WO2006074802A1 - Use of a trpc channel for the treatment of a cardiovascular disease - Google Patents

Use of a trpc channel for the treatment of a cardiovascular disease Download PDF

Info

Publication number
WO2006074802A1
WO2006074802A1 PCT/EP2005/013977 EP2005013977W WO2006074802A1 WO 2006074802 A1 WO2006074802 A1 WO 2006074802A1 EP 2005013977 W EP2005013977 W EP 2005013977W WO 2006074802 A1 WO2006074802 A1 WO 2006074802A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
nucleotide sequence
channel
trpc3
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2005/013977
Other languages
French (fr)
Inventor
Carsten Struebing
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Sanofi Aventis Deutschland GmbH
Sanofi Aventis France
Original Assignee
Sanofi Aventis Deutschland GmbH
Sanofi Aventis France
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN200580046521XA priority Critical patent/CN101098709B/en
Priority to CA002593603A priority patent/CA2593603A1/en
Priority to EP05821755A priority patent/EP1838334A1/en
Priority to JP2007550707A priority patent/JP2008526905A/en
Priority to MX2007008428A priority patent/MX2007008428A/en
Priority to BRPI0519807-0A priority patent/BRPI0519807A2/en
Priority to US11/813,542 priority patent/US20080221025A1/en
Priority to AU2005324908A priority patent/AU2005324908B2/en
Application filed by Sanofi Aventis Deutschland GmbH, Sanofi Aventis France filed Critical Sanofi Aventis Deutschland GmbH
Publication of WO2006074802A1 publication Critical patent/WO2006074802A1/en
Priority to IL184316A priority patent/IL184316A0/en
Anticipated expiration legal-status Critical
Priority to US12/897,892 priority patent/US8030276B2/en
Priority to US13/217,755 priority patent/US8193150B2/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177Receptors; Cell surface antigens; Cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6872Intracellular protein regulatory factors and their receptors, e.g. including ion channels
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/32Cardiovascular disorders
    • G01N2800/323Arteriosclerosis, Stenosis

Definitions

  • the invention refers to the use of a TRPC channel, an inactivating mutant thereof, or a 5 nucleotide sequence coding for the TRPC channel or for the inactivating mutant for the production of a medicament for the treatment of a cardiovascular disease and a method of screening a modulator of the TRPC channel or an inactivating mutant thereof.
  • Atherosclerosis is one of the major causes of cardiovascular diseases in the Western world. In 2001 these diseases accounted for about 1 million deaths in the USA. Moreover, due to live style changes in the developing countries atherosclerosis and related cardiovascular diseases are becoming global epidemics. The WHO reports that cardiovascular diseases will be the leading cause of death in the developing world by
  • Atherosclerosis there is an immense medical need for new medicines that prevent and treat atherosclerosis.
  • the generation and progression of atherosclerosis is a complex and incompletely understood process that is dependent on a number of epigenetic (e.g. life 20 style, nutrition, exercise) and genetic factors.
  • epigenetic e.g. life 20 style, nutrition, exercise
  • genetic factors e.g. life 20 style, nutrition, exercise
  • Numerous clinical observations implicate dysfunction of endothelial cells that line the inner vessel wall in the pathophysiology of atherosclerosis and atherogenesis (Ross, R. N. (1999), Engl. J. Med. 340:115-126).
  • Ca 2+ -regulatory proteins seem to be of particular interest as important endothelial functions such as the production of nitric oxide (NO) are controlled by the level of intracellular Ca 2+ .
  • NO nitric oxide
  • TRPC channels a novel class of ion channel proteins, are Ca 2+ permeable non- 30 selective cation channels expressed in the cardiovascular and other systems. Based on sequence homology TRPC3, TRPC6 and TRPC7 constitute a distinct TRPC subfamily. In expression systems these channels are activated by G protein coupled receptors or depletion of intracellular Ca 2+ stores (Clapham et al. (2001), Nat. Rev. Neurosci. 2:387-396). TRPC3 might also contribute to oxidative stress-activated cation currents in cultured endothelial cells (Balzer et al. (1999) Cardiovasc. Res. 42:543- 549).
  • TRPC 1 In order to study the functional role of TRPC 1 in smooth muscle cells an antibody against a specific epitope of TRPC1 was used in WO 02/059155. However, this epitope is not found on other TRPC channels.
  • WO 05/049084 discloses functional studies on isolated rat ventricular myocytes using the compound 2- aminoethoxydiphenylborate (2-APB). However, it is known that this compound shows unspecific and questionable effects in particular on TRPC3 (van Rossum et al. (2000), J. Biol. Chem., 275, 28562-28568). j
  • TRPC3, TRPC6 and TRPC7 activity in endothelial cells of atherosclerotic rabbits in vivo using a genetic approach.
  • TRPC3 gene which means that the suppression of the activity of TRPC channels, in particular of the channels mentioned above, shows an anti-atherosclerotic effect.
  • one subject matter of the present invention is directed to the use of a TRPC channel, an inactivating mutant thereof, or a nucleotide sequence coding for the TRPC channel or for the inactivating mutant for the production of a medicament for the treatment of a cardiovascular disease, in particular atherosclerosis.
  • TRPC channels are the TRPC3 channel, TRPC6 channel or TRPC7 channel, in particular the TRPC3 channel or TRPC6 channel, especially the TRPC3 channel.
  • the corresponding amino acid sequences are SEQ ID NO: 1 (TRPC3), SEQ ID NO: 5 (TRPC6), and SEQ ID NO: 9 (TRPC7), in particular the amino acid sequence SEQ ID NO: 1 coding for the TRPC3 channel.
  • the corresponding nucleotide sequences are SEQ ID NO: 2 (TRPC3), SEQ ID NO: 6 (TRPC6), and SEQ ID NO: 10 (TRPC7), in particular the nucleotide sequence SEQ ID NO: 2 coding for the TRPC3 channel.
  • the term "inactivating mutant” means a mutant which is functionally inactive as a cation channel but can suppress the channel activity of homologous naturally occurring TRPC channels. Suppression may be accomplished by replacing a homologous TRPC channel subunit in the native multimeric channel assembly with the effect that essentially all naturally occurring TRPC channels in the cell membrane contain mutant channel subunits or are totally replaced by the mutant channel. Mutations that render a channel subunit inactive may be preferably located within the pore regions of TRPC3 (amino acids 603-645 in SEQ ID NO: 1), TRPC6 (amino acids 660-705 in SEQ ID NO: 5) and TRPC7 (amino acids 610-650 in SEQ ID NO: 9).
  • TRPC3 DN mutant TRPC3 channel with the amino acid sequence of SEQ ID NO: 3
  • TRPC6 DN mutant TRPC6 channel
  • TRPC7 DN mutant TRPC7 channel
  • a nucleotide sequence coding for TRPC3 DN is the nucleotide sequence of SEQ ID NO: 4
  • a nucleotide sequence coding for TRPC6 DN is the nucleotide sequence of SEQ ID NO: 8
  • a nucleotide sequence coding for TRPC7 DN is the nucleotide sequence of SEQ ID NO: 12.
  • a particularly preferred example is the dominant-negative mutant TRPC3 DN with the amino acid sequence of SEQ ID NO: 3.
  • a nucleotide sequence coding for TRPC3 DN is the nucleotide sequence of SEQ ID NO: 4.
  • inactivating mutants may consist of any part of TRPC3, TRPC6 or TRPC7 that retain the ability to interact with naturally occurring TRPC channels at any step of protein synthesis or transport to the plasmamembrane and thereby suppress the function of the naturally occurring TRPC channels.
  • part may be for example amino acids 0-302 of TRPC3 (SEQ ID NO: 1) (see Balzer et al. (1999) Cardiovasc. Res. 42:543-549).
  • Inactivating mutants may be detected and/or analyzed using the whole cell patch clamp method as exemplarily described in the Examples.
  • Another subject matter of the present invention is directed to the use of a TRPC channel, an inactivating mutant thereof, or a nucleotide sequence coding for the TRPC channel or for the inactivating mutant for the discovery of a TRPC channel modulator, in particular an inhibitor, as a medicament for the treatment of a cardiovascular disease, in particular atherosclerosis.
  • TRPC channels are the TRPC3 channel, TRPC6 channel or TRPC7 channel, in particular the TRPC3 channel or TRPC6 channel, especially the TRPC3 channel, as described above in detail.
  • the TRPC channel or an inactivating mutant thereof, or a nucleotide sequence coding for the TRPC channel or for the inactivating mutant thereof is brought into contact with a test compound and the influence of the test compound on the TRPC channel, an inactivating mutant thereof, or a nucleotide sequence coding for the TRPC channel or for the inactivating mutant is measured or detected.
  • TRPC channel modulator means a modulating molecule ("modulator") of the TRPC channel, in particular an inhibitory or activating molecule (“inhibitor” or “activator”), especially an inhibitor of the TRPC channel identifiable according to the assay of the present invention.
  • An inhibitors is generally a compound that, e.g. bind to, partially or totally block activity, decrease, prevent, delay activation, inactivate, desensitize, or down-regulate the activity or expression of at least one of the TRPC channels as preferably described above in detail.
  • An activator is generally a compound that, e.g.
  • Such modulators include genetically modified versions of the TRPC channels, preferably an inactivating mutant of the TRPC channels, such as TRPC3 DM , as well as naturally occurring or synthetic ligands, antagonists, agonists, peptides, cyclic peptides, nucleic acids, antibodies, antisense molecules, ribozymes, small organic molecules and the like.
  • An example for the measurement of the TRPC channel activity is an assay comprising the steps of:
  • another subject matter of the present invention is directed to a method of screening a modulator of TRPC or an inactivating mutant thereof, or a nucleotide sequence coding for TRPC or for the inactivating mutant, wherein the method comprises the steps of: (a) contacting a cell expressing a TRPC channel or an inactivating mutant thereof, (b) stimulating Ca 2+ influx by a channel activator before, simultaneously or after contacting the cell with a test compound, and
  • the method further comprises the step of: (d) selecting a test compound with an activity against a cardiovascular disease by comparing the changes of the TRPC channel activity in the absence of the test compound.
  • the expression of the TRPC channel or an inactivating mutant thereof in the cell is controlled by an inducible promoter, preferably by a promoter which is selected from a tetracycline inducible promoter.
  • the cell is a fluorescent cell as e.g. further described below.
  • Preferred cells or cell lines according to the present invention are MDCK, HEK 293, HEK 293 T, BHK, COS, NIH3T3, Swiss3T3 or CHO cells, in particular a HEK 293 cell line.
  • TRPC channel activity can be measured or detected by measuring or detecting a change in ion fluxes, in particular Ca 2+ fluxes, by e.g. patch clamp techniques, whole cell currents, radiolabeled ion fluxes, or in particular fluorescence e.g. using voltage- sensitive dyes or ion-sensitive dyes (Vestergarrd-Bogind et al. (1988), J. Membrane Biol., 88:67-75; Daniel et al. (1991) J. Pharmacol. Meth. 25:185-193; Hoevinsky et al. (1994) J. Membrane Biol., 137:59-70; Ackerman et al. (1997), New Engl. J. Med., 336:1575-1595; Hamil et al. (1981), Pflugers. Archiv., 391:185).
  • Di-4-ANEPPS pyridinium 4-(2(6-(dibutylamino)-2- naphthalenyl)ethenyl)-1-(3-sulfopropyl) hydroxide
  • CC-2-DMPE 1,2-ditetradecanoyl- sn-glycero-3-phosphoethanolamine triethylammonium
  • DiSBAC2 bis-(1 ,2-dibarbituric acid)-trimethine oxanol
  • DisBAC3 ((bis-(1 ,3-dibarbituric acid)-trimethine oxanol)
  • SBFI- AM (1 ,3-benzenedicarboxylic acid,4,4'-[1,4,10-trioxa-7,13-diazacyclopentadecane- 7,13-diylbis(5-methoxy-6, 12-benzofurandiyl)]bis-(tetrakis-[(acetyl)
  • channel activators are diacylglycerols, in particular 1-Oleyl-2acetyl-sn- glycerol (OAG), G q -coupled receptor agonists, such as phenylephrine and in particular trypsin, an agonist that stimulates receptor tyrosine kinases such as epidermal growth factor (EGF) or diacylglycerol generating enzymes such as phospholipases or activators thereof.
  • OAG 1-Oleyl-2acetyl-sn- glycerol
  • G q -coupled receptor agonists such as phenylephrine and in particular trypsin
  • an agonist that stimulates receptor tyrosine kinases such as epidermal growth factor (EGF) or diacylglycerol generating enzymes such as phospholipases or activators thereof.
  • EGF epidermal growth factor
  • diacylglycerol generating enzymes such as phospholipases or activators thereof
  • the channel activators in particular OAG, can be used for the direct stimulation of the TRPC channels which is an additional advantage of the assay of the present invention compared to the indirect, receptor-mediated activation of the channels because, for example, in the present assay the rate of false-positive results are substantially reduced.
  • a cell which expresses a TRPC channel or an inactivating mutant thereof under an inducible promoter, as e.g. described above.
  • Such cell can be produced using genetic methods known to a person skilled in the art and as described in the Examples.
  • the cells are usually plated into e.g. microtiter plates and grown. Usually the cells grow at the bottom of multiwell plates and are fixed. Thereafter, the cells are generally washed and loaded with a dye in a suitable loading buffer, preferably with a fluorescent dye such as fluo4am.
  • the cells are incubated with the test compound or modulator, in particular with a biochemical or chemical test compound as described above, e.g. in the form of a chemical compound library.
  • Ca 2+ measurements can be carried out using e.g. a Fluorescense Imaging Plate Reader (FLIPR).
  • FLIPR Fluorescense Imaging Plate Reader
  • a channel activator such as OAG should generally be applied.
  • inhibitors would be a reduction of e.g. the fluorescence increase.
  • Activators would lead to a further increase of e.g. an activator-evoked fluorescence or induce e.g. an activator-independent fluorescence increase.
  • modulators in particular inhibitors
  • suitable modulators for the screening of chemical compound libraries, the use of high-throughput assays are preferred which are known to the skilled person or which are commercially available.
  • chemical compound library means a plurality of chemical compounds that have been assembled from any of multiple sources, including chemically synthesized molecules and natural products or combinatorial chemical libraries.
  • the method of the present invention is carried out on an array and/or in a robotics system e.g. including robotic plating and a robotic liquid transfer system, e.g. using microfluidics, i.e. channelled structured.
  • a robotics system e.g. including robotic plating and a robotic liquid transfer system, e.g. using microfluidics, i.e. channelled structured.
  • the method is carried out in form of a high-through put screening system.
  • the screening method is automated and miniaturized, in particular it uses miniaturized wells and microfluidics controlled by a roboter.
  • the assay/method of the present invention is carried out in a cell line containing a gene of a TRPC channel under the control of an inducible promoter, as detailed above, wherein the channel activator is solubilised.
  • the activator OAG is solubilised in the presence of a serum albumin, e.g. bovine serum albumin, or plutonic acid.
  • Another subject matter of the present invention is directed to a method for producing a medicament for the treatment of atherosclerosis, wherein the method comprises the steps of:
  • compositions suitable for the treatment of a cardiovascular disease in particular atherosclerosis
  • pharmaceutically acceptable carriers or auxiliary substances are for example a physiological buffer solution, e.g. sodium chloride solution, demineralised water, stabilizers, such as protease or nuclease inhibitors, or sequestering agents, such as EDTA.
  • Figures 1A and 1B show that TRPC3 DN does not carry functional ion currents
  • Figures 2A and B show the dominant-negative effect of TRPC3 DN on TRPC3 and TRPC6
  • Figure 3 shows the effect of TRPC3 DN on acetylcholine-induced vasoreactivity in carotid arteries of atherosclerotic rabbits
  • Figure 4 shows a sonographic assessment of flow-induced vasoreactivity in TRPC3 DN expressing carotid artery segments
  • Figure 5 shows the size of atherosclerotic plaques in TRPC3 DN expressing carotid artery segments
  • Figure 6 shows the effect of TRPC3 DN expression on mean macrophage density in atherosclerotic carotid arteries
  • Figures 7A and 7B show the detection of OAG-activated Ca 2+ signals in inducible TRPC3 and TRPC6 cell lines using FLIPR technology
  • Figures 8A and 8B illustrate the IC 50 for TRPC3 and TRPC6 inhibition by SKF 96365 in doxycycline-induced cell lines by a FLIPR assay
  • SEQ ID NO: 1 shows the amino acid sequence of TRPC3
  • SEQ ID NO: 2 shows a nucleotide sequence coding for TRPC3
  • SEQ ID NO: 3 shows the complete amino acid sequence of the dominant-negative TRPC3 channel (TRPC3 DN ), (mutated amino acids are in bold)
  • SEQ ID NO: 4 shows the complete nucleotide sequence of TRPC3 DN ; (mutated nucleotides are in bold)
  • SEQ ID NO: 5 shows the amino acid sequence of TRPC6
  • SEQ ID NO: 6 shows a nucleotide sequence coding for TRPC ⁇
  • SEQ ID NO: 7 shows the amino acid sequence of a dominant-negative TRPC6 channel (TRPC6 DN ), (mutated amino acids are in bold)
  • SEQ ID NO: 8 shows the complete nucleotide sequence of TRPC6 DN ; (mutated nucleotides are in bold)
  • SEQ ID NO: 9 shows the amino acid sequence of TRPC7
  • SEQ ID NO: 10 shows a nucleotide sequence coding for TRPC7
  • SEQ ID NO: 11 shows the amino acid sequence of a dominant-negative TRPC7 channel (TRPC7 DN ), (mutated amino acids are in bold)
  • SEQ ID NO: 12 shows the complete nucleotide sequence of TRPC7 DN ; (mutated nucleotides are in bold)
  • TRPC3 DN dominant- negative TRPC3 channel
  • HM1 cells muscarinic Mi-receptor
  • DMEM/F12 (1:1) medium supplemented with 10% fetal calf serum, 2 mM glutamine,
  • Standard external buffer contained (in mM): NaCI 140, KCI 5.4, CaCI 2 2, MgCI 2 1 , glucose 10, HEPES 10, and pH was adjusted to 7.4 with NaOH.
  • the standard pipette buffer contained (in mM): CsOH 120, gluconic acid 120, MgCI 2 2, CaCI 2 3, Cs 4 -BAPTA 5, HEPES 10; pH was adjusted to 7.3 with gluconic acid.
  • Free [Ca 2+ ] was calculated to be ⁇ 200 nM using the CaBuf program (G. Droogmans, KU Leuven). Receptor- activated currents were elicited in HM1 cells by application of 10 ⁇ M carbachol.
  • TRPC3 DN does not carry functional ion currents
  • TRPC3 DN acts as a negative TRPC channel modulator
  • functional properties of the channel mutant were investigated by whole cell patch clamp.
  • TRPC currents were elicited by the acetylcholine receptor agonist carbachol (10 ⁇ M). Currents were recorded before (con) and in the presence of carbachol (carb).
  • TRPC3 DN did not carry notable ion currents.
  • TRPC3 directly interacts with itself as well as TRPC6 and TRPC7 (Hofmann et al. (2002) Proc. Natl. Acad. Sci. U.S.A., 99, 7461-7466). Therefore, the modulatory effects of TRPC3 DN were tested by co-expression with wild type TRPC3 and TRPC6 channels.
  • HM 1 cells were co-transfected with 7 ⁇ g TRPC3-YFP and 7 ⁇ g LacZ as control (open bars) or 7 ⁇ g TRPC3 DN (gray bars).
  • HM 1 cells were co-transfected with 7 ⁇ g TRPC6-YFP and LacZ or TRPC3 DN as in Figure 2A.
  • TRPC3 DN significantly ( *** p ⁇ 0-0°'l) suppressed currents through both TRPC3 and TRPC6.
  • TRPC3 DN conferred a dominant-negative effect on TRPC3 and TRPC6 channels. Based on sequence homology and previous reports (Hofmann et al. (2002), supra) it can be assumed that also the homologous TRPC7 channel is suppressed by TRPC3 DN .
  • TRPC3 DN expression and, thus, inhibition of TRPC3, TRPC6, and TRPC7 on atherosclerosis viral gene transfer of TRPC3 DN to vessels of atherosclerotic rabbits were used. Carotid arteries were infected with viruses harbouring TRPC3 DN or eGFP as a control. 8 weeks after gene transfer the disease state was evaluated by functional and histological parameters. , '
  • Adenoviruses encoding the dominant negative mutant of TPRC3 were generated, amplified and purified at large scale. Subsequently, the correctness of the sequence was checked by DNA sequencing (Medigenomix, Martinsried, Germany) and specific expression of the proteins was confirmed by Western Blotting.
  • Serum cholesterol levels were assessed before the initiation of feeding, directly before gene transfer, and 2, 4 and 8 weeks after gene transfer. The measurements were carried out in a validated laboratory specialized oh veterinarian serum determinations
  • basal vessel diameter and acetylcholine-induced vasoreactivity were determined by high definition ultrasound of the carotid artery.
  • Acetylcholine-induced vasoreactivity was measured 4 times every minute after the injection of the given doses of acetylcholine.
  • TRPC3 DN expression significantly improved acetylcholine-induced vasoreactivity compared to eGFP expressing segments (*** p ⁇ 0.001).
  • a decrease of vasoreactivity was observed in eGFP expressing segments vs. healthy controls (# p ⁇ 0.01).
  • Luminal vessel diameter of carotid artery segments was measured in atherosclerotic rabbits transduced with TRPC3 DN (hatched bars) or eGFP (open bars) and in healthy (non-atherosclerotic) rabbits (filled bars). Flow-induced vasoreactivity was tested during administration of 100 ml sodium chloride solution (applied over 5 min). Measurements taken after 80 ml of infusion and 1-2 min after application of the total volume are shown. TRPC3 DN expression significantly improved flow-induced vasoreactivity compared to eGFP expressing segments (** p ⁇ 0.01). 2.4 Determination of histological markers of atherosclerosis
  • the rest of the artery was used for Sudan macrostaining to detect lipid plaques.
  • sudan red staining was directly induced after perfusing the vessels with saline for 2 minutes and cutting longitudinally in the middle. Thereafter, the vessels were transferred to Sudan stain solution (Sudan III dissolved in alcohol and acetone).
  • Relative plaque size was determined by Sudan red staining followed by histological image analysis of carotid artery segments trancduced with TRPC3 DN or eGFP (Figure 5).
  • the right carotid arteries from rabbits that received TRPC3 DN were evaluated as untreated controls.
  • TRPC3 DN decreased plaque size vs. both eGFP (**p ⁇ 0.01) and untreated (*p ⁇ 0.05) controls.
  • Macrophages were identified by immunocytochernistry in the intimal layer of carotid arteries expressing TRPC3 DN or eGFP. TRPC3 DN caused a significant reduction of macrophage infiltration compared to eGFP expressing vessels (*p ⁇ 0.05).
  • HEK 293 cell lines were produced using the FIp-In T-REx system (Invitrogen,
  • TRPC3 accession # U47050
  • TRPC6 accession # AF080394
  • Channel cDNAs were amplified by standard techniques and cloned into pcDNA5/FRT/TO (Invitrogen, Düsseldorf, Germany). After transfection of FIp-In T-Rex 293 cells with the channel constructs stable cell lines were selected with hygromycin. Cells were maintained
  • FIGS 7A and 7B show that responses to OAG were observed only in doxycyclin- treated but not in non-induced cells. Thus, this result demonstrates that the OAG- activated Ca 2+ signal is specifically mediated by TRPC3 or TRPC6 respectively.
  • Fluorescence changes in fluo-4 loaded cells were measured using FLIPR II. The bar indicates application of 50 ⁇ M OAG. Shown are mean fluorescence values ⁇ SEM from 9 wells each. Fluorescence values were ! normalized to the mean baseline fluorescence (F 0 ).
  • SKF 96365 (1-( ⁇ [3-(4- methoxyphenyl)propoxy]-4-methoxyphenethyl)-1 H-imidazole-HCI) has been described as an inhibitor of nonselective cation channels including TRPC3 and TRPC6 (Boulay et al. (1997), J. Biol. Chem., 272, 29672-29680; Zhu et al. (1998), J. Biol. Chem., 273, 133-142).
  • Fluorescence changes induced by 30 ⁇ M OAG in TRPC3- and TRPC6 expressing cells were measured in the presence of the given concentrations of SKF 96365. Mean inhibition values ⁇ SEM are shown. Inhibition is expressed as % of control fluorescence in the absence of SKF 96365. Dose-response curves were fitted to the general dose-response equation. The spline curves represent the best fits to the composite data.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Urology & Nephrology (AREA)
  • Cell Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Veterinary Medicine (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Epidemiology (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Biotechnology (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Food Science & Technology (AREA)
  • Organic Chemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Heart & Thoracic Surgery (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Zoology (AREA)
  • Cardiology (AREA)
  • Vascular Medicine (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Investigating Or Analysing Biological Materials (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

