposition of urate crystals in joints, soft tissue and/or the urinary tract.
4. Use of a regulatory protein RS 1 fragment or a nucleic acid molecule encoding said regulatory protein RS 1 fragment for the preparation of food and/or food supplements, wherein said RS 1 fragment is characterized in comprising at least the amino acid sequence Q-C-P (Glutamine-Cysteine-Proline) or derivatives thereof.
5. The use of any one of claims 1 , 3 and 4 or the method of claim 2 or 3, wherein said RS 1 fragment is a fragment derived from a polypeptide selected from the group consisting of:
(a) a polypeptide encoded by a nucleic acid molecule as shown in SEQ ID NO: 1, 3, 5, 7;
(b) a polypeptide encoded by a nucleic acid molecule being at least 55 % homologous to a nucleic acid molecule as shown in SEQ ID NO: 1, 3, 5, 7 and encoding at least the amino acid stretch Q-C-P, Q-S-P, Q-P-P or Q-T-P; and
(c) a polypeptide as shown in any one of SEQ ID NO: 2, 4, 6, 8.
6. The use of any one of claims 1 and 3 to 5 or the method of any one of claims 2, 3 and 5, wherein said RS 1 fragment is derived from pig, rabbit, mouse or human.
7. The use of any one of claims 1 and 3 to 6 or the method of any one of claims 2, 3, 5 and 6, wherein said RS1 fragment is selected from the group consisting of the fragments:
(a) Q-C-P;
(b) Q-N-E-Q-C-P;
(C) Q-C-P-Q-V-S;
(d) Q-N-E-Q-C-P-Q-V-S;
(e) . Q-N-E-Q-C-P-Q-V-S-F;
(f) Q-S-P;
(g) S-S-G-Q-S-P;
(h) Q-S-P-D-V-G;
(i) S-S-G-Q-S-P-D-V-G;
0) P-T-D-Q-S-P;
(k) Q-S-P-A-M-P;
(I) P-T-D-Q-S-P-A-M-P;
(m) Q-P-P;
(n) Q-D-L-Q-P-P;
(o) Q-P-P-E-T-N;
(P) Q-D-L-Q-P-P-E-T-N; and (q) Q-T-P
8. The use of any one of claims 1 and 3 to 7 or the method of any one of claims 2, 3 and 5 to 7, wherein said RS1 fragment is Q-C-P, Q-S-P, Q-P-P or Q-T-P.
9. The use of any one of claims 1 and 3 to 8 or the method of any one of claims 2, 3 and 5 to 8, wherein said RS 1 fragment is to be administered to a human patient.
10. The use of any one of claims 1 and 3 to 9 or the method of any one of claims 2, 3 and 5 to 9, wherein said RS1 fragment is to be administered in a concentration of 2x10"9 M to 5 M.
11. The use of any one of claims 1 and 3 to 10 or the method of any one of claims 2, 3 and 5 to 10, wherein said RS1 fragment is to be administered orally, rectally, topically, intranasally, intrapulmonally, vaginally, intravesically, subcutaneously, intravenously or cutaneously.
12. The use of any one of claims 1 and 3 to 11 or the method of any one of claims 2, 3 and 5 to 11 , wherein said RS1 fragment is to be administered orally.
13. The use of any one of claims 1 and 3 to 12 or the method of any one of claims 2, 3 and 5 to 12, wherein said RS1 fragment is to be administered with a pharmaceutically acceptable carrier.
14. The use or the method of claim 13, wherein said pharmaceutically acceptable carrier is capable to release said RS 1 fragment within the small intestine, renal proximal tubules, colon, rectum or bladder.
15. The use or the method of claim 13 or 14, wherein said pharmaceutically acceptable carrier is capable to release said RS 1 fragment within the small intestine.
16. The use or the method of any one of claims 13 to 15 , wherein said pharmaceutically acceptable carrier comprises a gastric-juice resistant (coated) tablet.
17. Use of a vector comprising a nucleic acid sequence encoding an RS 1 fragment as defined in any one of claims 1 to 8 for the preparation of a pharmaceutical composition for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a pathological modification of homeostasis.
18. Use of claim 17, wherein said metabolic disease or secondary disorder is obesity, hypercholesterolemia, diabetes, hyperglycaemia, diarrhoea, a bile disorder, a renal disorder and/or a disorder related to the deposition of urate crystals in joints, soft tissue and/or the urinary tract.
