WO2006098764A2 - Potassium channel blockers - Google Patents

Potassium channel blockers Download PDF

Info

Publication number
WO2006098764A2
WO2006098764A2 PCT/US2005/032129 US2005032129W WO2006098764A2 WO 2006098764 A2 WO2006098764 A2 WO 2006098764A2 US 2005032129 W US2005032129 W US 2005032129W WO 2006098764 A2 WO2006098764 A2 WO 2006098764A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
substituted
residues
tyr
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2005/032129
Other languages
French (fr)
Other versions
WO2006098764A3 (en
Inventor
Baldomero M. Olivera
Heinrich Terlau
Julita S. Imperial
James E. Garrett
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Max Planck Gesellschaft zur Foerderung der Wissenschaften eV
Cognetix Inc
University of Utah Research Foundation Inc
Original Assignee
Max Planck Gesellschaft zur Foerderung der Wissenschaften eV
Cognetix Inc
University of Utah Research Foundation Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Max Planck Gesellschaft zur Foerderung der Wissenschaften eV, Cognetix Inc, University of Utah Research Foundation Inc filed Critical Max Planck Gesellschaft zur Foerderung der Wissenschaften eV
Publication of WO2006098764A2 publication Critical patent/WO2006098764A2/en
Publication of WO2006098764A3 publication Critical patent/WO2006098764A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides

Definitions

  • the present invention is directed to conopeptides termed conkunitzins and their use for blocking the flow of potassium ions through voltage-gated potassium channels.
  • conkunitzins In view of the Kunitz domain in the conkunitzins, they are also useful for inhibiting platelet aggregation and as protease inhibitors.
  • Mollusks of the genus Conus produce a venom that enables them to carry out their unique predatory lifestyle. Prey are immobilized by the venom that is injected by means of a highly specialized venom apparatus, a disposable hollow tooth that functions both in the manner of a harpoon and a hypodermic needle.
  • Venom may be used as a primary weapon to capture prey or as a defense mechanism. Many of these venoms contain molecules directed to receptors and ion channels of neuromuscular systems.
  • the predatory cone snails ⁇ Conus have developed a unique biological strategy. Their venom contains relatively small peptides that are targeted to various neuromuscular receptors and may be equivalent in their pharmacological diversity to the alkaloids of plants or secondary metabolites of microorganisms. Many of these peptides are among the smallest nucleic acid- encoded translation products having defined conformations, and as such, they are somewhat unusual. Peptides in this size range normally equilibrate among many conformations. Proteins having a fixed conformation are generally much larger.
  • the cone snails that produce these toxic peptides which are generally referred to as conotoxins or conotoxin peptides, are a large genus of venomous gastropods comprising approximately 500 species.
  • AU cone snail species are predators that inject venom to capture prey, and the spectrum of animals that the genus as a whole can envenomate is broad.
  • hunting strategies are used, however, every Conus species uses fundamentally the same basic pattern of envenomation.
  • peptides have unusual age-dependent physiological effects: they induce a sleep-like state in mice younger than two weeks and hyperactive behavior in mice older than 3 weeks (Haack et al., 1990).
  • ⁇ -conotoxins now named icA conotoxins
  • peptides named contryphans containing D- tryptophan residues have been isolated from Conus radiatus (U.S. Patent No. 6,077,934)
  • bromo-tryptophan conopeptides have been isolated from Conus imperialis and Conus radiatus (U.S. Patent No. 5,889,147).
  • Potassium channels comprise a large and diverse group of proteins that, through maintenance of the cellular membrane potential, are fundamental in normal biological function. These channels are vital in controlling the resting membrane potential in excitable cells and can be broadly sub-divided into three classes: voltage-gated K + channels, Ca 2+ activated K + channels and ATP-sensitive K channels. Many disorders are associated with abnormal flow of potassium ions through these channels. The identification of agents which would regulate the flow of potassium ions through each of these channel types would be useful in treating disorders associated with such abnormal flow. [0010] It is desired to identify additional conotoxin peptides having activities of the above conopeptides, as well as conotoxin peptides having additional activities.
  • the present invention is directed to conopeptides termed conkunitzins and their use for blocking the flow of potassium ions through voltage-gated potassium channels.
  • the conkunitzins described herein are useful for treating various disorders as described in further detail herein. In view of the Kunitz domain in the conkunitzins, they are also useful for inhibiting platelet aggregation and as protease inhibitors.
  • the present invention is directed to uses of the conkunitzins described herein for regulating the flow of potassium ions through K + channels.
  • disorders which can be treated using these conopeptides include multiple sclerosis, other demyelinating diseases (such as acute dis shiated encephalomyelitis, optic neuromyelitis, adrenoleukodystrophy, acute transverse myelitis, progressive multifocal leukoencephalopathy), sub-acute sclerosing panencephalomyelitis (SSPE), metachromatic leukodystrophy, Pelizaeus- Merzbacher disease, spinal cord injury, botulinum toxin poisoning, Huntington's chorea, compression and entrapment neurophathies (such as carpal tunnel syndrome, ulnar nerve palsy), cardiovascular disorders (such as cardiac arrhythmias, congestive heart failure), reactive gliosis, hyperglycemia, immunosuppression, cocaine addiction, cancer, cognitive dysfunction and disorders resulting from defects in neurotransmitter release (such as Eaton-Lambert syndrome), hi addition, these conkunitzins can provide reversal of the actions of curare
  • the present invention is directed to conkunitzins, having the amino acid sequences set forth in Tables 1-5 below, as well as the corresponding propeptides and the nucleic acids that encode the propeptides that are set forth in Table 1.
  • the present invention is further directed to derivatives of the conkunitzins described herein or pharmaceutically acceptable salts of these peptides.
  • Substitutions of one amino acid for another can be made at one or more additional sites within the described peptides, and may be made to modulate one or more of the properties of the peptides. Substitutions of this kind are preferably conservative, i.e., one amino acid is replaced with one of similar shape and charge.
  • Conservative substitutions are well known in the art and include, for example: alanine to glycine, arginine to lysine, asparagine to glutamine or histidine, glycine to proline, leucine to valine or isoleucine, serine to threonine, phenylalanine to tyrosine, and the like.
  • Examples of derivatives include peptides in which the Arg residues may be substituted by Lys, ornithine, homoargine, nor-Lys, N-methyl-Lys, N,N-dimethyl-Lys, N,N,N-trimethyl- Lys or any synthetic basic amino acid; the Lys residues may be substituted by Arg, ornithine, homoargine, nor-Lys, or any synthetic basic amino acid; the Tyr residues may be substituted with meta-Tyr, ortho-Tyr, nor-Tyr, mono-halo-Tyr, di-halo-Tyr, O-sulpho-Tyr, O-phospho-Tyr, nitro-Tyr or any synthetic hydroxy containing amino acid; the Ser residues may be substituted with Thr or any synthetic hydroxylated amino acid; the Tlir residues may be substituted with Ser or any synthetic hydroxylated amino acid; the Phe residues may be substituted with any synthetic aromatic amino
  • the halogen may be iodo, chloro, fluoro or bromo; preferably iodo for halogen substituted-Tyr and bromo for halogen-substituted Trp.
  • the Tyr residues may also be substituted with the 3-hydroxyl or 2-hydroxyl isomers (meta-Tyr or ortho-Tyr, respectively) and corresponding O-sulpho- and O-phospho-derivatives.
  • the acidic amino acid residues may be substituted with any synthetic acidic amino acid, e.g., tetrazolyl derivatives of GIy and Ala.
  • the Leu residues may be substituted with Leu (D).
  • the GIu residues may be substituted with GIa.
  • the GIa residues may be substituted with GIu.
  • the N-terminal GIn residues may be substituted with pyroGlu.
  • the Met residues may be substituted with norleucine (NIe).
  • the Cys residues may be in D or L configuration and may optionally be substituted with homocysteine (D or L).
  • the present invention is further directed to derivatives of the above peptides and peptide derivatives which are acylic permutations in which the cyclic permutants retain the native bridging pattern of native toxin. See Craik et al. (2001).
  • Examples of synthetic aromatic amino acids include, but are not limited to, nitro-Phe, 4-substituted-Phe wherein the substituent is Cj-C 3 alkyl, carboxyl, hyrdroxymethyl, sulphomethyl, halo, phenyl, -CHO, -CN, -SO 3 H and -NHAc.
  • Examples of synthetic hydroxy containing amino acids include, but are not limited to, such as 4-hydroxymethyl-Phe, 4- hydroxyphenyl-Gly, 2,6-dimethyl-Tyr and 5-amino-Tyr.
  • Examples of synthetic basic amino acids include, but are not limited to, N-l-(2-pyrazolinyl)-Arg, 2-(4 ⁇ piperinyl)-Gly, 2-(4- piperinyi)-Ala, 2-[3-(2S)pyrrolininyl)-Gly and 2-[3-(2S)pyrrolininyl)-Ala.
  • synthetic basic amino acids, synthetic hydroxy containing amino acids or synthetic aromatic amino acids are described in Building Block Index, Version 3.0 (1999 Catalog, pages 4-47 for hydroxy containing amino acids and aromatic amino acids and pages 66-87 for basic amino acids; see also their online catalog), incorporated herein by reference, by and available from RSP Amino Acid Analogues, Inc., Worcester, MA.
  • Examples of synthetic acid amino acids include those derivatives bearing acidic functionality, including carboxyl, phosphate, sulfonate and synthetic tetrazolyl derivatives such as described by Ornstein et al. (1993) and in U.S. Patent No. 5,331,001, each incorporated herein by reference, and such as shown in the following schemes 1-3.
  • R COOH, tetrazole, CH 2 COOH, 4-NHSO 2 CH 3 , 4-NHSO 2 Phenyl, 4-CH 2 SO 3 H, SO 3 H, 4-CH 2 PO 3 H 2 , CH 2 CH 2 COOH, OCH 2 Tetrazole, CH 2 STetrazole, HNTetrazole, CONHSO 2 Ri where R 1 is CH 3 or Phenyl SO 2 -Tetrazole, CH 2 CH 2 SO 3 H, 1,2,4-tetrazole, 3-isoxazolone, amidotetrazole, CH 2 CH 2 PO 3 H 2
  • R COOH, tetrazole, CH 2 COOH, CH 2 tetrazole
  • the Asn residues may be modified to contain an N-glycan and the Ser, Thr and Hyp residues may be modified to contain an O-glycan (e.g., g-N, g-S, g-T and g-Hyp).
  • a glycan shall mean any N-, S- or O-linked mono-, di-, tri-, poly- or oligosaccharide that can be attached to any hydroxy, amino or thiol group of natural or modified amino acids by synthetic or enzymatic methodologies known in the art.
  • the monosaccharides making up the glycan can include D-allose, D-altrose, D-glucose, D-mannose, D-gulose, D-idose, D-galactose, D-talose, D-galactosamine, D-glucosamine, D-N-acetyl-glucosamine (GIcNAc), D-N-acetyl- galactosamine (GaINAc), D-fucose or D-arabinose.
  • These saccharides may be structurally modified, e.g., with one or more O-sulfate, O-phosphate, O-acetyl or acidic groups, such as sialic acid, including combinations thereof.
  • the glycan may also include similar polyhydroxy groups, such as D-penicillamine 2,5 and halogenated derivatives thereof or polypropylene glycol derivatives.
  • the glycosidic linkage is beta and 1-4 or 1-3, preferably 1-3.
  • the linkage between the glycan and the amino acid may be alpha or beta, preferably alpha and is 1-.
  • Core O-glycaiis have been described by Van de Steen et al. (1998), incorporated herein by reference. Mucin type O-linked oligosaccharides are attached to Ser or Thr (or other hydroxylated residues of the present peptides) by a GaINAc residue.
  • the monosaccharide building blocks and the linkage attached to this first GaINAc residue define the "core glycans," of which eight have been identified.
  • the type of glycosidic linkage (orientation and connectivities) are defined for each core glycan.
  • Suitable glycans and glycan analogs are described further in U.S. Patent Applicantion Serial No. 09/420,797 filed 19 October 1999 and in Internatioinal Patent Application No. PCT/US99/24380 filed 19 October 1999 (publication No. WO 00/23092), each incorporated herein by reference.
  • a preferred glycan is Gal( ⁇ l->3)GalNAc( ⁇ l ⁇ ).
  • pairs of Cys residues may be replaced pairwise with isoteric lactam or ester-thioether replacements, such as Ser/(Glu or Asp),
  • Lys/(Glu or Asp), Cys/(Glu or Asp) or Cys/Ala combinations are sequential coupling by known methods (Barnay et al., 2000; Hruby et al, 1994; Bitan et al, 1997) allows replacement of native Cys bridges with lactam bridges.
  • Thioether analogs may be readily synthesized using halo- Ala residues commercially available from RSP Amino Acid Analogues.
  • individual Cys residues may be replaced with homoCys, seleno-Cys or penicillamine, so that disulfide bridges may be formed between Cys-homoCys or Cys-penicillamine, or homoCys- penicillamine and the like.
  • the present invention is directed conlcunitzins and their uses as described above.
  • Potassium channels comprise a large and diverse group of proteins that, through maintenance of the cellular membrane potential, are fundamental in normal biological function.
  • the therapeutic applications for compounds that regulate the flow of potassium ions through K channels are far- reaching and include treatments of a wide range of disease and injury states.
  • disorders which can be treated using these conopeptides include multiple sclerosis, other demyelinating diseases (such as acute dissenmiated encephalomyelitis, optic neuromyelitis, adrenoleukodystrophy, acute transverse myelitis, progressive multifocal leukoencephalopathy), sub-acute sclerosing panencephalomyelitis (SSPE), metachromatic leukodystrophy, Pelizaeus-Merzbacher disease, spinal cord injury, botulinum toxin poisoning, Huntington's chorea, compression and entrapment neurophathies (such as carpal tunnel syndrome, ulnar nerve palsy), cardiovascular disorders (such as cardiac arrhythmias, congestive heart failure), reactive gliosis, hyperglycemia, immunosuppression, cocaine addiction, cancer, cognitive dysfunction and disorders resulting ⁇ from defects in neurotransmitter release (such as Eaton-Lambert syndrome).
  • demyelinating diseases such as acute dissenmi
  • the conkunitzins of the present invention are identified by isolation from Coitus venom or by using recombinant DNA techniques by screening cDNA libraries of various Conus species using conventional techniques, such as the use of reverse-transcriptase polymerase chain reaction (RT-PCR) or the use of degenerate probes. Clones which hybridize to degenerate probes are analyzed to identify those which meet minimal size requirements, i.e., clones having approximately 400 nucleotides (for a propeptide), as determined using PCR primers which flank the cDNA cloning sites for the specific cDNA library being examined. These minimal-sized clones and the clones produced by RT-PCR are then sequenced.
  • RT-PCR reverse-transcriptase polymerase chain reaction
  • the conopeptides of the present invention can be obtained by purification from cone snails, because the amounts of conopeptides obtainable from individual snails are very small, the desired substantially pure conopeptides are best practically obtained in commercially valuable amounts by chemical synthesis using solid-phase strategy.
  • the yield from a single cone snail may be about 10 micrograms or less of conopeptide.
  • substantially pure is meant that the peptide is present in the substantial absence of other biological molecules of the same type; it is preferably present in an amount of at least about 85% purity and preferably at least about 95% purity. Chemical synthesis of biologically active conopeptides depends of course upon correct determination of the amino acid sequence.
  • the conopeptides of the present invention may be isolated, synthesized and/or substantially pure.
  • the conopeptides can also be produced by recombinant DNA techniques well known in the art. Such techniques are described by Sambrook et al. (1989). The peptides produced in this manner are isolated, reduced if necessary, and oxidized to form the correct disulfide bonds, if present in the final molecule.
  • One method of forming disulfide bonds in the conopeptides of the present invention is the air oxidation of the linear peptides for prolonged periods under cold room temperatures or at room temperature. This procedure results in the creation of a substantial amount of the bioactive, disulfide-linked peptides.
  • the oxidized peptides are fractionated using reverse-phase high performance liquid chromatography (HPLC) or the like, to separate peptides having different linked configurations. Thereafter, either by comparing these fractions with the elution of the native material or by using a simple assay, the particular fraction having the correct linkage for maximum biological potency is easily determined. It is also found that the linear peptide, or the oxidized product having more than one fraction, can sometimes be used for in vivo administration because the cross-linking and/or rearrangement which occurs in vivo has been found to create the biologically potent conopeptide molecule. However, because of the dilution resulting from the presence of other fractions of less biopotency, a somewhat higher dosage may be required. [0027]
  • the peptides are synthesized by a suitable method, such as by exclusively solid-phase techniques, by partial solid-phase techniques, by fragment condensation or by classical solution couplings.
  • the peptide chain can be prepared by a series of coupling reactions in which constituent amino acids are added to the growing peptide chain in the desired sequence.
  • various coupling reagents e.g., dicyclohexylcarbodiimide or diisopropylcarbonyldimidazole
  • various active esters e.g., esters of N-hydroxyphthalimide or N-hydroxy-succinimide
  • the various cleavage reagents to carry out reaction in solution, with subsequent isolation and purification of intermediates, is well known classical peptide methodology.
  • the protecting group preferably retains its protecting properties and is not split off under coupling conditions
  • the protecting group should be stable under the reaction conditions selected for removing the ⁇ -amino protecting group at each step of the synthesis
  • the side chain protecting group must be removable, upon the completion of the synthesis containing the desired amino acid sequence, under reaction conditions that will not undesirably alter the peptide chain.
  • peptides are not so prepared, they are preferably prepared using the Merrifield solid-phase synthesis, although other equivalent chemical syntheses known in the art can also be used as previously mentioned.
  • Solid-phase synthesis is commenced from the C-terminus of the peptide by coupling a protected ⁇ -amino acid to a suitable resin.
  • a suitable resin can be prepared by attaching an ⁇ -amino-protected amino acid by an ester linkage to a chloromethylated resin or a hydroxymethyl resin, or by an amide bond to a benzhydrylamine (BHA) resin or paramethylbenzhydrylamine (MBHA) resin.
  • BHA benzhydrylamine
  • MBHA paramethylbenzhydrylamine
  • Chloromethylated resins are commercially available from Bio Rad Laboratories (Richmond, CA) and from Lab. Systems, Inc. The preparation of such a resin is described by Stewart and Young (1969).
  • BHA and MBHA resin supports are commercially available, and are generally used when the desired polypeptide being synthesized has an unsubstituted amide at the C-terminus.
  • solid resin supports may be any of those known in the art, such as one having the formulae -O-CH 2 -resin support, -NH BHA resin support, or -NH-MBHA resin support.
  • use of a BHA or MBHA resin is preferred, because cleavage directly gives the amide.
  • N-methyl amide In case the N-methyl amide is desired, it can be generated from an N-methyl BHA resin. Should other substituted amides be desired, the teaching of U.S. Patent No. 4,569,967 (Kornheim et al., 1986) can be used, or should still other groups than the free acid be desired at the C-terminus, it may be preferable to synthesize the peptide using classical methods as set forth in the Houben- Weyl text (1974).
  • the C-terminal amino acid protected by Boc or Fmoc and by a side-chain protecting group, if appropriate, can be first coupled to a chloromethylated resin according to the procedure set forth in Horiki et al. (1978), using KP in DMF at about 6O 0 C for 24 hours with stirring, when a peptide having free acid at the C-terminus is to be synthesized.
  • the ⁇ -amino protecting group is removed, as by using trifluoroacetic acid (TFA) in methylene chloride or TFA alone.
  • TFA trifluoroacetic acid
  • the deprotection is carried out at a temperature between about O 0 C and room temperature.
  • Other standard cleaving reagents, such as HCl in dioxane, and conditions for removal of specific ⁇ - amino protecting groups may be used as described in Schroder and Lubke (1965).
  • the remaining ⁇ -amino- and side chain-protected amino acids are coupled step-wise in the desired order to obtain the intermediate compound defined hereinbefore, or as an alternative to adding each amino acid separately in the synthesis, some of them may be coupled to one another prior to addition to the solid phase reactor.
  • Selection of an appropriate coupling reagent is within the skill of the art. Particularly suitable as a coupling reagent is N,N'-dicyclohexylcarbodiimide (DCC, DIC, HBTU, HATU, TBTU in the presence of HoBt or HoAt).
  • activating reagents used in the solid phase synthesis of the peptides are well known in the peptide art.
  • suitable activating reagents are carbodiimides, such as N,N'-diisopropylcarbodiimide and N-ethyl-N'-(3-dimethylaminopropyl)carbodiimide.
  • Other activating reagents and their use in peptide coupling are described by Schroder and Lubke (1965) and Kapoor (1970).
  • Each protected amino acid or amino acid sequence is introduced into the solid-phase reactor in about a twofold or more excess, and the coupling may be carried out in a medium of dimethylformamide (DMF): CH 2 Cl 2 (1:1) or in DMF or CH 2 Cl 2 alone.
  • DMF dimethylformamide
  • the coupling procedure is repeated before removal of the ⁇ -amino protecting group prior to the coupling of the next amino acid.
  • the success of the coupling reaction at each stage of the synthesis if performed manually, is preferably monitored by the ninhydrin reaction, as described by Kaiser et al. (1970).
  • Coupling reactions can be performed automatically, as on a Beckman 990 automatic synthesizer, using a program such as that reported in Rivier et al.
  • the intermediate peptide can be removed from the resin support by treatment with a reagent, such as liquid hydrogen fluoride or TFA (if using Fmoc chemistry), which not only cleaves the peptide from the resin but also cleaves all remaining side chain protecting groups and also the ⁇ -amino protecting group at the N-terminus if it was not previously removed to obtain the peptide in the form of the free acid.
  • a reagent such as liquid hydrogen fluoride or TFA (if using Fmoc chemistry)
  • TFA trifiuoroacetic acid
  • one or more scavengers such as anisole, cresol, dimethyl sulfide and methylethyl sulfide are included in the reaction vessel.
  • Cyclization of the linear peptide is preferably affected, as opposed to cyclizing the peptide while a part of the peptido-resin, to create bonds between Cys residues.
  • fully protected peptide can be cleaved from a hydroxymethylated resin or a chloromethylated resin support by ammonolysis, as is well known in the art, to yield the fully protected amide intermediate, which is thereafter suitably cyclized and deprotected.
  • deprotection, as well as cleavage of the peptide from the above resins or a benzhydrylamine (BHA) resin or a methylbenzhydrylamine (MBHA), can take place at 0°C with hydrofluoric acid (HF) or TFA, followed by oxidation as described above.
  • a suitable method for cyclization is the method described by Cartier et al. (1996).
  • Muteins, analogs or active fragments, of the foregoing conkunitzins are also contemplated here. See, e.g., Hammerland et al (1992).
  • Derivative muteins, analogs or active fragments of the conkunitzins may be synthesized according to known techniques, including conservative amino acid substitutions, such as outlined in U.S. Patents No. 5,545,723 (see particularly col. 2, line 50 to col. 3, line 8); 5,534,615 (see particularly col. 19, line 45 to col. 22, line 33); and 5,364,769 (see particularly col. 4, line 55 to col. 7, line 26), each incorporated herein by reference.
  • compositions containing a compound of the present invention as the active ingredient can be prepared according to conventional pharmaceutical compounding techniques. See, for example, Remington 's Pharmaceutical Sciences, 18th Ed. (1990, Mack Publishing Co., Easton, PA). Typically, an antagonistic amount of the active ingredient will be admixed with a pharmaceutically acceptable carrier.
  • the carrier may take a wide variety of forms depending on the form of preparation desired for administration, e.g., intravenous, oral or parenteral. For examples of delivery methods, see U.S. Patent No. 5,844,077, incorporated herein by reference.
  • the compounds can be formulated into solid or liquid preparations such as capsules, pills, tablets, lozenges, melts, powders, suspensions or emulsions.
  • any of the usual pharmaceutical media may be employed, such as, for example, water, glycols, oils, alcohols, flavoring agents, preservatives, coloring agents, suspending agents and the like in the case of oral liquid preparations (such as, for example, suspensions, elixirs and solutions); or carriers such as starches, sugars, diluents, granulating agents, lubricants, binders, disintegrating agents and the like in the case of oral solid preparations (such as, for example, powders, capsules and tablets).
  • tablets and capsules represent the most advantageous oral dosage unit form, in which case solid pharmaceutical carriers are obviously employed. If desired, tablets may be sugar-coated or enteric-coated by standard techniques.
  • the active agent can be encapsulated to make it stable for passage through the gastrointestinal tract, while at the same time allowing for passage across the blood brain barrier. See for example, WO 96/11698.
  • the compound may be dissolved in a pharmaceutical carrier and administered as either a solution or a suspension.
  • suitable carriers are water, saline, dextrose solutions, fructose solutions, ethanol, or oils of animal, vegetative or synthetic origin.
  • the carrier may also contain other ingredients, for example, preservatives, suspending agents, solubilizing agents, buffers and the like.
  • the compounds When the compounds are being administered intrathecally, they may also be dissolved in cerebrospinal fluid.
  • the active agent is preferably administered in a therapeutically effective amount. The actual amount administered, and the rate and time-course of administration, will depend on the nature and severity of the condition being treated. Prescription of treatment, e.g.
  • the active agents of the present invention exhibit their effect at a dosage range of from about 0.001 mg/kg to about 250 mg/kg, preferably from about 0.01 mg/kg to about 100 mg/kg, of the active ingredient and more preferably, from about 0.05 mg/kg to about 75 mg/kg.
  • a suitable dose can be administered in multiple sub-doses per day.
  • a dose or sub-dose may contain from about 0.1 mg to about 500 mg of the active ingredient per unit dosage form.
  • a more preferred dosage will contain from about 0.5 mg to about 100 mg of active ingredient per unit dosage form. Dosages are generally initiated at lower levels and increased until desired effects are achieved.
  • targeting therapies may be used to deliver the active agent more specifically to certain types of cells, by the use of targeting systems such as antibodies or cell- specific ligands. Targeting may be desirable for a variety of reasons, e.g. if the agent is unacceptably toxic, if it would otherwise require too high a dosage, or if it would not otherwise be able to enter target cells.
  • the active agents which are peptides, can also be administered in a cell-based delivery system in which a DNA sequence encoding an active agent is introduced into cells designed for implantation in the body of the patient, especially in the spinal cord region. Suitable delivery systems are described in U.S. Patent No. 5,550,050 and in published PCT Applications No.
  • Suitable DNA sequences can be prepared synthetically for each active agent on the basis of developed sequences and the known genetic code.
  • Voltage- gated ion channels determine the membrane excitability of cells. Although many Conus peptides that interact with voltage-gated Na + and Ca ++ channels have been characterized, relatively few have been identified that interact with K + channels. We describe novel Conus peptides that interact with the Shaker K channel, the conkunitzins. The peptide was chemically synthesized.
  • Peptide 32-60 cleavage/deprotection was accomplished with reagent K (82.5% TFA:5% phenol:5% water:5% thioanisole:2.5% EDT) for 4 hours at room temperature. Soluble crude peptide product was precipitated with cold MTBE, washed with MBTE and then dissolved in 25% aqueous acetonitrile, 1% TFA and lyophilized. Peptide was purified on a semi-preparative RP-HPLC column to 99% of purity.
  • peptide 1-31 For synthesis of the thioester peptide, peptide 1-31, the first amino acid was attached by mixing 4-sulfamylbutyryl AM resin (0.2 mmol), CH 2 Cl 2 (5 mL), DIEA (342 ⁇ L, 2mmol), and the Fmoc-Gln(Trt)-OH (1 mmol) (Backes and Ellman, 1999). The reaction mixture was stirred for 20 min, followed by cooling to -20° C.
  • Boc-Lys(Boc)-OH derivative Twenty mg of the resin-bound protein ( ⁇ 1.0 mmol/g) was prepared for activation by initial addition 3 mL dried under solid Na tetrahydrofuran (THF) and after 15 min, 3 mL of 2 M TMS-CHN 2 (2 M solution in hexane) was added. After stirring on a rotary plated for 6 hours, the resin was washed with THF (5 x 5 mL) and DMF (5 x 5 mL) and used in the displacement reaction. The activated resin was swollen in DMF and drained.
  • THF solid Na tetrahydrofuran
  • peptide 1-31 (1.2 mg, 0.33 ⁇ mol) and peptide 32- 60 (1.75 mg, 0.5 ⁇ mol) were dissolved in 160 ⁇ L of 0.1 sodium phosphate buffer containing 6M GuHCL, pH 7.5 to which 4% thiopheno was added (1.6 ⁇ L) (Shin et al., 1999).
  • the reaction was incubated for 10 h and monitored by analytical Cl 8 reversed-phase HPLC separations in the linear gradient of acetonitrile from 10% to 60% buffer B in 45 minutes. The flow rate was 1 niL/min and the elution was monitored by UV detection at 220 nm.
  • the final ligation product was purified on C18 reversed-phase HPLC column using semi-preparative column Vydac C-18 column (5 ⁇ m. 1 cm x 25 cm) and a flow rated of 5 niL/min.
  • Oxidative folding Folding reactions were carried out in buffered solution (0.1 M Tris-HCL, 1 niM EDTA, pH 8.7) containing appropriate concentration of the linear peptide and a mixture of 0.5 mM reduced and 2.5 mM oxidized glutathione.
  • the analytical folding reactions were initiated by adding 10 ⁇ L of the linear peptide, (resuspended in 0.01% TFA) to 40 ⁇ L folding mixture. The final peptide concentration was 20 ⁇ M. After appropriate time, the reaction was quenched by acidification with 5 ⁇ L of formic acid. The reaction mixtures was analyzed by analytical RP-HPLC (linear 40 min gradient from 21% to 25% buffer B) at 45° C.
  • Disulfide mapping Qualitative disulfide mapping of the peptide was performed with immobilized pepsin (Pierce Biotechnology). Immobilized pepsin, 100 ⁇ L was resuspended in 200 ⁇ L digest buffer (20 mM sodium acetate, pH 3.5). Peptide (10 nmoles) was dissolved in 200 ⁇ L digest buffer and 40 ⁇ L with pepsin was then added. The solution was incubated at 37° C.
  • Peptide corresponding to peak 5 was dissolved in 160 ⁇ L digest buffer and 32 ⁇ L digest buffer with pepsin was added. The solution was incubated at 37° C. After 1 h, sample was stirred (2 min, 10,000 rpm) and 150 ⁇ L supernatant was applied to analytical RP-HPLC (linear 40 min gradient from 2% to 40% buffer B). Peaks were collected and analyzed by MALDI-TOF-MS.
  • Electrophysiological methods The Xenopus expression system was used for investigating the potential effects of the conkunitizins on voltage-gated Na + and K + channels. Oocytes from Xenopus laevis were prepared as described previously (Methfessel et al., 1986; St ⁇ hmer, 1992). Frogs were anaesthetized with 0.2% tricaine in ice water for surgery. Following cRNA injection, the oocytes were incubated 1-5 days to allow expression of the protein.
  • cRNAs encoding various cloned Na + and K + channels to be tested were prepared by standard techniques. Whole cell currents were recorded under two- electrode voltage clamp control using a Turbo-Tec amplifier (npi electronic, Tamm Germany). The intracellular electrodes were filled with 2 M KCl and had a resistance between 0.6 and 1 M ⁇ . Current records were low-pass filtered at 1 kHz (K + channels) or 3 kHz (Na + channels) (- 3dB) and sampled at 4 or 10 kHz, respectively. Leak and capacitive currents were corrected online by using a P/n method.
  • Conlcunitzin ShK str-1 was found to have the following sequence:
  • KDRPSLCDLP ADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCL YT (SEQ ID NO: 1).
  • the Lys at position 1 may be replaced by an Arg.
  • Conkunitzin SIiK str-2 was found to have the following partial sequence: GRPKDRPSYCNLPADSGSGTKPEQRIYYNSAKKQCVTFTYNGKGGNGNNFSR (SEQ ID NO:2).
  • Conlcunitzin ShK magus was found to have the following sequence: RPSVCNKPADKGPCAGSEKRFYFSTYHNECRTFKYGGCEGNGNKFIHVYNCRIITCVYP M A (SEQ ID NO:3)
  • Lys ⁇ Gln ⁇ - ⁇ -thiosester peptide 1-31
  • Cys 32 -Thr 60 peptide 32- 60
  • Both peptides were prepared in a stepwise solid-phase method using Fmoc chemistry, purified by preparative RP-HPLC and characterized by MALDI mass spectrometry.
  • Peptide Lys ⁇ Gln ⁇ - ⁇ -thioester was synthesized as described above. Ligation reaction was observed on RP-HPLC and all details are described above.
  • the 60-residue polypeptide chain of conkunitzin ShK str-1 contains four cysteines that form two disulfide bonds.
  • Disulfide Mapping of Conkunitzin ShK str-1 Enzymatic cleavage with pepsin in acidic conditions to reduce the potential for disulfide bond interchange was performed to generate individual disulfide-linkage peptides. Pepsin digestion of conkunitzin ShK str-1 was performed in two steps as described above. At the first step, conkunitzin ShK str-1 was cleaved into several linear fragments.
  • This peptide fragment was separated by analytical RP-HPLC and used in the second pepsin digest step. Mass spectrometric analyses of four additional peaks identified three ions corresponding to peptides linked by a single disulfide bond.
  • the RP-HPLC peak 6 at 2161.46 Da represents peptide NSARKQCLRF(Cys2- Cys3)RRTYDCQ (amino acids 26-35 of SEQ ID NO:1 (Cys2-Cys3) amino acids 48-54 of SEQ ID NO:1).
  • Peak 7 at 1960.31 Da represents peptide ARKQCLRF(Cys2-Cys3)RRTYDCQ (amino acids 28-35 of SEQ ID NO:1 (Cys2-Cys3) amino acids 48-54 of SEQ ID NO:1).
  • Peak 8 at 2407.67 Da represents peptide KDRPSLCDLPADSGSGTKA(Cysl- Cys4)RTCL (amino acids 1-19 of SEQ ID NO:1 (Cysl-Cys4) amino acids 55-58 of SEQ ID NO:1).
  • the linkage of the two disulfide bonds in conkunitzin ShK str-1 is identified as Cysl-Cys4 and Cys2-Cys3, by pepsin digestion followed by mass mapping.
  • Conkunitzin Sl has been expressed in insect cell lines. [0065] Most of the clones consist of a single kunitz domain. However, a few conkunitzins contain 2 or 3 kunitz domains in tandem. The conkunitzins can be grouped into four classes as shown in Tables 2-5. The groupings are based upon cysteine patterns (6 cysteines vs. 4 cysteines) and upon the number of tandem kunitz domains found in the peptide.
  • magus magus
  • MEGRRFAAVLILTLCMLASGAVAARPKDRPSYCNLP ADSGSGTKPEQRIYYNSAREQCL TFTYNGKGGNENNFIHTYDCRRTCQYTV (SEQ ID NO:5)
  • magus magus
  • magus magus
  • magus magus
  • magus magus
  • ShK str-1 Species: striatus
  • Xaal is GIu or ⁇ -carboxy-Glu Xaa2 is GIn or pyro-Glu
  • Xaa3 is Pro or hydroxy-Pro
  • Xaa4 is Trp or bromo-Trp
  • Xaa5 is Tyr, 125 I-Tyr, mono-iodo-Tyr, di-iodo-Tyr, O-sulpho-Tyr or O-phospho-Tyr
  • Xaa6 is VaI, Ala, Asp or GIy ⁇ is free carboxyl or amidated C-terminus, preferably free carboxyl
  • # is free carboxyl or amidated C-terminus, preferably amidated
  • ICV administration of conkunitzin ShK str-1 resulted in a dose-dependent increase in the percentage of animals displaying seizures.
  • ICV administration of conkunitzin ShK str-1 produced spastic running followed by tonic extension seizures.
  • the ED 50 for ICV conkunitzin ShK str-1 was determined to be 0.96 nmol/mouse (95% confidence limits: 0.29 to 2.00 nmol).
  • EP administration of conkunitzin SIiK str-1 (3 nmol/mouse) was without effect.
  • Conkunitzin ShK str-1 has been tested on the Shaker K + channel and an inhibition of channel conductance was observed.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Biophysics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Toxicology (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The present invention is directed to conopeptides termed conkunitzins and their use for blocking the flow of potassium ions through voltage-gated potassium channels. In view of the Kunitz domain in the conkunitzins, they are also useful for inhibiting platelet aggregation and as protease inhibitors.