The invention refers to the use of a TRPC channel, an inactivating mutant thereof, or a nucleotide sequence coding for the TRPC channel or for the inactivating mutant for the production of a medicament for the treatment of a cardiovascular disease and a method of screening a modulator of the TRPC channel or an inactivating mutant thereof.

Description

Use of a TRPC Channel for the Treatment of a Cardiovascular Disease
The invention refers to the use of a TRPC channel, an inactivating mutant thereof, or a 5 nucleotide sequence coding for the TRPC channel or for the inactivating mutant for the production of a medicament for the treatment of a cardiovascular disease and a method of screening a modulator of the TRPC channel or an inactivating mutant thereof.
10 Atherosclerosis is one of the major causes of cardiovascular diseases in the Western world. In 2001 these diseases accounted for about 1 million deaths in the USA. Moreover, due to live style changes in the developing countries atherosclerosis and related cardiovascular diseases are becoming global epidemics. The WHO reports that cardiovascular diseases will be the leading cause of death in the developing world by
15 2010.
Thus, there is an immense medical need for new medicines that prevent and treat atherosclerosis. The generation and progression of atherosclerosis is a complex and incompletely understood process that is dependent on a number of epigenetic (e.g. life 20 style, nutrition, exercise) and genetic factors. Numerous clinical observations implicate dysfunction of endothelial cells that line the inner vessel wall in the pathophysiology of atherosclerosis and atherogenesis (Ross, R. N. (1999), Engl. J. Med. 340:115-126).
Therefore, proteins involved in the regulation of endothelial function might be primary 25 targets for anti-atherosclerotic therapies. Ca2+-regulatory proteins seem to be of particular interest as important endothelial functions such as the production of nitric oxide (NO) are controlled by the level of intracellular Ca2+.
TRPC channels, a novel class of ion channel proteins, are Ca2+ permeable non- 30 selective cation channels expressed in the cardiovascular and other systems. Based on sequence homology TRPC3, TRPC6 and TRPC7 constitute a distinct TRPC subfamily. In expression systems these channels are activated by G protein coupled receptors or depletion of intracellular Ca2+ stores (Clapham et al. (2001), Nat. Rev. Neurosci. 2:387-396). TRPC3 might also contribute to oxidative stress-activated cation currents in cultured endothelial cells (Balzer et al. (1999) Cardiovasc. Res. 42:543- 549).
In order to study the functional role of TRPC 1 in smooth muscle cells an antibody against a specific epitope of TRPC1 was used in WO 02/059155. However, this epitope is not found on other TRPC channels. WO 05/049084 discloses functional studies on isolated rat ventricular myocytes using the compound 2- aminoethoxydiphenylborate (2-APB). However, it is known that this compound shows unspecific and questionable effects in particular on TRPC3 (van Rossum et al. (2000), J. Biol. Chem., 275, 28562-28568). j
According to the present invention we have suppressed TRPC3, TRPC6 and TRPC7 activity in endothelial cells of atherosclerotic rabbits in vivo using a genetic approach.
Surprisingly, we found a dramatic improvement of vascular function and reduction of histological markers of atherosclerosis in vessels treated with a dominant negative
TRPC3 gene, which means that the suppression of the activity of TRPC channels, in particular of the channels mentioned above, shows an anti-atherosclerotic effect. These findings establish a novel link between TRPC channels and cardiovascular diseases as atherosclerosis.
Therefore, one subject matter of the present invention is directed to the use of a TRPC channel, an inactivating mutant thereof, or a nucleotide sequence coding for the TRPC channel or for the inactivating mutant for the production of a medicament for the treatment of a cardiovascular disease, in particular atherosclerosis.
Preferred TRPC channels are the TRPC3 channel, TRPC6 channel or TRPC7 channel, in particular the TRPC3 channel or TRPC6 channel, especially the TRPC3 channel. The corresponding amino acid sequences are SEQ ID NO: 1 (TRPC3), SEQ ID NO: 5 (TRPC6), and SEQ ID NO: 9 (TRPC7), in particular the amino acid sequence SEQ ID NO: 1 coding for the TRPC3 channel. The corresponding nucleotide sequences are SEQ ID NO: 2 (TRPC3), SEQ ID NO: 6 (TRPC6), and SEQ ID NO: 10 (TRPC7), in particular the nucleotide sequence SEQ ID NO: 2 coding for the TRPC3 channel.
According to the present invention the term "inactivating mutant" means a mutant which is functionally inactive as a cation channel but can suppress the channel activity of homologous naturally occurring TRPC channels. Suppression may be accomplished by replacing a homologous TRPC channel subunit in the native multimeric channel assembly with the effect that essentially all naturally occurring TRPC channels in the cell membrane contain mutant channel subunits or are totally replaced by the mutant channel. Mutations that render a channel subunit inactive may be preferably located within the pore regions of TRPC3 (amino acids 603-645 in SEQ ID NO: 1), TRPC6 (amino acids 660-705 in SEQ ID NO: 5) and TRPC7 (amino acids 610-650 in SEQ ID NO: 9). Particular examples are the mutant TRPC3 channel (TRPC3DN) with the amino acid sequence of SEQ ID NO: 3, the mutant TRPC6 channel (TRPC6DN) with the amino acid sequence of SEQ ID NO: 7, and the mutant TRPC7 channel (TRPC7DN) with the amino acid sequence of SEQ ID NO: 11. A nucleotide sequence coding for TRPC3DN is the nucleotide sequence of SEQ ID NO: 4; a nucleotide sequence coding for TRPC6DN is the nucleotide sequence of SEQ ID NO: 8, and a nucleotide sequence coding for TRPC7DN is the nucleotide sequence of SEQ ID NO: 12. A particularly preferred example is the dominant-negative mutant TRPC3DN with the amino acid sequence of SEQ ID NO: 3. A nucleotide sequence coding for TRPC3DN is the nucleotide sequence of SEQ ID NO: 4.
Moreover, "inactivating mutants" may consist of any part of TRPC3, TRPC6 or TRPC7 that retain the ability to interact with naturally occurring TRPC channels at any step of protein synthesis or transport to the plasmamembrane and thereby suppress the function of the naturally occurring TRPC channels. Such part may be for example amino acids 0-302 of TRPC3 (SEQ ID NO: 1) (see Balzer et al. (1999) Cardiovasc. Res. 42:543-549). Inactivating mutants may be detected and/or analyzed using the whole cell patch clamp method as exemplarily described in the Examples.
Another subject matter of the present invention is directed to the use of a TRPC channel, an inactivating mutant thereof, or a nucleotide sequence coding for the TRPC channel or for the inactivating mutant for the discovery of a TRPC channel modulator, in particular an inhibitor, as a medicament for the treatment of a cardiovascular disease, in particular atherosclerosis.
Preferred TRPC channels are the TRPC3 channel, TRPC6 channel or TRPC7 channel, in particular the TRPC3 channel or TRPC6 channel, especially the TRPC3 channel, as described above in detail.
In general, the TRPC channel or an inactivating mutant thereof, or a nucleotide sequence coding for the TRPC channel or for the inactivating mutant thereof is brought into contact with a test compound and the influence of the test compound on the TRPC channel, an inactivating mutant thereof, or a nucleotide sequence coding for the TRPC channel or for the inactivating mutant is measured or detected.
According to the present invention the term "TRPC channel modulator" means a modulating molecule ("modulator") of the TRPC channel, in particular an inhibitory or activating molecule ("inhibitor" or "activator"), especially an inhibitor of the TRPC channel identifiable according to the assay of the present invention. An inhibitors is generally a compound that, e.g. bind to, partially or totally block activity, decrease, prevent, delay activation, inactivate, desensitize, or down-regulate the activity or expression of at least one of the TRPC channels as preferably described above in detail. An activator is generally a compound that, e.g. increase, open, activate, facilitate, enhance activation, sensitize, agonize, or up-regulate the activity or expression of at least one of the TRPC channels as preferably described above in detail. Such modulators include genetically modified versions of the TRPC channels, preferably an inactivating mutant of the TRPC channels, such as TRPC3DM, as well as naturally occurring or synthetic ligands, antagonists, agonists, peptides, cyclic peptides, nucleic acids, antibodies, antisense molecules, ribozymes, small organic molecules and the like.
An example for the measurement of the TRPC channel activity is an assay comprising the steps of:
(a) contacting a fluorescent cell expressing a TRPC channel,
(b) stimulating Ca2+ influx by a channel activator before, simultaneously or after contacting the fluorescent cell with the modulator or test compound, and (c) measuring or detecting a change in fluorescence.
Further details and alternative or preferred embodiments of that assay are described below and in the Examples.
Therefore, another subject matter of the present invention is directed to a method of screening a modulator of TRPC or an inactivating mutant thereof, or a nucleotide sequence coding for TRPC or for the inactivating mutant, wherein the method comprises the steps of: (a) contacting a cell expressing a TRPC channel or an inactivating mutant thereof, (b) stimulating Ca2+ influx by a channel activator before, simultaneously or after contacting the cell with a test compound, and
(c) measuring or detecting a change of the TRPC channel activity.
In a preferred embodiment the method further comprises the step of: (d) selecting a test compound with an activity against a cardiovascular disease by comparing the changes of the TRPC channel activity in the absence of the test compound.
In another preferred embodiment the expression of the TRPC channel or an inactivating mutant thereof in the cell is controlled by an inducible promoter, preferably by a promoter which is selected from a tetracycline inducible promoter. In a particular preferred embodiment the cell is a fluorescent cell as e.g. further described below.
Preferred cells or cell lines according to the present invention are MDCK, HEK 293, HEK 293 T, BHK, COS, NIH3T3, Swiss3T3 or CHO cells, in particular a HEK 293 cell line.
TRPC channel activity can be measured or detected by measuring or detecting a change in ion fluxes, in particular Ca2+ fluxes, by e.g. patch clamp techniques, whole cell currents, radiolabeled ion fluxes, or in particular fluorescence e.g. using voltage- sensitive dyes or ion-sensitive dyes (Vestergarrd-Bogind et al. (1988), J. Membrane Biol., 88:67-75; Daniel et al. (1991) J. Pharmacol. Meth. 25:185-193; Hoevinsky et al. (1994) J. Membrane Biol., 137:59-70; Ackerman et al. (1997), New Engl. J. Med., 336:1575-1595; Hamil et al. (1981), Pflugers. Archiv., 391:185).