19. The use of any one of claims 1 and 3 to 18 or the method of any one of claims 2, 3 and 5 to 16, wherein said RS1 fragment interacts with a receptor, transporter and/or channel selected from the group consisting of receptors, transporters and/or channels for sugars, amino acids, peptides, neurotransmitters, vitamins, organic ions, inorganic ions, zwitterions, urea, water, protons and drugs.
20. A method of preparation of a pharmaceutical composition for the amelioration, prevention and/or treatment of a metabolic disease or a secondary disorder caused by a pathological modification of homeostasis, comprising the step of admixing an RS 1 fragment as defined in any one of claims 1 to 8, a nucleic acid molecule as defined in any one of claims 1 to 8 and/or a vector as defined in claim 17 or 18 with a pharmaceutically acceptable carrier.
21. The method of claim 20, wherein said metabolic disease or secondary disorder is obesity, hypercholesterolemia, diabetes, hyperglycaemia, diarrhoea, a bile disorder, a renal disorder and/or a disorder related to the deposition of urate crystals in joints, soft tissue and/or the urinary tract.
22. A method of preparation of food and/or food supplements, comprising the step of admixing an RS 1 fragment as defined in any one of claims 1 to 8, a nucleic acid molecule as defined in any one of claims 1 to 8 and/or a vector as defined in claim 17 or 18 with food basics.
23. The method of claim 22, wherein said food and/or food supplement is selected from the group consisting of:
(a) food and/or food supplement having a low or high glycemic index;
(b) carbohydrate-low or -rich food and/or food supplement; and/or
(c) fat-low or -rich food and/or food supplement.
24. Method of screening for a receptor, transporter and/or channel that (specifically) interacts with an RS 1 fragment as defined in any one of claims 1 to 8, comprising the steps of:
(a) introducing said RS 1 fragment into a system allowing for a candidate receptor, transporter and/or channel to be active, under conditions which allow said RS 1 fragment be active/interacting with said candidate receptor, transporter and/or channel; and
(b) evaluating changes in activity of said candidate receptor, transporter and/or channel in said system.
25. Method of screening for a target and/or an interacting partner of an RS 1 fragment as defined in any one of claims 1 to 8, comprising the steps of:
(a) contacting said RS 1 fragment with a candidate target and/or a candidate interacting partner under conditions allowing for interaction of said candidate target and/or said candidate interacting partner with said RS 1 fragment; and
(b) evaluating the degree of affinity between said candidate target and/or said candidate interacting partner and said RS1 fragment.
26. The use according to any one of claims 1 and 3 to 19 or the method according to any one of claims 2, 3, 5 to 16 and 20 to 25, wherein said derivatives are selected from the group consisting of:
(a) Q-S-P;
(b) Q-T-P; and (C) Q-P-P.
PCT/EP2006/002981 2005-04-04 2006-03-31 Tripeptides that down regulate the activity of plasma membrane transporters including sodium-d-glucose cotransporter sglt1 WO2006105913A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
US11/910,594 US9155778B2 (en) 2005-04-04 2006-03-31 Tripeptides that down regulate the activity of plasma membrane transporters including sodium-D-glucose cotransporter SgIt1
EP06723941.8A EP1896049B1 (en) 2005-04-04 2006-03-31 Tripeptides that down regulate the activity of plasma membrane transporters including sodium-d-glucose cotransporter sglt1
CA002603452A CA2603452A1 (en) 2005-04-04 2006-03-31 Tripeptides that down regulate the activity of plasma membrane transporters including sodium-d-glucose cotransporter sglt1
AU2006231071A AU2006231071B2 (en) 2005-04-04 2006-03-31 Tripeptides that down regulate the activity of plasma membrane transporters including sodium-D-glucose cotransporter SGLT1