Description

TITLE OF THE INVENTION POTASSIUM CHANNEL BLOCKERS
[0001] This invention was made with Government support under Grant No. GM-48677 awarded by the National Institutes of Health, Bethesda, Maryland. The United States Government has certain rights in the invention.
BACKGROUND OF THE INVENTION
[0002] The present invention is directed to conopeptides termed conkunitzins and their use for blocking the flow of potassium ions through voltage-gated potassium channels. In view of the Kunitz domain in the conkunitzins, they are also useful for inhibiting platelet aggregation and as protease inhibitors.
[0003] The publications and other materials used herein to illuminate the background of the invention, and in particular, cases to provide additional details respecting the practice, are incorporated by reference, and for convenience are numerically referenced in the following text and respectively grouped in the appended bibliography.
[0004] Mollusks of the genus Conus produce a venom that enables them to carry out their unique predatory lifestyle. Prey are immobilized by the venom that is injected by means of a highly specialized venom apparatus, a disposable hollow tooth that functions both in the manner of a harpoon and a hypodermic needle.
[0005] Few interactions between organisms are more striking than those between a venomous animal and its envenomated victim. Venom may be used as a primary weapon to capture prey or as a defense mechanism. Many of these venoms contain molecules directed to receptors and ion channels of neuromuscular systems. [0006] The predatory cone snails {Conus) have developed a unique biological strategy. Their venom contains relatively small peptides that are targeted to various neuromuscular receptors and may be equivalent in their pharmacological diversity to the alkaloids of plants or secondary metabolites of microorganisms. Many of these peptides are among the smallest nucleic acid- encoded translation products having defined conformations, and as such, they are somewhat unusual. Peptides in this size range normally equilibrate among many conformations. Proteins having a fixed conformation are generally much larger.
[0007] The cone snails that produce these toxic peptides, which are generally referred to as conotoxins or conotoxin peptides, are a large genus of venomous gastropods comprising approximately 500 species. AU cone snail species are predators that inject venom to capture prey, and the spectrum of animals that the genus as a whole can envenomate is broad. A wide variety of hunting strategies are used, however, every Conus species uses fundamentally the same basic pattern of envenomation.
[0008] Several peptides isolated from Conus venoms have been characterized. These include the α-, μ- and ω-conotoxins which target nicotinic acetylcholine receptors, muscle sodium channels, and neuronal calcium channels, respectively (Olivera et al., 1985). Conopressins, which are vasopressin analogs, have also been identified (Cruz et al., 1987). hi addition, peptides named conantokins have been isolated as well (Mena et al., 1990; Haack et al., 1990). These peptides have unusual age-dependent physiological effects: they induce a sleep-like state in mice younger than two weeks and hyperactive behavior in mice older than 3 weeks (Haack et al., 1990). The isolation, structure and activity of κ-conotoxins (now named icA conotoxins) are described in U.S. Patent No. 5,633,347. Recently, peptides named contryphans containing D- tryptophan residues have been isolated from Conus radiatus (U.S. Patent No. 6,077,934), and bromo-tryptophan conopeptides have been isolated from Conus imperialis and Conus radiatus (U.S. Patent No. 5,889,147).
[0009] Potassium channels comprise a large and diverse group of proteins that, through maintenance of the cellular membrane potential, are fundamental in normal biological function. These channels are vital in controlling the resting membrane potential in excitable cells and can be broadly sub-divided into three classes: voltage-gated K+ channels, Ca2+ activated K+ channels and ATP-sensitive K channels. Many disorders are associated with abnormal flow of potassium ions through these channels. The identification of agents which would regulate the flow of potassium ions through each of these channel types would be useful in treating disorders associated with such abnormal flow. [0010] It is desired to identify additional conotoxin peptides having activities of the above conopeptides, as well as conotoxin peptides having additional activities.
SUMMARY OF THE INVENTION
[0011] The present invention is directed to conopeptides termed conkunitzins and their use for blocking the flow of potassium ions through voltage-gated potassium channels. The conkunitzins described herein are useful for treating various disorders as described in further detail herein. In view of the Kunitz domain in the conkunitzins, they are also useful for inhibiting platelet aggregation and as protease inhibitors. [0012] In one embodiment, the present invention is directed to uses of the conkunitzins described herein for regulating the flow of potassium ions through K+ channels. Disorders which can be treated using these conopeptides include multiple sclerosis, other demyelinating diseases (such as acute dissemniated encephalomyelitis, optic neuromyelitis, adrenoleukodystrophy, acute transverse myelitis, progressive multifocal leukoencephalopathy), sub-acute sclerosing panencephalomyelitis (SSPE), metachromatic leukodystrophy, Pelizaeus- Merzbacher disease, spinal cord injury, botulinum toxin poisoning, Huntington's chorea, compression and entrapment neurophathies (such as carpal tunnel syndrome, ulnar nerve palsy), cardiovascular disorders (such as cardiac arrhythmias, congestive heart failure), reactive gliosis, hyperglycemia, immunosuppression, cocaine addiction, cancer, cognitive dysfunction and disorders resulting from defects in neurotransmitter release (such as Eaton-Lambert syndrome), hi addition, these conkunitzins can provide reversal of the actions of curare and other neuromuscular blocking drugs. [0013] More specifically, the present invention is directed to conkunitzins, having the amino acid sequences set forth in Tables 1-5 below, as well as the corresponding propeptides and the nucleic acids that encode the propeptides that are set forth in Table 1.
[0014] The present invention is further directed to derivatives of the conkunitzins described herein or pharmaceutically acceptable salts of these peptides. Substitutions of one amino acid for another can be made at one or more additional sites within the described peptides, and may be made to modulate one or more of the properties of the peptides. Substitutions of this kind are preferably conservative, i.e., one amino acid is replaced with one of similar shape and charge. Conservative substitutions are well known in the art and include, for example: alanine to glycine, arginine to lysine, asparagine to glutamine or histidine, glycine to proline, leucine to valine or isoleucine, serine to threonine, phenylalanine to tyrosine, and the like. [0015] Examples of derivatives include peptides in which the Arg residues may be substituted by Lys, ornithine, homoargine, nor-Lys, N-methyl-Lys, N,N-dimethyl-Lys, N,N,N-trimethyl- Lys or any synthetic basic amino acid; the Lys residues may be substituted by Arg, ornithine, homoargine, nor-Lys, or any synthetic basic amino acid; the Tyr residues may be substituted with meta-Tyr, ortho-Tyr, nor-Tyr, mono-halo-Tyr, di-halo-Tyr, O-sulpho-Tyr, O-phospho-Tyr, nitro-Tyr or any synthetic hydroxy containing amino acid; the Ser residues may be substituted with Thr or any synthetic hydroxylated amino acid; the Tlir residues may be substituted with Ser or any synthetic hydroxylated amino acid; the Phe residues may be substituted with any synthetic aromatic amino acid; the Trp residues may be substituted with Trp (D), neo-Trp, halo- Tip (D or L) or any aromatic synthetic amino acid; and the Asn, Ser, Thr or Hyp residues may be glycosylated. The halogen may be iodo, chloro, fluoro or bromo; preferably iodo for halogen substituted-Tyr and bromo for halogen-substituted Trp. The Tyr residues may also be substituted with the 3-hydroxyl or 2-hydroxyl isomers (meta-Tyr or ortho-Tyr, respectively) and corresponding O-sulpho- and O-phospho-derivatives. The acidic amino acid residues may be substituted with any synthetic acidic amino acid, e.g., tetrazolyl derivatives of GIy and Ala. The aliphatic amino acids may be substituted by synthetic derivatives bearing non-natural aliphatic branched or linear side chains CnH2n+2 up to and including n=8. The Leu residues may be substituted with Leu (D). The GIu residues may be substituted with GIa. The GIa residues may be substituted with GIu. The N-terminal GIn residues may be substituted with pyroGlu. The Met residues may be substituted with norleucine (NIe). The Cys residues may be in D or L configuration and may optionally be substituted with homocysteine (D or L). [0016] The present invention is further directed to derivatives of the above peptides and peptide derivatives which are acylic permutations in which the cyclic permutants retain the native bridging pattern of native toxin. See Craik et al. (2001).
[0017] Examples of synthetic aromatic amino acids include, but are not limited to, nitro-Phe, 4-substituted-Phe wherein the substituent is Cj-C3 alkyl, carboxyl, hyrdroxymethyl, sulphomethyl, halo, phenyl, -CHO, -CN, -SO3H and -NHAc. Examples of synthetic hydroxy containing amino acids, include, but are not limited to, such as 4-hydroxymethyl-Phe, 4- hydroxyphenyl-Gly, 2,6-dimethyl-Tyr and 5-amino-Tyr. Examples of synthetic basic amino acids include, but are not limited to, N-l-(2-pyrazolinyl)-Arg, 2-(4~piperinyl)-Gly, 2-(4- piperinyi)-Ala, 2-[3-(2S)pyrrolininyl)-Gly and 2-[3-(2S)pyrrolininyl)-Ala. These and other synthetic basic amino acids, synthetic hydroxy containing amino acids or synthetic aromatic amino acids are described in Building Block Index, Version 3.0 (1999 Catalog, pages 4-47 for hydroxy containing amino acids and aromatic amino acids and pages 66-87 for basic amino acids; see also their online catalog), incorporated herein by reference, by and available from RSP Amino Acid Analogues, Inc., Worcester, MA. Examples of synthetic acid amino acids include those derivatives bearing acidic functionality, including carboxyl, phosphate, sulfonate and synthetic tetrazolyl derivatives such as described by Ornstein et al. (1993) and in U.S. Patent No. 5,331,001, each incorporated herein by reference, and such as shown in the following schemes 1-3.
Figure imgf000006_0001
Fmo
Figure imgf000006_0002
R=COOH, tetrazole, CH2COOH, 4-NHSO2CH3, 4-NHSO2Phenyl, 4-CH2SO3H, SO3H, 4-CH2PO3H2, CH2CH2COOH, OCH2Tetrazole, CH2STetrazole, HNTetrazole, CONHSO2Ri where R1 is CH3 or Phenyl SO2-Tetrazole, CH2CH2SO3H, 1,2,4-tetrazole, 3-isoxazolone, amidotetrazole, CH2CH2PO3H2
Scheme 1
Figure imgf000006_0003
R = COOH, tetrazole, CH2COOH, CH2tetrazole
Scheme 2
Figure imgf000007_0001
R = COOH, tetrazole, CH2COOH, 4-NHSO2CH3, 4-NHSO2Phenyl, 4-CH2SO3H, SO3H, 4-CH2PO3H2, CH2CH2COOH, OCH2Tetrazole, CH2STetrazole, HNTetrazole, CONHSO2R1 where R1 is CH3 or Phenyl, S O2 -Tetrazole, CH2CH2SO3H, 1,2,4-tetrazole, 3-isoxazolone, amidotetrazole, CH2CH2PO3H2 n = O, 1, 2, or 3
Scheme 3
[0018] Optionally, in the conkunitzins of the present invention, the Asn residues may be modified to contain an N-glycan and the Ser, Thr and Hyp residues may be modified to contain an O-glycan (e.g., g-N, g-S, g-T and g-Hyp). hi accordance with the present invention, a glycan shall mean any N-, S- or O-linked mono-, di-, tri-, poly- or oligosaccharide that can be attached to any hydroxy, amino or thiol group of natural or modified amino acids by synthetic or enzymatic methodologies known in the art. The monosaccharides making up the glycan can include D-allose, D-altrose, D-glucose, D-mannose, D-gulose, D-idose, D-galactose, D-talose, D-galactosamine, D-glucosamine, D-N-acetyl-glucosamine (GIcNAc), D-N-acetyl- galactosamine (GaINAc), D-fucose or D-arabinose. These saccharides may be structurally modified, e.g., with one or more O-sulfate, O-phosphate, O-acetyl or acidic groups, such as sialic acid, including combinations thereof. The glycan may also include similar polyhydroxy groups, such as D-penicillamine 2,5 and halogenated derivatives thereof or polypropylene glycol derivatives. The glycosidic linkage is beta and 1-4 or 1-3, preferably 1-3. The linkage between the glycan and the amino acid may be alpha or beta, preferably alpha and is 1-. [0019] Core O-glycaiis have been described by Van de Steen et al. (1998), incorporated herein by reference. Mucin type O-linked oligosaccharides are attached to Ser or Thr (or other hydroxylated residues of the present peptides) by a GaINAc residue. The monosaccharide building blocks and the linkage attached to this first GaINAc residue define the "core glycans," of which eight have been identified. The type of glycosidic linkage (orientation and connectivities) are defined for each core glycan. Suitable glycans and glycan analogs are described further in U.S. Patent Applicantion Serial No. 09/420,797 filed 19 October 1999 and in Internatioinal Patent Application No. PCT/US99/24380 filed 19 October 1999 (publication No. WO 00/23092), each incorporated herein by reference. A preferred glycan is Gal(β l->3)GalNAc(αl→).
[0020] Optionally, in the conlcunitzins of the present invention, pairs of Cys residues may be replaced pairwise with isoteric lactam or ester-thioether replacements, such as Ser/(Glu or Asp),
Lys/(Glu or Asp), Cys/(Glu or Asp) or Cys/Ala combinations. Sequential coupling by known methods (Barnay et al., 2000; Hruby et al, 1994; Bitan et al, 1997) allows replacement of native Cys bridges with lactam bridges. Thioether analogs may be readily synthesized using halo- Ala residues commercially available from RSP Amino Acid Analogues. In addition, individual Cys residues may be replaced with homoCys, seleno-Cys or penicillamine, so that disulfide bridges may be formed between Cys-homoCys or Cys-penicillamine, or homoCys- penicillamine and the like.
DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS [0021] The present invention is directed conlcunitzins and their uses as described above. Potassium channels comprise a large and diverse group of proteins that, through maintenance of the cellular membrane potential, are fundamental in normal biological function. The therapeutic applications for compounds that regulate the flow of potassium ions through K channels are far- reaching and include treatments of a wide range of disease and injury states. Disorders which can be treated using these conopeptides include multiple sclerosis, other demyelinating diseases (such as acute dissenmiated encephalomyelitis, optic neuromyelitis, adrenoleukodystrophy, acute transverse myelitis, progressive multifocal leukoencephalopathy), sub-acute sclerosing panencephalomyelitis (SSPE), metachromatic leukodystrophy, Pelizaeus-Merzbacher disease, spinal cord injury, botulinum toxin poisoning, Huntington's chorea, compression and entrapment neurophathies (such as carpal tunnel syndrome, ulnar nerve palsy), cardiovascular disorders (such as cardiac arrhythmias, congestive heart failure), reactive gliosis, hyperglycemia, immunosuppression, cocaine addiction, cancer, cognitive dysfunction and disorders resulting ■from defects in neurotransmitter release (such as Eaton-Lambert syndrome). In addition, these conlcunitzins can provide reversal of the actions of curare and other neuromuscular blocking drugs.