Examples of such dyes are Di-4-ANEPPS (pyridinium 4-(2(6-(dibutylamino)-2- naphthalenyl)ethenyl)-1-(3-sulfopropyl) hydroxide), CC-2-DMPE (1 ,2-ditetradecanoyl- sn-glycero-3-phosphoethanolamine triethylammonium), DiSBAC2 (bis-(1 ,2-dibarbituric acid)-trimethine oxanol), DisBAC3 ((bis-(1 ,3-dibarbituric acid)-trimethine oxanol), SBFI- AM (1 ,3-benzenedicarboxylic acid,4,4'-[1,4,10-trioxa-7,13-diazacyclopentadecane- 7,13-diylbis(5-methoxy-6, 12-benzofurandiyl)]bis-(tetrakis-[(acetyloxy)methyl]ester)), fluo3am (1-[2-Amino-5-(2,7-dichloro-6-hydroxy-3-oxy-9-xanthenyl)phenoxy]-2-(2'- amino-51- methylphenoxy)ethane- N,N,N',N'-tetraacetic), fluo4am (1-[2-Amino-5-(2,7- dichloro-6-hydroxy-4-oxy-9-xanthenyl) phenoxy]-2-(2'-amino-5'- methylphenoxy)ethane- N,N,N',N'-tetraacetic) or fura2am (1-t2-(5'-carboxyoxazol-2'-yl)- 6-aminobenzofuran-5-oxy]-2-(2'-amino-5l-methyl-phenoxy)-ethane-N,N,N',N'- tetraacetic).
Examples of the channel activators are diacylglycerols, in particular 1-Oleyl-2acetyl-sn- glycerol (OAG), Gq-coupled receptor agonists, such as phenylephrine and in particular trypsin, an agonist that stimulates receptor tyrosine kinases such as epidermal growth factor (EGF) or diacylglycerol generating enzymes such as phospholipases or activators thereof.
The channel activators, in particular OAG, can be used for the direct stimulation of the TRPC channels which is an additional advantage of the assay of the present invention compared to the indirect, receptor-mediated activation of the channels because, for example, in the present assay the rate of false-positive results are substantially reduced.
In general, a cell is provided which expresses a TRPC channel or an inactivating mutant thereof under an inducible promoter, as e.g. described above. Such cell can be produced using genetic methods known to a person skilled in the art and as described in the Examples. After having induced the expression of the TRPC channel or an inactivating mutant thereof the cells are usually plated into e.g. microtiter plates and grown. Usually the cells grow at the bottom of multiwell plates and are fixed. Thereafter, the cells are generally washed and loaded with a dye in a suitable loading buffer, preferably with a fluorescent dye such as fluo4am. After having removed the loading buffer, the cells are incubated with the test compound or modulator, in particular with a biochemical or chemical test compound as described above, e.g. in the form of a chemical compound library. Ca2+ measurements can be carried out using e.g. a Fluorescense Imaging Plate Reader (FLIPR). To stimulate Ca2+ influx through the TRPC channel a channel activator such as OAG should generally be applied.
As an alternative mode of TRPC channel activation trypsin as a Gq-coupled receptor agonist can be applied.
The expected effects of inhibitors would be a reduction of e.g. the fluorescence increase. Activators would lead to a further increase of e.g. an activator-evoked fluorescence or induce e.g. an activator-independent fluorescence increase.
Thereafter, suitable modulators, in particular inhibitors can be analyzed and/or isolated. For the screening of chemical compound libraries, the use of high-throughput assays are preferred which are known to the skilled person or which are commercially available.
According to the present invention the term "chemical compound library" means a plurality of chemical compounds that have been assembled from any of multiple sources, including chemically synthesized molecules and natural products or combinatorial chemical libraries. j
Advantageously the method of the present invention is carried out on an array and/or in a robotics system e.g. including robotic plating and a robotic liquid transfer system, e.g. using microfluidics, i.e. channelled structured.
In another embodiment of the present invention, the method is carried out in form of a high-through put screening system. In such a system advantageously the screening method is automated and miniaturized, in particular it uses miniaturized wells and microfluidics controlled by a roboter.
In a particularly preferred embodiment the assay/method of the present invention is carried out in a cell line containing a gene of a TRPC channel under the control of an inducible promoter, as detailed above, wherein the channel activator is solubilised. For example, preferably the activator OAG is solubilised in the presence of a serum albumin, e.g. bovine serum albumin, or plutonic acid.
Another subject matter of the present invention is directed to a method for producing a medicament for the treatment of atherosclerosis,, wherein the method comprises the steps of:
(a) carrying out the method as described above,
(b) isolating a detected test compound suitable for the treatment of a cardiovascular disease, in particular atherosclerosis, and (c) formulating the detected test compound with one or more pharmaceutically acceptable carriers or auxiliary substances. Pharmaceutically acceptable carriers or auxiliary substances are for example a physiological buffer solution, e.g. sodium chloride solution, demineralised water, stabilizers, such as protease or nuclease inhibitors, or sequestering agents, such as EDTA.
The following Figures, Sequences and Examples shall explain the present invention without limiting the scope of the invention.
Description of the Figures
Figures 1A and 1B show that TRPC3DN does not carry functional ion currents
Figures 2A and B show the dominant-negative effect of TRPC3DN on TRPC3 and TRPC6
Figure 3 shows the effect of TRPC3DN on acetylcholine-induced vasoreactivity in carotid arteries of atherosclerotic rabbits
Figure 4 shows a sonographic assessment of flow-induced vasoreactivity in TRPC3DN expressing carotid artery segments
Figure 5 shows the size of atherosclerotic plaques in TRPC3DN expressing carotid artery segments
Figure 6 shows the effect of TRPC3DN expression on mean macrophage density in atherosclerotic carotid arteries
Figures 7A and 7B show the detection of OAG-activated Ca2+ signals in inducible TRPC3 and TRPC6 cell lines using FLIPR technology Figures 8A and 8B illustrate the IC50 for TRPC3 and TRPC6 inhibition by SKF 96365 in doxycycline-induced cell lines by a FLIPR assay
Description of the Sequences
SEQ ID NO: 1 shows the amino acid sequence of TRPC3
SEQ ID NO: 2 shows a nucleotide sequence coding for TRPC3
SEQ ID NO: 3 shows the complete amino acid sequence of the dominant-negative TRPC3 channel (TRPC3DN), (mutated amino acids are in bold)
SEQ ID NO: 4 shows the complete nucleotide sequence of TRPC3DN; (mutated nucleotides are in bold)
SEQ ID NO: 5 shows the amino acid sequence of TRPC6
SEQ ID NO: 6 shows a nucleotide sequence coding for TRPCδ
SEQ ID NO: 7 shows the amino acid sequence of a dominant-negative TRPC6 channel (TRPC6DN), (mutated amino acids are in bold)
SEQ ID NO: 8 shows the complete nucleotide sequence of TRPC6DN; (mutated nucleotides are in bold)
SEQ ID NO: 9 shows the amino acid sequence of TRPC7
SEQ ID NO: 10 shows a nucleotide sequence coding for TRPC7
SEQ ID NO: 11 shows the amino acid sequence of a dominant-negative TRPC7 channel (TRPC7DN), (mutated amino acids are in bold) SEQ ID NO: 12 shows the complete nucleotide sequence of TRPC7DN; (mutated nucleotides are in bold)
Examples
1. Construction and functional properties of TRPC3DN
To study TRPC channel function in vitro and in vivo we used a dominant-negative channel mutant to modulate native TRPC channel activity. The applicability of this approach for TRPC channels had been previously demonstrated (Hofmann et al. (2002) Proc. Natl. Acad. Sci. U.S.A., 99, 7461-7466). We generated a dominant- negative TRPC3 channel (TRPC3DN) by exchanging amino acids 621-623 of wild type human TRPC3 (NP__003296) for alanines by site directed mutagenesis. The insert was cloned into a modified pcDNA3 vector backbone using gateway technology (Invitrogen, Karlsruhe, Germany).
A HEK 293 line stably expressing the muscarinic Mi-receptor (HM1 cells) was used in this study (Peralta et al. (1988) Nature, 334, 434-437). Cells were grown at 37°C in
DMEM/F12 (1:1) medium supplemented with 10% fetal calf serum, 2 mM glutamine,
100 U/ml penicillin, 100 μg/ml streptomycin (Invitrogen, Karlsruhe, Germany) in 5.5%
CO2. G418 (0.5 mg/ml) was added to the growth medium. The cDNAs for hTRPC3
(U47050), hTRPC6 (AF080394), TRPC3DN, and eGFP (pEGFP-N1 , BD Biosciences, Palo Alto, CA) or YFP-tagged versions of the channel proteins were transfected using
LipofectAMINE 2000 (Invitrogen, Karlsruhe, Germany) according to the manufacturers' instructions
For electrophysiological experiments cells were transfected with the indicated amounts of cDNA in 35 mm dishes and plated onto coverslips 12 - 24 hrs after transfection. Cells were used 24-48 hrs after plating. If not indicated otherwise 0.4 μg eGFP was co-transfected as expression marker for patch-clamp experiments. Whole-cell currents were recorded from fluorescent cells at room temperature with a HEKA EPC 10 patch clamp amplifier and PULSE software (HEKA, Lambrecht, Germany). Patch pipettes with resistances of 2 - 5 MΩ in standard extracellular buffer were pulled from borosilicate glass. The holding potential was set to -70 mV and currents during 160 ms voltage ramps from -100 to +60 mV were sampled with 6.6 kHz. All recordings were filtered at 2 kHz.
Standard external buffer contained (in mM): NaCI 140, KCI 5.4, CaCI2 2, MgCI2 1 , glucose 10, HEPES 10, and pH was adjusted to 7.4 with NaOH. The standard pipette buffer contained (in mM): CsOH 120, gluconic acid 120, MgCI2 2, CaCI2 3, Cs4-BAPTA 5, HEPES 10; pH was adjusted to 7.3 with gluconic acid. Free [Ca2+] was calculated to be ~200 nM using the CaBuf program (G. Droogmans, KU Leuven). Receptor- activated currents were elicited in HM1 cells by application of 10 μM carbachol.
All statistical data is expressed as means ± SEMi Statistical analysis was performed using SigmaStat (SPSS, Chicago, IL). Results were pooled and analyzed using the Mann-Whitney rank sum test. The significance level was set to p < 0.05.
1.1 TRPC3DN does not carry functional ion currents
To establish that TRPC3DN acts as a negative TRPC channel modulator the functional properties of the channel mutant were investigated by whole cell patch clamp.
Representative current recordings from HM 1 cells transfected with 3 μg TRPC3 or TRPC3DN are shown in Figures 1A and 1B. TRPC currents were elicited by the acetylcholine receptor agonist carbachol (10 μM). Currents were recorded before (con) and in the presence of carbachol (carb).
On average the current density of TRPC3DN expressing cells (1 ,3 pA/pF, n = 11) was not different from cells transfected with LacZ as a negative control (1 ,2 pA/pF, n = 10). In accordance with the recordings shown in Figures 1A and 1B cells transfected with TRPC3 as a positive control displayed significantly greater current densities (11,2 pA/pF, n = 11 ; p < 0,001). Thus, TRPC3DN did not carry notable ion currents.
Previous studies suggest that TRPC3 directly interacts with itself as well as TRPC6 and TRPC7 (Hofmann et al. (2002) Proc. Natl. Acad. Sci. U.S.A., 99, 7461-7466). Therefore, the modulatory effects of TRPC3DN were tested by co-expression with wild type TRPC3 and TRPC6 channels.
1.2 Dominant-negative effect of TRPC3DN on TRPC3 and TRPC6
According to Figure 2A HM 1 cells were co-transfected with 7 μg TRPC3-YFP and 7 μg LacZ as control (open bars) or 7 μg TRPC3DN (gray bars). According to Figure 2B HM 1 cells were co-transfected with 7 μg TRPC6-YFP and LacZ or TRPC3DN as in Figure 2A.