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
EP05007319.6 2005-04-04
EP05007319 2005-04-04
US71517505P 2005-09-09 2005-09-09
US60/715,175 2005-09-09

Publications (1)

Publication Number Publication Date
WO2006105913A1 true WO2006105913A1 (en) 2006-10-12

Family

ID=56290803

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2006/002981 WO2006105913A1 (en) 2005-04-04 2006-03-31 Tripeptides that down regulate the activity of plasma membrane transporters including sodium-d-glucose cotransporter sglt1

Country Status (5)

Country Link
US (1) US9155778B2 (en)
EP (1) EP1896049B1 (en)
AU (1) AU2006231071B2 (en)
CA (1) CA2603452A1 (en)
WO (1) WO2006105913A1 (en)

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7834056B2 (en) 2007-04-06 2010-11-16 Shuhua Gu Pharmaceutical composition for gout
WO2013063526A1 (en) 2011-10-28 2013-05-02 Lumena Pharmaceuticals, Inc. Bile acid recycling inhibitors for treatment of hypercholemia and cholestatic liver disease
WO2014144485A1 (en) 2013-03-15 2014-09-18 Lumena Pharmaceuticals, Inc. Bile acid recycling inhibitors for treatment of barrett's esophagus and gastroesophageal reflux disease
WO2014144650A2 (en) 2013-03-15 2014-09-18 Lumena Pharmaceuticals, Inc. Bile acid recycling inhibitors for treatment of primary sclerosing cholangitis and inflammatory bowel disease
EP2937096A1 (en) 2014-04-23 2015-10-28 Julius-Maximilians-Universität Würzburg Peptides derived from RS1 which down-regulate glucose absorption after a glucose rich meal and increase insulin sensitivity
EP2995317A1 (en) 2010-05-26 2016-03-16 Satiogen Pharmaceuticals, Inc. Bile acid recycling inhibitors and satiogens for treatment of diabetes, obesity, and inflammatory gastrointestinal conditions
US9339480B2 (en) 2008-11-26 2016-05-17 Satiogen Pharmaceuticals, Inc. Bile acid recycling inhibitors for treatment of obesity and diabetes
EP3266457A1 (en) 2011-10-28 2018-01-10 Lumena Pharmaceuticals LLC Bile acid recycling inhibitors for treatment of pediatric cholestatic liver diseases
EP4241840A2 (en) 2019-02-12 2023-09-13 Mirum Pharmaceuticals, Inc. Methods for treating cholestasis

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE10006887A1 (en) * 2000-02-16 2001-09-06 Hermann Koepsell Modulators of regulatory protein RS1, useful for treating diabetes or tumors and for increasing drug transport, control concentration of transport proteins in plasma membranes
EP1444890A1 (en) * 2003-02-05 2004-08-11 Hermann Koepsell RS1 deficient transgenic animal and uses thereof

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040010121A1 (en) * 2001-03-16 2004-01-15 Birse Charles E. 7 Human ovarian and ovarian cancer associated proteins
GB0130720D0 (en) * 2001-12-21 2002-02-06 Serono Internat S A Proteins
WO2004061088A2 (en) * 2002-12-30 2004-07-22 Ppd Development, Lp Compositions and methods for inhibiting human immunodeficiency virus infection by down-regulating human cellular genes

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE10006887A1 (en) * 2000-02-16 2001-09-06 Hermann Koepsell Modulators of regulatory protein RS1, useful for treating diabetes or tumors and for increasing drug transport, control concentration of transport proteins in plasma membranes
EP1444890A1 (en) * 2003-02-05 2004-08-11 Hermann Koepsell RS1 deficient transgenic animal and uses thereof

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
LAMBOTTE S ET AL: "THE HUMAN GENE OF A PROTEIN THAT MODIFIES NA+-D-GLUCOSE CO-TRANSPORT", DNA AND CELL BIOLOGY, NEW YORK, NY, US, vol. 15, no. 9, September 1996 (1996-09-01), pages 769 - 777, XP000993045, ISSN: 1044-5498 *
VALENTIN M ET AL: "The transport modifier RS1 is localized at the inner side of the plasma membrane and changes membrane capacitance", BIOCHIMICA ET BIOPHYSICA ACTA. BIOMEMBRANES, AMSTERDAM, NL, vol. 1468, no. 1-2, 29 September 2000 (2000-09-29), pages 367 - 380, XP004273331, ISSN: 0005-2736 *