[0022] The conkunitzins of the present invention are identified by isolation from Coitus venom or by using recombinant DNA techniques by screening cDNA libraries of various Conus species using conventional techniques, such as the use of reverse-transcriptase polymerase chain reaction (RT-PCR) or the use of degenerate probes. Clones which hybridize to degenerate probes are analyzed to identify those which meet minimal size requirements, i.e., clones having approximately 400 nucleotides (for a propeptide), as determined using PCR primers which flank the cDNA cloning sites for the specific cDNA library being examined. These minimal-sized clones and the clones produced by RT-PCR are then sequenced. The sequences are then examined for the presence of a peptide having the characteristics noted above for conkunitzins. The biological activity of the peptides identified by this method is tested as described herein or conventionally in the art. [0023] These peptides are sufficiently small to be chemically synthesized. General chemical syntheses for preparing the foregoing conopeptides are described hereinafter, along with specific chemical synthesis of conopeptides and indications of biological activities of these synthetic products. Various ones of these conopeptides can also be obtained by isolation and purification from specific Conus species using the techniques described in U.S. Patent Nos. 4,447,356 (Olivera et al., 1984), 5,514,774 (Olivera et al., 1996) and 5,591,821 (Olivera et al, 1997), the disclosures of which are incorporated herein by reference.
[0024] Although the conopeptides of the present invention can be obtained by purification from cone snails, because the amounts of conopeptides obtainable from individual snails are very small, the desired substantially pure conopeptides are best practically obtained in commercially valuable amounts by chemical synthesis using solid-phase strategy. For example, the yield from a single cone snail may be about 10 micrograms or less of conopeptide. By "substantially pure" is meant that the peptide is present in the substantial absence of other biological molecules of the same type; it is preferably present in an amount of at least about 85% purity and preferably at least about 95% purity. Chemical synthesis of biologically active conopeptides depends of course upon correct determination of the amino acid sequence. Thus, the conopeptides of the present invention may be isolated, synthesized and/or substantially pure. [0025] The conopeptides can also be produced by recombinant DNA techniques well known in the art. Such techniques are described by Sambrook et al. (1989). The peptides produced in this manner are isolated, reduced if necessary, and oxidized to form the correct disulfide bonds, if present in the final molecule. [0026] One method of forming disulfide bonds in the conopeptides of the present invention is the air oxidation of the linear peptides for prolonged periods under cold room temperatures or at room temperature. This procedure results in the creation of a substantial amount of the bioactive, disulfide-linked peptides. The oxidized peptides are fractionated using reverse-phase high performance liquid chromatography (HPLC) or the like, to separate peptides having different linked configurations. Thereafter, either by comparing these fractions with the elution of the native material or by using a simple assay, the particular fraction having the correct linkage for maximum biological potency is easily determined. It is also found that the linear peptide, or the oxidized product having more than one fraction, can sometimes be used for in vivo administration because the cross-linking and/or rearrangement which occurs in vivo has been found to create the biologically potent conopeptide molecule. However, because of the dilution resulting from the presence of other fractions of less biopotency, a somewhat higher dosage may be required. [0027] The peptides are synthesized by a suitable method, such as by exclusively solid-phase techniques, by partial solid-phase techniques, by fragment condensation or by classical solution couplings.
[0028] hi conventional solution phase peptide synthesis, the peptide chain can be prepared by a series of coupling reactions in which constituent amino acids are added to the growing peptide chain in the desired sequence. Use of various coupling reagents, e.g., dicyclohexylcarbodiimide or diisopropylcarbonyldimidazole, various active esters, e.g., esters of N-hydroxyphthalimide or N-hydroxy-succinimide, and the various cleavage reagents, to carry out reaction in solution, with subsequent isolation and purification of intermediates, is well known classical peptide methodology. Classical solution synthesis is described in detail in the treatise, "Methoden der Organischen Chemie (Houben-Weyl): Synthese von Peptiden," (1974). Techniques of exclusively solid-phase synthesis are set forth in the textbook, "Solid-Phase Peptide Synthesis," (Stewart and Young, 1969), and are exemplified by the disclosure of U.S. Patent 4,105,603 (Vale et al., 1978). The fragment condensation method of synthesis is exemplified in U.S. Patent 3,972,859 (1976). Other available syntheses are exemplified by U.S. Patents No. 3,842,067 (1974) and 3,862,925 (1975). The synthesis of peptides containing γ-carboxyglutamic acid residues is exemplified by Rivier et al. (1987), Nishiuchi et al. (1993) and Zhou et al. (1996). Synthesis of conopeptides have been described in U.S. Patent Nos. 4,447,356 (Olivera et al., 1984), 5,514,774 (Olivera et al., 1996) and 5,591,821 (Olivera et al., 1997). [0029] Common to such chemical syntheses is the protection of the labile side chain groups of the various amino acid moieties with suitable protecting groups which will prevent a chemical reaction from occurring at that site until the group is ultimately removed. Usually also common is the protection of an α-amino group on an amino acid or a fragment while that entity reacts at the carboxyl group, followed by the selective removal of the α-amino protecting group to allow subsequent reaction to take place at that location. Accordingly, it is common that, as a step in such a synthesis, an intermediate compound is produced which includes each of the amino acid residues located in its desired sequence in the peptide chain with appropriate side-chain protecting groups linked to various ones of the residues having labile side chains. [0030] As far as the selection of a side chain amino protecting group is concerned, generally one is chosen which is not removed during deprotection of the α-amino groups during the synthesis. However, for some amino acids, e.g., His, protection is not generally necessary. In selecting a particular side chain protecting group to be used in the synthesis of the peptides, the following general rules are followed: (a) the protecting group preferably retains its protecting properties and is not split off under coupling conditions, (b) the protecting group should be stable under the reaction conditions selected for removing the α-amino protecting group at each step of the synthesis, and (c) the side chain protecting group must be removable, upon the completion of the synthesis containing the desired amino acid sequence, under reaction conditions that will not undesirably alter the peptide chain. [0031] It should be possible to prepare many, or even all, of these peptides using recombinant DNA technology. However, when peptides are not so prepared, they are preferably prepared using the Merrifield solid-phase synthesis, although other equivalent chemical syntheses known in the art can also be used as previously mentioned. Solid-phase synthesis is commenced from the C-terminus of the peptide by coupling a protected α-amino acid to a suitable resin. Such a starting material can be prepared by attaching an α-amino-protected amino acid by an ester linkage to a chloromethylated resin or a hydroxymethyl resin, or by an amide bond to a benzhydrylamine (BHA) resin or paramethylbenzhydrylamine (MBHA) resin. Preparation of the hydroxymethyl resin is described by Bodansky et al. (1966). Chloromethylated resins are commercially available from Bio Rad Laboratories (Richmond, CA) and from Lab. Systems, Inc. The preparation of such a resin is described by Stewart and Young (1969). BHA and MBHA resin supports are commercially available, and are generally used when the desired polypeptide being synthesized has an unsubstituted amide at the C-terminus. Thus, solid resin supports may be any of those known in the art, such as one having the formulae -O-CH2-resin support, -NH BHA resin support, or -NH-MBHA resin support. When the unsubstituted amide is desired, use of a BHA or MBHA resin is preferred, because cleavage directly gives the amide. In case the N-methyl amide is desired, it can be generated from an N-methyl BHA resin. Should other substituted amides be desired, the teaching of U.S. Patent No. 4,569,967 (Kornreich et al., 1986) can be used, or should still other groups than the free acid be desired at the C-terminus, it may be preferable to synthesize the peptide using classical methods as set forth in the Houben- Weyl text (1974).
[0032] The C-terminal amino acid, protected by Boc or Fmoc and by a side-chain protecting group, if appropriate, can be first coupled to a chloromethylated resin according to the procedure set forth in Horiki et al. (1978), using KP in DMF at about 6O0C for 24 hours with stirring, when a peptide having free acid at the C-terminus is to be synthesized. Following the coupling of the BOC-protected amino acid to the resin support, the α-amino protecting group is removed, as by using trifluoroacetic acid (TFA) in methylene chloride or TFA alone. The deprotection is carried out at a temperature between about O0C and room temperature. Other standard cleaving reagents, such as HCl in dioxane, and conditions for removal of specific α- amino protecting groups may be used as described in Schroder and Lubke (1965).
[0033] After removal of the α-amino-protecting group, the remaining α-amino- and side chain-protected amino acids are coupled step-wise in the desired order to obtain the intermediate compound defined hereinbefore, or as an alternative to adding each amino acid separately in the synthesis, some of them may be coupled to one another prior to addition to the solid phase reactor. Selection of an appropriate coupling reagent is within the skill of the art. Particularly suitable as a coupling reagent is N,N'-dicyclohexylcarbodiimide (DCC, DIC, HBTU, HATU, TBTU in the presence of HoBt or HoAt). [0034] The activating reagents used in the solid phase synthesis of the peptides are well known in the peptide art. Examples of suitable activating reagents are carbodiimides, such as N,N'-diisopropylcarbodiimide and N-ethyl-N'-(3-dimethylaminopropyl)carbodiimide. Other activating reagents and their use in peptide coupling are described by Schroder and Lubke (1965) and Kapoor (1970). [0035] Each protected amino acid or amino acid sequence is introduced into the solid-phase reactor in about a twofold or more excess, and the coupling may be carried out in a medium of dimethylformamide (DMF): CH2Cl2 (1:1) or in DMF or CH2Cl2 alone. In cases where intermediate coupling occurs, the coupling procedure is repeated before removal of the α-amino protecting group prior to the coupling of the next amino acid. The success of the coupling reaction at each stage of the synthesis, if performed manually, is preferably monitored by the ninhydrin reaction, as described by Kaiser et al. (1970). Coupling reactions can be performed automatically, as on a Beckman 990 automatic synthesizer, using a program such as that reported in Rivier et al. (1978). [0036] After the desired amino acid sequence has been completed, the intermediate peptide can be removed from the resin support by treatment with a reagent, such as liquid hydrogen fluoride or TFA (if using Fmoc chemistry), which not only cleaves the peptide from the resin but also cleaves all remaining side chain protecting groups and also the α-amino protecting group at the N-terminus if it was not previously removed to obtain the peptide in the form of the free acid. If Met is present in the sequence, the Boc protecting group is preferably first removed using trifiuoroacetic acid (TFA)/ethanedithiol prior to cleaving the peptide from the resin with HF to eliminate potential S-alkylation. When using hydrogen fluoride or TFA for cleaving, one or more scavengers such as anisole, cresol, dimethyl sulfide and methylethyl sulfide are included in the reaction vessel.
[0037] Cyclization of the linear peptide is preferably affected, as opposed to cyclizing the peptide while a part of the peptido-resin, to create bonds between Cys residues. To effect such a disulfide cyclizing linkage, fully protected peptide can be cleaved from a hydroxymethylated resin or a chloromethylated resin support by ammonolysis, as is well known in the art, to yield the fully protected amide intermediate, which is thereafter suitably cyclized and deprotected. Alternatively, deprotection, as well as cleavage of the peptide from the above resins or a benzhydrylamine (BHA) resin or a methylbenzhydrylamine (MBHA), can take place at 0°C with hydrofluoric acid (HF) or TFA, followed by oxidation as described above. A suitable method for cyclization is the method described by Cartier et al. (1996). [0038] Muteins, analogs or active fragments, of the foregoing conkunitzins are also contemplated here. See, e.g., Hammerland et al (1992). Derivative muteins, analogs or active fragments of the conkunitzins may be synthesized according to known techniques, including conservative amino acid substitutions, such as outlined in U.S. Patents No. 5,545,723 (see particularly col. 2, line 50 to col. 3, line 8); 5,534,615 (see particularly col. 19, line 45 to col. 22, line 33); and 5,364,769 (see particularly col. 4, line 55 to col. 7, line 26), each incorporated herein by reference.
[0039] Pharmaceutical compositions containing a compound of the present invention as the active ingredient can be prepared according to conventional pharmaceutical compounding techniques. See, for example, Remington 's Pharmaceutical Sciences, 18th Ed. (1990, Mack Publishing Co., Easton, PA). Typically, an antagonistic amount of the active ingredient will be admixed with a pharmaceutically acceptable carrier. The carrier may take a wide variety of forms depending on the form of preparation desired for administration, e.g., intravenous, oral or parenteral. For examples of delivery methods, see U.S. Patent No. 5,844,077, incorporated herein by reference.