Carbachol-induced currents were measured at -70 mV and normalized to the cell capacitance. TRPC3DN significantly (***p<0-0°'l) suppressed currents through both TRPC3 and TRPC6.
2. Anti-atherosclerotic effects of TRPC3DN in vivo
As shown in Figures 2A and 2B TRPC3DN conferred a dominant-negative effect on TRPC3 and TRPC6 channels. Based on sequence homology and previous reports (Hofmann et al. (2002), supra) it can be assumed that also the homologous TRPC7 channel is suppressed by TRPC3DN. To investigate the effects of TRPC3DN expression and, thus, inhibition of TRPC3, TRPC6, and TRPC7 on atherosclerosis viral gene transfer of TRPC3DN to vessels of atherosclerotic rabbits were used. Carotid arteries were infected with viruses harbouring TRPC3DN or eGFP as a control. 8 weeks after gene transfer the disease state was evaluated by functional and histological parameters. , '
2.1 Virus generation and animal studies
Adenoviruses encoding the dominant negative mutant of TPRC3 were generated, amplified and purified at large scale. Subsequently, the correctness of the sequence was checked by DNA sequencing (Medigenomix, Martinsried, Germany) and specific expression of the proteins was confirmed by Western Blotting.
White New Zealand rabbits, 20 weeks of age, were fed on a diet with 1% cholesterol + 5% corn oil. After 1 week of feeding, transgene expression was induced by catheter- based viral gene transfer (see below). Cholesterol feeding was continued for the whole course of the experiment. At least 8 animals were independently investigated in each group.
Serum cholesterol levels were assessed before the initiation of feeding, directly before gene transfer, and 2, 4 and 8 weeks after gene transfer. The measurements were carried out in a validated laboratory specialized oh veterinarian serum determinations
(Synlab, Augsburg, Germany). Also the LDL and HDL subfractions were determined with standard techniques. No significant differences were observed for serum cholesterol, LDL- or HDL cholesterol in control versus TRPC3DN receiving animals (p > 0.05) for all time points measured (n = 8 each group).
2.2 Endothelial gene transfer to the carotid artery
For gene transfer to the carotid artery a cervical midline incision was made and the left common artery was exposed. A segment of 4 cm was isolated with two small atraumatic clips (BIEMER vessel clips, FD 561 R). Approximately 0.2 ml TRPCV3DN or eGFP virus solution (titer 1010 pfu) was injected by a small needle (0.4x20) into the isolated segment. The incubation time was 20 min. Then, the clips were removed and the blood circulation was restored. The cervical wound was sutured and the animal was allowed to recover. The rabbits obtained analgesia (Temgesic®, Buprenorphin 0.01 mg/kg sc. every 12 h) for 72 hours post operation.
2.3 Measurement of Endothelial Vasoreactivity
At the end of the experiment, eight weeks after gene transfer, basal vessel diameter and acetylcholine-induced vasoreactivity were determined by high definition ultrasound of the carotid artery.
In vivo measurements of luminal vessel diameter was performed on carotid artery segments of atherosclerotic rabbits (Figure 3) transduced with TRPC3DN (hatched bars) or eGFP (open bars) and in healthy (non-atherosclerotic) rabbits (filled bars).
Acetylcholine-induced vasoreactivity was measured 4 times every minute after the injection of the given doses of acetylcholine. TRPC3DN expression significantly improved acetylcholine-induced vasoreactivity compared to eGFP expressing segments (*** p<0.001). A decrease of vasoreactivity was observed in eGFP expressing segments vs. healthy controls (# p<0.01).
In a second set of experiments, flow-induced vasoreactivity in response to administration of sodium chloride solution was tested (Figure 4).
Luminal vessel diameter of carotid artery segments was measured in atherosclerotic rabbits transduced with TRPC3DN (hatched bars) or eGFP (open bars) and in healthy (non-atherosclerotic) rabbits (filled bars). Flow-induced vasoreactivity was tested during administration of 100 ml sodium chloride solution (applied over 5 min). Measurements taken after 80 ml of infusion and 1-2 min after application of the total volume are shown. TRPC3DN expression significantly improved flow-induced vasoreactivity compared to eGFP expressing segments (** p<0.01). 2.4 Determination of histological markers of atherosclerosis
In order to assess disease progression histologically animals were injected with heparin and sacrificed. Carotid arteries were dissected proximally 1 cm from the sternum, distally at the epiglottis. The vessels were flushed with saline, dried carefully and shock frozen. A piece of artery from the central area was excised for investigation of GFP expression, HE and van Gieson staining and immunohistochemistry.
The rest of the artery was used for Sudan macrostaining to detect lipid plaques. For this purpose, sudan red staining was directly induced after perfusing the vessels with saline for 2 minutes and cutting longitudinally in the middle. Thereafter, the vessels were transferred to Sudan stain solution (Sudan III dissolved in alcohol and acetone).
Relative plaque size was determined by Sudan red staining followed by histological image analysis of carotid artery segments trancduced with TRPC3DN or eGFP (Figure 5). The right carotid arteries from rabbits that received TRPC3DN (to the left arteries) were evaluated as untreated controls. TRPC3DN decreased plaque size vs. both eGFP (**p < 0.01) and untreated (*p < 0.05) controls.
As another marker of atherosclerosis progression macrophage infiltration of the vessel intima was studied by immunocytochemisty. For histological staining, 6 μm slices were cut from the middle of all vessels which had been prepared by removing fat. The slices were fixed with acetone for 10 minutes at room temperature and air dried. They were then permeabilized with 0.6% H2O2 in 100% methanol for 5 minutes, washed with PBS three times and incubated with 20% rabbit serum. Next the slices were incubated with an anti-macrophage monoclonal antibody (1 :100, clone RAM-11, DAKO, Hamburg, Germany) at 200C for 20 - 30 minutes and washed three times with PBS. They were then incubated with the appropriate biotin-labelled secondary antibodies for 30 minutes at 2O0C, and again washed three times with PBS. Subsequently slices were incubated with ABC reagent for 30 minutes, washed with PBS, and stained with diaminobenzidine and H2O2 for 10 minutes. Counterstaining with Harris/hematoxylin/eosin was carried out thereafter. Analysis was performed by directly counting single positive cells in the vessel intima in each slide at high magnification (typically 600-fold) by a standardized counting procedure (Figure 6). 5
Macrophages were identified by immunocytochernistry in the intimal layer of carotid arteries expressing TRPC3DN or eGFP. TRPC3DN caused a significant reduction of macrophage infiltration compared to eGFP expressing vessels (*p < 0.05).
10 3. Assay for high throughput identification of TRPC3, TRPC6 and TRPC7 modulators
To develop an assay for the identification of TRPC channel modulators, recombinant HEK 293 cell lines were produced using the FIp-In T-REx system (Invitrogen,
15 Karsruhe, Germany) that express TRPC3 (accession # U47050) or TRPC6 (accession # AF080394) cDNAs under the control of an inducible promoter. Channel cDNAs were amplified by standard techniques and cloned into pcDNA5/FRT/TO (Invitrogen, Karlsruhe, Germany). After transfection of FIp-In T-Rex 293 cells with the channel constructs stable cell lines were selected with hygromycin. Cells were maintained
20 according to the manufactures instructions and channel expression of was induced by addition of 1 μg / ml doxycycline for 20 - 30 h. Cells were plated into 96 well poly-d- lysine coated black walled clear bottom microtiter plates (BD Biosciences, Bedford, MA) at a density of 40000-50000 cells/well 20 - 3O h before experiments. Cell were then washed and loaded with 2 μM fluo4am (Molecular Probes, Eugene, OR) for 30 -
25 45 min at room temperature in a buffer containing 1x HBSS (#14065-049, Invitrogen), 1 mM CaCI2, 20 mM HEPES, 0.02 % Pluronic F-127 (Molecular Probes), and 0.05% bovine serum albumin (pH = 7.4). Loading buffer was removed and cells incubated with test compounds for 10 min at room temperature. Ca2+ measurements were performed using a 96 well Fluorescence Imaging Plate Reader (FLIPR), (Molecular
30 Devices Corporation, Sunnyvale, CA). To stimulate Ca2+ influx through TRPC3 or TRPC6 we applied the channel activator 1-oleyl-2-acetyl-sn-glycerol (OAG) (Hofmann et al., 1999), at a final concentration of 30 - 50 μM. OAG was dissolved in a buffer containing 1x HBSS (#14065-049, Invitrogen), 1 mM CaCI2, 20 mM HEPES, 0.02 % Pluronic F-127 (Molecular Probes) (pH = 7.4) and added to the cells. Alternatively, OAG could be dissolved in a buffer containing 1x HBSS (#14065-049, Invitrogen), 1 mM CaCI2, 20 mM HEPES, and 0.1 % bovine serum albumin (pH = 7.4).
Figures 7A and 7B show that responses to OAG were observed only in doxycyclin- treated but not in non-induced cells. Thus, this result demonstrates that the OAG- activated Ca2+ signal is specifically mediated by TRPC3 or TRPC6 respectively.
Fluorescence changes in fluo-4 loaded cells were measured using FLIPR II. The bar indicates application of 50 μM OAG. Shown are mean fluorescence values ± SEM from 9 wells each. Fluorescence values were ! normalized to the mean baseline fluorescence (F0).
To identify modulators of TRPC3 or TRPC6 with the assays described above induced cells were used and test compounds are added to the wells before or after application of OAG. The expected effect of inhibitors would be a reduction of the fluorescence increase. Channel activators would lead to a further increase of the OAG-evoked signal or induce an OλG-independent fluorescence increase. SKF 96365 (1-(β~[3-(4- methoxyphenyl)propoxy]-4-methoxyphenethyl)-1 H-imidazole-HCI) has been described as an inhibitor of nonselective cation channels including TRPC3 and TRPC6 (Boulay et al. (1997), J. Biol. Chem., 272, 29672-29680; Zhu et al. (1998), J. Biol. Chem., 273, 133-142).
As shown in Figures 8A and 8B SKF 96365 inhibited OAG-activated fluorescence responses in TRPC3 expressing cells with an IC5O of 1 ,8 ± 0,12 μM (n = 8) and in TRPC6 expressing cells with an IC50 of 5.04 ± 0.17 μM (n = 8). Thus, the given examples demonstrate the ability of the assays to identify TRPC3 and TRPC6 modulators.
Fluorescence changes induced by 30 μM OAG in TRPC3- and TRPC6 expressing cells were measured in the presence of the given concentrations of SKF 96365. Mean inhibition values ± SEM are shown. Inhibition is expressed as % of control fluorescence in the absence of SKF 96365. Dose-response curves were fitted to the general dose-response equation. The spline curves represent the best fits to the composite data.