Cited By (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7834056B2 (en) 2007-04-06 2010-11-16 Shuhua Gu Pharmaceutical composition for gout
US10555950B2 (en) 2008-11-26 2020-02-11 Satiogen Pharmaceuticals, Inc. Bile acid recycling inhibitors for treatment of obesity and diabetes
US9339480B2 (en) 2008-11-26 2016-05-17 Satiogen Pharmaceuticals, Inc. Bile acid recycling inhibitors for treatment of obesity and diabetes
US10251880B2 (en) 2010-05-26 2019-04-09 Satiogen Pharmaceuticals, Inc. Bile acid recycling inhibitors and satiogens for treatment of diabetes, obesity, and inflammatory gastrointestinal conditions
US10188646B2 (en) 2010-05-26 2019-01-29 Satiogen Pharmaceuticals, Inc. Bile acid recycling inhibitors and satiogens for treatment of diabetes, obesity, and inflammatory gastrointestinal conditions
EP3593802A2 (en) 2010-05-26 2020-01-15 Satiogen Pharmaceuticals, Inc. Bile acid recycling inhibitors and satiogens for treatment of diabetes, obesity, and inflammatory gastrointestinal conditions
EP2995317A1 (en) 2010-05-26 2016-03-16 Satiogen Pharmaceuticals, Inc. Bile acid recycling inhibitors and satiogens for treatment of diabetes, obesity, and inflammatory gastrointestinal conditions
EP4137137A1 (en) 2010-05-26 2023-02-22 Satiogen Pharmaceuticals, Inc. Bile acid recycling inhibitors and satiogens for treatment of diabetes, obesity, and inflammatory gastrointestinal conditions
US11260053B2 (en) 2010-05-26 2022-03-01 Satiogen Pharmaceuticals, Inc. Bile acid recycling inhibitors and satiogens for treatment of diabetes, obesity, and inflammatory gastrointestinal conditions
US10512657B2 (en) 2011-10-28 2019-12-24 Lumena Pharmaceutials Llc Bile acid recycling inhibitors for treatment of pediatric cholestatic liver diseases
US11376251B2 (en) 2011-10-28 2022-07-05 Shire Human Genetic Therapies, Inc. Bile acid recycling inhibitors for treatment of pediatric cholestatic liver diseases
EP3278796A1 (en) 2011-10-28 2018-02-07 Lumena Pharmaceuticals LLC Bile acid recycling inhibitors for treatment of hypercholemia and cholestatic liver disease
EP3266457A1 (en) 2011-10-28 2018-01-10 Lumena Pharmaceuticals LLC Bile acid recycling inhibitors for treatment of pediatric cholestatic liver diseases
WO2013063526A1 (en) 2011-10-28 2013-05-02 Lumena Pharmaceuticals, Inc. Bile acid recycling inhibitors for treatment of hypercholemia and cholestatic liver disease
US11229661B2 (en) 2011-10-28 2022-01-25 Shire Human Genetic Therapies, Inc. Bile acid recycling inhibitors for treatment of pediatric cholestatic liver diseases
WO2014144485A1 (en) 2013-03-15 2014-09-18 Lumena Pharmaceuticals, Inc. Bile acid recycling inhibitors for treatment of barrett's esophagus and gastroesophageal reflux disease
WO2014144650A2 (en) 2013-03-15 2014-09-18 Lumena Pharmaceuticals, Inc. Bile acid recycling inhibitors for treatment of primary sclerosing cholangitis and inflammatory bowel disease
WO2015162214A1 (en) 2014-04-23 2015-10-29 Julius-Maximilians-Universität Würzburg Peptides derived from rs1 which down-regulate glucose absorption after a glucose rich meal and increase insulin sensitivity
US10105414B2 (en) 2014-04-23 2018-10-23 Julius-Maximilians-Universität Würzburg Peptides derived from RS1 which down-regulate glucose absorption after a glucose rich meal and increase insulin sensitivity
EP2937096A1 (en) 2014-04-23 2015-10-28 Julius-Maximilians-Universität Würzburg Peptides derived from RS1 which down-regulate glucose absorption after a glucose rich meal and increase insulin sensitivity
EP4241840A2 (en) 2019-02-12 2023-09-13 Mirum Pharmaceuticals, Inc. Methods for treating cholestasis
EP4245367A2 (en) 2019-02-12 2023-09-20 Mirum Pharmaceuticals, Inc. Methods for treating cholestasis