[0040] For oral administration, the compounds can be formulated into solid or liquid preparations such as capsules, pills, tablets, lozenges, melts, powders, suspensions or emulsions. In preparing the compositions in oral dosage form, any of the usual pharmaceutical media may be employed, such as, for example, water, glycols, oils, alcohols, flavoring agents, preservatives, coloring agents, suspending agents and the like in the case of oral liquid preparations (such as, for example, suspensions, elixirs and solutions); or carriers such as starches, sugars, diluents, granulating agents, lubricants, binders, disintegrating agents and the like in the case of oral solid preparations (such as, for example, powders, capsules and tablets). Because of their ease in administration, tablets and capsules represent the most advantageous oral dosage unit form, in which case solid pharmaceutical carriers are obviously employed. If desired, tablets may be sugar-coated or enteric-coated by standard techniques. The active agent can be encapsulated to make it stable for passage through the gastrointestinal tract, while at the same time allowing for passage across the blood brain barrier. See for example, WO 96/11698.
[0041] For parenteral administration, the compound may be dissolved in a pharmaceutical carrier and administered as either a solution or a suspension. Illustrative of suitable carriers are water, saline, dextrose solutions, fructose solutions, ethanol, or oils of animal, vegetative or synthetic origin. The carrier may also contain other ingredients, for example, preservatives, suspending agents, solubilizing agents, buffers and the like. When the compounds are being administered intrathecally, they may also be dissolved in cerebrospinal fluid. [0042] The active agent is preferably administered in a therapeutically effective amount. The actual amount administered, and the rate and time-course of administration, will depend on the nature and severity of the condition being treated. Prescription of treatment, e.g. decisions on dosage, timing, etc., is within the responsibility of general practitioners or specialists, and typically takes into account the disorder to be treated, the condition of the individual patient, the site of delivery, the method of administration and other factors known to practitioners. Examples of techniques and protocols can be found in Remington 's Pharmaceutical Sciences. Typically, the active agents of the present invention exhibit their effect at a dosage range of from about 0.001 mg/kg to about 250 mg/kg, preferably from about 0.01 mg/kg to about 100 mg/kg, of the active ingredient and more preferably, from about 0.05 mg/kg to about 75 mg/kg. A suitable dose can be administered in multiple sub-doses per day. Typically, a dose or sub-dose may contain from about 0.1 mg to about 500 mg of the active ingredient per unit dosage form. A more preferred dosage will contain from about 0.5 mg to about 100 mg of active ingredient per unit dosage form. Dosages are generally initiated at lower levels and increased until desired effects are achieved.
[0043] Alternatively, targeting therapies may be used to deliver the active agent more specifically to certain types of cells, by the use of targeting systems such as antibodies or cell- specific ligands. Targeting may be desirable for a variety of reasons, e.g. if the agent is unacceptably toxic, if it would otherwise require too high a dosage, or if it would not otherwise be able to enter target cells. [0044] The active agents, which are peptides, can also be administered in a cell-based delivery system in which a DNA sequence encoding an active agent is introduced into cells designed for implantation in the body of the patient, especially in the spinal cord region. Suitable delivery systems are described in U.S. Patent No. 5,550,050 and in published PCT Applications No. WO 92/19195, WO 94/25503, WO 95/01203, WO 95/05452, WO 96/02286, WO 96/02646, WO 96/40871, WO 96/40959 and WO 97/12635. Suitable DNA sequences can be prepared synthetically for each active agent on the basis of developed sequences and the known genetic code.
EXAMPLES
[0045] The present invention is described by reference to the following Examples, which are offered by way of illustration and are not intended to limit the invention in any manner.
Standard techniques well known in the art or the techniques specifically described below were utilized.
[0046] Voltage- gated ion channels determine the membrane excitability of cells. Although many Conus peptides that interact with voltage-gated Na+ and Ca++ channels have been characterized, relatively few have been identified that interact with K+ channels. We describe novel Conus peptides that interact with the Shaker K channel, the conkunitzins. The peptide was chemically synthesized.
EXAMPLE l Experimental Procedures
[0047] Abbreviations: FMOC, N-(9-fluorenyl)methoxycarboxyl; HPLC; high performance liquid chromatography; i.c.v., intracerbrovascular; i.p., intraperitoneal; i.t, intrathecal; TFA, trifiuoroacetic acid. [0048] Synthesis: The peptides were synthesized on solid support using standard FMOC chemistry and a peptide synthesizer Symphony/Multiplex™ (Protein Technologies Inc.). Coupling time with HBTU and DIEA was 1.5 h. Peptide 32-60 cleavage/deprotection was accomplished with reagent K (82.5% TFA:5% phenol:5% water:5% thioanisole:2.5% EDT) for 4 hours at room temperature. Soluble crude peptide product was precipitated with cold MTBE, washed with MBTE and then dissolved in 25% aqueous acetonitrile, 1% TFA and lyophilized. Peptide was purified on a semi-preparative RP-HPLC column to 99% of purity. [0049] For synthesis of the thioester peptide, peptide 1-31, the first amino acid was attached by mixing 4-sulfamylbutyryl AM resin (0.2 mmol), CH2Cl2 (5 mL), DIEA (342 μL, 2mmol), and the Fmoc-Gln(Trt)-OH (1 mmol) (Backes and Ellman, 1999). The reaction mixture was stirred for 20 min, followed by cooling to -20° C. Then 420 mg of benzotriazole-1-yl-oxy-tris- pyrrolidino-phosphonium hexafluorophosphate (PyBOP) was added as a solid, and the reaction mixture was stirred for 12 h at -20° C, filtered and washed with CH2Cl2 (5 x 5 mL). The extent of incorporation was quantitated by the Fmoc release UV assay (Atherton and Sheppard, 1989). Coupling was repeated when loading <70%. The last Lys residue was introduced manually as a
Boc-Lys(Boc)-OH derivative. Twenty mg of the resin-bound protein (~ 1.0 mmol/g) was prepared for activation by initial addition 3 mL dried under solid Na tetrahydrofuran (THF) and after 15 min, 3 mL of 2 M TMS-CHN2 (2 M solution in hexane) was added. After stirring on a rotary plated for 6 hours, the resin was washed with THF (5 x 5 mL) and DMF (5 x 5 mL) and used in the displacement reaction. The activated resin was swollen in DMF and drained. DMF (875 μL), ethyl-3-mercaptopropionate (130 μL, 1 mmol, 50 equiv) and sodium thiophenate (1.5 mg, 10 μmol, 0.5 equiv) was then added. The mixture was stirred on a rotary plated for 24 hours and the resin was filtered and washed with DMF (3 x 2 mL). The combined filtrate and washes were collected in a round-bottom flask and rotary evaporated, and then the oil was dried over KOH in vacuo for a minimum of 5 h. The side-chain-protecting groups on the crude peptide were removed with 2 mL of reagent B (88% TFA:5% phenol:2% triisopropylsilane:5% water) for 3 h at room temperature (Sole and Barany, 1992). The TFA solution was added dropwise to screw-cap centrifuge tubes containing MTBE with a TFA/MTBE ratio of 1/20. After centrifugation at 3200 g (30 min), the ether was removed and the peptide precipitate resuspended in MTBE. The process was repeated twice. The final precipitate was dissolved in 25% aqueous acetonitrile and lyophilized. Peptide was purified on a semi-preparative RP-HPLC column to 99% of purity. [0050] To initiate native chemical ligation, peptide 1-31 (1.2 mg, 0.33 μmol) and peptide 32- 60 (1.75 mg, 0.5 μmol) were dissolved in 160 μL of 0.1 sodium phosphate buffer containing 6M GuHCL, pH 7.5 to which 4% thiopheno was added (1.6 μL) (Shin et al., 1999). The reaction was incubated for 10 h and monitored by analytical Cl 8 reversed-phase HPLC separations in the linear gradient of acetonitrile from 10% to 60% buffer B in 45 minutes. The flow rate was 1 niL/min and the elution was monitored by UV detection at 220 nm. The final ligation product was purified on C18 reversed-phase HPLC column using semi-preparative column Vydac C-18 column (5 μm. 1 cm x 25 cm) and a flow rated of 5 niL/min. The concentration of linear form of the peptide was determined spectrophotometrically using the molar absorbance coefficient at 274.5 nm, ε = 1420 M"1 x cm"1 (Litchfield and Wilcoxon, 1949).
[0051] Oxidative folding: Folding reactions were carried out in buffered solution (0.1 M Tris-HCL, 1 niM EDTA, pH 8.7) containing appropriate concentration of the linear peptide and a mixture of 0.5 mM reduced and 2.5 mM oxidized glutathione. The analytical folding reactions were initiated by adding 10 μL of the linear peptide, (resuspended in 0.01% TFA) to 40 μL folding mixture. The final peptide concentration was 20 μM. After appropriate time, the reaction was quenched by acidification with 5 μL of formic acid. The reaction mixtures was analyzed by analytical RP-HPLC (linear 40 min gradient from 21% to 25% buffer B) at 45° C. Peaks were collected and analyzed by MALDI-TOF on a Bruker Daltoncis OmniFLEX mass spectrometer using α-cyano-4-hydroxy cinnamic acid as matrix. [0052] Disulfide mapping: Qualitative disulfide mapping of the peptide was performed with immobilized pepsin (Pierce Biotechnology). Immobilized pepsin, 100 μL was resuspended in 200 μL digest buffer (20 mM sodium acetate, pH 3.5). Peptide (10 nmoles) was dissolved in 200 μL digest buffer and 40 μL with pepsin was then added. The solution was incubated at 37° C. After 1 h, sample was stirred (2 min, 10,000 rpm) and 200 μL supernatant was applied to analytical RP-HPLC (linear 40 min gradient from 2% to 40% buffer B). Peaks were collected and analyzed by MALDI-TOF-MS.
[0053] Peptide corresponding to peak 5, about 8 nmoles, was dissolved in 160 μL digest buffer and 32 μL digest buffer with pepsin was added. The solution was incubated at 37° C. After 1 h, sample was stirred (2 min, 10,000 rpm) and 150 μL supernatant was applied to analytical RP-HPLC (linear 40 min gradient from 2% to 40% buffer B). Peaks were collected and analyzed by MALDI-TOF-MS.
[0054] Assessment of Preconvulsive Activity: Male CF-I mice (26-35 g; Charles River Laboratories) were housed in a temperature controlled (23° ± 2° C) room with a 12 hour light- dark cycle with free access to food and water. Conkunitzin ShK str-1 was administered to mice either by intraperitoneal injection (IP) or by freehand intracerebroventricular (ICV) injection (%:1 volume) using a 10:1 Hamilton syringe. Five doses (0.1, 0.3, 1, 2 and 3 nmol/mouse) of conlcunitzin ShK str-1 with 3-5 mice per dose group were used for ED50 determination. The percent of mice having seizures was calculated for each group, and the ED50 and 95% confidence limits were calculated using probit analysis (Litchfield and Wilcoxon, 1949). [0055] Electrophysiological methods: The Xenopus expression system was used for investigating the potential effects of the conkunitizins on voltage-gated Na+ and K+ channels. Oocytes from Xenopus laevis were prepared as described previously (Methfessel et al., 1986; Stϋhmer, 1992). Frogs were anaesthetized with 0.2% tricaine in ice water for surgery. Following cRNA injection, the oocytes were incubated 1-5 days to allow expression of the protein. Prior to the electrophysiological measurements, the vitelline membranes of the oocytes were removed mechanically with fine forceps. cRNAs encoding various cloned Na+ and K+ channels to be tested were prepared by standard techniques. Whole cell currents were recorded under two- electrode voltage clamp control using a Turbo-Tec amplifier (npi electronic, Tamm Germany). The intracellular electrodes were filled with 2 M KCl and had a resistance between 0.6 and 1 MΩ. Current records were low-pass filtered at 1 kHz (K+ channels) or 3 kHz (Na+ channels) (- 3dB) and sampled at 4 or 10 kHz, respectively. Leak and capacitive currents were corrected online by using a P/n method. The bath solution was normal frog Ringer's (NFR) containing (in mM): 115 NaCl, 2.5 KCl, 1.8 CaCl2, 10 Hepes pH 7.2 (NaOH). Lyophilized conlcunitzin was dissolved in NFR, diluted to the final concentration and added to the bath chamber. All electrophysiological experiments were performed at room temperature (19-22 0C). [0056] Protein Isolation: Conkunitzin ShK str-1 and ShK str-2 were obtained by isolation and purification from Conus striatus using the techniques described in U.S. Patent Nos. 4,447,356 (Olivera et al., 1984), 5,514,774 (Olivera et al., 1996) and 5,591,821 (Olivera et al., 1997),
[0057] Molecular biology: The cDNA library from C. striatus venom ducts was prepared as previously described (Colledge et al., 1992; Jacobsen et al., 1998). EXAMPLE 2
Isolation of Conkunitzin ShK str-1, ShK str-2 and ShK magus
[0058] Two conkunitzins were isolated from Conus striatus and sequenced. One additional conkunitzin was isolated from Conus magus and sequenced. Conlcunitzin ShK str-1 was found to have the following sequence:
KDRPSLCDLP ADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCL YT (SEQ ID NO: 1). The Lys at position 1 may be replaced by an Arg. [0059] Conkunitzin SIiK str-2 was found to have the following partial sequence: GRPKDRPSYCNLPADSGSGTKPEQRIYYNSAKKQCVTFTYNGKGGNGNNFSR (SEQ ID NO:2).
[0060] Conlcunitzin ShK magus was found to have the following sequence: RPSVCNKPADKGPCAGSEKRFYFSTYHNECRTFKYGGCEGNGNKFIHVYNCRIITCVYP MA (SEQ ID NO:3)
EXAMPLE 3
Synthesis of Conkunitzin SIiK str-1
[0061] To access synthetic conkunitzin by native chemical ligation strategy, two separate peptides were synthesized: Lys^Gln^-α-thiosester (peptide 1-31) and Cys32-Thr60 (peptide 32- 60). Both peptides were prepared in a stepwise solid-phase method using Fmoc chemistry, purified by preparative RP-HPLC and characterized by MALDI mass spectrometry. Peptide Lys^Gln^-α-thioester was synthesized as described above. Ligation reaction was observed on RP-HPLC and all details are described above. After oxidative folding conkunitizin SHk str-1, the observed molecular mass decreased from 6934.43 Da (calculated mass of MH+ = 6934.66 Da, average) to 6930.41 Da (calculated mass OfMH+ = 6930.66 Da, average), reflecting the loss of four protons because of the formation of two disulfide bonds.
EXAMPLE 4
Folding of Conlcunitzin SITK str-1
[0062] The 60-residue polypeptide chain of conkunitzin ShK str-1 contains four cysteines that form two disulfide bonds. The peptide was folded in buffered solution as described above. The yield of correct disulfide linkages was very high, with six intermediates observed on analytical RP-HPLC. Each intermediate was collected and analyzed by MALDI-TOF-MS. In the mass spectrum of intermediates IA, IB, IC and ID, a succession of peaks was observed at 6932.17, 6932.07, 6932.53 and 6932.31 Da (calculated mass of MH+ = 6932.66 Da, average), reflecting loss of two protons and indicating the presence of one disulfide bridge. In the mass spectrum of intermediates HA and HB, a succession of peaks was observed at 6930.80 and 6930.12 Da (calculated mass OfMH+ = 6930.66 Da, average), reflecting loss of four protons and indicating the presence of two disulfide bridge.