As an alternative mode of TRPC3 and TRPC6 channel activation the protease- activated receptor agonist trypsin (200 nM) was applied to induced FIp-In T-REx- TRPC3 and FIp-In T-REx-TRPC6 cells. This treatment exemplifies the use of Gq- coupled receptor agonists for stimulation of TRPC3 or TRPC6. At t = 60 sec after application trypsin induced significantly greater increases in fluorescence in induced FIp-In T-REx-TRPC3 and FIp-In T-REx-TRPC6 cells compared to non-induced. controls (Table 1). Hence, Gq-coupled receptor agonists, e.g. trypsin, may also be used in the assay to stimulate TRPC3 and TRPC6 responses.
Table 1: Fluorescence changes (F/Fo) in induced and non-induced FIp-In T-REx- TRPC3 and FIp-In T-REx-TRPC6 cells in response to 200 nM trypsin
Figure imgf000020_0001
Values are given as means ± SEM. Induced and non-induced groups were significantly different (p < 0.001 , t-test).
SEQ ID NO : 1
MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYGNIPWRKMLEESKT
LNVNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEAILNHPGFA ASKRLTLSPCEQELQDDDFYAYDEDGTRFSPDITPIILAAHCQKYEWHMLLMKGARIERPHDY
FCKCGDCMEKQRHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLTALELSNELAKLANIEKEFK
NDYRKLSMQCKDFWGVLDLCRDSEEVEAILNGDLESAEPLEVHRHKASLSRVKLAIKYEVKKF
VAHPNCQQQLLTIWYENLSGLREQTIAIKCLWLWALGLPFLAIGYWIAPCSRLGKILRSPFM
KFVAHAASFIIFLGLLVFNASDRFEGITTLPNITVTDYPKQIFRVKTTQFTWTEMLIMVWVLGM MWSECKELWLEGPREYILQLWNVLDFGMLSIFIAAFTARFLAFLQATKAQQYVDSYVQESDLSE
VTLPPEIQYFTYARDKWLPSDPQIISEGLYAIAWLSFSRIAYILPANESFGPLQISLGRTVKD
IFKFMVLFIMVFFAFMIGMFILYSYYLGAKVNAAFTTVEESFKTLFWSIFGLSEVTSWLKYDH
KFIENIGYVLYGIYNVTMVWLLNMLIAMINSSYQEIEDDSDVEWKFARSKLWLSYFDDGKTLP
PPFSLVPSPKSFVYFIMRIVNFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRVFESHSFNSI LNQPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQATEELAIL
IHKLSEKLNPSMLRCE
SEQ ID NO : 2
ATGGAGGGAAGCCCATCCCTGAGACGCATGACAGTGATGCGGGAGAAGGGCCGGCGCCAGGCTG TCAGGGGCCCGGCCTTCATGTTCAATGACCGCGGCACCAGCCTCACCGCCGAGGAGGAGCGCTT CCTCGACGCCGCCGAGTACGGCAACATCCCAGTGGTGCGCAAGATGCTGGAGGAGTCCAAGACG CTGAACGTCAACTGCGTGGACTACATGGGCCAGAACGCGCTGCAGCTGGCTGTGGGCAACGAGC ACCTGGAGGTGACCGAGCTGCTGCTCAAGAAGGAGAACCTGGCGCGCATTGGCGACGCCCTGCT GCTCGCCATCAGCAAGGGCTACGTGCGCATTGTAGAGGCCATCCTCAACCACCCTGGCTTCGCG GCCAGCAAGCGTCTCACTCTGAGCCCCTGTGAGCAGGAGCTGCAGGACGACGACTTCTACGCTT ACGATGAGGACGGCACGCGCTTCTCGCCGGACATCACCCCCATCATCCTGGCGGCGCACTGCCA GAAATACGAAGTGGTGCACATGCTGCTGATGAAGGGTGCCAGGATCGAGCGGCCGCACGACTAT TTCTGCAAGTGCGGGGACTGCATGGAGAAGCAGAGGCACGACTCCTTCAGCCACTCACGCTCGA GGATCAATGCCTACAAGGGGCTGGCCAGCCCGGCTTACCTCTCATTGTCCAGCGAGGACCCGGT GCTTACGGCCCTAGAGCTCAGCAACGAGCTGGCCAAGCTGGCCAACATAGAGAAGGAGTTCAAG AATGACTATCGGAAGCTCTCCATGCAATGCAAAGACTTTGTAGTGGGTGTGCTGGATCTCTGCC GAGACTCAGAAGAGGTAGAAGCCATTCTGAATGGAGATCTGGAATCAGCAGAGCCTCTGGAGGT ACACAGGCACAAAGCTTCATTAAGTCGTGTCAAACTTGCCATTAAGTATGAAGTCAAAAAGTTT GTGGCTCATCCCAACTGCCAGCAGCAGCTCTTGACGATCTGGTATGAGAACCTCTCAGGCCTAA GGGAGCAGACCATAGCTATCAAGTGTCTCGTTGTGCTGGTCGTGGCCCTGGGCCTTCCATTCCT GGCCATTGGCTACTGGATCGCACCTTGCAGCAGGCTGGGGAAAATTCTGCGAAGCCCTTTTATG AAGTTTGTAGCACATGCAGCTTCTTTCATCATCTTCCTGGGTCTGCTTGTGTTCAATGCCTCAG ACAGGTTCGAAGGCATCACCACGCTGCCCAATATCACAGTTACTGACTATCCCAAACAGATCTT CAGGGTGAAAACCACCCAGTTTACATGGACTGAAATGCTAATTATGGTCTGGGTTCTTGGAATG ATGTGGTCTGAATGTAAAGAGCTCTGGCTGGAAGGACCTAGGGAATACATTTTGCAGTTGTGGA ATGTGCTTGACTTTGGGATGCTGTCCATCTTCATTGCTGCTTTCACAGCCAGATTCCTAGCTTT CCTTCAGGCAACGAAGGCACAACAGTATGTGGACAGTTACGTCCAAGAGAGTGACCTCAGTGAA GTGACACTCCCACCAGAGATACAGTATTTCACTTATGCTAGAGATAAATGGCTCCCTTCTGACC CTCAGATTATATCTGAAGGCCTTTATGCCATAGCTGTTGTGCTCAGCTTCTCTCGGATTGCGTA CATCCTCCCTGCAAATGAGAGCTTTGGCCCCCTGCAGATCTCTCTTGGAAGGACTGTAAAGGAC ATATTCAAGTTCATGGTCCTCTTTATTATGGTGTTTTTTGCCTTTATGATTGGCATGTTCATAC TTTATTCTTACTACCTTGGGGCTAΆAGTTAATGCTGCTTTTACCACTGTAGAAGAAAGTTTCAA GACTTTATTTTGGTCAATATTTGGGTTGTCTGAAGTGACTTCCGTTGTGCTCAAATATGATCAC AAATTCATAGAAAATATTGGATACGTTCTTTATGGAATATACAATGTAACTATGGTGGTCGTTT TACTCAACATGCTAATTGCTATGATTAATAGCTCATATCAAGAAATTGAGGATGACAGTGATGT AGAATGGAAGTTTGCTCGTTCAAAACTTTGGTTATCCTATTTTGATGATGGAAAAACATTACCT CCACCTTTCAGTCTAGTTCCTAGTCCAAAATCATTTGTTTATTTCATCATGCGAATTGTTAACT TTCCCAAATGCAGAAGGAGAAGACTTCAGAAGGATATAGAAATGGGAATGGGTAACTCAAAGTC CAGGTTAAACCTCTTCACTCAGTCTAACTCAAGAGTTTTTGAATCACACAGTTTTAACAGCATT CTCAATCAGCCAACACGTTATCAGCAGATAATGAAAAGACTTATAAAGCGGTATGTTTTGAAAG CACAAGTAGACAAAGAAAATGATGAAGTTAATGAAGGTGAATTAAAAGAAATCAAGCAAGATAT CTCCAGCCTTCGTTATGAACTTTTGGAAGACAAGAGCCAAGCAACTGAGGAATTAGCCATTCTA ATTCATAAACTTAGTGAGAAACTGAATCCCAGCATGCTGAGATGTGAATGA
SEQ ID NO : 3
MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYGNIPWRKMLEESKT LNVNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARIiGDALLLAISKGYVRIVEAILNHPGFA ASKRLTLSPCEQELQDDDFYAYDEDGTRFSPDITPIILAAHCQKYEWHMLLMKGARIERPHDY FCKCGDCMEKQRHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLTALELSNELAKLANIEKEFK ND YRKLSMQCKD FWGVLDLCRDSEEVEAILNGDLESAEPLEVHRHKASLSRVKLAIKYEVKKF VAHPNCQQQLLTIWYENLSGLREQTIAIKCL WLWALGLPFLAIGYWIAPCSRLGKILRSPFM KFVAHAASFIIFLGLLVFNASDRFEGITTLPNITVTDYPKQIFRVKTTQFTWTEMLIMVWVLGM MWSECKELWLEGPREYILQLWNVLDFGMLSIFIAAFTARFLAFLQATKAQQYVDSYVQESDLSE VTLPPEIQYFTYARDKWLPSDPQIISEGLYAIAWLSFSRIAYILPANESFGPLQISLGRTVKD IFKFMVLFIMVFFAFMIGMFILYSYYLGAKVNAAFTTVEESFKTAAASIFGLSEVTSWLKYDH KFIENIGYVLYGIYNVTMWVLLNMLIAMINSSYQEIEDDSDVEWKFARSKLWLSYFDDGKTLP PPFSLVPSPKSFVYFIMRIVNFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRVFESHSFNSI LNQPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQATEELAIL IHKLSEKLNPSMLRCE
SEQ ID NO : 4
ATGGAGGGAAGCCCATCCCTGAGACGCATGACAGTGATGCGGGAGAAGGGCCGGCGCCAGGCTG TCAGGGGCCCGGCCTTCATGTTCAATGACCGCGGCACCAGCCTCACCGCCGAGGAGGAGCGCTT CCTCGACGCCGCCGAGTACGGCAACATCCCAGTGGTGCGCAAGATGCTGGAGGAGTCCAAGACG CTGAACGTCAACTGCGTGGACTACATGGGCCAGAACGCGCTGCAGCTGGCTGTGGGCAACGAGC ACCTGGAGGTGACCGAGCTGCTGCTCAAGAAGGAGAACCTGGCGCGCATTGGCGACGCCCTGCT GCTCGCCATCAGCAAGGGCTACGTGCGCATTGTAGAGGCCATCCTCAACCACCCTGGCTTCGCG GCCAGCAAGCGTCTCACTCTGAGCCCCTGTGAGCAGGAGCTGCAGGACGACGACTTCTACGCTT ACGATGAGGACGGCACGCGCTTCTCGCCGGACATCACCCCCATCATCCTGGCGGCGCACTGCCA GAAATACGAAGTGGTGCACATGCTGCTGATGAAGGGTGCCAGGATCGAGCGGCCGCACGACTAT TTCTGCAAGTGCGGGGACTGCATGGAGAAGCAGAGGCACGACTCCTTCAGCCACTCACGCTCGA GGATCAATGCCTACAAGGGGCTGGCCAGCCCGGCTTACCTCTCATTGTCCAGCGAGGACCCGGT GCTTACGGCCCTAGAGCTCAGCAACGAGCTGGCCAAGCTGGCCAACATAGAGAAGGAGTTCAAG AATGACTATCGGAAGCTCTCCATGCAATGCAAAGACTTTGTAGTGGGTGTGCTGGATCTCTGCC GAGACTCAGAAGAGGTAGAAGCCATTCTGAATGGAGATCTGGAATCAGCAGAGCCTCTGGAGGT ACACAGGCACAAAGCTTCATTAAGTCGTGTCAAACTTGCCATTAAGTATGAAGTCAAAAAGTTT GTGGCTCATCCCAACTGCCAGCAGCAGCTCTTGACGATCTGGTATGAGAACCTCTCAGGCCTAA GGGAGCAGACCATAGCTATCAAGTGTCTCGTTGTGCTGGTCGTGGCCCTGGGCCTTCCATTCCT GGCCATTGGCTACTGGATCGCACCTTGCAGCAGGCTGGGGAAAATTCTGCGAAGCCCTTTTATG AAGTTTGTAGCACATGCAGCTTCTTTCATCATCTTCCTGGGTCTGCTTGTGTTCAATGCCTCAG ACAGGTTCGAAGGCATCACCACGCTGCCCAATATCACAGTTACTGACTATCCCAAACAGATCTT CAGGGTGAAAACCACCCAGTTTACATGGACTGAAATGCTAATTATGGTCTGGGTTCTTGGAATG ATGTGGTCTGAATGTAAAGAGCTCTGGCTGGAAGGACCTAGGGAATACATTTTGCAGTTGTGGA ATGTGCTTGACTTTGGGATGCTGTCCATCTTCATTGCTGCTTTCACAGCCAGATTCCTAGCTTT CCTTCAGGCAACGAAGGCACAACAGTATGTGGACAGTTACGTCCAAGAGAGTGACCTCAGTGAA GTGACACTCCCACCAGAGATACAGTATTTCACTTATGCTAGAGATAAATGGCTCCCTTCTGACC CTCAGATTATATCTGAAGGCCTTTATGCCATAGCTGTTGTGCTCAGCTTCTCTCGGATTGCGTA CATCCTCCCTGCAAATGAGAGCTTTGGCCCCCTGCAGATCTCTCTTGGAAGGACTGTAAAGGAC ATATTCAAGTTCATGGTCCTCTTTATTATGGTGTTTTTTGCCTTTATGATTGGCATGTTCATAC TTTATTCTTACTACCTTGGGGCTAAAGTTAATGCTGCTTTTACCACTGTAGAAGAAAGTTTCAA GACTGCAGCTGCGTCAATATTTGGGTTGTCTGAAGTGACTTCCGTTGTGCTCAAATATGATCAC AAATTCATAGAAAATATTGGATACGTTCTTTATGGAATATACAATGTAACTATGGTGGTCGTTT TACTCAACATGCTAATTGCTATGATTAATAGCTCATATCAAGAAATTGAGGATGACAGTGATGT AGAATGGAAGTTTGCTCGTTCAAAACTTTGGTTATCCTATTTTGATGATGGAAAAACATTACCT CCACCTTTCAGTCTAGTTCCTAGTCCAAAATCATTTGTTTATTTCATCATGCGAATTGTTAACT TTCCCAAATGCAGAAGGAGAAGACTTCAGAAGGATATAGAAATGGGAATGGGTAACTCAAAGTC CAGGTTAAACCTCTTCACTCAGTCTAACTCAAGAGTTTTTGAATCACACAGTTTTAACAGCATT CTCAATCAGCCAACACGTTATCAGCAGATAATGAAAAGACTTATAAAGCGGTATGTTTTGAAAG CACAAGTAGACAAAGAAAATGATGAAGTTAATGAAGGTGAATTAAAAGAAATCAAGCAAGATAT CTCCAGCCTTCGTTATGAACTTTTGGAAGACAAGAGCCAAGCAACTGAGGAATTAGCCATTCTA ATTCATAAACTTAGTGAGAAACTGAATCCCAGCATGCTGAGATGTGAATGA
SEQ ID NO : 5
MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPCYGYYPCFRGSDNRL AHRRQTVLREKGRRLANRGPAYMFSDRSTSLSIEEERFLDAAEYGNIPWRKMLEECHSLNVNC VDYMGQNALQLAVANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAILSHPAFAEGKRL ATSPSQSELQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLRKGARIERPHDYFCKCN DCNQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKK LSMQCKDFWGLLDLCRNTEEVEAILNGDVETLQSGDHGRPNLSRLKLAIKYEVKKFVAHPNCQ QQLLSIWYENLSGLRQQTMAVKFLWLAVAIGLPFLALIYWFAPCSKMGKIMRGPFMKFVAHAA SFTIFLGLLVMNAADRFEGTKLLPNETSTDNAKQLFRMKTSCFSWMEMLIISWVIGMIWAECKE IWTQGPKEYLFELWNMLDFGMLAIFAASFIARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNV KYYNLARIKWDPSDPQIISEGLYAIAWLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVI FIMVFVAFMIGMFNLYSYYIGAKQNEAFTTVEESFKTLFWAIFGLSEVKSWINYNHKFIENIG YVLYGVYNVTMVIVLLNMLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVP SPKSLFYLLLKLKKWISELFQGHKKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHN KQPSIRSSEDFHLNSFNNPPRQYQKIMKRLIKRYVLQAQIDKESDEVNEGELKEIKQDISSLRY ELLEEKSQNTEDLAELIRELGEKLSMEPNQEETNR
SEQ ID NO : 6
ATGAGCCAGAGCCCGGCGTTCGGGCCCCGGAGGGGCAGTTCTCCCCGGGGCGCTGCCGGAGCCG CTGCGCGGCGCAACGAGAGCCAGGACTATCTGCTCATGGACTCGGAGCTGGGAGAAGACGGCTG CCCGCAAGCCCCGCTGCCTTGCTACGGCTACTACCCCTGCTTCCGGGGATCTGACAACAGACTG GCTCACCGGCGGCAGACAGTTCTCCGTGAGAAGGGGAGAAGGTTAGCTAATCGAGGACCAGCAT ACATGTTTAGTGATCGCTCCACAAGCCTATCTATAGAGGAGGAACGCTTTTTGGATGCAGCTGA ATATGGTAACATCCCAGTGGTGCGGAAGATGTTAGAAGAATGCCACTCACTCAACGTTAACTGT GTGGATTACATGGGCCAGAATGCCCTACAGTTGGCAGTGGCCAATGAGCATCTGGAAATTACAG AACTTCTTCTCAAGAAAGAAAACCTCTCTCGAGTTGGGGATGCTTTGCTTCTAGCTATTAGTAA AGGTTATGTTCGGATTGTGGAAGCAATTCTCAGTCATCCGGCTTTTGCTGAAGGCAAGAGGTTA GCAACCAGCCCTAGCCAGTCTGAACTCCAGCAAGATGATTTTTATGCCTATGATGAAGATGGGA CACGGTTCTCCCATGATGTGACTCCAATCATTCTGGCTGCCCACTGCCAGGAATATGAAATTGT GCATACCCTCCTGCGGAAGGGTGCTAGGATTGAACGGCCTCATGATTATTTCTGCAAGTGCAAT GACTGCAACCAGAAACAGAAGCATGACTCGTTTAGCCACTCCAGATCTAGGATTAATGCCTATA AAGGCCTGGCAAGTCCGGCTTACCTGTCATTGTCTAGTGAAGATCCAGTCATGACGGCTTTAGA ACTTAGCAATGAACTGGCAGTTCTGGCCAATATTGAGAAAGAGTTCAAGAATGACTACAAAAAA CTGTCAATGCAGTGCAAAGACTTTGTTGTTGGACTCCTTGATCTGTGCAGAAACACTGAAGAAG TCGAGGCCATTCTGAATGGGGATGTTGAAACGCTCCAGAGTGGTGATCACGGTCGCCCAAATCT CAGCCGTTTAAAACTTGCCATTAAATATGAAGTAAAAAAATTTGTAGCTCATCCAAACTGCCAA CAGCAACTTCTCTCCATTTGGTATGAGAATCTTTCTGGTTTACGACAGCAGACAATGGCGGTCA AGTTCCTTGTGGTCCTTGCTGTTGCCATTGGACTGCCCTTCCTGGCTCTCATTTACTGGTTTGC TCCATGCAGCAAGATGGGGAAGATAATGCGTGGACCATTCATGAAGTTTGTAGCACACGCAGCC TCCTTCACCATTTTTCTGGGACTGCTAGTCATGAATGCAGCTGACAGATTTGAAGGCACAAAAC TCCTTCCTAATGAAACCAGCACΆGATAATGCAΆAACAGCTGTTCAGGATGAAAACATCCTGCTT CTCATGGATGGAGATGCTCATTATATCCTGGGTAATAGGCATGATATGGGCTGAATGTAAAGAA ATCTGGACTCAGGGCCCCAAGGAATATTTGTTTGAGTTGTGGAACATGCTTGATTTTGGTATGT TAGCAATTTTCGCAGCATCATTCATTGCGAGATTCATGGCATTTTGGCATGCTTCCAAAGCCCA GAGCATCATTGACGCAAACGATACTTTGAAGGACTTGACGAAAGTAACATTGGGAGACAATGTG AAATACTACAATTTGGCCAGGATAAAGTGGGACCCCTCTGATCCTCAAATAATATCTGAAGGTC TTTATGCAATTGCTGTAGTTTTAAGTTTCTCTAGGATAGCTTATATTTTACCAGCAAATGAAAG CTTTGGACCTCTGCAGATATCACTTGGAAGAACAGTCAAAGACATCTTCAAGTTCATGGTCATA TTCATTATGGTGTTTGTGGCCTTTATGATTGGAATGTTCAATCTCTACTCCTACTACATTGGTG CAAJVACAAAATGAAGCCTTCACAACAGTTGAAGAGAGTTTTAAGACACTGTTCTGGGCTATATT TGGACTTTCTGAAGTGAAATCAGTGGTCATCAACTATAACCACAAATTCATTGAAAACATTGGT TACGTTCTTTATGGAGTCTATAATGTTACGATGGTCATTGTTTTGCTAAATATGTTAATTGCCA TGATCAACAGTTCATTCCAGGAAATTGAGGATGACGCTGATGTGGAGTGGAAATTTGCAAGGGC CAAACTCTGGTTTTCCTACTTTGAGGAGGGCAGAACACTTCCTGTACCCTTCAATCTGGTGCCG AGTCCAAAGTCCCTGTTTTATCTCTTACTGAAGCTTAAAAAATGGATTTCTGAGCTGTTCCAGG GCCATAAAAAAGGTTTCCAGGAAGATGCAGAGATGAACAAGATAAATGAAGAAAAGAAACTTGG AATTTTAGGAAGTCATGAAGACCTTTCAAAATTATCACTTGACAAAAA
ACAGGTTGGGCACAATAAACAACCAAGTATAAGGAGCTCAGAAGATTTCCATCTAAATAGTTTC AATAATCCTCCAAGACAATATCAGAAAATAATGAAAAGGCTCATTAAAAGATATGTACTGCAGG CCCAGATAGATAAGGAGAGTGATGAAGTGAACGAAGGGGAACTGAAGGAAATTAAGCAGGACAT CTCAAGTCTCCGCTATGAACTCCTTGAAGAAAAATCTCAGAATACAGAAGACCTAGCAGAACTT ATTAGAGAACTTGGAGAGAAATTATCCATGGAACCAAATCAAGAGGAAACCAATAGATAA
SEQ ID NO : 7
MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPCYGYYPCFRGSDNRL AHRRQTVLREKGRRLANRGPAYMFSDRSTSLSIEEERFLDAAEYGNIPWRKMLEECHSLNVNC VDYMGQNALQLAVANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAILSHPAFAEGKRL ATSPSQSELQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLRKGARIERPHDYFCKCN DCNQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKK LSMQCKDFWGLLDLCRNTEEVEAILNGDVETLQSGDHGRPNLSRLKLAIKYEVKKFVAHPNCQ QQLLSIWYENLSGLRQQTMAVKFLWLAVAIGLPFLALIYWFAPCSKMGKIMRGPFMKFVAHAA SFTIFLGLLVMNAADRFEGTKLLPNETSTDNAKQLFRMKTSCFSWMEMLIISWVIGMIWAECKE IWTQGPKEYLFELWNMLDFGMLAIFAASFIARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNV KYYNLARIKWDPSDPQIISEGLYAIAWLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVI FIMVFVAFMIGMFNLYSYYIGAKQNEAFTTVEESFKTAAAAIFGLSEVKSWINYNHKFIENIG YVLYGVYNVTMVIVLLNMLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVP SPKSLFYLLLKLKKWISELFQGHKKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHN KQPSIRSSEDFHLNSFNNPPRQYQKIMKRLIKRYVLQAQIDKESDEVNEGELKEIKQDISSLRY ELLEEKSQNTEDLAELIRELGEKLSMEPNQEETNR
SEQ ID NO : 8
ATGAGCCAGAGCCCGGCGTTCGGGCCCCGGAGGGGCAGTTCTCCCCGGGGCGCTGCCGGAGCCG CTGCGCGGCGCAACGAGAGCCAGGACTATCTGCTCATGGACTCGGAGCTGGGAGAAGACGGCTG CCCGCAAGCCCCGCTGCCTTGCTACGGCTACTACCCCTGCTTCCGGGGATCTGACAACAGACTG GCTCACCGGCGGCAGACAGTTCTCCGTGAGAAGGGGAGAAGGTTAGCTAATCGAGGACCAGCAT ACATGTTTAGTGATCGCTCCACAAGCCTATCTATAGAGGAGGAACGCTTTTTGGATGCAGCTGA ATATGGTAACATCCCAGTGGTGCGGAAGATGTTAGAAGAATGCCACTCACTCAACGTTAACTGT GTGGATTACATGGGCCAGAATGCCCTACAGTTGGCAGTGGCCAATGAGCATCTGGAAATTACAG AACTTCTTCTCAAGAAAGAAAΆCCTCTCTCGAGTTGGGGATGCTTTGCTTCTAGCTATTAGTAA AGGTTATGTTCGGATTGTGGAAGCAATTCTCAGTCATCCGGCTTTTGCTGAAGGCAAGAGGTTA GCAACCAGCCCTAGCCAGTCTGAACTCCAGCAAGATGATTTTTATGCCTATGATGAΆGATGGGA CACGGTTCTCCCATGATGTGACTCCAATCATTCTGGCTGCCCACTGCCAGGAATATGAAATTGT GCATACCCTCCTGCGGAAGGGTGCTAGGATTGAACGGCCTCATGATTATTTCTGCAAGTGCAAT GACTGCAACCAGAAACAGAAGCATGACTCGTTTAGCCACTCCAGATCTAGGATTAATGCCTATA AAGGCCTGGCAAGTCCGGCTTACCTGTCATTGTCTAGTGAAGATCCAGTCATGACGGCTTTAGA ACTTAGCAΆTGAACTGGCAGTTCTGGCCAATATTGAGAAAGAGTTCAAGAATGACTACAAAAAA CTGTCAATGCAGTGCAAAGACTTTGTTGTTGGACTCCTTGATCTGTGCAGAAACACTGAAGAAG TCGAGGCCATTCTGAATGGGGATGTTGAAACGCTCCAGAGTGGTGATCACGGTCGCCCAAATCT CAGCCGTTTAAAACTTGCCATTAAATATGAAGTAAAAAAATTTGTAGCTCATCCAAACTGCCAA CAGCAACTTCTCTCCATTTGGTATGAGAATCTTTCTGGTTTACGACAGCAGACAATGGCGGTCA AGTTCCTTGTGGTCCTTGCTGTTGCCATTGGACTGCCCTTCCTGGCTCTCATTTACTGGTTTGC TCCATGCAGCAΆGATGGGGAAGATAATGCGTGGACCATTCATGAAGTTTGTAGCACACGCAGCC TCCTTCACCATTTTTCTGGGACTGCTAGTCATGAATGCAGCTGACAGATTTGAAGGCACAAAAC TCCTTCCTAATGAAACCAGCACAGATAATGCAAAACAGCTGTTCAGGATGAAAACATCCTGCTT CTCATGGATGGAGATGCTCATTATATCCTGGGTAATAGGCATGATATGGGCTGAATGTAAAGAA ATCTGGACTCAGGGCCCCAAGGAATATTTGTTTGAGTTGTGGAACATGCTTGATTTTGGTATGT TAGCAATTTTCGCAGCATCATTCATTGCGAGATTCATGGCATTTTGGCATGCTTCCAAAGCCCA GAGCATCATTGACGCAAACGATACTTTGAAGGACTTGACGAAAGTAACATTGGGAGACAATGTG AΆATACTACAATTTGGCCAGGATAAAGTGGGACCCCTCTGATCCTCAAATAATATCTGAAGGTC TTTATGCAATTGCTGTAGTTTTAAGTTTCTCTAGGATAGCTTATATTTTACCAGCAAATGAAAG CTTTGGACCTCTGCAGATATCACTTGGAAGAACAGTCAAAGACATCTTCAAGTTCATGGTCATA TTCATTATGGTGTTTGTGGCCTTTATGATTGGAATGTTCAATCTCTACTCCTACTACATTGGTG CAAAACAAAATGAAGCCTTCACAACAGTTGAAGAGAGTTTTAAGACAGCGGCCGCGGCTATATT TGGACTTTCTGAAGTGAAATCAGTGGTCATCAACTATAACCACAAATTCATTGAAAACATTGGT
TACGTTCTTTATGGAGTCTATAATGTTACGATGGTCATTGTTTTGCTAAATATGTTAATTGCCA TGATCAACAGTTCATTCCAGGAAATTGAGGATGACGCTGATGTGGAGTGGAAATTTGCAAGGGC CAAACTCTGGTTTTCCTACTTTGAGGAGGGCAGAACACTTCCTGTACCCTTCAATCTGGTGCCG AGTCCAAAGTCCCTGTTTTATCTCTTACTGAAGCTTAAAAAATGGATTTCTGAGCTGTTCCAGG GCCATAAAAAAGGTTTCCAGGAAGATGCAGAGATGAΆCAAGATAAATGAAGAAAAGAAACTTGG AATTTTAGGAAGTCATGAAGACCTTTCAAAATTATCACTTGACAAAAA ACAGGTTGGGCACAATAAACAACCAAGTATAAGGAGCTCAGAAGATTTCCATCTAAATAGTTTC AATAATCCTCCAAGACAATATCAGAAAATAATGAAAAGGCTCATTAAAAGATATGTACTGCAGG CCCAGATAGATAAGGAGAGTGATGAAGTGAACGAAGGGGAACTGAAGGAAATTAAGCAGGACAT CTCAAGTCTCCGCTATGAACTCCTTGAAGAAAAATCTCAGAATACAGAAGACCTAGCAGAACTT ATTAGAGAACTTGGAGAGAAATTATCCATGGAACCAAATCAAGAGGAAACCAATAGATAA
SEQ ID NO : 9
MLRNSTFKNMQRRHTTLREKGRRQAIRGPAYMFNEKGTSLTPEEERFLDSAEYGNIPWRKMLE
ESKTLNFNCVD YMGQNALQLAVGNEHLEVTELLLKKENLARVGDALLLAISKGYVRIVEAILNH PAFAQGQRLTLSPLEQELRDDDFYAYDEDGTRFSHDITPIILAAHCQEYEIVHILLLKGARIER
PHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGLASAAYLSLSSEDPVLTALELSNELARLANIE
TEFKND YRKLSMQCKDFWGVLDLCRDTEEVEAILNGDVNFQVWSDHHRPSLSRIKLAIKYEVK
KFVAHPNCQQQLLTMWYENLSGLRQQS IAVKFLAVFGVS IGLPFLAIAYWIAPCSKLGRTLRS P
FMKFVAHAVS FTI FLGLLWNASDRFEGVKTLPNETFTDYPKQI FRVKTTQFS WTEMLIMKWVL GMIWS E CKE IWEEGPREYVLHLWNLLD FGMLS I FVAS FTARFMAFLKATEAQLYVDQHVQDDTL
HNVSLPPEVAYFTYARDKWWPSDPQIISEGLYAIAWLSFSRIAYILPANESFGPLQISLGRTV KDIFKFMVIFIMVFVAFMIGMFNLYSYYRGAKYNPAFTTVEESFKTLFWSIFGLSEVISWLKY DHKFIENIGYVLYGVYNVTMWVLLNMLIAMINNSYQEIEEDADVEWKFARAKLWLSYFDEGRT LPAPFNLVPSPKSFYYLIMRIKMCLIKLCKSKAKSCENDLEMGMLNSKFKKTRYQAGMRNSENL TANNTLSKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATG ELADLIQQLSEKFGKNLNKDHLRVNKGKDI
SEQ ID NO : 10
ATGTTGAGGAACAGCACCTTCAAAAACATGCAGCGCCGGCACACAACGCTGAGGGAGAAGGGCC
GTCGCCAGGCCATCCGGGGTCCCGCCTACATGTTCAACGAGAAGGGCACCAGTCTGACGCCCGA GGAGGAGCGCTTCCTGGACTCGGCTGAGTATGGCAACATCCCGGTGGTCCGGAAAATGCTGGAG
GAGTCCAAGACCCTTAACTTCAACTGTGTGGACTACATGGGGCAGAACGCTCTGCAGCTGGCCG
TGGGCAACGAGCACCTAGAGGTCACGGAGCTGCTGCTGAAGAAGGAGAACCTGGCACGGGTGGG GGACGCGCTGCTGCTGGCCATCAGCAAGGGCTATGTGCGCATCGTGGAGGCCATCCTCAACCAC CCGGCCTTCGCGCAGGGCCAGCGCCTGACGCTCAGCCCGCTGGAACAGGAGCTGCGCGACGACG ACTTCTATGCCTACGACGAGGACGGCACGCGCTTCTCCCACGACATCACGCCCATCATCCTGGC GGCGCACTGCCAGGAGTATGAGATCGTGCACATCCTGCTGCTCAAGGGCGCCCGCATCGAGCGG CCCCACGACTACTTCTGCAAGTGCAΆTGAGTGCACCGAGAΆACAGCGGAAAGACTCCTTCAGCC ACTCGCGCTCGCGCATGAACGCCTACAAAGGACTGGCGAGTGCTGCCTACTTGTCCCTGTCCAG CGAAGACCCTGTCCTCACCGCCCTGGAGCTCAGCAACGAGTTAGCCAGACTAGCCAACATTGAG ACTGAATTTAAGAACGATTACAGGAAGTTATCTATGCAATGCAAGGATTTTGTAGTGGGCGTGC TGGACCTGTGCCGAGACACAGAAGAGGTGGAAGCAATTTTAAACGGTGATGTGAACTTCCAAGT CTGGTCCGACCACCACCGTCCAAGTCTGAGCCGGATCAAACTCGCCATTAAATATGAAGTCAAG AAGTTCGTTGCTCATCCTAACTGTCAGCAGCAATTGCTTACCATGTGGTATGAAAATCTCTCAG GCTTACGTCAACAGTCTATCGCTGTGAAATTCCTGGCTGTCTTTGGAGTCTCCATAGGCCTCCC TTTTCTCGCCATAGCCTATTGGATTGCTCCGTGCAGCAAGCTAGGACGAACCCTGAGGAGCCCT TTCATGAAGTTTGTAGCTCATGCAGTTTCTTTTACAATCTTCTTGGGATTATTAGTTGTGAATG CATCTGACCGATTTGAAGGTGTTAAAACCCTGCCAAACGAAACCTTCACAGACTACCCAAAACA AATCTTCAGAGTGAAAACCACACAGTTCTCCTGGACAGAAATGCTCATTATGAAGTGGGTCTTA GGAATGATTTGGTCCGAATGCAAGGAAATCTGGGAGGAGGGGCCACGGGAGTACGTGCTGCACT TGTGGAACCTGCTAGATTTCGGGATGCTGTCCATCTTCGTGGCCTCCTTCACAGCACGCTTCAT GGCCTTCCTGAΆGGCCACGGAGGCACAGCTGTACGTGGACCAGCACGTGCAGGACGACACGCTG CACAATGTCTCGCTTCCGCCGGAAGTGGCATACTTCACCTACGCCAGGGACAAGTGGTGGCCTT CAGACCCTCAGATCATATCGGAAGGGCTCTACGCGATAGCCGTCGTGCTGAGCTTCTCTCGCAT TGCATACATTCTGCCAGCCAACGAGAGTTTTGGGCCCCTGCAGATCTCGCTAGGGAGAACTGTG AAAGATATCTTCAAGTTCATGGTCATTTTCATCATGGTATTTGTGGCCTTCATGATTGGGATGT TCAACCTGTACTCTTACTACCGAGGTGCCAAATACAACCCAGCGTTTACAACGGTTGAAGAAAG TTTTAAAACTTTGTTTTGGTCCATATTCGGCTTATCTGAAGTAATCTCAGTGGTGCTGAAATAC GACCACAAATTCATCGAGAACATTGGCTACGTTCTCTACGGCGTTTATAACGTCACCATGGTGG TAGTGTTGCTCAACATGCTAATAGCCATGATAAACAACTCCTATCAGGAAATTGAGGAGGATGC AGATGTGGAATGGAAGTTCGCCCGAGCAAAACTCTGGCTGTCTTACTTTGATGAAGGAAGAACT CTACCTGCTCCTTTTAATCTAGTGCCAAGTCCTAAATCATTTTATTATCTCATAATGAGAATCA AGATGTGCCTCATAAAACTCTGCAAATCTAAGGCCAAAAGCTGTGAAAATGACCTTGAAATGGG CATGCTGAATTCCAAATTCAAGAAGACTCGCTACCAGGCTGGCATGAGGAATTCTGAAAATCTG ACAGCAAATAACACTTTGAGCAAGCCCACCAGATACCAGAAAATCATGAAACGGCTCATAAAAA GATACGTCCTGAAAGCCCAGGTGGACAGAGAAAATGACGAAGTCAATGAAGGCGAGCTGAAGGA AATCAAGCAAGATATCTCCAGCCTGCGCTATGAGCTTCTTGAGGAAAA
ATCTCAAGCTACTGGTGAGCTGGCAGACCTGATTCAACAACTCAGCGAGAAGTTTGGAAAGAAC TTAAACAAAGACCACCTGAGGGTGAACAAGGGCAAAGACATTTAG
SEQ ID NO : 11
MLRNSTFKNMQRRHTTLREKGRRQAIRGPAYMFNEKGTSLTPEEERFLDSAEYGNIPWRKMLE ESKTLNFNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARVGDALLLAISKGYVRIVEAILNH PAFAQGQRLTLSPLEQELRDDDFYAYDEDGTRFSHDITPIILAAHCQEYEIVHILLLKGARIER PHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGLASAAYLSLSSEDPVLTALELSNELARLANIE TEFKNDYRKLSMQCKDFWGVLDLCRDTEEVEAILNGDVNFQVWSDHHRPSLSRIKLAIKYEVK KFVAHPNCQQQLLTMWYENLSGLRQQSIAVKFLAVFGVSIGLPFLAIAYWIAPCSKLGRTLRSP FMKFVAHAVSFTIFLGLLWNASDRFEGVKTLPNETFTDYPKQIFRVKTTQFSWTEMLIMKWVL GMIWSECKEIWEEGPREYVLHLWNLLDFGMLSIFVASFTARFMAFLKATEAQLYVDQHVQDDTL HNVSLPPEVAYFTYARDKWWPSDPQIISEGLYAIAWLSFSRIAYILPANESFGPLQISLGRTV KDIFKFMVIFIMVFVAFMIGMFNLYSYYRGAKYNPAFTTVEESFKTAAASIFGLSEVISWLKY DHKFIENIGYVLYGVYNVTMVWLLNMLIAMINNSYQEIEEDADVEWKFARAKLWLSYFDEGRT LPAPFNLVPSPKSFYYLIMRIKMCLIKLCKSKAKSCENDLEMGMLNSKFKKTRYQAGMRNSENL TANNTLSKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATG ELADLIQQLSEKFGKNLNKDHLRVNKGKDI
SEQ ID NO : 12
ATGTTGAGGAACAGCACCTTCASAAACATGCAGCGCCGGCACACAACGCTGAGGGAGAAGGGCC GTCGCCAGGCCATCCGGGGTCCCGCCTACATGTTCAACGAGAAGGGCACCAGTCTGACGCCCGA GGAGGAGCGCTTCCTGGACTCGGCTGAGTATGGCAACATCCCGGTGGTCCGGAAAATGCTGGAG GAGTCCAAGACCCTTAACTTCAACTGTGTGGACTACATGGGGCAGAACGCTCTGCAGCTGGCCG TGGGCAACGAGCACCTAGAGGTCACGGAGCTGCTGCTGAAGAAGGAGAACCTGGCACGGGTGGG GGACGCGCTGCTGCTGGCCATCAGCAAGGGCTATGTGCGCATCGTGGAGGCCATCCTCAACCAC CCGGCCTTCGCGCAGGGCCAGCGCCTGACGCTCAGCCCGCTGGAACAGGAGCTGCGCGACGACG ACTTCTATGCCTACGACGAGGACGGCACGCGCTTCTCCCACGACATCACGCCCATCATCCTGGC GGCGCACTGCCAGGAGTATGAGATCGTGCACATCCTGCTGCTCAAGGGCGCCCGCATCGAGCGG CCCCACGACTACTTCTGCAAGTGCAATGAGTGCACCGAGAAACAGCGGAAAGACTCCTTCAGCC ACTCGCGCTCGCGCATGAACGCCTACAAAGGACTGGCGAGTGCTGCCTACTTGTCCCTGTCCAG CGAAGACCCTGTCCTCACCGCCCTGGAGCTCAGCAACGAGTTAGCCAGACTAGCCAACATTGAG ACTGAATTTAAGAACGATTACAGGAAGTTATCTATGCAATGCAAGGATTTTGTAGTGGGCGTGC TGGACCTGTGCCGAGACACAGAAGAGGTGGAAGCAATTTTAAACGGTGATGTGAACTTCCAAGT CTGGTCCGACCACCACCGTCCAAGTCTGAGCCGGATCAAACTCGCCATTAAATATGAAGTCAAG AAGTTCGTTGCTCATCCTAACTGTCAGCAGCAATTGCTTACCATGTGGTATGAAAATCTCTCAG GCTTACGTCAACAGTCTATCGCTGTGAAATTCCTGGCTGTCTTTGGAGTCTCCATAGGCCTCCC TTTTCTCGCCATAGCCTATTGGATTGCTCCGTGCAGCAAGCTAGGACGAACCCTGAGGAGCCCT TTCATGAAGTTTGTAGCTCATGCAGTTTCTTTTACAATCTTCTTGGGATTATTAGTTGTGAATG CATCTGACCGATTTGAAGGTGTTAAAACCCTGCCAAACGAAACCTTCACAGACTACCCAAAACA AATCTTCAGAGTGAAAACCACACAGTTCTCCTGGACAGAAATGCTCATTATGAAGTGGGTCTTA GGAATGATTTGGTCCGAATGCAAGGAAATCTGGGAGGAGGGGCCACGGGAGTACGTGCTGCACT TGTGGAACCTGCTAGATTTCGGGATGCTGTCCATCTTCGTGGCCTCCTTCACAGCACGCTTCAT GGCCTTCCTGAAGGCCACGGAGGCACAGCTGTACGTGGACCAGCACGTGCAGGACGACACGCTG CACAATGTCTCGCTTCCGCCGGAAGTGGCATACTTCACCTACGCCAGGGACAAGTGGTGGCCTT CAGACCCTCAGATCATATCGGAAGGGCTCTACGCGATAGCCGTCGTGCTGAGCTTCTCTCGCAT TGCATACATTCTGCCAGCCAACGAGAGTTTTGGGCCCCTGCAGATCTCGCTAGGGAGAACTGTG AAAGATATCTTCAAGTTCATGGTCATTTTCATCATGGTATTTGTGGCCTTCATGATTGGGATGT TCAACCTGTACTCTTACTACCGAGGTGCCAAATACAACCCAGCGTTTACAACGGTTGAAGAAAG TTTTAAAACTGCGGCTGCGTCCATATTCGGCTTATCTGAAGTAATCTCAGTGGTGCTGAAATAC GACCACAAATTCATCGAGAACATTGGCTACGTTCTCTACGGCGTTTATAACGTCACCATGGTGG TAGTGTTGCTCAACATGCTAATAGCCATGATAAACAACTCCTATCAGGAAATTGAGGAGGATGC AGATGTGGAATGGAAGTTCGCCCGAGCAAAACTCTGGCTGTCTTACTTTGATGAAGGAAGAACT CTACCTGCTCCTTTTAATCTAGTGCCAAGTCCTAAATCATTTTATTATCTCATAATGAGAATCA AGATGTGCCTCATAAAACTCTGCAAATCTAAGGCCAAAAGCTGTGAAAATGACCTTGAAATGGG CATGCTGAATTCCAAATTCAAGAAGACTCGCTACCAGGCTGGCATGAGGAATTCTGAAAATCTG ACAGCAAATAACACTTTGAGCAAGCCCACCAGATACCAGAAAATCATGAAACGGCTCATAAAAA GATACGTCCTGAAAGCCCAGGTGGACAGAGAAAATGACGAAGTCAATGAAGGCGAGCTGAAGGA AATCAAGCAAGATATCTCCAGCCTGCGCTATGAGCTTCTTGAGGAAAA
ATCTCAAGCTACTGGTGAGCTGGCAGACCTGATTCAACAACTCAGCGAGAAGTTTGGAAAGAAC TTAAACAAAGACCACCTGAGGGTGAACAAGGGCAAAGACATTTAG