Also Published As

Publication number Publication date
CA2603452A1 (en) 2006-10-12
EP1896049A1 (en) 2008-03-12
AU2006231071B2 (en) 2012-09-06
US9155778B2 (en) 2015-10-13
US20090203621A1 (en) 2009-08-13
AU2006231071A1 (en) 2006-10-12
EP1896049B1 (en) 2017-11-29

Similar Documents

Publication Publication Date Title
EP1896049B1 (en) Tripeptides that down regulate the activity of plasma membrane transporters including sodium-d-glucose cotransporter sglt1
US8207133B1 (en) Peptides that down regulate the activity of plasma membrane transporters including sodium-D-glucose cotransporter SGLT1
Liu et al. Exploration of the molecular interactions between angiotensin-I-converting enzyme (ACE) and the inhibitory peptides derived from hazelnut (Corylus heterophylla Fisch.)
JP2007261999A (en) Hypotensive peptide derived from royal jelly
AU2005302921B2 (en) Protein hydrolysate with antidiabetic effect
WO2017010133A1 (en) Composition that contains plant- or animal-derived peptide and inhibits serum carnosinase
KR20210036293A (en) Composition for improving, protecting or treating sarcopenia comprising whey protein hydrolysate
US10105414B2 (en) Peptides derived from RS1 which down-regulate glucose absorption after a glucose rich meal and increase insulin sensitivity
RU2572623C2 (en) Peptide
EP1480668A1 (en) Compositions and methods for promoting lipid mobilization, glycogen mobilization,or both, in humans
CN104640989A (en) Osteopontin peptide fragments for use in suppression or prevention of tumor growth
JP7318897B2 (en) Peptides, compositions, and ghrelin secretagogues
JP2005255670A (en) Hypotensive peptide derived from royal jelly
JP2022072837A (en) Oxytocin receptor-operated composition
US20220330595A1 (en) Angiotensin-converting enzyme inhibitor, blood pressure-lowering agent, and beverages and food products
US20190183811A1 (en) Composition containing squalene for improving muscle function and preventing muscle damage
KR102008621B1 (en) Composition for Increas of Muscle Growth or Improvement of Exercise Performance Using Fractions of Alcalase Hydrolysates of Hippocampus abdominalis, or Effective Peptides Thereof
JP5317456B2 (en) Composition for promoting blood secretion of endogenous opioid peptides
KR20230040782A (en) Insect-derived Proteatiamycine-9 peptide with anti-inflammation and a use of the peptide
JP2022522723A (en) A composition for the prevention or treatment of muscle diseases containing LRRD2, a Slit3 protein bound to albumin.
JP2007031364A (en) Anti-arteriosclerotic agent

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application
WWE Wipo information: entry into national phase

Ref document number: 2603452

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2006231071

Country of ref document: AU

NENP Non-entry into the national phase

Ref country code: DE

WWW Wipo information: withdrawn in national office

Ref document number: DE

ENP Entry into the national phase

Ref document number: 2006231071

Country of ref document: AU

Date of ref document: 20060331

Kind code of ref document: A

WWP Wipo information: published in national office

Ref document number: 2006231071

Country of ref document: AU

REEP Request for entry into the european phase

Ref document number: 2006723941

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2006723941

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: RU

WWW Wipo information: withdrawn in national office

Ref document number: RU

WWE Wipo information: entry into national phase

Ref document number: 11910594

Country of ref document: US

WWP Wipo information: published in national office

Ref document number: 2006723941

Country of ref document: EP