EXAMPLE 5
Disulfide Mapping of Conkunitzin ShK str-1 [0063] Enzymatic cleavage with pepsin in acidic conditions to reduce the potential for disulfide bond interchange was performed to generate individual disulfide-linkage peptides. Pepsin digestion of conkunitzin ShK str-1 was performed in two steps as described above. At the first step, conkunitzin ShK str-1 was cleaved into several linear fragments. One fragment was interpreted as being three linear peptides, KDRP SLCDLPAD S GS GTKA (amino acids 1-19 of SEQ ID NO:1), NSARKQCLRF (amino acids 26-35 of SEQ ID NO:1) and RRTYDCQRTCL (amino acids 48-58 of SEQ ID NO:1), connected by two disulfide bonds and having the molecular mass of 4549.74 Da (calculated mass of MH+ = 4549.23 Da, monosiotopic). This peptide fragment was separated by analytical RP-HPLC and used in the second pepsin digest step. Mass spectrometric analyses of four additional peaks identified three ions corresponding to peptides linked by a single disulfide bond. The RP-HPLC peak 6 at 2161.46 Da (calculated mass of MH+ = 2161.06 Da, monoisotopic), represents peptide NSARKQCLRF(Cys2- Cys3)RRTYDCQ (amino acids 26-35 of SEQ ID NO:1 (Cys2-Cys3) amino acids 48-54 of SEQ ID NO:1). Peak 7 at 1960.31 Da (calculated mass of MH+ = 1599.99 Da, monoisotopic) represents peptide ARKQCLRF(Cys2-Cys3)RRTYDCQ (amino acids 28-35 of SEQ ID NO:1 (Cys2-Cys3) amino acids 48-54 of SEQ ID NO:1). Peak 8 at 2407.67 Da (calculated mass of MH+ = 2407.18 Da, monoisotopic) represents peptide KDRPSLCDLPADSGSGTKA(Cysl- Cys4)RTCL (amino acids 1-19 of SEQ ID NO:1 (Cysl-Cys4) amino acids 55-58 of SEQ ID NO:1). In summary, the linkage of the two disulfide bonds in conkunitzin ShK str-1 is identified as Cysl-Cys4 and Cys2-Cys3, by pepsin digestion followed by mass mapping.
EXAMPLE 6
Cloning of Conkunitzin Sl
[0064] Based upon the sequences of the mature peptides isolated from Conus magus and Conus striatus, degenerate primers were designed and used to isolate full-length cDNA clones for three conkunitzin peptides via 3' and 5' RACE techniques. The cDNA for each peptide encoded a precursor sequence containing a hydrophobic signal sequence N-terminal to the mature peptide. Primers were then designed to target the conserved 3' and 5' UTR regions of conkunitzins and were used to screen various Conus venoms. The DNA sequences of the clones, the sequences of the encoded propeptides, and the sequences of the mature peptides are shown in Table 1. One of these, Conkunitzin Sl, has been expressed in insect cell lines. [0065] Most of the clones consist of a single kunitz domain. However, a few conkunitzins contain 2 or 3 kunitz domains in tandem. The conkunitzins can be grouped into four classes as shown in Tables 2-5. The groupings are based upon cysteine patterns (6 cysteines vs. 4 cysteines) and upon the number of tandem kunitz domains found in the peptide.
TABLE l
Sequences of Mature Conkunitzins, Propeptides and DNA Encoding Propeptides Name: C1679
Species: magus
Isolated: No
Cloned: Yes DNA Sequence:
GAATTCGCCCTTGCTGATGGCGATGAATGAACACTGCGTTTGCTGGCTTTGATGAAA AGTCCACGTCAGCAGAGGGAGAGAGAGAGACCTTAGGAGCTGTGTATTCTCCAGTC ATCTGACGGCCCTATCCACGTCAGTGCTGTTTCGTCTGTCAGCCAGTCCACATCACC GCTCAACCATCTGTCAGCCTGTTTACGTCAGCACTGTCATCTGACTGTCCAGGTTAA AAAATGGAGGGACGTCGTTTTGCTGCTGTTCTGATCCTGACCCTCTGTATGCTTGCA TCTGGGGCTGTCGCTGCGAGACCTAAGGATCGACCGAGTTATTGCAATCTACCAGC GGACAGTGGGTCGGGCACAAAGCCTGAGCAGAGAATTTACTACAATAGCGCTCGAG AACAGTGTTTAACGTTCACTTACAATGGAAAAGGAGGCAACGAAAACAATTTTATC CATACTTACGATTGCCGACGAACGTGTCAGTATACAGTCTGATGCATCCGCTCTGGC GGTGGTGGCAATATCTCTAACACTGTTGAGGAGAGCCAAGGGCGAATTC (SEQ ID NO:4)
Translation:
MEGRRFAAVLILTLCMLASGAVAARPKDRPSYCNLP ADSGSGTKPEQRIYYNSAREQCL TFTYNGKGGNENNFIHTYDCRRTCQYTV (SEQ ID NO:5)
Toxin Sequence:
Ala-Arg-Xaa3-Lys-Asp-Arg-Xaa3-Ser~Xaa5-Cys-Asn-Leu-Xaa3-Ala-Asp-Ser-Gly-Ser-Gly- Thr-Lys-Xaa3 -Xaal -Ghi-Arg-Ile-Xaa5-Xaa5 - Asn-S er- Ala- Arg-Xaal -Gln-Cys-Leu-Thr-Phe- Tlir-XaaS-Asn-Gly-Lys-Gly-Gly-Asn-Xaal-Asn-Asn-Phe-Ile-His-Thr-XaaS-Asp-Cys-Arg-Arg- Thr-Cys-Gln-Xaa5-Thr-Val-Λ (SEQ ID NO:6) Name: C 1687
Species: magus Isolated: No
Cloned: Yes
DNA Sequence:
GAATTCGCCCTTGGCGATGAATGAACACTGCGTTTGCTGGCTTTGACGAAAACCAGT CCACGTCAGCAGAGGGAGAGAGAGAGAGAGACCTTAGGAGCTGTGTATTCTCCAGT CATCTGACGGCCCCATCCACGTCAGTGCTGTTTCTTCTATCAGCCAGTCCATATCAA CGCTCTACCGTCTGTCAGCCAGTCCACATCAGCGCTCTACCATCTGTCAGCCTGTTT ACGTCAGCACTGTCATCTGACTGTCCAGGTTAAAAAATGGAGGGACGTCGTTTTGCT GCTGTTCTGATCCTGACCATCTGTATGCTTGCACCTGGGACTGGTCGACCGAGTGTA TGCAATAAACCAGCGGACAAGGGGCCGTGCACAGGGTCTGAGAAGAGATTCTACTT CAGTACCTATCATAATGAGTGTAGAACGTTCAAATACGGAGGATGTGAAGGCAACG GCAACAATTTTATCCATGTGTACAATTGTCGAAGAACGTGTGTGTATCCACCTGGCT GAAATAACTGCGCTGACTGTTGTGGCGACATCCCTAACACTGTTGAGGAGAGCCAA GGGCGAATTC (SEQ ID NO:7)
Translation:
MEGRRPAAVLILTICMLAPGTGRPSVCNKPADKGPCTGSEKRPYFSTYHNECRTFKYGG CEGNGNNFIHVYNCRRTCVYPPG (SEQ ID NO:8) Toxin Sequence:
Arg-XaaS-Ser-Val-Cys-Asn-Lys-XaaS-Ala-Asp-Lys-Gly-XaaS-Cys-Thr-Gly-Ser-Xaal-Lys- Arg-Phe-XaaS-Phe-Ser-Thr-XaaS-His-Asn-Xaal-Cys-Ai-g-Thr-Phe-Lys-XaaS-Gly-Gly-Cys- Xaal-Gly-Asn-Gly-Asn-Asn-Phe-Ile-His-Val-XaaS-Asn-Cys-Arg-Arg-Thr-Cys-Val-XaaS- Xaa3-Xaa3-# (SEQ ID NO:9)
Name: C1689
Species: magus Isolated: No
Cloned: Yes
DNA Sequence:
GAATTCGCCCTTGCTGATGGCGATGAATGAACACTGCGTTTGCTGGCTTTGATGAAA ACCAGTCCACGTCAGCAGAGGGAGAGAGAGAGAGAGACCTTAGGAGCTGTGTATT CTCCAGTCATCTGACGGCCCCATCCACGTCAGTGCTGTTTCTTCTATCAGCCAGTCC ATATCAACGCTCTACCGTCTGTCAGCCAGTCCACATCAGCGCTCTACCATCTGTCAG CCTGTTTACGTCAGCACTGTCATCTGACTGTCCAGGTTAAAAAATGGAGGGACGTCG TTTTGCTGCTGTTCTGATCCTGACCCTCTGTATGCTTGCATCTGGGGCTGTCGCTGCG AAACCTAAGAGTCGGCCGAGTTATTGCAATCTACCAGCGGACAGTGGGTCGGGCAC AAAGTCTGAGAAGAGAATTTACTACAATAGCGCTAGAAAACAGTGTTTAAGGTTCA CTTACCATGGAGAAGGAGGCAACGCAAACAATTTTCTCCATACTTTCGATTGCCAAC ATACGTGTCTGTATACAGTCTGATGCATCCCCTCTGGCGGTGGTGGCAATATCTCTA ACACTGTTGAGGAGAGCCAAGGGCGAATTC (SEQ ID NO: 10) Translation:
MEGRIIFAAVLILTLCMLASGAVAAK-PKSRPSYCNLPADSGSGTKSEK-RIYYNSARKQCL RFTYHGEGGNANNFLHTFDCQHTCLYTV (SEQ ID NO: 11)
Toxin Sequence:
Ala-Lys-XaaS-Lys-Ser-Arg-XaaS-Ser-XaaS-Cys-Asn-Leu-XaaS-Ala-Asp-Ser-Gly-Ser-Gly-Thr- Lys-Ser-Xaal-Lys-Arg-Ile-XaaS-XaaS-Asn-Ser-Ala-Arg-Lys-Gln-Cys-Leu-Arg-Phe-Thr-XaaS- His-Gly-Xaal-Gly-Gly-Asn-Ala-Asn-Asn-Phe-Leu-His-Tlir-Phe-Asp-Cys-Gln-His-Thr-Cys- Leu-Xaa5-Thr-Val-Λ (SEQ ID NO: 12)
Name: C 1704 Species: magus
Isolated: No
Cloned: Yes
DNA Sequence: GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGTTCTGATCCTGACCATCTGT ATGCTTGCACCTGGGACTGGTACTTTGATACCTCGGGGTCGACCGAGTGAATGCAAT CTACGAAAGGACAGTGGGTCGTGCACAAGGTCTGAGCAGAGCACAAAGTCTGAGC AGAGATATTACTTCAGTACATATTATAATGAGTGTAGAATGTTCACTTACAGTGGAT GTGGAGGCAACCGCAACAATTTTATCCATATGTACGATTGTCGACGAAAGTGTGTG TATACAGTTGGCTGAAATAACTGCGCTGACTGTTGTGGCGACATCCCTAACACTGTT GAGGAGAGCCAAGGGCGAATTC (SEQ JD NO: 13)
Translation:
MEGRRFAAVLILTICMLAPGTGTLIPRGRPSECNLRKDSGSCTRSEQSTKSEQRYYFSTY YNECRMFTYSGCGGNRNNFIHMYDCRRKCVYTVG* (SEQ ID NO: 14)
Toxin Sequence:
Thr-Leu-Ile-XaaS-Arg-Gly-Arg-XaaS-Ser-Xaal-Cys-Asn-Leu-Arg-Lys-Asp-Ser-Gly-Ser-Cys- Tlir-Arg-Ser-Xaal-Gln-Ser-Thr-Lys-Ser-Xaal-Gln-Arg-XaaS-XaaS-Phe-Ser-Tlir-XaaS-XaaS- Asn-Xaal-Cys-Arg-Met-Phe-Thl-Xaa5-Ser-Gly-Cys-Gly-Gly-Asn-Arg-Asn-Asn-Phe-Ile-His- Met-Xaa5-Asp-Cys-Arg-Arg-Lys-Cys-Val-Xaa5~Thr-Val-# (SEQ ID NO: 15)
Name: C 1705
Species: magus
Isolated: No
Cloned: Yes DNA Sequence:
GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGTTCTGATCCTGACCCTCTGT ATGCTTGCATCTGGGGCTGTCGCTGCGAAACCTAAGAGTCGGCCGAGTTATTGCAAT CTACCAGCGGAGAGGGGGCCGTGCGAAGGGTCGGAGAAGAGATATTATTTCGATA GCTATCGTATTCAGTGTAGATTATTCAAATACGGAGGATGTGAAGGCAACCGCAAC AATTTTATCCGTGTGTACGATTGTCGAAAAAAGTGTTTGCATGCAGGCTGATGCATC CGCTCTGGCGGTGGTGGCGATATCTCTAACACTGTTGAGGAGAGCCAAGGGCGAAT TC (SEQ ID NO: 16) Translation:
MEGRRPAAVLILTLCMLASGAVAAKPKSRPSYCNLP AERGPCEGSEKRYYPDSYRIQCR LFKYGGCEGNRNNFIRVYDCRKKCLHAG (SEQ ID NO:17)
Toxin Sequence: Ala-Lys-XaaS-Lys-Ser-Arg-XaaS-Ser-XaaS-Cys-Asn-Leu-XaaS-Ala-Xaal-Arg-Gly-XaaS-Cys- Xaal-Gly~Ser~Xaal-Lys-Arg-Xaa5~Xaa5-Phe-Asp-Ser-Xaa5-Arg-Ile-Gm-Cys-Arg-Leu-Phe- Lys-XaaS-Gly-Gly-Cys-Xaal-Gly-Asn-Arg-Asn-Asn-Phe-Ile-Arg-Val-XaaS-Asp-Cys-Arg-Lys- Lys-Cys-Leu-His-Ala-# (SEQ ID NO: 18)
Name: C1708
Species: magus
Isolated: No Cloned: Yes
DNA Sequence:
GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGCTGTTCTGATCCTGACCCTCT GTATGCTTGCACCTGGGGCTGTCGCTTCGAGACGTAAGGCTCGACCGAGTGTATGC AATCTACCACCGGAAAGGGGGCCGTGCGCAGGGTCTGAGCGGAGAGTTTACTTCGA TAGCACTTCTAAACAGTGTAAAATGTTCACTTACGGAGGATGTGGAGGCAACGGCA ACAATTTTAAACGTGCTCACGATTGTTTAAAAATGTGTGTGTATTCAGTTGGCTGAA ACAACTGCGCTGAGTGTTGTGGCGACATCCCTAACACTGTTGAGGAGAGCCAAGGG CGAATTC (SEQ ID NO: 19)
Translation:
MEGRRFAAAVLILTLCMLAPGAVASRRKARPSVCNLPPERGPCAGSERRVYFDSTSKQC KMFTYGGCGGNGNNFKRAHDCLKMCVYSVG (SEQ ID NO:20)
Toxin Sequence:
Ser-Arg-Arg-Lys-Ala-Arg-XaaS-Ser-Val-Cys-Asn-Leu-XaaS-XaaS-Xaal-Ai-g-Gly-XaaS-Cys- Ala-Gly-Ser-Xaal-Arg-Arg-Val-XaaS-Phe-Asp-Ser-Thr-Ser-Lys-Gln-Cys-Lys-Met-Phe-Thr- XaaS-Gly-Gly-Cys-Gly-Gly-Asn-Gly-Asn-Asn-Phe-Lys-Arg-Ala-His-Asp-Cys-Leu-Lys-Met- Cys-Val-Xaa5-Ser-Val-# (SEQ ID NO:21)
Name: C1710
Species: magus Isolated: No
Cloned: Yes
DNA Sequence: GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGTTCTGATCCTGACCCTCTGT ATGCTTGCATCTGGGGCTGTCGCTGCGAAACCTAAGAGTCGGCCGAGTTATTGCAAT CTACCAGCGGACAGTGGGTCGGGCACAAAGTCTGAGAAGAGAATTTACTACAATAG CGCTAGAAAACAGTGTTTAAGGTTCACTTACCATGGAGAAGGAGGCAACGCAAACA ATTTTCTCCATACTTTCGATTGCCAACATACGTGTCTGTATACAGTCTGATGCATCCC CTCTGGCGGTGGTGGCAATATCTCTAACACTGTTGAGGAGAGCCAAGGGCGAATTC (SEQ ID NO:22)
Translation: MEGRRFAAVLILTLCMLASGAVAAKPKSRPSYCNLP ADSGSGTKSEKRIYYNSARKQCL RFTYHGEGGNANNFLHTFDCQHTCLYTV (SEQ ID NO:23)
Toxin Sequence:
Ala-Lys-XaaB-Lys-Ser-Arg-XaaS-Ser-XaaS-Cys-Asn-Leu-XaaS-Ala-Asp-Ser-Gly-Ser-Gly-Thr- Lys-Ser-Xaal-Lys-Arg-Ile-XaaS-XaaS-Asn-Ser-Ala-Arg-Lys-Gln-Cys-Leu-Arg-Phe-Thr-XaaS- His-Gly-Xaal-Gly-Gly-Asn-Ala-Asn-Asn-Phe-Leu-His-Tlu-Phe-Asp-Cys-Gln-His-Thr-Cys- Leu-Xaa5-Thr-Val-A (SEQ ID NO:24)
Name: C1716
Species: striatus
Isolated: No
Cloned: Yes
DNA Sequence:
GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGTTCTGATCCTGACCATCTGT ATGCTTGCACCTGGGACTGGTACTTTGCTACCTCGGGATCGACCGAGTCTATGCGAT CTACCAGCGGACAGTGGGTCGGGCACAAAGGCTGAGAAGAGAATTTACTACAATA GCGCTAGAAAACAGTGTTTAAGGTTCGATTACACAGGACAAGGAGGCAACGAAAA CAATTTTCGCCGTACTTACGATTGCCAACGAACGTGTCTGTATACAGGCTGATGCAT CCGCTCTGGTGGTGGTGGCAATATCTCTAACACTGTTGAGGAGAGCCAAGGGCGAA TTC (SEQ ID NO:25) Translation:
MEGRRFAAVLILTICMLAPGTGTLLPRDRPSLCDLP ADSGSGTKAEKRIYYNSARKQCL RFDYTGQGGNENNFRRTYDCQRTCLYTG (SEQ ID NO:26)
Toxin Sequence: Thr-Leu-Leu-XaaS-Arg-Asp-Arg-XaaS-Ser-Leu-Cys-Asp-Leu-XaaS-Ala-Asp-Ser-Gly-Ser-Gly- Tlir-Lys-Ala-Xaal-Lys-Arg-Ile-XaaS-XaaS-Asn-Ser-Ala-Arg-Lys-Gln-Cys-Leu-Arg-Phe-Asp- Xaa5-Thr-Gly-Gln-Gly-Gly-Asn-Xaal-Asn-Asn-Phe-Arg-Arg-Thl--Xaa5-Asp-Cys-Gln-Arg- Thr-Cys-Leu-Xaa5-Thr-# (SEQ ID NO:27)
Name: C 1722
Species: striatus
Isolated: No Cloned: Yes
DNA Sequence:
GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGTTCTGATCCTGACCCTCTGT ATGCTTGCATCTGGGGCTGTCGCTGCGAGACCTAAGGATCGACCGAGTTATTGCAAT CTACCAGCGGACAGTGGGTCGGGCACAAAGCCTGAGCAGAGAATTTACTACAATAG CGCTAAAAAACAGTGTGTAACGTTCACTTACAATGGAAAAGGAGGCAACGGCAAC AATTTTAGCCGTACTAACGATTGCCGACAAACGTGTCAGTATCCAGTTGGCTGAAAT AACTGCGCTGACTGGTGTGGCGACATCCCTAACACTGTTGAGGAGAGCCAAGGGCG AATTC (SEQ E) NO:28)
Translation:
MEGRRPAAVLILTLCMLASGAVAARPKDRPSYCNLP ADSGSGTKPEQRIYYNSAKKQC VTFTYNGKGGNGNNFSRTNDCRQTCQYPVG (SEQ ID NO:29)
Toxin Sequence:
Ala-Arg-XaaS-Lys-Asp-Arg-XaaS-Ser-XaaS-Cys-Asn-Leu-XaaS-Ala-Asp-Ser-Gly-Ser-Gly- Thl--Lys-Xaa3-Xaal-Gln-Arg-Ile-Xaa5-Xaa5-Asn-Ser-Ala-Lys-Lys-Glll-Cys-Val-Thr-Phe-Tl^r- XaaS-Asn-Gly-Lys-Gly-Gly-Asn-Gly-Asn-Asn-Phe-Ser-Arg-Thr-Asn-Asp-Cys-Arg-Gln-Thr- Cys-Gln-Xaa5-Xaa3-Val-# (SEQ ID NO:30)
Name: C1723 Species: striatus
Isolated: No
Cloned: Yes
DNA Sequence: GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGTTCTGATCCTGACCCTCTGT ATGCTTGCATCTCGGGCTGTCGCTGCGAGACCTAAGGATCGACCGAGTTATTGCAAT CTACCAGCGGACAGTGGGTCGGGCACAAAGCCTGAGCAGAGAATTTACTACAATAG CGCTAAAAAACAGTGTGTAACGTTCACTTACAGTGGAAAAGGAGGCAACGGCAAC AATTTTAGCCGTACTAACGATTGCCGACAAACGTGTCAGTATCCAGCTGGCTGAAAT AACTGCGCTGACTGTTGTGGCGACATCCCTAACACTGTTGAGGAGAGCCAAGGGCG AATTC (SEQ ID NO:31)
Translation:
MEGRRFAAVLILTLCMLASPvAVAARPKORPSYCNLPADSGSGTKPEQRIYYNSAKKQC VTFTYSGKGGNGNNFSRTNDCRQTCQYPAG (SEQ ID NO:32)
Toxin Sequence:
Ala-Arg-XaaS-Lys-Asp-Arg-XaaS-Ser-XaaS-Cys-Asn-Leu-XaaS-Ala-Asp-Ser-Gly-Ser-Gly- Tl^l--Lys-Xaa3-Xaal-Gln-Arg-Ile-Xaa5-Xaa5-Asn-Ser-Ala-Lys-Lys-Gln-Cys-Val-Thr-Phe-Thr- XaaS-Ser-Gly-Lys-Gly-Gly-Asn-Gly-Asn-Asn-Phe-Ser-Arg-Tlir-Asn-Asp-Cys-Arg-Gln-Tlir- Cys-Gln-Xaa5-Xaa3-Ala-# (SEQ ID NO:33) Name: C 1726
Species: striatus
Isolated: No
Cloned: Yes
DNA Sequence:
GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGTTCTGATCCTGACCCTCTGT ATGCTTGCATCTGGGGCTGTCGCTGCGAAACCTAAGAGTCGGCCGAGTTATTGCAAT CTACCAGCGGACAGTGGGTCGGGCACAAAGTCTGAGAAGAGAATTTACTACAATAG CGCTAGAAAACAGTGTTTAGGGTTCACTTACCATGGAGAAGGAGGCAACGCAAACA ACTTTCTCCATACTTTCGATTGCCAACATACGTGTCTGTATACAGTCTGATGCATCCG CTCTGGCGGTGGTGGCAATATCTCTAACACTGTTGAGGAGAGCCAAGGGCGAATTC (SEQ ID NO:34) Translation:
MEGRRPAAVLILTLCMLASGAVAAKPKSRPSYCNLP ADSGSGTKSEKRIYYNSARKQCL GFTYHGEGGNANNFLHTFDCQHTCLYTV (SEQ ΓD NO:35)
Toxin Sequence: Ala-Lys-XaaS-Lys-Ser-Arg-XaaS-Ser-XaaS-Cys-Asn-Leu-XaaS-Ala-Asp-Ser-Gly-Ser-Gly-Thr- Lys-Ser-Xaal-Lys-Arg-Ile-XaaS-XaaS-Asn-Ser-Ala-Arg-Lys-Gln-Cys-Leu-Gly-Phe-Thr-XaaS- His-Gly-Xaal-Gly-Gly-Asn-Ala-Asn-Asn-Phe-Leu-His-Thr-Phe-Asp-Cys-Gln-His-Thr-Cys- Leu-Xaa5-Thr-Val-Λ (SEQ E) NO:36)
Name: C 1728
Species: consors
Isolated: No
Cloned: Yes
DNA Sequence:
GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGTTCTGATCCTGACCCTCTGT ATGCTTGCATCTGGGGCTGTCGCTGCGAAACCTAAGAGTCGGCCGAGTTATTGCAAT CTACCAGCGGACAGTGGGTCGGGCACAAAGTCTGAGAAGAGAATTTACTACAATAG" CGCTAGAAAACAGTGTTTAAGGTTCACTTACCATGGAGAAAGGGAAGGGCCAAACG NCAAAAACAATTTTCTCCATACTTTCGATTGCCAACATACGTGTCTGTATACAGTCT GATGCATCCGCTCTGGCGGTGGTGGCAATATCTCTAACACTGTTGAGGAGAGCCAA GGGCGAATTC (SEQ ID NO:37)
Translation:
MEGRRFAAVLiLTLCMLASGAVAAKPKSRPSYCNLP ADSGSGTKSEKRIYYNSARKQCL
RFTYΉGEREGPNXKNNFLHTFDCQHTCLYTV (SEQ ID NO:38)
Toxin Sequence:
Ala-Lys-XaaS-Lys-Ser-Arg-XaaS-Ser-XaaS-Cys-Asn-Leu-XaaS-Ala-Asp-Ser-Gly-Ser-Gly-Thr- Lys-Ser-Xaal-Lys-Arg-Ile-XaaS-XaaS-Asn-Ser-Ala-Arg-Lys-Gln-Cys-Leu-Arg-Plie-Tlir-XaaS- His-Gly-Xaal - Arg-Xaal -Gly-Xaa3 - Asn-Xaa6-Lys- Asn-Asn-Phe-Leu-His-Thr-Phe- Asp-Cys- Gln-His-Thr-Cys-Leu-Xaa5-Thr-Val-Λ (SEQ ID NO:39) Name: C1733 Species: consors
Isolated: No
Cloned: Yes
DNA Sequence: GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGTTCTGATCCTGACCCTCTGT ATGCTTGCATCTGGGGCTGTCGCTGCGAAACCTAAGAGTCGGCCGAGTTATTGCAAT CTACCAGCGGACAGTGGGTCGGGCACAAAGTCTGAGAAGAGAATTTACTACAATAG CGCTAGAAAACAGTGTTTAAGGTTCACTTACCATGGAGAAGGAGGCAACGCAAACA ATTTTCTCCATACTTTCGATTGCCAACATACGTGTCTGTATACAGTCTGATGCATCCG CTCTGGCGGTGGTGGCAATATCTCTAACACTGTTGAGGAGAGCCAAGGGCGAATTC (SEQ ID NO:40)
Translation:
MEGRKFAAVLILTLCMLASGAVAAKPKSRPSYCNLPADSGSGTKSEKillYYNSARKQCL RFTYHGEGGNANNFLHTFDCQHTCLYTV (SEQ ID NO:41)
Toxin Sequence:
Ala-Lys-XaaS-Lys-Ser-Arg-XaaS-Ser-XaaS-Cys-Asn-Leu-XaaS-Ala-Asp-Ser-Gly-Ser-Gly-Thr- Lys-Ser-Xaal-Lys-Arg-Ile-XaaS-XaaS-Asn-Ser-Ala-Arg-Lys-Gln-Cys-Leu-Arg-Plie-Thr-XaaS- His-Gly-Xaal-Gly-Gly-Asn-Ala-Asn-Asn-Phe-Leu-His-Thr-Phe-Asp-Cys-Gln-His-Thr-Cys- Leu-Xaa5-Tlτr-Val-Λ (SEQ ID NO:42)
Name: C1736
Species: consors
Isolated: No
Cloned: Yes DNA Sequence:
GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGTTCTGATCCTGACCCTCTGT ATGCTTGCATCTGGGGCTGTCGCTGCGAGACCTAAGGATCGACCGAGTTATTGCAAT CTACCAGCGGACAGTGGGTCGGGCACAAAGCCTGAGCAGAGAATTTACTACAATAG CGCTCGAAAACAGTGTTTAACGTTCACTTACAATGGAAAAGGAGGCAACGAAAACA ATTTTATCCATACTTACGATTGCCGACGAACGTGTCAGTATACAGTCTGATGCATCC GCTCTGGCGGTGGTGGCAATATCTCTAACACTGTTGAGGAGAGCCAAGGGCGAATT C (SEQ E) NO:43)
Translation: MEGRRFAAVLILTLCMLASGAVAARPKDRPSYCNLP ADSGSGTKPEQRIYYNSARKQC LTFTYNGKGGNENNFΓHTYDCRRTCQYTV (SEQ ID NO:44)
Toxin Sequence: Ala-Arg-XaaS-Lys-Asp-Arg-XaaS-Ser-XaaS-Cys-Asn-Leu-XaaS-Ala-Asp-Ser-Gly-Ser-Gly- Thr-Lys-XaaS-Xaal-Gln-Arg-Ile-XaaS-XaaS-Asn-Ser-Ala-Arg-Lys-Gln-Cys-Leu-Tliir-Phe-Thr- XaaS-Asn-Gly-Lys-Gly-Gly-Asn-Xaal-Asn-Asn-Phe-Ile-His-Thr-XaaS-Asp-Cys-Arg-Arg-Thr- Cys-Gln-Xaa5-Thr-Val-Λ (SEQ ID NO:45)
Name: C1741
Species: catus Isolated: No
Cloned: Yes
DNA Sequence:
GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGTTCTGATCCTGACCACCTGT ATGCTTGCACCTGGGACTGGTACTTTGATACCTCGGGGTCGACCGAGTTATTGCAAT CTACGAAAGGACAGTGGGTCGTGCACAAGGTCTGAGCAGAGCACAGAGTCTGAGT ACAGATATTACTTCAGTACACATTATAATGAGTGTAGAATGTTCACTTACAAAGGAT GTGGAGGCAACCGCAACAATTTTATCCATATGCACGATTGTCGACAAAAGTGTGTG TATACAGTTGGCTGAAATAATTGCGCTGACTGTTGTGGCGACATCCCTAACACTGTT GAGGAGATCCAAGGGCGAATTC (SEQ ID NO:46)
Translation:
MEGRJRPAAVLILTTCMLAPGTGTLIPRGRPSYCNLRECDSGSCTRSEQSTESEYRYYFSTH YNECRMFTYKGCGGNRJSINFIHMHDCRQKCVYTVG (SEQ ID NO:47)
Toxin Sequence:
Thr-Leu-Ile-XaaS-Arg-Gly-Arg-XaaS-Ser-XaaS-Cys-Asn-Leu-Arg-Lys-Asp-Ser-Gly-Ser-Cys- Tlαr-Arg-Ser-Xaal-Gln-Ser-Thr-Xaal-Ser-Xaal-XaaS-Arg-XaaS-XaaS-Phe-Ser-Thr-His-XaaS- Asn-Xaal-Cys-Arg-Met-Phe-Thr-XaaS-Lys-Gly-Cys-Gly-Gly-Asn-Arg-Asn-Asn-Phe-Ile-His- Met-His-Asp-Cys-Arg-Gln-Lys-Cys-Val-Xaa5-Thr-Val-# (SEQ ID NO:48)
Name: C1742 Species: catus
Isolated: No
Cloned: Yes
DNA Sequence: GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGTTCTGATCCTGACCATCTGT ATGCTTGCACCTGGGACTGGTACTTTGATACCTCGGGATCGACCGAGTTATTGCAAT CTACCAGCGGACAGTGGGTCGGGCACAAATCGTGAGCAGAGAATTTACTACAATAG CGCTAGAAAACAGTGTTTAACGTTCCCTTACAAAGGAAAAGGAGGCAACGCAAACA ATTTTAGCCGTACTAACGATTGCCGACGAACGTGTCAGTATCCAGCAGCTGGCTGA AATAATTGCGCTGACTGTTGTGGCGACATCCCTAACACTGTTGAGGAGAGCCAAGG GCGAATTC (SEQ ID NO:49) Translation:
MEGRRFAAVLILTICMLAPGTGTLIPRDRPSYCNLP ADSGSGTNREQRIYYNSAJRKQCLT FPYKGKGGNANNFSRTNDCRRTCQYPAAG (SEQ ID NO:50) Toxin Sequence:
Thr-Leii-Ile-XaaS-Arg-Asp-Arg-XaaS-Ser-XaaS-Cys-Asn-Leu-XaaS-Ala-Asp-Ser-Gly-Ser-Gly- TJar-Asn-Arg-Xaal-Gln-Arg-Ile-XaaS-XaaS-Asn-Ser-Ala-Ai-g-Lys-Gln-Cys-Leu-Thr-Phe-XaaS- XaaS-Lys-Gly-Lys-Gly-Gly-Asn-Ala-Asn-Asn-Phe-Ser-Arg-Thr-Asn-Asp-Cys-Arg-Arg-Thr- Cys-Gln-Xaa5-Xaa3-Ala-Ala-# (SEQ ID NO:51)
Name: C1754
Species: betulinus
Isolated: No
Cloned: Yes
DNA Sequence:
GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGTTCTGATCCTGACCATCTGT CTGCTGGCACTTGGGGACGGCGCTTCCAGACGTCAGGGTCCGCCAACAAATAAGTG TTCTCGTGATGTTGCCCTAAGTAAGTGTTACCAACCCAGGGATCCGGGGCCGTGTAA TGCTTTCTTTGAGAAGTATTACTTCAACAGGTATATCAACACTTGCGAAAAATTCAC TTACGGAGGATGTCAAGGCAACGACAACAGATTTAACACCGTGGAGGACTGCCTAG GATGTTGTCTACTGAGTGTATGCAGACAACCAGCGGAAACGGGACCGTGCAGAGGG TATTTCCCGAAATATTACTTCGATATGGATTCTTACGAGTGCAAACAGTTCATTTAC GGAGGATGCGGTGGCAACGACAACAATTTTGGCACTGTCGAAGAGTGTCAAGGCAG ATGTGGGCCGAAATAACTGCGCTGATTGTTGTGGCGACATCCCTAACACTGTTGAG GAGAGCCAAGGGCGAATTC (SEQ ID NO:52) Translation:
MEGRRFAAVLILTICLLALGDGASRRQGPPTNKCSRDVALSKCYQPRDPGPCNAFFEKY YFNRYINTCEKFTYGGCQGNDNRFNTVEDCLGCCLLSVCRQP AETGPCRGYFPKYYFD MDSYECKQFIYGGCGGNDNNFGTVEECQGRCGPK (SEQ ID NO:53)
Toxin Sequence:
Ala-Ser-Arg-Arg-Glii-Gly-XaaS-XaaS-Thr-Asn-Lys-Cys-Ser-Arg-Asp-Val-Ala-Leu-Ser-Lys- Cys-XaaS-Gln-XaaS-Arg-Asp-XaaS-Gly-XaaS-Cys-Asn-Ala-Phe-Phe-Xaal-Lys-XaaS-XaaS- Phe- Asn- Arg-Xaa5 -He- Asn-Thr-Cys-Xaal -Lys-Phe-Thr-Xaa5 -Gly-Gly-Cys-Gln-Gly- Asn- Asp- Asn-Arg-Phe-Asn-Tlir-Val-Xaal-Asp-Cys-Leu-Gly-Cys-Cys-Leu-Leu-Ser-Val-Cys-Arg-Gln- XaaS-Ala-Xaal-Thr-Gly-XaaS-Cys-Arg-Gly-XaaS-Plie-XaaS-Lys-XaaS-XaaS-Phe-Asp-Met- Asp-Ser-XaaS-Xaal-Cys-Lys-Gln-Phe-Ile-XaaS-Gly-Gly-Cys-Gly-Gly-Asn-Asp-Asn-Asn-Phe- Gly-Thr-Val-Xaal-Xaal-Cys-Gln-Gly-Arg-Cys-Gly-Xaa3-Lys-Λ (SEQ ID NO:54)
Name: C1756
Species: betulinus
Isolated: No Cloned: Yes
DNA Sequence:
GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGTTCTGATCCTGACCATCTGT CTGCTTGCTCTTGGGGCTGGCGCTTCCAGACGTCAGGGTCCGCCAACAAACAAGTGT TCTCGTGATGTTGCCCTAAGTAAGTGTTACCAACCCAGGGATCCGGGGCCGTGTTAT GCTTTGTTGGAGAGGTATTACTTCAACAGGTATATCAACACTTGCGAAAAATTCACT TACGGAGGATGTCAAGGCAACGACAACAGATTTAACACCATGGAGGATTGCCTAGG ATGTTGTCAACTGAGTGTATGCAGACAACCAGCGGAACCGGGACTGTGCAGAGGGT ATTTCCTGAGACATTACTTCGATATGGATTTTAACGAGTGCAAAGAGTTCATTTACG GAGGATGCGGTGGCAACGACAACAATTTTCTCACTGACGAAGAGTGTCAAGGCAGA TGTGGGCCGGAATAACTGCGCTGATTGTTGTGGCGACATCCCTAACACTGTTGAGG AGAGCCAAGGGCGAATTC (SEQ ID NO:55) Translation:
MEGRRFAAVLILTICLLALGAGASRRQGPPTNKCSRDVALSKCYQPRDPGPCYALLERY YFNRYINTCEKFTYGGCQGNDNRFNTMEDCLGCCQLSVCRQPAEPGLCRGYFLRHYFD MDFNECKEFIYGGCGGNDNNFLTDEECQGRCGPE (SEQ ID NO:56) Toxin Sequence:
Ser-Arg-Arg-Gln-Gly-XaaS-XaaS-Tlir-Asn-Lys-Cys-Ser-Arg-Asp-Val-Ala-Leu-Ser-Lys-Cys- XaaS-Gln-XaaS-Arg-Asp-XaaS-Gly-XaaS-Cys-XaaS-Ala-Leu-Leu-Xaal-Arg-XaaS-XaaS-Phe- Asn-Arg-XaaS-Ile-Asn-Thr-Cys-Xaal-Lys-Phe-Thr-XaaS-Gly-Gly-Cys-Gln-Gly-Asn-Asp-Asn- Arg-Phe-Asn-Thr-Met-Xaal-Asp-Cys-Leu-Gly-Cys-Cys-Gln-Leu-Ser-Val-Cys-Arg-Gln-XaaS- Ala-Xaal-XaaS-Gly-Leu-Cys-Axg-Gly-XaaS-Phe-Leu-Arg-His-XaaS-Phe-Asp-Met-Asp-Phe- Asn-Xaal-Cys-Lys-Xaal-Phe-Ile-XaaS-Gly-Gly-Cys-Gly-Gly-Asn-Asp-Asn-Asn-Phe-Leu-Thr- Asp-Xaal-Xaal-Cys-Gln-Gly-Arg-Cys-Gly-Xaa3-Xaal-Λ (SEQ ID NO:57)
Name: C1757
Species: betulinus
Isolated: No
Cloned: Yes
DNA Sequence:
GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGCTCTGGTCCTGACCATTTGT CTGCTTGCACTTGGGGCTGACGCTTCCAGACGTCAGGATCTGTGCAGTCTACCAGCG GAAAAGGGACCGTGCTTAGCATATATGCCGAGATTTTACTTCGATTGGGATTCTAAG TTATGCAAAGTGTTCATTTACGGAGGATGTCAGGGCAACGACAACAATTTTCACAG TTCCACGGACTGTTACGACACATGTTGGTTTGAATAACTGCGCTGATTGTTGTGGCG ACATCCCTAACACTGTTGAGGAGAGCCAAGGGCGAATTC (SEQ ID NO:58)
Translation: MEGRRFAAALVLTICLLALGADASRRQDLCSLPAEKGPCLAYMPRFYFDAVDSKLCKVF IYGGCQGNDNNFHSSTDCYDTCWFE (SEQ ID NO:59)
Toxin Sequence: Ser-Arg-Arg-Gln-Asp-Leu-Cys-Ser-Leu-XaaS-Ala-Xaal-Lys-Gly-XaaS-Cys-Leu-Ala-XaaS- Met-Xaa3-Arg-Phe-Xaa5-Phe-Asp-Xaa4-Asp-Ser-Lys-Leu-Cys-Lys-Val-Phe-Ile-Xaa5-Gly- Gly-Cys-Gln-Gly-Asn-Asp-Asn-Asll-Phe-His-Ser-Ser-Thr-Asp-Cys-Xaa5-Asp-Thr-Cys-Xaa4- Phe-Xaal-Λ (SEQ ID NO:60)
Name: C1758
Species: betulinus
Isolated: No
Cloned: Yes
DNA Sequence:
GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGTTCTGATCCTGACCATCTGT CTGCTTGCACTTGGGGCTGGCGCTTCCAGACGTCAGGATCTGTGCAGTCTACCAGCG GAAAAGGGACCGTGCTTAGCATATATGCCGAGATTTTACTTCGATTGGGATTCTAAG TTATGCAAAGTGTTCATTTACGGAGGATGTCAGGGCAACGACAACAATTTTCACAG TTCCTCGGACTGTTACGACACATGTTGGTTTGAATAACTGCGCTGATTGTTGTGGCG ACACCCCTAACACTGTTGAGGAGAGCCAAGGGCGAATTC (SEQ ID NO:61)
Translation:
MEGRRFAAVLILTICLLALGAGASRRQDLCSLPAEKGPCLAYMPRFYFDWDSKLCKVFI YGGCQGNDNNFHSSSDCYDTCWFE (SEQ ID NO:62) Toxin Sequence:
Ser-Arg-Arg-Gln-Asp-Leu-Cys-Ser-Leu-XaaS-Ala-Xaal-Lys-Gly-XaaS-Cys-Leu-Ala-XaaS- Met-Xaa3-Arg-Phe-Xaa5-Phe-Asp-Xaa4-Asρ-Ser-Lys-Leu-Cys-Lys-Val-Phe-Ile-Xaa5-Gly- Gly-Cys-Gln-Gly-Asn-Asp-Asn-Asn-Phe-His-Ser-Ser-Ser-Asp-Cys-Xaa5-Asp-Thr-Cys-Xaa4- Phe-Xaal-Λ (SEQ ID NO:63)
Name: C1760
Species: betulinus
Isolated: No
Cloned: Yes
DNA Sequence:
GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGTTCTGATCCTGACCATCTGT CTGCTGGCACTTGGGGCTGGCGCTTCCAAACGTCAGGGTCCGCCAACAAACAAGTG TTCTCGTGATGTCGCCCTAAGTAAGTGTTACCAACCCAGGGATCCGGGGCCGTGTTA TGCTTCGTTTCGCATGTATTACTTCAACAGGTATATCAACACTTGCGAAAAATTCAC TTACGGAGGATGTCAAGGCAACGACAACAGATTTAACACCGTGGAGGACTGCCTAG GATGTTGTCAACTGAGTGTATGCAGACAACCAGCGGAACCGGGACTGTGCAAAGGG TATTTCCCGAGACATTACTTCGATATGGATTCTTACGAGTGCAAAACGTTCATTTAC GGAGGATGCGGTGGCAACGACAACAATTTTCTCACTGACGGAGAGTGTCAAGGCAG ATGTGGGCCGGAATAACTGCGCTGATTGTTGTGGCGACATCCCTAACACTGTTGAG GAGAGCCAAGGGCGAATTC (SEQ ID NO:64) Translation:
MEGRRFAAVLILTICLLALGAGASK-RQGPPTMCCSRDVALSKCYQPRDPGPCYASFRMY YFNRYINTCEKFTYGGCQGNDNRFNTVEDCLGCCQLSVCRQP AEPGLCKGYFPRHYFD MDSYECKTFIYGGCGGNDNNFLTDGECQGRCGPE (SEQ TD NO:65)
Toxin Sequence:
Ser-Lys-Arg-Gln-Gly-XaaS-XaaS-Thr-Asn-Lys-Cys-Ser-Arg-Asp-Val-Ala-Leu-Ser-Lys-Cys- XaaS-Gln-XaaS-Ai-g-Asp-XaaB-Gly-XaaS-Cys-XaaS-Ala-Ser-Phe-Arg-Met-XaaS-XaaS-Plie- Asn-Arg-XaaS-Ile-Asn-Thr-Cys-Xaal-Lys-Phe-Thr-XaaS-Gly-Gly-Cys-Gln-Gly-Asn-Asp-Asn- Arg-Phe-Asn-Thr-Val-Xaal -Asp-Cys-Leu-Gly-Cys-Cys-Gln-Leu-Ser-Val-Cys-Arg-Gln-XaaS - Ala-Xaal-XaaS-Gly-Leu-Cys-Lys-Gly-XaaS-Phe-XaaS-Arg-His-XaaS-Phe-Asp-Met-Asp-Ser- Xaa5-Xaal-Cys-Lys-Thl-Phe-Ile-Xaa5-Gly-Gly-Cys-Gly-Gly-Asn-Asp-Asn-Asn-Phe-Leu-Tllr- Asp-Gly-Xaal-Cys-Gln-Gly-Arg-Cys-Gly-Xaa3-Xaal-A (SEQ ID NO:66)
Name: C 1768
Species: biliosus
Isolated: No Cloned: Yes
DNA Sequence:
GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGTTATGATCCTCACCATCTGC GTGCTTGCACTTAGGGCTGGCGCTTTCAGACTTCGTGGTTCGCGAGCTGAACAGTGT TCTCGTTCTGAAGCCTTAGCAAAGTGTTACCTTCCCAAGGATCCGGGGCCGTGTAAG GCATGGAAGTCCAGGTATTACTTCAACAGATACCTCAACACGTGCCAAGAGTTCAG TTACGGAGGATGTCGTGGCAACGCCAACAGATTTGACACCATGGAGGACTGCCAAG AATGTTGTCTACTGAGTGTATGCAGACAACCAGCGGAACCGGGGCTGTGCAAAGCG TATATGGAGAGATATTACTTTGATATGGATTCTTACGACTGTAAGCCGTTCATTTAC GGAGGATGTAACGGCAACGACAACAATTTTCTCACTTACATTGAGTGTTACGGCAG ATGTGGGCCGGAATAACTGCGCTGGTTGTTGTGCCGACACCCCTAACACTGTTGAG GAGAGCCAAGGGCGAATTC (SEQ ID NO:67)
Translation: MEGRRFAAVMILTICVLALRAGAFRLRGSRAEQCSRSEALAKCYLPKDPGPCKAWKSR YYFNRYLNTCQEFSYGGCRGNANRFDTMEDCQECCLLSVCRQP AEPGLCKAYMERYY FDMDSYDCKPFIYGGCNGNDNNFLTYIECYGRCGPE (SEQ ID NO:68)
Toxin Sequence: Phe-Arg-Leu-Arg-Gly-Ser-Arg-Ala-Xaal-Gln-Cys-Ser-Arg-Ser-Xaal -Ala-Leu- Ala-Lys-Cys- Xaa5 -Leu-Xaa3-Lys- Asp-Xaa3 -Gly-Xaa3 -Cys-Lys- Ala-Xaa4-Lys-S er- Arg-Xaa5 -Xaa5 -Phe- Asn-Arg-XaaS-Leu-Asn-Thr-Cys-Gln-Xaal-Plie-Ser-XaaS-Gly-Gly-Cys-Arg-Gly-Asn-Ala- Asn-Arg-Phe-Asp-Tlir-Met-Xaal-Asp-Cys-Gln-Xaal-Cys-Cys-Leu-Leu-Ser-Val-Cys-Arg-Gln- XaaS-Ala-Xaal-XaaS-Gly-Leu-Cys-Lys-Ala-XaaS-Met-Xaal-Ai-g-XaaS-XaaS-Phe-Asp-Met- Asp-Ser-XaaS-Asp-Cys-Lys-XaaS-Phe-Ile-XaaS-Gly-Gly-Cys-Asn-Gly-Asn-Asp-Asn-Asn-Phe- Leu-Thr-Xaa5-Ile-Xaal-Cys-Xaa5-Gly-Arg-Cys-Gly-Xaa3-Xaal-Λ (SEQ ID NO:69) Name: C 1769
Species: biliosus
Isolated: No
Cloned: Yes
DNA Sequence:
GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGTACTGATCCTCACCATCTGC
GTGCTTGCACTTAGGGCTGGCGCTTTCAGACTTCGTGGTTCGCGAGCTGAAGAGTGT
TCTCGTTCTGAAGCCTTAGCAAAGTGTTACCTTCCCAAGGATCCGGGGCCGTGTAAG GCATGGAAGTCCAGGTATTACTTCAACAGATACCTCAACACGTGCCAAGAGTTCAG TTACGGAGGATGTCGTGGCAACGCCAACAGATTTGACACCATGGAGGACTGCCAAG AATGTTGTCTACTGAGTGTATGCAGACAACCAGCGGAACCGGGGCTGTGCAAAGCG TATATGGAGAGATATTACTTTGATATGGATTCTTACGACTGTAAGCCGTTCATTTAC GGAGGATGTAACGGCAACGACAACAATTTTCTCACTTACATTGAGTGTTACGGCAG ATGTGGGCCGGAATAACTGCGCTGGTTGTTGTGCCGACACCCCTAACACTGTTGAG GAGAGCCAAGGGCGAATTC (SEQ ID NO:70)
Translation:
MEGRRFAAVLILTICVLALRAGAFRLRGSRAEECSRSEALAKCYLPKDPGPCKAWKSRY YFNRYLNTCQEFSYGGCRGNANRFDTMEDCQECCLLSVCRQPAEPGLCKAYMERYYF DMDSYDCKPFIYGGCNGNDNNFLTYIECYGRCGPE (SEQ ID NO:71)
Toxin Sequence:
Phe-Arg-Leu-Arg-Gly-Ser-Arg-Ala-Xaal-Xaal-Cys-Ser-Arg-Ser-Xaal -Ala-Leu- Ala-Lys-Cys- Xaa5-Leu-Xaa3 -Lys- Asp-Xaa3 -Gly-Xaa3 -Cys-Lys-Ala-Xaa4-Lys-S er- Arg-Xaa5 -Xaa5 -Phe- Asn-Arg-XaaS-Leu-Asn-Thr-Cys-Glii-Xaal-Phe-Ser-XaaS-Gly-Gly-Cys-Arg-Gly-Asn-Ala- Asn-Arg-Phe-Asp-Thr-Met-Xaal-Asp-Cys-Gln-Xaal-Cys-Cys-Leu-Leu-Ser-Val-Cys-Arg-Gln- XaaS-Ala-Xaal-XaaS-Gly-Leu-Cys-Lys-Ala-XaaS-Met-Xaal-Arg-XaaS-XaaS-Phe-Asp-Met- Asp-Ser-Xaa5-Asp-Cys-Lys-Xaa3-Phe-Ile--Xaa5-Gly~Gly-Cys-Asn-Gly-Asn-Asp-Asn-Asn-Phe- Leu-Tlir-XaaS-Ile-Xaal-Cys-XaaS-Gly-Arg-Cys-Gly-XaaS-Xaal^ (SEQ ID NO:72)
Name: C 1790
Species: wittigi
Isolated: No
Cloned: Yes
DNA Sequence: GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGTTCTGATCCTGACCATCTGT ATGCTTGCACTTGGGGCTGGTGCTTCGAGACTTCGGGATCAACTGAATAGATGCAA ACAACCAAAGGTAACGGGGCCGTGCAAAGGGGCGTTTCGGAGGTATTACTTTGATA CAGATGTTCGCAACTGTAAACAGTTCACTTACGGAGGATGTAGAGGCAACGACAAC AATTTTCTCACTTATGATGACTGTAACGCCACATGTGGTCCGAAATAATTGCGCTGA TTGTTGTGGCGACATCCCTAGCACTGCTGAGGAGAGCCACGCTGTGTGCTGATTGTT GTGGCGACATCCCTAACACTGTTGAGGAGAGCCAAGGGCGAATTC (SEQ ID NO:73) Translation:
MEGRRFAAVLILTICMLALGAGASRLRDQLNRCKQPKVTGPCKGAFRRYYFDTDVRNC KQFTYGGCRGNDNNFLTYDDCNATCGPK (SEQ ID NO:74) Toxin Sequence:
Ser-Arg-Leu-Arg-Asp-Gln-Leu-Asn-Arg-Cys-Lys-Gln-XaaS-Lys-Val-Thr-Gly-XaaS-Cys-Lys- GIy- Ala-Phe- Arg- Arg-Xaa5 -Xaa5 -Plie- Asp-Thr- Asρ-Val-Arg-Asn-Cys-Lys-Gln-Phe-Thi--Xaa5 - Gly-Gly-Cys-Arg-Gly-Asn-Asp-Asn-Asn-Phe-Leu-Thr-XaaS-Asp-Asp-Cys-Asn-Ala-Thr-Cys- Gly-Xaa3-Lys-Λ (SEQ ID NO:75)
Name: DI008
Species: distans Isolated: No
Cloned: Yes
DNA Sequence:
GAATTCGGCCATTACGGCCGGGATCTACACTCCGCCTGCTGACACGTCATCTACTCT CTGTCTCCCTGACTGCTGCCTTCAGTCGACCCTGCCGTCATCTCAGCGCAGACTTGG TAAGAAGTGAAAACCTTTATCATGGAGAAACTGATAACCCTGCTTCTTGTTGCTACT GTCCTATTGTTGACCCTGGTTCAAGCAATAGCAGAAAACACCTGCGAACAGCCACC GGAGCCAGGTAGGTGTGAGGGATACTATCGTAGGTTTTTCTACAACTGGAGGTCGG GCCAGTGCGAGTCATTTGTCTATGGAGGTTGTGGTGGCAACGACAACAATTTCCGG ACCAACGCTGAATGTGAGGCTGCGTGCTCCAGTACCAACACTTATGCTATATCAGA AAACACCTGCGAACAGCCAGCGGAGCAAGGTAGGTGTACGGAGTACGTTGTCAGGT TTTTCTACAACTGGAAGTCGGACAAGTGCGAGCCATTTGTCTATGGAGGTTGTGGTG GCAACAGCAACAGTTTCCTGACCATCACTGAATGTGAGACTGCATGCTCCAGTGGA AACACTTATGAAGACGTATGCCAACTGCCAGCTGATCGAGGGGTATGTTCGGCGCA CTTGCACATGTTTTACTATAACTCCTCATCAGGACAGTGCCATCAGTTTATCTACAG AGGTTGTGGNGGTAACGGCAACAAATTTTCGACCATGAGGGAATGTCAAGCTAAGT GCTCCAGAGGCGTAAAGTACTCAAAGGTCTTGCCAACAAAACAATGGAAATTTTTT AGACGAAACGAGCCCCGATATTTGTTGGCATGAGTAAAAGAGGAAATTGANCAGC NCGGAGAGGTNCCNNACGGAGTNCCNGGGGTGCTTGGGGATTCAGGACNCCCTGCT GCTGCTGTTGCATGCGGCTGGAATCCTTGGCGTTNTTTGACAGTTTNCCCCAGANGA ANCCTTTGCTTGACATCNCGTTTTTTCCCTTTTTNTCTTTTTGTAGATCGTTTTTAACC TGTTGGNGTTTTCANTTAGAACAGCGNGTTTTCAGATGTNCAGTATCCANGTNTATG NGATNTCTTTGTCTGCCNGTCTGTCTGTCTGTCTGTCTGTNTNTCAATNTGAGATTTT AGTCAGAACAATATNCNTTTAAACATAAAGTTTTCAANCCAANGTATTTNTAGTTTT TCCCTTTTNTTTTACCNCTNTTATTTTTCCCCNTGATTTNCCNTTAAACNTTGTTTTTC TAAAAAAAAAAAAAAAAAAAAAAAAAAAAAACATGTCGGCCGCCTCGGCCCTCGA GAAGCTTTCTAGA (SEQ ID NO:76)
Translation: MEKLITLLLVATVLLLTLVQAIAENTCEQPPEPGRCEGYYRRFFYNWRSGQCESFVYGG CGGNDNNFRTNAECEAACSSTNTYAISENTCEQPAEQGRCTEYVVRFFYNWKSDKCEP FVYGGCGGNSNSFLTITECETACSSGNTYEDVCQLPADRGVCSAHLHMFYYNSSSGQC HQFIYRGCGGNGNKFSTMRECQAKCSRGVKYSKVLPTKQWKFFRRNEPRYLLA (SEQ ID NO:77) Toxin Sequence:
Xaal -Asn-Thr-Cys-Xaal -Gln-Xaa3-Xaa3-Xaal -Xaa3-Gly-Arg-Cys-Xaal -Gly-Xaa5-Xaa5-Arg- Arg-Phe-Phe-Xaa5-Asn-Xaa4-AIg-Ser-Gly-Glll-Cys-Xaal-Ser-Phe-Val-Xaa5-Gly-Gly-Cys- Gly-Gly- Asn-Asp-Asn-Asn-Phe-Arg-Thr-Asn-Ala-Xaal -Cys-Xaal -Ala-Ala-Cys-Ser-Ser-Tlir- Asn-Thr-XaaS-Ala-Ile-Ser-Xaal-Asn-Thr-Cys-Xaal-Gln-XaaS-Ala-Xaal-Gln-Gly-Arg-Cys- Tllr-Xaal-Xaa5-Val-Val-Arg-Phe-Phe-Xaa5-Asn-Xaa4-Lys-Ser-Asp-Lys-Cys-Xaal-Xaa3-Phe- Val-XaaS-Gly-Gly-Cys-Gly-Gly-Asn-Ser-Asn-Ser-Phe-Leu-Thr-Ile-Thr-Xaal-Cys-Xaal-Thr- Ala-Cys-Ser-Ser-Gly-Asn-Thr-XaaS-Xaal-Asp-Val-Cys-Gln-Leu-XaaS-Ala-Asp-Arg-Gly-Val- Cys-Ser-Ala-His-Leu-His-Met-Phe-XaaS-XaaS-Asn-Ser-Ser-Ser-Gly-Gln-Cys-His-Gln-Phe-Ile- XaaS-Arg-Gly-Cys-Gly-Gly-Asn-Gly-Asn-Lys-Phe-Ser-Thr-Met-Arg-Xaal-Cys-Gln-Ala-Lys- Cys-Ser-Arg-Gly-Val-Lys-Xaa5-Ser-Lys-Val-Leu-Xaa3-Thr-Lys-Gln-Xaa4-Lys-Phe-Phe-Arg- Arg-Asn-Xaal-Xaa3-Arg-Xaa5-Leu-Leu-Ala-Λ (SEQ ID NO:78)
Name: DI085
Species: distans
Isolated: No Cloned: Yes
DNA Sequence:
GAATTCGGCCATTACGGCCGGGGATTCAAGCGACGAGGTAGGTGAAGTGAAGGCG AGACGTAGGTGCATTTCTCTACTGAGTGCTGCTGTGTTCTGCCTTGACCTGCCTCAG CCCGGTCAGAAATACAGTGGGCTACAACACGGAGGTTCTGGCGATGTCAAAACTGG GAGTCGTGCTGATCACCTTTCTGCTTCTGTTTCCCCTGGGAACTGTTCAGCTGGGTG GAGATGACCGCTGCACACTGCAGTTATCCCACGGCACCTGTCCAGGCTATTTCCCCC GCTGGTTCTATGACTCGGCCAGTGGCCAGTGCCAGAGCTTCATATACAGCGGATGT AAAGGCAACGCCAACAACTTTCTGTCTGAGGAGGAATGCCGCCAGGCTTGCGTCAG CCGTTGACGTCAATTATACCACGTTCCTTCCTTCCGTCGTGATGGAGATTTCAATCTT GTCATCGGTAGAAGCCAGTCTCGTCGTTCTATGTGTATGACGTCACCGTTTTATGGT GTGACGTCACCGTTTTATGGATGTGGCGTGGCCTGAAACTGAAAAGGTATAAAAAC ATCAGAAATCTACT (SEQ ID NO:79) Translation:
MSKLGVVLITFLLLFPLGTVQLGGDDRCTLQLSHGTCPGYFPRWFYDSASGQCQSFIYS GCKGNANNFLSEEECRQACVSR (SEQ ID NO:80)
Toxin Sequence: Gly-Gly-Asp-Asp-Arg-Cys-Tlir-Leu-Gln-Leu-Ser-His-Gly-Thr-Cys-XaaS-Gly-XaaS-Phe-XaaS- Arg-Xaa4-Plle-Xaa5-Asp-Ser-Ala-Ser-Gly-Gln-Cys-Gln-Ser-Phe-Ile-Xaa5-Ser-Gly-Cys-Lys- GIy- Asn- Ala- Asn-Asn-Phe-Leu-Ser-Xaal -Xaal -Xaal -Cys-Arg-Gln-Ala-Cys-Val-Ser-Arg-Λ (SEQ ID NO:81)
Name: Conkunitzm Sl
Species: striatus
Isolated: No Cloned: Yes
DNA Sequence:
GAATTCGCCCTTATGGAGGGACGTCGTTTTGCTGCTGTTCTGATCCTGACCATCTGT ATGCTTGCACCTGGGACTGGTACTTTGCTACCTCGGGATCGACCGAGTCTATGCGAT CTACCAGCGGACAGTGGGTCGGGCACAAAGGCTGAGAAGAGAATTTACTACAATA GCGCTAGAAAACAGTGTTTAAGGTTCGATTACACAGGACAAGGAGGCAACGAAAA CAATTTTCGCCGTACTTACGATTGCCAACGAACGTGTCTGTATACAGGCTGATGCAT CCGCTCTGGTGGTGGTGGCAATATCTCTAACACTGTTGAGGAGAGCCAAGGGCGAA TTC (SEQ E) NO:82)
Translation:
MEGRRFAAVLILTICMLAPGTGTLLPRDRPSLCDLP ADSGSGTKAEKRIYYNSARKQCL RFDYTGQGGNENMFRRTYDCQRTCLYTG (SEQ ID NO:83)
Toxin Sequence:
Thr-Leu-Leu-XaaS-Arg-Asp-Arg-XaaS-Ser-Leu-Cys-Asp-Leu-XaaS-Ala-Asp-Ser-Gly-Ser-Gly- Tlir-Lys-Ala-Xaal-Lys-Arg-Ile-XaaS-XaaS-Asn-Ser-Ala-Arg-Lys-Gln-Cys-Leu-Arg-Phe-Asp- XaaS-Thr-Gly-Gln-Gly-Gly-Asn-Xaal-Asn-Asn-Phe-Arg-Arg-Thr-XaaS-Asp-Cys-Gln-Arg- Thr-Cys-Leu-Xaa5-Thr-# (SEQ ID NO:84)
Name: ShKmI
Species: magus
Isolated: No
Cloned: Yes
DNA Sequence: GAATTCGCCCTTGGCGATGAATGAACACTGCGTTTGCTGGCTTTGACGAAAACCAGT CCACGTCAGCAGAGGGAGAGAGAGAGAGAGACCTTAGGAGCTGTGTATTCTCCAGT CATCTGACGGCCCCATCCACGTCAGTGCTGTTTCTTCTATCAGCCAGTCCATATCAA CGCTCTACCGTCTGTCAGCCAGTCCACATCAGCGCTCTACCATCTGTCAGCCTGTTT ACGTCAGCACTGTCATCTGACTGTCCAGGTTAAAAAATGGAGGGACGTCGTTTTGCT GCTGTTCTGATCCTGACCATCTGTATGCTTGCACCTGGGACTGGTCGACCGAGTGTA TGCAATAAACCAGCGGACAAGGGGCCGTGCACAGGGTCTGAGAAGAGATTCTACTT CAGTACCTATCATAATGAGTGTAGAACGTTCAAATACGGAGGATGTGAAGGCAACG GCAACAATTTTATCCATGTGTACAATTGTCGAAGAACGTGTGTGTATCCACCTGGCT GAAATAACTGCGCTGACTGTTGTGGCGACATCCCTAACACTGTTGAGGAGAGCCAA GCTGTGGGCTTCTACAGATCCTTTCTACAGCGTCTAGTCTGTGTTCTGTATCTCTGTG GATCCTTTTAATGGTATCTGTTTTGGGTATCTCTATAGATACTTTACAGAGGGTCTGT TTTGTGTTTCTGTACAGATCCTTTTCAAAGTGTCTGTTTTGTGTATCTCTACAGGTCC TTTTCAAAGTGTCTGTTTTGTGTATCTCTACAGATCCTTTTCGTAGTGTCTGTTTTGTG TATCGCTACAGATCCTTTTCAAAGTGTTTTGTGTATCTCTACAGATCCTTTTCAAATT GTTTTGTGTATCTCTACAGATCCTTTTCAAAGTGTCTGTTTGTGTACCTCTACAGATA CTTCCCATAGAGTCTGTTATAGAGTCTATAAATCCTTTCTATAGCATCTCTTTTTATG CGCCTGTACATATCCGTTTCACTGCATCTATTTTGTGCATCTCTATAGATCCTTTCCA TAGTGTCTGTACTCTGTATTCCAAAAGATTCTTTCCGTGGTGTCTTTCTTGTGCACCA CTACGCATCCTTTCCATAGTATCTGTCTTGATTATCTCCCCACACTCTTTACTCGGTG CTTTCTCCTTATTTCACCCCCTTCTCATTCTGTGTTGATTCTCCAATCCTATCTTTCTC CTGCTTCCTTTTTTCCCTCCACTTGTAGTACTTGTTCGTCTTCTGAGCTCTTTTTTATT TTTTACTTCTCCTGTTCTTAAAAAAGGGCATTGAATAAAATTATGTCAGATGAATCA ATGTAAATGTTATCTACAGACAAGAGAGAACCTTTTTTTTTTGGTACGTCTTCCAAA CGACACACATATGAATCTGTGGAAAAAGTTATTTACAGATAAGAAGCGAGTTTCTT TTTTTAAACATATACTCCAAAATATGTACACGATCGCCATGTGCCCTACCAGTCTGA CTGTCATCTTTTGATTTTTGATATTAGGATGCGTTCTTTTTTTTTTTTTTTAACTAAAA CTATTCTAGCCAAACATCTTCAACACTATCTAAATGTCATAAAGAATGCATGAATCG TTTAACACTATTTAGAGAATAAGATTACTTTAGGTATCAGGCTTTATATGTATGATA GTTTTGTTATTCTATCCATTGGCATCGTGCCTGCTGAACCAGATATACACATCACTTT TTTTATTAGAAAGTAGTCGTCAGAAATTTGGAAAAAAAAGTCAAACGGCTATTTTGT ATGTTTTCCAGAATTTATGGTTGAGACGCATTTACATTGTTCTGTTTGCATAATGTTT GCTTGGCTTCGCCAGTGTGTATTTGTAATAGCCTGGTGCGGCTTGAAAACCCCAAGG CTGAAGTGTCGCCAAATCTCGTGGAGCAAAATCAGGAAGGAGGAGGACAGGGCGA CCTTAAAACTCCATCTACTCAGCACTGTTTGGATTGCCTCATCATTTCCTTTCAATAC TTTTCGTTTTAAACGTTGGTGTCTATTGGATTTTTCTTCATTATTCACCACTTAATCTA CGGTGGAGGATCTTTGTTCCCGTCTTTACCTCTTTGTCTGCTTTGTACGTGCTTCTGT TCTTCTTTGAATCGAACAGTAAATGTCTGCTTTGTCCATTTAGGGGAGTGGTGTCCC CTTGTTTTGAAATCTTGTGAACTGGTTTCTGCCAATTAAACCTATTTTCTCTGTAGAA GCGAAAAAAAAAAAAAAAAAAAGTACTCTGCGTTGTTACTCGGCTTAAGGGCGAAT TC (SEQ ID NO:85)
Translation: ,
MEGRRF AAVLILTICMLAPGTGRPSVCNKP ADKGPCTGSEKRFYFSTYHNECRTFKYGG CEGNGNNFmVYNCRRTCVYPPG (SEQ ID NO:86)
Toxin Sequence:
Arg-XaaS-Ser-Val-Cys-Asn-Lys-XaaS-Ala-Asp-Lys-Gly-XaaS-Cys-Thr-Gly-Ser-Xaal-Lys- Arg-Phe-XaaS-Phe-Ser-Thr-XaaS-His-Asn-Xaal-Cys-Arg-Tlir-Phe-Lys-XaaS-Gly-Gly-Cys- Xaal-Gly-Asn-Gly-Asn-Asn-Phe-Ile-His-Val-XaaS-Asn-Cys-Arg-Arg-Thr-Cys-Val-XaaS- Xaa3-Xaa3-# (SEQ ID NO:87)
Name: ShK magus
Species: magus
Isolated: Yes
Cloned: No Toxin Sequence:
Arg-XaaS-Ser-Val-Cys-Asn-Lys-XaaS-Ala-Asp-Lys-Gly-XaaS-Cys-Ala-Gly-Ser-Xaal-Lys- Arg-Phe-XaaS-Phe-Ser-Thr-XaaS-His-Asn-Xaal-Cys-Arg-Tlir-Phe-Lys-XaaS-Gly-Gly-Cys- Xaal-Gly-Asn-Gly-Asn-Asn-Phe-Ile-His-Val-XaaS-Asn-Cys-Arg-Arg-Tlir-Cys-Val-XaaS- Xaa3-Met-Λ (SEQ ID NO:88)
Name: ShK str-1 Species: striatus
Isolated: Yes Cloned: No Toxin Sequence:
Lys-Asp-Arg-XaaS-Ser-Leu-Cys-Asp-Leu-XaaS-Ala-Asp-Ser-Gly-Ser-Gly-Thr-Lys-Ala-Xaal- Lys-Arg-Ile-XaaS-XaaS-Asn-Ser-Ala-Arg-Lys-Gln-Cys-Leu-Arg-Phe-Asp-XaaS-Thr-Gly-Gln- Gly-Gly-Asn-Xaal-Asn-Asn-Phe-Arg-Arg-Thr-XaaS-Asp-Cys-Gln-Arg-Thr-Cys-Leu-XaaS- Thr-Λ (SEQ ID NO:90)
Name: ShK str-2
Species: striatus
Isolated: Yes
Cloned: No
Toxin Sequence:
Gly-Arg-XaaS-Lys-Asp-Arg-XaaS-Ser-XaaS-Cys-Asn-Leu-XaaS-Ala-Asp-Ser-Gly-Ser-Gly- Thr-Lys-XaaS-Xaal-Gln-Arg-Ile-XaaS-XaaS-Asn-Ser-Ala-Lys-Lys-Gln-Cys-Val-Thr-Phe-Thr- Xaa5-Asn-Gly-Lys-Gly-Gly-Asn-Gly-Asn-Asn-Phe-Ser-Arg-Λ (SEQ ID NO:91)
Xaal is GIu or γ-carboxy-Glu Xaa2 is GIn or pyro-Glu
Xaa3 is Pro or hydroxy-Pro
Xaa4 is Trp or bromo-Trp
Xaa5 is Tyr, 125I-Tyr, mono-iodo-Tyr, di-iodo-Tyr, O-sulpho-Tyr or O-phospho-Tyr
Xaa6 is VaI, Ala, Asp or GIy Λ is free carboxyl or amidated C-terminus, preferably free carboxyl
# is free carboxyl or amidated C-terminus, preferably amidated
TABLE 2 Alignment of Conkunitzin Mature Peptide Sequences (Group 1) 10 20 30 40 50
C1757 -SRRQD LCSLPAEKGPCLAYMP RFYFDWDSKLCKVFIYGGC
C1758 -SRRQD LCSLPAEKGPCLAYMP RFYFDWDSKLCKVFIYGGC
Shk magus RPSVCNKPADKGPCAGSEK RFYFSTYHNECRTFKYGGC
C1687 RPSVCNKPADKGPCTGSEK RFYFSTYHNECRTFKYGGC ShKmI RPSVCNKPADKGPCTGSEK RFYFSTYHNECRTFKYGGC
C1708 -SRRKARPSVCNLPPERGPCAGSER RVYFDSTSKQCKMFTYGGC
C1790 -SRLRDQLNRCKQPKVTGPCKGAFR RYYFDTDVRNCKQFTYGGC
DIO85 - -GGDD RCTLQLSHGTCPGYFP RWFYDSASGQCQSFIYSGC
Cl705 -AKPKSRPSYCNLPAERGPCEGSEK RYYFDSYRIQCRLFKYGGC C1704 TLIPRGRPSECNLRKDSGSCTRSEQSTKSEQRYYFSTYYNECRMFTYSGC
C1741 TLIPRGRPSYCNLRKDSGSCTRSEQSTESEYRYYFSTHYNECRMFTYKGC 60 70
C1757 QGNDNNFHSSTDCYDTCWFE-Λ ( SEQ I D NO : 91 )
C1758 QGNDNNFHSSSDCYDTCWFΞ-^ ( SEQ I D NO : 92 )
Shk magus EGNGNNFIHVYNCRRTCVYPM^ ( SEQ I D NO 3 )
C1687 EGNGNNFIHVYNCRRTCVYPP# ( SEQ I D NO . 93 )
ShKmI EGNGNNFIHVYNCRRTCVYPPt ( SEQ I D NO 94 )
C1708 GGNGNNFKRAHDCLKMCVYSVt ( SEQ I D NO 95 )
C1790 RGNDNNFLTYDDCNATCGPK-^ ( SEQ I D NO 96 )
DI085 KGNANNFLSEEECRQACVSR-■*■ ( SEQ I D NO 97 )
C1705 EGNRNNFIRVYDCRKKCLHA-# ( SEQ I D NO
C1704 GGNRNNFIHMYDCRRKCVYTVt ( SEQ I D NO 99 )
Cl741 GGNRNNFIHMHDCRQKCVYTVt ( SEQ ID NO 100 )
TABLE 3 Alignment of Conlαmitzin Mature Peptide Sequences (Group 2)
10 20 30 40 50
ShK str- 1 KDRPSLCDLPADSGSGTKAΞKRIYYNSARKQCLRFDYTGQ- -GGN-
C1716 TLLPRDRPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQ- -GGN-
Conkunitzin Sl TLLPRDRPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQ- -GGN-
C1742 TLIPRDRPSYCNLPADSGSGTNREQRIYYNSARKQCLTFPYKGK- -GGN-
ShK str-2 -GRPKDRPSYCNLPADSGSGTKPEQRIYYNSAKKQCVTFTYNGK--GGN-
C1722 -ARPKDRPSYCNLPADSGSGTKPEQRIYYNSAKKQCVTFTYNGK--GGN-
C1736 -ARPKDRPSYCNLPADSGSGTKPEQRIYYNSARKQCLTFTYNGK--GGN-
C1679 -ARPKDRPSYCNLPADSGSGTKPEQRIYYNSAREQCLTFTYNGK--GGN-
C1723 -ARPKDRPSYCNLPADSGSGTKPEQRIYYNSAKKQCVTFTYSGK--GGN-
C1726 -AKPKSRPSYCNLPADSGSGTKSEKRIYYNSARKQCLGFTYHGE--GGN-
C1710 -AKPKSRPSYCNLPADSGSGTKSEKRIYYNSARKQCLRFTYHGE--GGN-
C1733 -AKPKSRPSYCNLPADSGSGTKSEKRIYYNSARKQCLRFTYHGE--GGN-
C1689 -AKPKSRPSYCNLPADSGSGTKSEKRIYYNSARKQCLRFTYHGE- -GGN-
C1728 -AKPKSRPSYCNLPADSGSGTKSEKRIYYNSARKQCLRFTYHGEREGPNX
60 ShK str-1 ENNFRRTYDCQRTCLYT- -Λ (SEQ ID NO:1)
C1716 ENNFRRTYDCQRTCLYT- -t (SEQ ID NO:101)
Conkunitzin Sl ENNFRRTYDCQRTCLYT- -# (SEQ ID NO:102)
C1742 ANNFSRTNDCRRTCQYPAAt (SEQ ID NO:103)
ShK str- 2 GNNFSR (SEQ ID NO:2) C1722 GNNFSRTNDCRQTCQYPV-t (SEQ ID NO:104)
C1736 ENNFIHTYDCRRTCQYTV-Λ (SEQ ID NO:105)
C1679 ΞNNFIHTYDCRRTCQYTV-Λ (SEQ ID NO:106)
C1723 GNNFSRTNDCRQTCQYPA-t (SEQ ID NO:107)
C1726 ANNFLHTFDCQHTCLYTV-λ (SEQ ID NO:108) C1710 ANNFLHTFDCQHTCLYTV-Λ (SEQ ID NO:109)
C1733 ANNFLHTFDCQHTCLYTV-Λ (SEQ ID NO: 110)
C1689 ANNFLHTFDCQHTCLYTV-A (SEQ ID NO:111)
C1728 KNNFLHTFDCQHTCLYTV-Λ (SEQ ID NO:112) TABLE 4 Alignment of Conkunitzin Mature Peptide Sequences (Group 3) 10 20 30 40 50
C1769 -FRLRGSRAEECSRSΞALAKCYLPKDPGPCKAWKSRYYFNRYLNTCQEFS
Cl768 -FRLRGSRAEQCSRSEALAKCYLPKDPGPCKAWKSRYYFNRYLNTCQEFS
Cl760 -SKRQGPPTNKCSRDVALSKCYQPRDPGPCYASFRMYYFNRYINTCEKFT
Cl756 -SRRQGPPTNKCSRDVALSKCYQPRDPGPCYALLERYYFNRYINTCΞKFT C1754 ASRRQGPPTNKCSRDVALSKCYQPRDPGPCNAFFEKYYFNRYINTCEKFT
60 70 80 90 100
C1769 YGGCRGNANRFDTMEDCQECCLLSVCRQPAEPGLCKAYMERYYFDMDSYD Cl768 YGGCRGNANRFDTMEDCQECCLLSVCRQPAEPGLCKAYMERYYFDMDSYD C1760 YGGCQGNDNRFNTVEDCLGCCQLSVCRQPAEPGLCKGYFPRHYFDMDSYE C1756 YGGCQGNDNRFNTMEDCLGCCQLSVCRQPAEPGLCRGYFLRHYFDMDFNE Cl754 YGGCQGNDNRFNTVEDCLGCCLLSVCRQPAETGPCRGYFPKYYFDMDSYE
110 120 C1769 CKPFIYGGCNGNDNNFLTYIECYGRCGPE^ (SEQ ID NO: 113)
C1768 CKPFIYGGCNGNDNNFLTYIECYGRCGPE^ (SEQ ID NO: 114)
C1760 CKTFIYGGCGGNDNNFLTDGECQGRCGPE^ (SEQ ID NO: 115)
C1756 CKEFIYGGCGGNDNNFLTDEECQGRCGPE^ (SEQ ID NO: 116)
C1754 CKQFIYGGCGGNDNNFGTVΞECQGRCGPK^ (SEQ ID NO: 117)
TABLE 5 Conkunitzin DI008 (Group 4)
10 20 30 40 50
DI008 ENTCEQPPEPGRCEGYYRRFFYNWRSGQCESFVYGGCGGNDNNFRTNAEC
60 70 80 90 100
DI008 EAACSSTNTYAISENTCEQPAEQGRCTEYWRFFYNWKSDKCEPFVYGGC
110 120 130 140 150 DI008 GGNSNSFLTITECΞTACSSGNTYEDVCQLPADRGVCSAHLHMFYYNSSSG
160 170 180 190 200 DI008 QCHQFIYRGCGGNGNKFSTMRECQAKCSRGVKYSKVLPTKQWKFFRRNEP
DI008 RYLLAΛ (SEQ ID NO: 118) EXAMPLE 7
Biological Activity and Electrophysiological Characterization
[0066] ICV administration of conkunitzin ShK str-1 resulted in a dose-dependent increase in the percentage of animals displaying seizures. In general, ICV administration of conkunitzin ShK str-1 produced spastic running followed by tonic extension seizures. The ED50 for ICV conkunitzin ShK str-1 was determined to be 0.96 nmol/mouse (95% confidence limits: 0.29 to 2.00 nmol). hi contrast, EP administration of conkunitzin SIiK str-1 (3 nmol/mouse) was without effect. [0067] Conkunitzin ShK str-1 has been tested on the Shaker K+ channel and an inhibition of channel conductance was observed.
[0068] It will be appreciated that the methods and compositions of the instant invention can be incorporated in the form of a variety of embodiments, only a few of which are disclosed herein. It will be apparent to the artisan that other embodiments exist and do not depart from the spirit of the invention. Thus, the described embodiments are illustrative and should not be construed as restrictive.
BIBLIOGRAPHY
[0069] Atherton, E. and Sheppard, R.C. (1989). Solid-Phase Peptide Synthesis, A Practical Approach, IRL Press, Oxford.
[0070] Backes, BJ. and Ellman, J.A. (1999). J Org Chem Soc 64:2322-2330.
[0071] Barber, M. et al. (1982). Anal. Chem. 54:645 A-657A.
[0072] Bamay, G. et al. (2000). J. Med. Chem.
[0073] Bitan, G. et al. (1997). J. Peptide Res. 49:421-426. [0074] Bodansky et al. (1966). Chem. Ind. 38:1597-98.
[0075] Bulaj, G. et al. (2001). Biochemistry 40:13201-13208.
[0076] Cartier, G.E. et al. (1996). J. Biol. Chem. 271:7522-7528.
[0077] Colledge, C. J. et al. (1992). Toxicon 30:1111-1116.
[0078] Craik, DJ. et al. (1991). Toxicon 39:43-60. [0079] Cruz, LJ. et al. (1987). J. Biol. Chem. 260:9280-9288.
[0080] Dodd, J. et al. (1983). J. Physiol. 334:255-268.
[0081] Duda Jr, T. F. et al. (2001). Biol. J. Linnean Soc. 73:391-409.
[0082] Espiritu, D. J. D. et al. (2001). Toxicon 39:1899-1916. [0083] Gobbo, M. et al. (1992). Int. J. Pept. Protein Res. 40:51-54.
[0084] Haack, J.A. et al. (1990). J. Biol. Chem. 265:6025-6029.
[0085] Hammerland, L.G. et al. (1992). Eur. J. Pharmacol. 226:239-244.
[0086] Horiki, K. et al. (1978). Chemistry Letters 165-68. [0087] Hubry, V. et al. (1994). Reactive Polymers 22:231-241.
[0088] Jacobsen, R. et al., (1997). J Biol. Chem. 272:22531-22537.
[0089] Jacobsen, R. et al. (1998). J. Peptide Res. 51 : 173-179.
[0090] Jacobsen, R. B. et al. (2000). J. Biol. Chem. 275:24639- 24644.
[0091] Kaiser et al. (1970). Anal. Biochem. 34:595. [0092] Kapoor (1970). J. Pharm. Sci. 59:1-27.
[0093] Lowry, O. et al. (1951). J. Biol. Chem. 193:265.
[0094] Litchfield, J. and Wilcoxon, F. (1949). J Pharmacol Exp Ther 96:99-113.
[0095] Mena, E.E. et al. (1990). Neurosci. Lett. 118:241-244.
[0096] Methfessel, C. et al. (1986). Pβugers Arch. 407:577-588. [0097] Methoden der Organischen Chemie (Houben-Weyl): Synthese von Peptiden, E. Wunsch (Ed.), Georg Thieme Verlag, Stuttgart, Ger. (1974).
[0098] Nishiuchi, Y. et al. (1993). Int. J. Pept. Protein Res. 42:533-538.
[0099] Nguyen, T.-D. et al. (2000). J. Neurosci. Res. 60:175- 183.
[0100] Olivera, B.M. et al. (1985). Science 230:1338-1343. [0101] Olivera, B. M. et al. (1990). Science 249:257- 263.
[0102] Olivera, B. M. (1997). MoI. Biol. Cell 8:2101-2109.
[0103] Olivera, B. M. et al. (1999). Ann. KY. Acad. Sci. 870:223-237.
[0104] Ornstein, et al. (1993). Biorganic Medicinal Chemistry Letters 3:43-48.
[0105] Piscano, A. et al. (1993). Glycobiology 3:429-435. [0106] Remington 's Pharmaceutical Sciences, 18th Ed., Mack Publishing Co., Easton, PA (1990).
[0107] Rivier, J.R. et al. (1978). Biopolymers 17:1927-38.
[0108] Rivier, J.R. et al. (1987). Biochem. 26:8508-8512.
[0109] Sambrook, J. et al. (1989). Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, NY.
[0110] Schroder & Lubke (1965). The Peptides 1:72-75, Academic Press, NY.
[0111] Shin, Y. et al. (1999). JAm Chem Soc 121:11684-11689.
[0112] Shon, K-J. et al. (1998). J. Biol. Chem. 273:33-38.
[0113] Sole, N.A. and Barany, G. (1992). J Org Chem 57:5399-5403. [0114] Stewart and Young, Solid-Phase Peptide Synthesis, Freeman & Co., San Francisco CA (1969).
[0115] Stϋhmer, W. (1992) Meth. Enzymol. 207, 319-339
[0116] Terlau, H. et al. (1996). Nature 381:148-151. [0117] Terlau, H. et al. (1999). J Gen. Physiol. 114:125- 140.
[0118] Van de Steen et al. (1998). Crit. Rev. Biochem. MoI. Biol. 33:151-208.
[0119] Woodward, S. R. et al. (1990). EMBO J. 1:1015-1020.
[0120] Yoshikami, D. et al. (1989). Ann. KY. Acad. ScL 560:230-248.
[0121] Zhou L.M., et al. (1996). J. Neurochem. 66:620-628.
[0122] U.S. Patent Application No. 09/910,009
[0123] U.S. Patent No. 3,842,067.
[0124] U.S. Patent No. 3,862,925.
[0125] U.S. Patent No. 3,972,859. [0126] U.S. Patent No. 4,105,603.
[0127] U.S. Patent No. 4,447,356.
[0128] U.S. Patent No. 4,569,967.
[0129] U.S. Patent No. 5,364,769.
[0130] U.S. Patent No. 5,514,774. [0131] U.S. Patent No. 5,534,615.
[0132] U.S. Patent No. 5,550,050.
[0133] U.S. Patent No. 5,591,821.
[0134] U.S. Patent No. 5,633,347.
[0135] U.S. Patent No. 5,635,347. [0136] U.S. Patent No. 5,844,077.
[0137] U.S. Patent No. 5,889,147.
[0138] U.S. Patent No. 6,077,934.
[0139] PCT Published Application WO 92/19125.
[0140] PCT Published Application WO 94/25503. [0141] PCT Published Application WO 95/01203.
[0142] PCT Published Application WO 96/02286.
[0143] PCT Published Application WO 96/02646.
[0144] PCT Published Application WO 96/05452. [0145] PCT Published Application WO 96/11698.
[0146] PCT Published Application WO 96/40871.
[0147] PCT Published Application WO 96/40979.
[0148] PCT Published Application WO 97/12635. [0149] PCT Published Application WO 02/07678.