Claims

Claims
1. Use of a TRPC channel, an inactivating mutant thereof, or a nucleotide sequence coding for the TRPC channel or for the inactivating mutant for the production of a medicament for the treatment of a cardiovascular disease. i
2. The use according to claim 1 , wherein the TRPC channel is selected from the TRPC3 channel, TRPC6 channel and/or TRPC7 channel.
3. The use according to claim 2, wherein the amino acid sequence of TRPC3 is the amino acid sequence of SEQ ID NO: 2, the amino acid sequence of TRPC6 is the amino acid sequence of SEQ ID NO: 5, and the amino acid sequence of TRPC7 is the amino acid sequence of SEQ ID NO: 9.
4. The use according to claim 2, wherein the inactivating mutant is TRPC3DN with the amino acid sequence of SEQ ID NO: 3, TRPC6DN with the amino acid sequence of SEQ ID NO: 7 or TRPC7DN with the amino acid sequence of SEQ ID NO: 11.
5. The use according to claim 2, wherein the nucleotide sequence coding for TRPC3 is the nucleotide sequence of SEQ ID NO: 2, the nucleotide sequence of TRPC6 is the nucleotide sequence of SEQ ID NO: 6, and the nucleotide sequence of TRPC7 is the nucleotide sequence of SEQ ID^ NO: 10.
6. The use according to claim 4, wherein the nucleotide sequence coding for TRPC3DN is the nucleotide sequence of SEQ ID NO: 4, the nucleotide sequence coding for TRPC6DN is the nucleotide sequence of SEQ ID NO: 8, and the nucleotide sequence coding for TRPC7DN is the nucleotide sequence of SEQ ID NO: 12.
7. Use of a TRPC channel, an inactivating mutant thereof, or a nucleotide sequence coding for the TRPC channel or for the inactivating mutant for the discovery of a TRPC channel modulator as a medicament for the treatment of a cardiovascular disease.
8. The use according to claim 7, wherein the TRPC channel is selected from the TRPC3 channel, TRPC6 channel and/or TRPC7 channel.
9. The use according to claim 8, wherein the amino acid sequence of TRPC3 is the amino acid sequence of SEQ ID NO: 1 , the amino acid sequence of TRPC6 is the amino acid sequence of SEQ ID NO: 5, and the amino acid sequence of TRPC7 is the amino acid sequence of SEQ ID NO: 9.
10. The use according to claim 8, wherein the inactivating mutant is TRPC3DN with the amino acid sequence of SEQ ID NO: 3, TRPC6DN with the amino acid sequence of SEQ ID NO: 7, or TRPC7DN with the amino acid sequence of SEQ ID NO: 11.
11. The use according to claim 8, wherein the nucleotide sequence coding for TRPC3 is the nucleotide sequence of SEQ ID NO: 2, the nucleotide sequence of TRPC6 is the nucleotide sequence of SEQ ID NO: 6, and the nucleotide sequence of TRPC7 is the nucleotide sequence of SEQ ID NO: 10.
12. The use according to claim 10, wherein the nucleotide sequence coding for TRPC3DN is the nucleotide sequence of SEQ ID NO: 4, the nucleotide sequence coding for TRPC6DN is the nucleotide sequence of SEQ ID NO: 8, and the nucleotide sequence coding for TRPC7DN is the nucleotide sequence of SEQ ID NO: 12.
13. The use according to any of the claims 5-8, wherein the TRPC channel, an inactivating mutant thereof, or a nucleotide sequence coding for the TRPC channel or for the inactivating mutant is brought into contact with a test compound and the influence of the test compound on the TRPC channel, an inactivating mutant thereof, or a nucleotide sequence coding for the TRPC channel or for the inactivating mutant is measured or detected.
14. The use according to any of the claims 1-13, wherein the cardiovascular disease 5 is atherosclerosis.
15. A method of screening a modulator of the TRPC channel or an inactivating mutant thereof, or a nucleotide sequence coding for the TRPC channel or for the inactivating mutant, wherein the method comprises the steps of:
10 (a) contacting a cell expressing a TRPC or an inactivating mutant thereof,
(b) stimulating Ca2+ influx by a channel activator before, simultaneously or after contacting the cell with a test compound, and
(c) measuring or detecting a change of the TRPC channel activity.
15 16. The method of claim 15 further comprising the step of:
(d) selecting a test compound with an activity against a cardiovascular disease by comparing the changes of the TRPC channel activity in the absence of the test compound.
20 17. The method according to any of the claims 15-16, wherein the expression of the TRPC channel or an inactivating mutant thereof in the cell is controlled by an inducible promoter.
18. The method according to claim 17, wherein the inducible promoter is selected 25 from a tetracycline-inducible promoter.
19. The method according to any of the claims 15-18, wherein the cell is a fluorescent cell.
30 20. The method according to any of the claims 15-19, wherein the cell is selected from a MDCK, HEK 293, HEK 293 T, BHK, COS, NIH3T3, Swiss3T3 or CHO cell.
21. The method according to any of the claims 15-20, wherein the TRPC channel activity is measured or detected by measuring or detecting a change in ion fluxes, in particular Ca2+ fluxes, by preferably patch clamp techniques, whole cell currents, radiolabeled ion fluxes, or in particular fluorescence preferably using
5 voltage-sensitive dyes or ion-sensitive dyes.
22. The method according to any of the claims 15-21 , wherein the channel activator is a compound selected from diacylglycerols, in particular 1-Oleyl-2acetyl-sn- glycerol (OAG), Gq-coupled receptor agonists, especially phenylephrine and in
10 particular trypsin, an agonist that stimulates receptor tyrosine kinases, expecially epidermal growth factor (EGF), or diacylglycerol generating enzymes, especially phospholipases or activators thereof.
23. The method according to any of claims 15-22, wherein the TRPC is selected from 15 TRPC3, TRPC6, TRPC7, or an inactivating mutant thereof.
24. The method according to claim 23, wherein the inactivating mutant is TRPC3DN with the amino acid sequence of SEQ ID NO: 3, TRPC6DN with the amino acid sequence of SEQ ID NO: 7, or TRPC7DN with the amino acid sequence of SEQ ID
20 NO: 11.
25. The method according to any of the claims 15-24, wherein the test compound is provided in the form of a chemical compound library.
25 26. The method according to any of the claims 15-25, wherein the method is carried out on an array.
27. The method according to any of the claims 15-26, wherein the method is carried out in a robotics system.
30
28. The method according to any of the claims 15-27, wherein the method is a method of high-through put screening of the test compound.
29. The method according to any of the claims 15-28, wherein the test compound detected is an inhibitor.
30. The method according to any of the claims 15-29, wherein the cells are seeded onto a well of a multi-well test plate.
31. A method for producing a medicament for the treatment of a cardiovascular disease, wherein the method comprises the steps of: (a) carrying out the method according to any of the claims 15-30,
(b) isolating a detected test compound suitable for the treatment of a cardiovascular disease, and
(c) formulating the detected test compound with one or more pharmaceutically acceptable carriers or auxiliary substances.
32. The method according to any of the claims 15-31 , wherein the cardiovascular disease is atherosclerosis.
PCT/EP2005/013977 2005-01-12 2005-12-23 Use of a trpc channel for the treatment of a cardiovascular disease Ceased WO2006074802A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
US11/813,542 US20080221025A1 (en) 2005-01-12 2005-12-23 Use of Trpc Channel for the Treatment of a Cardiovascular Disease
EP05821755A EP1838334A1 (en) 2005-01-12 2005-12-23 Use of a trpc channel for the treatment of a cardiovascular disease
JP2007550707A JP2008526905A (en) 2005-01-12 2005-12-23 Use of TRPC channels to treat cardiovascular disease
MX2007008428A MX2007008428A (en) 2005-01-12 2005-12-23 Use of a trpc channel for the treatment of a cardiovascular disease.
BRPI0519807-0A BRPI0519807A2 (en) 2005-01-12 2005-12-23 use of a trpc channel to treat cardiovascular disease
CN200580046521XA CN101098709B (en) 2005-01-12 2005-12-23 Use of a trpc channel for the treatment of a cardiovascular disease
CA002593603A CA2593603A1 (en) 2005-01-12 2005-12-23 Use of a trpc channel for the treatment of a cardiovascular disease
AU2005324908A AU2005324908B2 (en) 2005-01-12 2005-12-23 Use of a TRPC channel for the treatment of a cardiovascular disease
IL184316A IL184316A0 (en) 2005-01-12 2007-07-01 Use of a trpc channel for the treatment of a cardiovascular disease
US12/897,892 US8030276B2 (en) 2005-01-12 2010-10-05 Treating cardiovascular disease with TRPC3 channel protein
US13/217,755 US8193150B2 (en) 2005-01-12 2011-08-25 Improving vascular function with an inactivating mutant of a TRPC channel protein

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP05000440.7 2005-01-12
EP05000440 2005-01-12

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US11/813,542 A-371-Of-International US20080221025A1 (en) 2005-01-12 2005-12-23 Use of Trpc Channel for the Treatment of a Cardiovascular Disease
US12/897,892 Continuation US8030276B2 (en) 2005-01-12 2010-10-05 Treating cardiovascular disease with TRPC3 channel protein

Publications (1)

Publication Number Publication Date
WO2006074802A1 true WO2006074802A1 (en) 2006-07-20

Family

ID=34933248

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2005/013977 Ceased WO2006074802A1 (en) 2005-01-12 2005-12-23 Use of a trpc channel for the treatment of a cardiovascular disease

Country Status (11)

Country Link
US (3) US20080221025A1 (en)
EP (1) EP1838334A1 (en)
JP (1) JP2008526905A (en)
KR (1) KR20070094777A (en)
CN (1) CN101098709B (en)
AU (1) AU2005324908B2 (en)
BR (1) BRPI0519807A2 (en)
CA (1) CA2593603A1 (en)
IL (1) IL184316A0 (en)
MX (1) MX2007008428A (en)
WO (1) WO2006074802A1 (en)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2052724A1 (en) * 2007-10-26 2009-04-29 sanofi-aventis Use of norgestimate as a selective inhibitor of TRPC3, TRPC6 and TRPC6 and TRPC7 ion channel
WO2011107474A1 (en) 2010-03-01 2011-09-09 Sanofi-Aventis Derivatives of aminoindanes, their preparation and their application in therapeutics
EP2556829A1 (en) 2011-08-10 2013-02-13 Universität Leipzig Bicyclic labdane diterpenes for use in the treatment of TRPC6 associated diseases

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002059155A2 (en) 2001-01-04 2002-08-01 University Of Leeds Modulation of calcium channel activity
WO2002072824A2 (en) * 2001-02-20 2002-09-19 Bayer Aktiengesellschaft Human transient receptor potential channel protein.
WO2005049084A2 (en) 2003-11-13 2005-06-02 Board Of Regents, The University Of Texas System Inhibition of trp channels as a treatment for cardiac hypertrophy and heart failure

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2004013629A2 (en) * 2002-07-29 2004-02-12 Novartis Ag Screening for agents suitable for treatment of leukocyte associated inflammatory diseases

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002059155A2 (en) 2001-01-04 2002-08-01 University Of Leeds Modulation of calcium channel activity
WO2002072824A2 (en) * 2001-02-20 2002-09-19 Bayer Aktiengesellschaft Human transient receptor potential channel protein.
WO2005049084A2 (en) 2003-11-13 2005-06-02 Board Of Regents, The University Of Texas System Inhibition of trp channels as a treatment for cardiac hypertrophy and heart failure

Non-Patent Citations (14)

* Cited by examiner, † Cited by third party
Title
ACKERMAN ET AL., NEW ENGL. J. MED., vol. 336, 1997, pages 1575 - 1595
BALZER ET AL., CARDIOVASC. RES., vol. 42, 1999, pages 543 - 549
BERGDAHL ANDREAS ET AL: "Cholesterol depletion impairs vascular reactivity to endothelin-1 by reducing store-operated Ca2+ entry dependent on TRPC1.", CIRCULATION RESEARCH, vol. 93, no. 9, 31 October 2003 (2003-10-31), pages 839 - 847, XP009051203, ISSN: 0009-7330 *
CLAPHAM ET AL., NAT. REV. NEUROSCI., vol. 2, 2001, pages 387 - 396
DANIEL ET AL., J. PHARMACOL. METH., vol. 25, 1991, pages 185 - 193
GROSCHNER K ET AL: "Trp proteins form store-operated cation channels in human vascular endothelial cells", FEBS LETTERS, ELSEVIER SCIENCE PUBLISHERS, AMSTERDAM, NL, vol. 437, no. 1-2, 16 October 1998 (1998-10-16), pages 101 - 106, XP004258499, ISSN: 0014-5793 *
HAMIL ET AL., PFLUGERS. ARCHIV., vol. 391, 1981, pages 185
HOEVINSKY ET AL., J. MEMBRANE BIOL., vol. 137, 1994, pages 59 - 70
HOFMANN THOMAS ET AL: "Subunit composition of mammalian transient receptor potential channels in living cells.", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA. 28 MAY 2002, vol. 99, no. 11, 28 May 2002 (2002-05-28), pages 7461 - 7466, XP009051268, ISSN: 0027-8424 *
ROSS, R. N., ENGL. J. MED., vol. 340, 1999, pages 115 - 126
STRÜBING CARSTEN ET AL: "Formation of novel TRPC channels by complex subunit interactions in embryonic brain.", THE JOURNAL OF BIOLOGICAL CHEMISTRY. 3 OCT 2003, vol. 278, no. 40, 3 October 2003 (2003-10-03), pages 39014 - 39019, XP002337751, ISSN: 0021-9258 *
VAN ROSSUM ET AL., J. BIOL. CHEM., vol. 275, 2000, pages 28562 - 28568
VESTERGARRD-BOGIND ET AL., J. MEMBRANE BIOL., vol. 88, 1988, pages 67 - 75
YIP HAM ET AL: "Expression of TRPC homologs in endothelial cells and smooth muscle layers of human arteries", HISTOCHEMISTRY AND CELL BIOLOGY, vol. 122, no. 6, December 2004 (2004-12-01), pages 553 - 561, XP009051224, ISSN: 0948-6143 *

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2052724A1 (en) * 2007-10-26 2009-04-29 sanofi-aventis Use of norgestimate as a selective inhibitor of TRPC3, TRPC6 and TRPC6 and TRPC7 ion channel
WO2009052972A2 (en) 2007-10-26 2009-04-30 Sanofi-Aventis Use of norgestimate as a selective inhibitor of trpc3, trpc6 and trpc7 ion channels
WO2009052972A3 (en) * 2007-10-26 2009-08-13 Sanofi Aventis Use of norgestimate as a selective inhibitor of trpc3, trpc6 and trpc7 ion channels
US20110015167A1 (en) * 2007-10-26 2011-01-20 Sanofi-Aventis Use of norgestimate as a selective inhibitor of trpc3, trpc6 and trpc7 ion channels
EP2266575A3 (en) * 2007-10-26 2012-05-02 Sanofi Use of Norgestimate as a selective inhibitor of TRPC3, TRPC6 and TRPC7 ion channels
US8455469B2 (en) 2007-10-26 2013-06-04 Sanofi Use of norgestimate as a selective inhibitor of TRPC3, TRPC6 and TRPC7 ion channels
AU2008315952B2 (en) * 2007-10-26 2013-09-12 Sanofi Use of norgestimate as a selective inhibitor of TRPC3, TRPC6 and TRPC7 ion channels
WO2011107474A1 (en) 2010-03-01 2011-09-09 Sanofi-Aventis Derivatives of aminoindanes, their preparation and their application in therapeutics
EP2368876A1 (en) 2010-03-01 2011-09-28 Sanofi Derivatives of aminoindanes, their preparation and their application in therapeutics
EP2556829A1 (en) 2011-08-10 2013-02-13 Universität Leipzig Bicyclic labdane diterpenes for use in the treatment of TRPC6 associated diseases
WO2013021038A1 (en) 2011-08-10 2013-02-14 Universität Leipzig Bicyclic labdane diterpenes for use in the treatment of trpc6 associated diseases

Also Published As

Publication number Publication date
US20110312874A1 (en) 2011-12-22
CN101098709A (en) 2008-01-02
EP1838334A1 (en) 2007-10-03
AU2005324908B2 (en) 2011-03-24
CA2593603A1 (en) 2006-07-20
BRPI0519807A2 (en) 2009-03-17
CN101098709B (en) 2012-06-20
AU2005324908A1 (en) 2006-07-20
IL184316A0 (en) 2007-10-31
US8030276B2 (en) 2011-10-04
JP2008526905A (en) 2008-07-24
US20080221025A1 (en) 2008-09-11
US8193150B2 (en) 2012-06-05
US20110021377A1 (en) 2011-01-27
KR20070094777A (en) 2007-09-21
MX2007008428A (en) 2008-02-12

Similar Documents

Publication Publication Date Title
Li et al. Atrial natriuretic peptide inhibits transforming growth factor β–induced smad signaling and myofibroblast transformation in mouse cardiac fibroblasts
Herzog et al. VEGF binding to NRP1 is essential for VEGF stimulation of endothelial cell migration, complex formation between NRP1 and VEGFR2, and signaling via FAK Tyr407 phosphorylation
Zentilin et al. Cardiomyocyte VEGFR‐1 activation by VEGF‐B induces compensatory hypertrophy and preserves cardiac function after myocardial infarction
El-Shewy et al. Insulin-like growth factors mediate heterotrimeric G protein-dependent ERK1/2 activation by transactivating sphingosine 1-phosphate receptors
US8383600B2 (en) Increasing glucose transport and insulin-stimulated glucose uptake
Saifudeen et al. A role for p53 in terminal epithelial cell differentiation
Knöferle et al. TGF-β 1 enhances neurite outgrowth via regulation of proteasome function and EFABP
Ruginis et al. Consequence of gastrin-releasing peptide receptor activation in a human colon cancer cell line: a proteomic approach
US8193150B2 (en) Improving vascular function with an inactivating mutant of a TRPC channel protein
EP1164838A2 (en) Screening assay for antagonists of fgfr-mediated malignant cell transformation and tumor formation
Johansson et al. Nuclear import of glucokinase in pancreatic beta-cells is mediated by a nuclear localization signal and modulated by SUMOylation
Grubb et al. Phospholipase Cβlb associates with a Shank3 complex at the cardiac sarcolemma
Feng et al. Compartmentalizing proximal FGFR1 signaling in ovine placental artery endothelial cell caveolae
CN101610780A (en) Undercarboxylated/uncarboxylated osteocalcin enhances β-cell proliferation, insulin secretion, insulin sensitivity, glucose tolerance and reduces fat mass
Maru et al. An oncogenic form of the Flt-1 kinase has a tubulogenic potential in a sinusoidal endothelial cell line
HK1113740A (en) Use of a trpc channel for the treatment of a cardiovascular disease
Vuchkovska Polycystin-2 Is Cardioprotective Against Myocardial Infarction by Regulating the Calcium-Mediated ER-Stress Response
US20220135664A1 (en) Use of an antibody and antisense in the treatment of Congenital Muscular Dystrophy
Zheng Cardiac Voltage-Gated Sodium Channel Regulation
US20080187935A1 (en) Homo and Heterodimer Proteins of the Abcg Family, Methods For Detection and Screening Modulators Thereof
WO2023205752A2 (en) Ephrin ligand mimetic peptides for the treatment of neurodegenerative diseases
Wu Ion channel TRPM4 activity and cardiac conduction disease
Ma et al. Depletion of Intracellular Ca 2 Stores Stimulates the Translocation of Vanilloid Transient Receptor Potential 4-C1 Heteromeric Channels to the Plasma Membrane
US20070026436A1 (en) Glucose transport-related genes, polypeptides, and methods of use thereof
Francolini The expression of the rare caveolin-3 variant T78M alters cardiac ion channels function and membrane excitability

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application
WWE Wipo information: entry into national phase

Ref document number: 2005821755

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 184316

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 2593603

Country of ref document: CA

Ref document number: 3056/CHENP/2007

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: MX/a/2007/008428

Country of ref document: MX

Ref document number: 2007550707

Country of ref document: JP

Ref document number: 2005324908

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 200580046521.X

Country of ref document: CN

Ref document number: 1020077015982

Country of ref document: KR

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2005324908

Country of ref document: AU

Date of ref document: 20051223

Kind code of ref document: A

WWP Wipo information: published in national office

Ref document number: 2005324908

Country of ref document: AU

WWP Wipo information: published in national office

Ref document number: 2005821755

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 11813542

Country of ref document: US

ENP Entry into the national phase

Ref document number: PI0519807

Country of ref document: BR

Kind code of ref document: A2