Claims

WHAT IS CLAIMED IS:
1. A peptide selected from the group consisting of:
(i) a peptide comprising an amino acid sequence selected from the group consisting of the amino acid sequences set forth in SEQ ID NO: 6, SEQ ID NO: 9, SEQ
ID NO:12, SEQ ID NO:15, SEQ ID NO:18, SEQ E) NO:21, SEQ ID NO:24, SEQ ID NO:27, SEQ ID NO:30, SEQ ID NO:33, SEQ TD NO:36, SEQ ID NO:39, SEQ ID NO:42, SEQ E) NO:45, SEQ ID NO:48, SEQ ID NO:51, SEQ ID NO:54, SEQ ID NO:57, SEQ ID NO:60, SEQ ID NO:63, SEQ ID NO:66, SEQ ID NO:69, SEQ ID NO:72,' SEQ ID NO:75, SEQ ID NO:78, SEQ ID NO:81, SEQ ID NO:84, SEQ ID
NO:87, SEQ ID NO:88, SEQ ID NO:89 and SEQ ID NO:90;
(ii) a peptide comprising an amino acid sequence selected from the group consisting of the amino acid sequences set forth in SEQ ID NO:3, SEQ ID NO:91, SEQ ID NO:92, SEQ ID NO:93, SEQ ID NO:94, SEQ ID NO:95, SEQ E) NO:96, SEQ E) NO:97, SEQ E) NO:98, SEQ TD NO:99 and SEQ TD NO: 100;
(iii) a peptide comprising an amino acid sequence selected from the group consisting of the amino acid sequences set forth in SEQ TD NO:1, SEQ ID NO:2, SEQ SEQ TD NO:101, TD NO:102, SEQ E) NO:103, SEQ TD NO:104, SEQ TD NO:105, SEQ TD NO:106, SEQ TD NO:107, SEQ TD NO:108, SEQ TD NO:109, SEQ E) NO:110, SEQ E) NO:lll and SEQ I DNO:112;
(iv) a peptide comprising an amino acid sequence selected from the group consisting of the amino acid sequences set forth in SEQ TD NO: 113, SEQ TD NO: 114, SEQ E) NO: 115, SEQ TD NO: 116 and SEQ TD NO: 117;
(v) a peptide comprising the amino acid sequence set forth in SEQ TD NO: 118; (vi) propeptide comprising an amino acid sequence selected from the group consisting of the amino acid sequences set forth in SEQ TD NO:5, SEQ ID NO: 8, SEQ TD NO:11, SEQ TD NO: 14, SEQ TD NO:17, SEQ TD NO:20, SEQ TD NO:23, SEQ TD NO:26, SEQ TD NO:29, SEQ TD NO:32, SEQ TD NO:35, SEQ TD NO:38, SEQ TD NO:41, SEQ E) NO:44, SEQ E> NO:47, SEQ TD NO:50, SEQ TD NO:53, SEQ TD NO:56, SEQ E) NO:59, SEQ TD NO:62, SEQ TD NO:65, SEQ TD NO:68, SEQ TD
NO:71, SEQ TD NO:74, SEQ TD NO:77, SEQ TD NO:60, SEQ DD NO:83 and SEQ TD NO:86; and (vii) a derivative of (a) the peptide of (i), (ii), (iii), (iv) or (v) or (b) the propeptide of (vi).
2. The peptide of claim 1, wherein said derivative is the peptide or propeptide in which Arg residues may be substituted by Lys, ornithine, homoargine, nor-Lys, N-methyl-Lys, N,N- dimethyl-Lys, N,N,N-trimethyl-Lys or any synthetic basic amino acid; the Lys residues may be substituted by Arg, ornithine, homoargine, nor-Lys, or any synthetic basic amino acid; the Tyr residues may be substituted with meta-Tyr, ortho-Tyr, nor-Tyr, mono-halo- Tyr, di-halo-Tyr, O-sulpho-Tyr, O-phospho-Tyr, nitro-Tyr or any synthetic hydroxy containing amino acid; the Ser residues may be substituted with Thr or any synthetic hydroxylated amino acid; the Thr residues may be substituted with Ser or any synthetic hydroxylated amino acid; the Phe residues may be substituted with any synthetic aromatic amino acid; the Trp residues may be substituted with Tip (D), neo-Trp, halo- Trp (D or L) or any aromatic synthetic amino acid; and the Asn, Ser, Tlir or Hyp residues may be glycosylated; the halogen may be iodo, chloro, fluoro or bromo; preferably iodo for halogen substituted-Tyr and bromo for halogen-substituted Trp; the Tyr residues may also be substituted with the 3-hydroxyl or 2-hydroxyl isomers (meta-Tyr or ortho-Tyr, respectively) and corresponding O-sulpho- and O-phospho-derivatives; the acidic amino acid residues may be substituted with any synthetic acidic amino acid, e.g., tetrazolyl derivatives of GIy and Ala; the aliphatic amino acids may be substituted by synthetic derivatives bearing non-natural aliphatic branched or linear side chains CnH2n+2 up to and including n=8; the Leu residues may be substituted with Leu (D); the GIu residues may be substituted with GIa; the Met residues may be substituted with norleucine (NIe); the Cys residues may be in D or L configuration and may optionally be substituted with homocysteine (D or L).
3. The peptide of claim 1, wherein the peptide is the propeptide comprising an amino acid sequence selected from the group consisting of the amino acid sequences set forth in SEQ ID NO:5, SEQ ID NO:8, SEQ ID NO:11, SEQ ID NO:14, SEQ ID NO:17, SEQ ID NO:20, SEQ ID NO:23, SEQ ID NO:26, SEQ ID NO:29, SEQ ID NO:32, SEQ ID
NO:35, SEQ ID NO:38, SEQ ID NO:41, SEQ ID NO:44, SEQ ID NO:47, SEQ ID NO:50, SEQ ID NO:53, SEQ ID NO:56, SEQ ID NO:59, SEQ ID NO:62, SEQ ID NO:65, SEQ ID NO:68, SEQ ID NO:71, SEQ ID NO:74, SEQ ID NO:77, SEQ TD NO:60, SEQ ID NO:83 and SEQ ID NO:86.
4. A nucleic acid encoding the propeptide of claim 3.
5. The nucleic acid of claim 4 comprising a nucleotide sequence selected form the group of nucleotide sequences set forth in SEQ ID NO:4, SEQ ID NO:7, SEQ ID NO: 10, SEQ ID NO:13, SEQ ID NO:16, SEQ ID NO:19, SEQ TD NO:22, SEQ ID NO:25, SEQ E) NO:28, SEQ E) NO:31, SEQ E) NO:34, SEQ E) NO:37, SEQ E) NO:40, SEQ E) NO:43, SEQ E) NO:46, SEQ E) NO:49, SEQ E) NO:52, SEQ E) NO:55, SEQ E)
NO:58, SEQ E) NO:61, SEQ E) NO:64, SEQ E) NO:67, SEQ E) NO:70, SEQ E) NO:73, SEQ E) NO:76, SEQ E) NO:79, SEQ TD NO:82 and SEQ TD NO:85.
6. A method for regulating the flow of potassium through potassium channels in an individual in need thereof which comprises administering a therapeutically effective amount of a conkunitzin.
7. The method of claim 6, wherein said individual in need thereof (i) suffers from a disorder selected from the group consisting of multiple sclerosis, other demyelinating diseases (such as acute dissenmiated encephalomyelitis, optic neuromyelitis, adrenoleukodystrophy, acute transverse myelitis, progressive multifocal leukoencephalopathy), sub-acute sclerosing panencephalomyelitis (SSPE), metachromatic leukodystrophy, Pelizaeus-Merzbacher disease, spinal cord injury, botulinum toxin poisoning, Huntington's chorea, compression and entrapment neurophathies (such as carpal tunnel syndrome, ulnar nerve palsy), cardiovascular disorders (such as cardiac arrhythmias, congestive heart failure), reactive gliosis, hyperglycemia, immunosuppression, cocaine addiction, cancer, cognitive dysfunction and disorders resulting from defects in neurotransmitter release (such as Eaton-Lambert syndrome) or (ii) needs a reversal of the actions of curare and other neuromuscular blocking drags.
8. The method of claim 7, wherein said disorder is a demyelinating disease.
9. The method of claim 6, wherein said conlαmitzin is selected from the group consisting of:
(i) a peptide comprising an amino acid sequence selected from the group consisting of the amino acid sequences set forth in SEQ E) NO:6, SEQ ID NO:9, SEQ ID NO:12, SEQ ID NO: 15, SEQ E) NO:18, SEQ E) NO:21, SEQ E) NO:24, SEQ E)
NO:27, SEQ E) NO:30, SEQ E) NO:33, SEQ E) NO:36, SEQ E) NO:39, SEQ E) NO:42, SEQ E) NO:45, SEQ E) NO:48, SEQ E) NO:51, SEQ E) NO:54, SEQ E) NO:57, SEQ E) NO:60, SEQ E) NO:63, SEQ E) NO:66, SEQ E) NO:69, SEQ E) NO:72, SEQ E) NO:75, SEQ E) NO:78, SEQ ID NO:81, SEQ E) NO:84, SEQ E) NO:87, SEQ E) NO:88, SEQ E) NO:89 and SEQ E) NO:90;
(ii) a peptide comprising an amino acid sequence selected from the group consisting of the amino acid sequences set forth in SEQ E) NO:3, SEQ E) NO:91, SEQ E) NO:92, SEQ E) NO:93, SEQ E) NO:94, SEQ E) NO:95, SEQ E) NO:96, SEQ E) NO:97, SEQ E) NO:98, SEQ E) NO:99 and SEQ E) NO:100; (iii) a peptide comprising an amino acid sequence selected from the group consisting of the amino acid sequences set forth in SEQ E) NO:1, SEQ ID NO:2, SEQ E) NO:101,SEQ E) NO:102, SEQ E) NO:103, SEQ ID NO: 104, SEQ E) NO:105, SEQ E) NO:106, SEQ TD NO: 107, SEQ E) NO:108, SEQ E) NO: 109, SEQ E) NO:110, SEQ E) NO: 111 and SEQ E) NO: 112; (iv) a peptide comprising an amino acid sequence selected from the group consisting of the amino acid sequences set forth in SEQ E) NO: 113, SEQ E) NO: 114, SEQ E) NO:115, SEQ ID NO:116 and SEQ E) NO:117;
(v) a peptide comprising the amino acid sequence set forth in SEQ E) NO: 118; and (vi) a derivative of the peptide of (i), (ii), (iii), (iv) or (v).
10. The method of claim 9, wherein said derivative is the peptide in which Arg residues may be substituted by Lys, ornithine, homoargine, nor-Lys, N-methyl-Lys, N,N-dimethyl- Lys, N,N,N-trimethyl-Lys or any synthetic basic amino acid; the Lys residues may be substituted by Arg, ornithine, homoargine, nor-Lys, or any synthetic basic amino acid; the Tyr residues may be substituted with meta-Tyr, ortho-Tyr, nor-Tyr, mono-halo-Tyr, di-halo-Tyr, O-sulpho-Tyr, O-phospho-Tyr, nitro-Tyr or any synthetic hydroxy containing amino acid; the Ser residues may be substituted with Thr or any synthetic hydroxylated amino acid; the Thr residues may be substituted with Ser or any synthetic hydroxylated amino acid; the Phe residues may be substituted with any synthetic aromatic amino acid; the Tip residues may be substituted with Trp (D), neo-Trp, halo- Trp (D or L) or any aromatic synthetic amino acid; and the Asn, Ser, Thr or Hyp residues may be glycosylated; the halogen may be iodo, chloro, fluoro or bromo; preferably iodo for halogen substituted-Tyr and bromo for halogen-substituted Trp; the Tyr residues may also be substituted with the 3-hydroxyl or 2-hydroxyl isomers (meta-Tyr or ortho-Tyr, respectively) and corresponding O-sulpho- and O-phospho-derivatives; the acidic amino acid residues may be substituted with any synthetic acidic amino acid, e.g., tetrazolyl derivatives of GIy and Ala; the aliphatic amino acids may be substituted by synthetic derivatives bearing non-natural aliphatic branched or linear side chains CnH2n+2 up to and including n=8; the Leu residues may be substituted with Leu (D); the GIu residues may be substituted with GIa; the Met residues may be substituted with norleucine (NIe); the Cys residues may be in D or L configuration and may optionally be substituted with homocysteine (D or L).
11. A method of identifying compounds that mimic the therapeutic activity of a conkunitzin, comprising the steps of: (a) conducting a biological assay on a test compound to determine the therapeutic activity; and (b) comparing the results obtained from the biological assay of the test compound to the results obtained from the biological assay of a conkunitzin.
12. The method of claim 11, wherein said conkunitzin is selected from the group consisting of: (i) a peptide comprising an amino acid sequence selected from the group consisting of the amino acid sequences set forth in SEQ ID NO:6, SEQ ID NO:9, SEQ ID NO:12, SEQ ID NO:15, SEQ ID NO: 18, SEQ rD NO:21, SEQ ID NO:24, SEQ ID NO:27, SEQ ID NO:30, SEQ ID NO:33, SEQ ID NO:36, SEQ ID NO:39, SEQ ID NO:42, SEQ ID NO:45, SEQ ID NO:48, SEQ ID NO:51, SEQ ID NO:54, SEQ ID NO:57, SEQ ID NO:60, SEQ ID NO:63, SEQ ID NO:66, SEQ ID NO:69, SEQ ID
NO:72, SEQ ID NO:75, SEQ ID NO:78, SEQ ID NO:81, SEQ H) NO:84, SEQ ID NO:87, SEQ ID NO:88, SEQ ID NO:89 and SEQ ID NO:90; (ii) a peptide comprising an amino acid sequence selected from the group consisting of the amino acid sequences set forth in SEQ ID NO:3, SEQ ID NO:91, SEQ ID NO:92, SEQ ID NO:93, SEQ ID NO:94, SEQ ID NO:95, SEQ ID NO:96, SEQ ID NO:97, SEQ ID NO:98, SEQ TD NO:99 and SEQ ID NO: 100; (iii) a peptide comprising an amino acid sequence selected from the group consisting of the amino acid sequences set forth in SEQ ID NO:1, SEQ ID NO:2, SEQ ID NOrIOl, SEQ ID NO:102, SEQ ID NO:103, SEQ ID NO:104, SEQ ID NO:105, SEQ ID NO:106, SEQ TD NO:107, SEQ ID NO:108, SEQ ID NO:109, SEQ TD NO:110, SEQ ID NO: 111 and SEQ TD NO: 112; (iv) a peptide comprising an amino acid sequence selected from the group consisting of the amino acid sequences set forth in SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO:115, SEQ ID NO:116 and SEQ ID NO:117;
(v) a peptide comprising the amino acid sequence set forth in SEQ ID NO:118; and (vi) a derivative of the peptide of (i), (ii), (iii), (iv) or (v).
13. The method of claim 12, wherein said derivative is the peptide in which Arg residues may be substituted by Lys, ornithine, homoargine, nor-Lys, N-methyl-Lys, N5N- dimethyl-Lys, N,N,N-trimethyl-Lys or any synthetic basic amino acid; the Lys residues may be substituted by Arg, ornithine, homoargine, nor-Lys, or any synthetic basic amino acid; the Tyr residues may be substituted with meta-Tyr, ortho-Tyr, nor-Tyr, mono-halo- Tyr, di-halo-Tyr, O-sulpho-Tyr, O-phospho-Tyr, nitro-Tyr or any synthetic hydroxy containing amino acid; the Ser residues may be substituted with Thr or any synthetic hydroxylated amino acid; the Thr residues may be substituted with Ser or any synthetic hydroxylated amino acid; the Phe residues may be substituted with any synthetic aromatic amino acid; the Trp residues may be substituted with Trp (D), neo-Trp, halo- Trp (D or L) or any aromatic synthetic amino acid; and the Asn, Ser, Thr or Hyp residues may be glycosylated; the halogen may be iodo, chloro, fluoro or bromo; preferably iodo for halogen substituted-Tyr and bromo for halogen-substituted Trp; the Tyr residues may also be substituted with the 3-hydroxyl or 2-hydroxyl isomers (meta-Tyr or ortho-Tyr, respectively) and corresponding O-sulpho- and O-phospho-derivatives; the acidic amino acid residues may be substituted with any synthetic acidic amino acid, e.g., tetrazolyl derivatives of GIy and Ala; the aliphatic amino acids may be substituted by synthetic derivatives bearing non-natural aliphatic branched or linear side chains CnH2n+2 up to and including n=8; the Leu residues may be substituted with Leu (D); the GIu residues may be substituted with GIa; the Met residues may be substituted with norleucine (NIe); the Cys residues may be in D or L configuration and may optionally be substituted with homocysteine (D or L).
PCT/US2005/032129 2004-09-09 2005-09-09 Potassium channel blockers Ceased WO2006098764A2 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US60815304P 2004-09-09 2004-09-09
US60/608,153 2004-09-09

Publications (2)

Publication Number Publication Date
WO2006098764A2 true WO2006098764A2 (en) 2006-09-21
WO2006098764A3 WO2006098764A3 (en) 2007-03-08

Family

ID=36992161

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2005/032129 Ceased WO2006098764A2 (en) 2004-09-09 2005-09-09 Potassium channel blockers

Country Status (2)

Country Link
US (1) US20060178303A1 (en)
WO (1) WO2006098764A2 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2154152A1 (en) 2008-08-08 2010-02-17 Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. Use of Conkunitzin-S1 for the modulation of glucose-induced insulin secretion

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN116178502A (en) * 2021-07-27 2023-05-30 杭州彗搏科技有限公司 Polypeptide cyclic peptide and application thereof

Family Cites Families (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6399355B1 (en) * 1995-06-07 2002-06-04 The Trustees Of Columbia University In The City Of New York Non-naturally occurring targeted lipolytic compounds and related compositions and methods
US5672682A (en) * 1996-03-18 1997-09-30 University Of Utah Research Foundation Conotoxin peptide PVIIA
WO2000020018A1 (en) * 1998-10-06 2000-04-13 Cognetix, Inc. Kappa-a conopeptides and uses therefor
JP2003510257A (en) * 1999-09-22 2003-03-18 コグネティックス・インコーポレイテッド Use of kappa-conotoxin PVIIA
CA2416544A1 (en) * 2000-07-21 2002-01-31 University Of Utah Research Foundation Mu-conopeptides
WO2003063782A2 (en) * 2002-01-29 2003-08-07 Cognetix, Inc. Kappa-pviia-related conotoxins as organ protectants
US20040229780A1 (en) * 2002-09-20 2004-11-18 Olivera Baldomero M. KappaM-conopeptides as organ protectants
US20050137132A1 (en) * 2002-09-20 2005-06-23 University Of Utah Research Foundation Uses of novel potassium channel blockers

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2154152A1 (en) 2008-08-08 2010-02-17 Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. Use of Conkunitzin-S1 for the modulation of glucose-induced insulin secretion

Also Published As

Publication number Publication date
WO2006098764A3 (en) 2007-03-08
US20060178303A1 (en) 2006-08-10

Similar Documents

Publication Publication Date Title
US7666840B2 (en) α-Conotoxin peptides
EP0916681B1 (en) Neuropeptides originating in scorpion
WO2002064740A9 (en) Cone snail peptides
CA2361534C (en) Alpha-conotoxin peptides
WO1999033865A1 (en) Contryphan peptides
US20060178303A1 (en) Potassium channel blockers
US20080274976A1 (en) Uses of novel potassium channel blockers
US6630573B1 (en) Tau-conotoxin peptides
EP0948526A4 (en) CONTRYPHAN PEPTIDE
EP1852440A1 (en) Alpha-conotoxin peptides
WO2002007675A2 (en) Omega-conopeptides
WO2000020018A9 (en) Kappa-a conopeptides and uses therefor
AU2001271657A1 (en) I-superfamily conotoxins
AU2000199A (en) Gamma-conopeptides
AU2002253924A1 (en) Cone snail peptides

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application
NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase