WO2006044045A2 - Cryptosporidium hominis genes and gene products for chemotherapeutic, immunoprophylactic and diagnostic applications - Google Patents

Cryptosporidium hominis genes and gene products for chemotherapeutic, immunoprophylactic and diagnostic applications Download PDF

Info

Publication number
WO2006044045A2
WO2006044045A2 PCT/US2005/031657 US2005031657W WO2006044045A2 WO 2006044045 A2 WO2006044045 A2 WO 2006044045A2 US 2005031657 W US2005031657 W US 2005031657W WO 2006044045 A2 WO2006044045 A2 WO 2006044045A2
Authority
WO
WIPO (PCT)
Prior art keywords
chro
protein
aaelo
seq
hominis
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2005/031657
Other languages
French (fr)
Other versions
WO2006044045A3 (en
Inventor
Gregory A. Buck
Luiz Shozo Ozaki
Yingping Wang
Ping Xu
Myma Garcia Serrano
Patrico A. Manque
Jaoa Marcelo Pereira Alves
Daniela Puiu
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Virginia Commonwealth University
Original Assignee
Virginia Commonwealth University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Virginia Commonwealth University filed Critical Virginia Commonwealth University
Priority to US11/575,245 priority Critical patent/US8114976B2/en
Publication of WO2006044045A2 publication Critical patent/WO2006044045A2/en
Publication of WO2006044045A3 publication Critical patent/WO2006044045A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6888Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms
    • C12Q1/6893Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms for protozoa
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/44Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from protozoa
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/44Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from protozoa
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the invention generally relates to Cryptosporidium hominis genes and gene products
  • the invention provides Cryptosporidium hominis genes and gene products for use in chemotherapeutic, immunotherapeutic, immunoprophylactic and diagnostic applications.
  • Cryptosporidium species are the causative agent of cryptosporidiosis, a disease that is characterized by acute gastro-enteritis and diarrhea.
  • the disease is rampant in many developing countries (e.g. in Latin America, Africa, and Asia).
  • incidents of cryptosporidiosis occur worldwide and developing countries are not immune to such incidents.
  • an outbreak in Milwaukee, Wisconsin in the mid 1990's caused over 400,000 human infections.
  • no site on earth is free from the threat of serious outbreaks of cryptosporidiosis.
  • the National Institutes of Health and the Center for Disease Control classify Cryptosporidium as an important "Category B" agent of potential biological terrorism.
  • Cryptosporidium species are members of the Apicomplexa. These protozoan pathogens invade host cells using a specialized apical complex, and are usually transmitted by an invertebrate vector or intermediate host. Unlike most Apicomplexans, Cryptosporidium completes its life cycle in a single host and is transmitted by ingestion of oocysts. Two species, C. hominis, and C. parvum, which differ in host range, genotype and pathogenicity, are most relevant to humans. C. hominis is restricted to humans whereas C. parvum also infects other mammal species. Currently, there are no effective treatments for cryptosporidiosis, and control focuses on eliminating oocysts from water supplies.
  • the present invention is based on the determination of the sequence of the eight chromosome ⁇ 9.2 Mb genome of C. hominis, and the analysis of that sequence. Using genomics and bioinformatic approaches, a wide array of new targets for therapeutic and diagnostic applications has been identified. Moreover, an accurate view of the overall metabolism of the organism has been obtained, permitting a realistic approach to identification of critical points of attack for therapeutics.
  • C. hominis protein-coding genes show a striking concordance with the requirements imposed by the environmental niches the parasite inhabits.
  • Energy metabolism is largely from glycolysis.
  • Options for both aerobic and anaerobic metabolism are available, the former requiring an alternative electron transport system in a simplified mitochondrion.
  • Biosynthesis capabilities are limited, explaining an extensive array of transporters.
  • Evidence of an apicoplast is absent, but genes associated with apical complex organelles are present.
  • C. hominis and C. parvum exhibit very similar gene complements and phenotypic differences between these parasites must be due to subtle sequence divergence.
  • the invention thus provides newly identified genes and gene products of C. hominis that are of use in chemo and immunotherapy, immunoprophylaxis, and diagnostic applications.
  • SEQ ID NO: 2 amino acid sequences as represented in SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, SEQ ID NO:
  • SEQ ID NO: 22 It is a further object of this invention to provide nucleotide sequences as represented in SEQ DD NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ E) NO: 7, SEQ ID NO: 9, and SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, SEQ E) NO: 21, SEQ E) NO: 23 and SEQ E) NOS: 25-4000.
  • the invention further provides a method of detecting and diagnosing C. hominis infection in a patient in need thereof.
  • the method comprises the step of obtaining a biological sample from said patient, and amplifying nucleotide sequences from said sample, and determining infection based on whether there are one or more amplicons are produced.
  • the invention further provides a method for immunizing a patient against C. hominis infection.
  • the method comprises the step of administering to the patient a non- virulent C. hominis peptide or nucleotide in an amount sufficient to permit the patient to mount an antibody response to the non- virulent C. hominis peptide or nucleotide.
  • non-virulent we mean that the peptide or nucleotide does not cause pathology (e.g. symptoms of C. hominis infection).
  • the invention further provides a method for detecting Cryptosporidium such as C. hominis in a sample, for example, of detecting contamination of a water supply by
  • the method comprises the steps of 1) obtaining a sample; 2) amplifying nucleotide sequences from the sample; and 3) detecting amplicons produced in the step of amplifying.
  • the production of amplicons in the amplifying step indicates the presence of C. hominis in the sample.
  • the method may further include the step of quantifying the amount of amplicons that is produced. This amount will be indicative of the amount of
  • Cryptosporidium e.g. C. hominis
  • the method may be used, for example, to detect Cryptosporidium contamination in environmental samples such as water.
  • the sample may include several Cryptosporidium species other than C. hominis.
  • the determining step permits discrimination between C. hominis and other Cryptosporidium species in the sample.
  • the invention further provides arrays for assessing the presence or expression of genes in C. hominis, and for detecting the interaction (e.g. binding) of C. hominis macromolecules.
  • the array is a device comprising macromolecules such as nucleic acid probes, peptides, proteins, or antibodies, all of which originate from nucleic acid sequences of C. hominis, i.e. they are identical to or homologous to C. hominis genomic sequences; or are encoded by C. hominis genome sequences; or, in the case of antibodies, they bind to such macromolecules.
  • the nucleic acid probes include nucleotide sequences homologous to nucleotide sequences of C. hominis.
  • the nucleic acid probes are at least 70 nucleotides in length.
  • FIG. 1 Schematic representation of putative cellular components and metabolic pathways in C. hominis.
  • the cytoplasmic membrane is indicated by a broad stripe at the top of the figure, and the intracellular compartment is below the stripe.
  • ABC ATP-binding cassette
  • MRP multi-drug resistance protein
  • PEP phosphoenolpyruvate
  • THF tetrahydrofolate
  • DHF dihydrofolate
  • AOX alternative oxidase
  • UQ ubiquinone
  • NADH DH NADH dehydrogenase
  • Hsp70 heat-shock protein 70
  • Cpn60 chaperone 60
  • TIMl translocase of the inner mitochondrial membrane 17
  • TOM40 translocase of the outer mitochondrial membrane 40
  • FAS fatty-acid synthase
  • PKS polyketide synthase
  • GPI glycosylphosphatidylinositol
  • IP inositol phosphate
  • PLC phospholipase C
  • PKA protein kinase A
  • PKC protein kinase C
  • PDK phosphatidylinositol 3-kinase
  • AC oxidas
  • chromosome -9.2 Mb genome of C. hominis The genetic sequence of the eight chromosome -9.2 Mb genome of C. hominis has been determined and analyzed (see Table 1). By using genomics and bioinformatic approaches, a wide array of new targets for therapeutic and diagnostic applications has been identified, hi addition, the overall metabolism of the organism has been elucidated, permitting a realistic approach to identification of critical points of attack (i.e. therapeutic targets) for therapeutics directed to the prevention or treatment of cryptosporidiosis.
  • therapeutic target we mean a molecule or pathway, the function of which can be targeted for intervention (e.g. blocking or inhibition) by the administration of agents such as drugs, or by stimulation of a specific immune response (by induction or passive administration( such as an antibody production.
  • Such an intervention results in a decreased ability of the parasite to cause disease or disease symptoms.
  • such intervention may result in total or partial inhibition of the parasite's ability to carry out normal metabolism, to reproduce, to infect cells, to escape from infected cells, to proceed through a normal life cycle, to resist treatment with other disease alleviation agents, to navigate successfully, or to otherwise exert its pathological effects and cause disease.
  • C. hominis proteins that have been identified (or non-toxic or inactive fragments thereof) are useful for stimulating an immune system response to antigenic determinants of the proteins in an individual to whom they are administered.
  • the nucleotide sequences and selected amino acid sequences of such proteins are provided in the Sequence Listing, the complete contents of which is hereby incorporated by reference.
  • An immune system response may include increased antibody titers and/or increased cellular immunity, and, in a preferred embodiment, results in immunity to C. hominis.
  • the proteins, or regions of the proteins encompassing antigenic determinants may be administered as vaccines for immuno prophylaxis.
  • antibodies to antigenic determinants of the C may be administered as vaccines for immuno prophylaxis.
  • hominis proteins may also be administered directly to individuals in order to treat or prevent disease symptoms caused by C. hominis, i.e. immuno therapy. In addition, such antibodies may be useful as diagnostic or laboratory tools.
  • the highly tailored physiology of C. hominis suggests several potential therapeutic targets, examples of which include but are not limited to: 1) transport systems for peptides, amino acids, nucleosides, and sugars; 2) components of glycolysis; 3) the unique prokaryotic FASl (fatty acid synthase 1) and PKSl (polyketide synthase 1); 4) starch and amylopectin biosynthesis or catabolism; 5) nucleic acid or amino acid metabolism; 6) the AOX (alternate oxidase) electron transport system; 7) the TS-DHFR (thymidine synthase-dihydrofolate reductase); and 8) the diverged polyamine synthesis enzymes.
  • the invention provides the DNA sequences that encode numerous ribosomal RNA (rRNA) molecules (SEQ ID NOS: 4003-4014; see Table 14) and transfer
  • RNA (tRNA) molecules SEQ ID NOS: 4015 - 4059; see Table 13). These sequences are also provided in the Sequence Listing, the complete contents of which is hereby incorporated by reference. Those of skill in the art will recognize that rRNA and tRNA sequences may have many uses, including but not limited to: detection of Cryptosporidium in clinical samples, diagnosis of cryptosporidiosis in humans and animals, identification of
  • Cryptosporidium carriers detection of Cryptosporidium in water supplies, detection of Cryptosporidium contamination in lakes, rivers or other environmental sites, etc.
  • targets in particular the rRNA targets, are very useful for discrimination of Cryptosporidium strains; e.g., C. hominis and C. parvum.
  • these targets are useful for quantification of Cryptosporidium in any of the above, or other, clinical, water or environmental samples. An example of this is shown in Example 6 below.
  • nucleic acid sequences from Cryptosporidium hominis, as provided in the Sequence Listing (and see Table 1). Those of skill in the art will recognize that such sequences may be used for a variety of purposes, including but not limited to translation of the amino acid sequences encoded therein, as probes for diagnostic assay for the detection of C.
  • hominis for expression in bacterial systems, for expression in fungal or insect cell systems, for generation of recombinant and subunit vaccines or immuno therapeutics, for generation of active enzymes, for purification for structural determination (e.g., standard biochemical and biophysical applications such as NMR, MS, XRay crystallography), for the construction of RNA and protein microarrays, for the construction of nucleic acid libraries, for comparative genome analysis, for phylogeny and taxonomy, for prediction of putative blocking peptide domains, etc.
  • nucleic acid sequences disclosed herein those of skill in the art will recognize that many variants (derivatives) of the sequences may exist or be constructed which would still be suitable for use in the practice of the present invention.
  • nucleic acid sequences may be constructed for purposes related to other aspects of the invention, for example: for cloning strategies (e.g.
  • restriction enzyme cleavage sites for ease of manipulation of a sequence for insertion into a vector, for rendering the sequence compatible with the cloning system vector or host, for enabling fluorescent or affinity labeling technologies, etc.
  • modifying transcription e.g. the introduction of specific promoter or enhancer sequences, insertion or deletion of splice signals, for enhancing or negatively regulating transcription levels, for regulating polyadenylation, for controlling termination, and the like
  • modification of active or inactive domains for elimination or modification of certain activities or domains, for optimizing expression due to codon usage or other compositional biases, for addition of immunologically relevant (enhancing or inhibiting) sequences or for any other suitable purpose.
  • nucleic acid sequences disclosed herein are intended to be encompassed by the present invention, provided the sequences display identity in the range of about 50 to 100%, and preferably about 60 to 100%, or more preferably about 70 to 100%, or even more preferably about 80 to 100%, or most preferably about 90 to 100% or about 95 to 100% to the disclosed sequences.
  • the identity is with reference to the portion of the nucleic acid sequence that corresponds to the original sequence, and is not intended to cover additional elements such as promoters, vector-derived sequences, restriction enzyme cleavage sites, etc. derived from other sources.
  • nucleic acids of the present invention are not limited to DNA, but are intended to encompass other nucleic acids as well, such as RNA (e.g. mRNA, tRNA, rRNA, etc.), RNA-DNA hybrids, and various modified forms of DNA and RNA known to those of skill in the art.
  • RNA e.g. mRNA, tRNA, rRNA, etc.
  • RNA-DNA hybrids e.g. RNA-DNA hybrids
  • modified forms of DNA and RNA known to those of skill in the art.
  • nucleic acids may be modified to resist degradation via structural modification (e.g. by the introduction of secondary structures, such as stem loops, or via phosphate backbone modifications, etc.).
  • the nucleic acids may include phosphothioate or phosphodithioate rather than phosphodiesterase linkages within the backbone of the molecule, or methylphosphorothiate terminal linkages.
  • nucleic acid molecules include but are not limited to: nontraditional bases such as inosine and queosine; acetyl-, thio- and similarly modified forms of adenine, cytidine, guanine, thymine and uridine; stabilized nucleic acid molecules such as nonionic DNA analogs, alkyl- and aryl phosphonates; nucleic acid molecules which contain a diol, such as tetrahyleneglycol or hexaethyleneglycol, at either or both termini; etc. Further, the nucleic acid molecules may be either single or double stranded, or may comprise segments of both single and double strand nucleic acid.
  • nontraditional bases such as inosine and queosine
  • stabilized nucleic acid molecules such as nonionic DNA analogs, alkyl
  • the invention also provides vectors comprising nucleic acid sequences of the invention.
  • vectors comprising nucleic acid sequences of the invention.
  • Those of skill in the art are well-acquainted with various vectors that may be used e.g. for manipulation of nucleic acid sequences during genetic engineering procedures, for storage of stocks of the nucleic acid, for expression of an amino acid sequence encoded by the nucleic acid, for expression in bacterial, fungal, insect or other host systems, for delivery of DNA vaccines, for amplification of the DNA, for sequence analysis, for molecular interaction studies, etc.
  • Many such vectors are known to those of skill in the art, and include but are not limited to plasmids, adenoviral vectors, various expression vectors (e.g.
  • PTRIEX4 PET41, PET44, and others of the PET series, the pUC vector series, the BlueScript series, derivatives of pBR322 with CoIEl origin of replication, the TOPO vector series, the Gateway vectors, the TET repressor vectors, BAC vectors [pBeloBACs, pCCIBAC, etc.], pcDNA301 and related plasmids with the CMV promoter, pBAC insect vectors, pIEX for insect cells, and many others).
  • nucleotide sequences of the present invention represent open reading frames (ORFs) that encode for amino acid sequences, e.g. peptides, polypeptides, and proteins, all of which are also intended to be encompassed by the present invention, hi general, for the purposes of the present invention, a peptide comprises about 15 or fewer amino acids, a polypeptide comprises from about 15 to about 100 amino acids, and a protein comprises about 100 or more amino acids, although the terms maybe used interchangeably herein.
  • the peptides, polypeptides and proteins of the present invention are generally provided as recombinant molecules, although the amino acid sequences may also be produced synthetically via known peptide synthesis techniques.
  • the peptides, polypeptides and proteins of the present invention are provided in a substantially purified form, i.e. they are generally free of extraneous materials (such as other proteins, nucleic acids, lipids, cellular debris, etc.) and will generally be at least about 75% pure, preferably about 85% pure, and most preferably at least about 90-95% or more pure, as would be understood by one of ordinary skill in the art.
  • the present invention comprehends all amino acid sequences that may be translated from the nucleic acid sequences of the present invention, hi general, proteins/polypeptides that are so-translated will be translated from an open reading frame.
  • the invention also encompasses variants (derivatives) of such proteins/polypeptides.
  • variants may exist or be constructed which display: conservative amino acid substitutions; non-conservative amino acid substitutions; truncation by, for example, deletion of amino acids at the amino or carboxy terminus, or internally within the molecule; or by addition of amino acids at the amino or carboxy terminus, or internally within the molecule (e.g.
  • variants may be naturally occurring (e.g. as the result of natural variations between species or between individuals, or as a result of different expression systems used to produce the amino acid sequence, etc.); or they may be purposefully introduced (e.g. in a laboratory setting using genetic engineering techniques).
  • amino acid sequences may be in a variety of forms, including a neutral (uncharged) forms, or forms which are salts, and may contain modifications such as glycosylation, side chain oxidation or deamidation, phosphorylation and the like. Also included are amino acid sequences modified by additional substituents such as glycosyl units, lipids, or inorganic ions such as phosphates, as well as modifications relating to chemical conversions or the chains, such as oxidation of sulfhydryl groups.
  • Strategies for improving solubility of cloned proteins are known to those of skill in the art. Such strategies may be used in the practice of this invention, and include: modifying expression conditions (temperature, buffer, nutrients), modification of the promoter or its activity, linking the protein to a different fusion protein that helps it maintain its solubility, expression in the yeast system Pichiapastoris, the insect baculovirus system, or in another eukaryotic organism, etc. Expression of soluble proteins is difficult in bacterial systems, but success is much more common in Pichia, baculovirus or mammalian expression systems.
  • variants of the sequences disclosed herein are intended to be encompassed by the teachings of the present invention, provided the variant protein/polypeptide displays sufficient identity to the original sequences, the original sequence being a sequence as disclosed herein, or an amino acid sequence that can be translated from a nucleic acid sequence disclosed herein, (e.g. from an ORF or portion thereof).
  • amino acid identity will be in the range of about 50 to 100%, and preferably about 60 to 100%, or more preferably about 70 to 100%, or even more preferably about 80 to 100%, or most preferably about 90 to 100%, or even 95 to 100%, of the disclosed sequences.
  • the identity is with reference to the portion of the amino acid sequence that corresponds to the original amino acid sequence as translated directly from the nucleic acid sequences disclosed herein, i.e. not including additional elements that might be added, such as sequences added to form chimeric proteins, histidine tags, etc.
  • additional elements that might be added, such as sequences added to form chimeric proteins, histidine tags, etc.
  • Those of skill in the art are well acquainted with the methods available for determining the identity between amino acid sequences, for example, FASTA, FASTP, the BLAST suite of comparison software, ClustalW, Lineup, Pileup, or many other alignment software packages.
  • such protein/polypeptide variants retain at least about 50 to 100% or more of the activity of the original polypeptide, and preferably about 60 to 100% or more, or more preferably about 70 to 100% or more, or even more preferably about 80 to 100% or more, and most preferably about 90 to 100% or more of the activity of the original sequence.
  • activity we mean the activity or role of the amino acid sequence in C. hominis, which may include but is not limited to: enzymatic activity, activity as a structural component, activity as a transporter protein, activity in signal transduction, role as a membrane component, binding activity, activating activity, transport activity, etc.
  • the amino acid sequences of the invention are produced in recombinant expression systems.
  • the recombinant system is an E. coli recombinant system, which can be expressed as well in mammalian cells for use, for example, as a DNA vaccine.
  • the amino acid sequences may be produced in a variety of other recombinant expression systems.
  • yeast, insect cells using for example, a baculovirus expression vector
  • plant cells e.g. tobacco, potato, corn, etc.
  • transgenic animals e.g. tobacco, potato, corn, etc.
  • mammalian cell culture systems can be used for expression of recombinant proteins.
  • Any appropriate expression system that suitably produces the amino acid sequences of the invention may be used in the practice of the invention.
  • Such systems and their use for the production of recombinant proteins are well known to those of ordinary skill in the art.
  • vectors containing nucleic acid sequences that encode the amino acid sequences of the invention will encode a single protein.
  • Such vectors may contain DNA encoding more than one nucleic acid of the invention, either as separate, discrete sequences, or combined into a single chimeric sequence.
  • two or more nucleic acids according to the invention may be present in the vector, and the nucleic acids may be expressed separately, resulting in the translation of one amino acid sequence for each nucleic acid.
  • a single polypeptide chain containing more than one amino acid sequence of the invention, or portions of more than one amino acid sequence of the invention may be combined in tandem.
  • one or more highly antigenic proteins or regions of proteins of the invention may be expressed as a chimera from a single DNA sequence.
  • the amino acid sequences of the invention maybe expressed as part of a chimeric protein comprising amino acid sequences from another source, e.g. antigenic sequences known to be useful as adjuvants adjuvants (e.g.
  • PADRE Pan-DR T helper cell epitope
  • hepatitis B core antigen DNA sequences CPG, other chemokines, CTB or cholera toxin B subunit, Ricin B and other plant toxin subunits, LPS or lipopolysaccharide, KLH [key hole limpet hemocyanin], Freund's complete and Freund's incomplete adjuvant, and many other reagents, etc.
  • sequences that permit targeting of the protein to a specific location within the cell e.g.
  • nucleus nucleolus or nuclear membrane
  • mitochondrion mitosome/mitochondria-like organelle
  • membrane endoplasmic reticulum
  • golgi golgi
  • rhoptry dense granules
  • calcisomes or acidocalcisomes and other subcellular organelles compartments, etc.
  • the invention also comprehends a cell or cells containing the nucleic acids and/or the amino acid sequences of the invention.
  • the cell may be a host cell that harbors one or more vectors containing nucleic acid sequences of the invention (e.g. DNA or RNA) and/or amino acid sequences of the invention translated from such vectors.
  • Such cells may contain multiple vectors, and the vectors may be the same or different.
  • the cells may be either in vitro or in vivo.
  • the invention also provides antibodies directed to the amino acid sequences of the present invention.
  • the term "antibody" refers to a polypeptide or group of polypeptides composed of at least one antibody combining site.
  • an “antibody combining site” is the three-dimensional binding space with an internal surface shape and charge distribution complementary to the features of an epitope of an antigen, which allows binding of the antibody with the antigen.
  • Antibody includes, for example, vertebrate antibodies, hybrid antibodies, chimeric antibodies, humanised antibodies, altered antibodies, univalent antibodies, Fab proteins and fragments, and single domain antibodies.
  • Antibodies to the proteins of the invention, both polyclonal and monoclonal maybe prepared by conventional methods that are well-known to those of skill in the art. If desired, the antibodies (whether polyclonal or monoclonal) may also be labeled using conventional techniques. Such antibodies may be used, for example, for affinity chromatography, immunoassays, and for distinguishing or identifying C.
  • the invention also comprehends pharmaceutical compositions.
  • the pharmaceutical compositions can comprise polypeptides, antibodies, or nucleic acids of the invention, or combinations of these.
  • the pharmaceutical compositions will comprise a therapeutically effective amount of a polypeptide, antibody, or polynucleotide of the invention.
  • therapeutically effective amount refers to an amount of a therapeutic agent that is sufficient to treat, ameliorate, or prevent a desired disease or condition, or to exhibit a detectable therapeutic or preventative effect.
  • an effective dose will be from about 0.01 mg/kg to 50 mg/kg or about 0.05 mg/kg to about 10 mg/kg of active, therapeutic agent.
  • a pharmaceutical composition can also contain a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable carrier refers to a carrier for administration of a therapeutic agent, such as antibodies or a polypeptide, genes, and other therapeutic agents. Suitable carriers maybe large, slowly metabolized macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, and inactive virus particles. Such carriers are well known to those of ordinary skill in the art.
  • Pharmaceutically acceptable salts can be used therein, for example, mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like.
  • mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like
  • organic acids such as acetates, propionates, malonates, benzoates, and the like.
  • pharmaceutically acceptable carriers in therapeutic compositions may contain liquids such as water, saline, glycerol and ethanol. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present in such vehicles.
  • the therapeutic compositions are prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection may also be prepared. Liposomes are included within the definition of a pharmaceutically acceptable carrier.
  • compositions of the invention can be administered to the subject.
  • the subjects to be treated can be animals; in particular, human subjects can be treated.
  • Direct delivery of the compositions will generally be accomplished by inj ection, either subcutaneously, intraperitoneally, intravenously or intramuscularly or delivered to the interstitial space of a tissue.
  • the compositions can also be administered into a lesion.
  • Other modes of administration include oral and pulmonary administration, suppositories, and ' intranasal, transdermal or transcutaneous applications (eg. see WO98/20734), needles, and gene guns or hyposprays.
  • Dosage treatment may be a single dose schedule or a multiple dose schedule.
  • the present invention also encompasses vaccines that provide immunity to disease caused by C. hominis.
  • immuno we mean that administration of one or more proteins, polypeptides or peptides of the present invention to an individual either prevents the development of disease symptoms in that individual when exposed to or infected by C. hominis, or the disease symptoms that develop in the individual are milder than those that would otherwise develop, for example, the disease symptoms that would develop in a matched control individual.
  • controls when comparing results of individuals or populations that have been exposed to different variables (e.g. vaccinated or not).
  • the vaccine may either be prophylactic (i.e. to prevent or attenuate symptoms of infection) or therapeutic (i.e. to treat disease after infection).
  • Such vaccines comprise one or more of: immunizing antigen(s), immunogen(s), polypeptide(s), protein(s) and nucleic acid(s) from C. hominis (as described herein), usually in combination with "pharmaceutically acceptable carriers,” which include any carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition.
  • Suitable carriers are typically large, slowly metabolized macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, lipid aggregates (such as oil droplets or liposomes), and inactive virus particles. Such carriers are well known to those of ordinary skill in the art. Additionally, these carriers may function as immunostimulating agents ("adjuvants"). Furthermore, the antigen or immunogen may be conjugated to a bacterial toxoid, such as a toxoid from diphtheria, tetanus, cholera, H. pylori, etc. pathogens.
  • a bacterial toxoid such as a toxoid from diphtheria, tetanus, cholera, H. pylori, etc. pathogens.
  • Preferred adjuvants to enhance effectiveness of the composition include, but are not limited to: (1) aluminum salts (alum), such as aluminum hydroxide, aluminum phosphate, aluminum sulfate, etc; (2) oil-in-water emulsion formulations (with or without other specific immunostimulating agents such as muramyl peptides (see below) or bacterial cell wall components), such as for example (a) MF59TM (WO 90/14837; Chapter 10 in Vaccine design: the subunit and adjuvant approach, eds.
  • aluminum salts alum
  • oil-in-water emulsion formulations with or without other specific immunostimulating agents such as muramyl peptides (see below) or bacterial cell wall components
  • MF59TM WO 90/14837
  • Span 85 containing various amounts of MTP-PE (see below), although not required) formulated into submicron particles using a microfluidizer such as Model HOY microfluidizer (Microfluidics, Newton, Mass.), (b) SAF, containing 10% Squalane, 0.4% Tween 80, 5% pluronic-blocked polymer L121, and thr-MDP (see below) either microfluidized into a submicron emulsion or vortexed to generate a larger particle size emulsion, and (c) RibiTM adjuvant system (RAS), (Ribi Irnmunochem, Hamilton, Mont.) containing 2% Squalene, 0.2% Tween 80, and one or more bacterial cell wall components from the group consisting of monophosphorylipid A (MPL), trehalose dimycolate (TDM), and cell
  • MPL monophosphorylipid A
  • TDM trehalose dimycolate
  • interferons eg. gamma interferon
  • M-CSF macrophage colony stimulating factor
  • NF tumor necrosis factor c[NF]
  • other substances that act as immunostimulating agents to enhance the effectiveness of the composition.
  • Alum and MF59TM are preferred.
  • the immunogenic compositions typically will contain diluents, such as water, saline, glycerol, ethanol, etc. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, maybe present in such vehicles.
  • the immunogenic compositions are prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection may also be prepared. The preparation also may be emulsified or encapsulated in liposomes for enhanced adjuvant effect, as discussed above under pharmaceutically acceptable carriers.
  • Immunogenic compositions used as vaccines comprise an immunologically effective amount of the antigenic or immunogenic polypeptides, as well as any other of the above- mentioned components, as needed.
  • immunologically effective amount it is meant that the administration of that amount to an individual, either in a single dose or as part of a series, is effective for eliciting the production of antibodies, for eliciting a cellular immune response, (or both), and/or for treatment or prevention of disease. This amount varies depending upon the health and physical condition of the individual to be treated, the taxonomic group of individual to be treated (e.g.
  • the immunogenic compositions are conventionally administered parenterally, eg. by injection, either subcutaneously, intramuscularly, intranasally, or transdermally/transcutaneously. Additional formulations suitable for other modes of administration include oral and pulmonary formulations, suppositories, and transdermal applications. Dosage treatment may be a single dose schedule or a multiple dose schedule.
  • the vaccine may be administered in conjunction with other immunoregulatory agents.
  • DNA vaccination maybe employed [eg. Robinson & Torres (1997) Seminars in Immunology 9:271-283; Donnelly et al. (1997) Annu Rev Immunol 15:617-648].
  • the proteins that are used in an immunogenic preparation or vaccine of the present invention include at least one of the proteins represented by SEQ ID NOS: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 (see Example 2 below).
  • the present invention also provides tools and methods for the diagnosis of C. hominis infections.
  • Such tools include primers containing nucleotide sequences that specifically hybridize to nucleic acid sequences that are unique to the genome of the C. hominis species. Hybridization of the primers to such a unique sequence permits amplification of the unique sequence (for example, by polymerase chain reaction (PCR)), thus providing a means to specifically identify the presence of C. hominis in biological samples (blood, feces, sputum, urine, bronchoaveloar lavage, etc.). Amplification may be directly from the genome of the organism located in the sample, or from RNA, e.g.
  • rRNA ribosomal RNA
  • primer we mean a nucleotide sequence that hybridizes to another nucleotide sequence of interest, the primer typically being a relatively short nucleotide sequence (e.g. from about 10 to about 100 base pairs) and the nucleotide sequence of interest typically being transcribed from the genome of an organism. PCR amplification techniques are well- known to those of skill in the art
  • primers are selected that target sites that flank the sequence of interest for diagnostics or identification. These primers are designed to recognize only the target sequence; i.e., they will hybridize only to the target sequence and to no other sequences. Thus, the sequence is screened against all other known sequences to ensure that there is no other known sequence to which it will hybridize.
  • the primers generally range from 18-30 nucleotides in length (but can be longer or shorter), have Tm' s (melting temperatures) that are selected to be compatible with both amplification conditions and with specificity, have little or no internal structure (stem-loop structures caused by internal complementarity), little or not ability to dimerize with themselves, little or no ability to dimerize with the other primer, have few homopolymeric stretches, etc.
  • an internal fluorescent probe is also included for specific use in even more sensitive and automated tests.
  • the internal probe is fluorescently labeled such that it is specifically degraded and therefore fluoresces only if it specifically hybridizes to the target sequence.
  • other fluorescent probes can be designed that only fluoresce upon binding specifically to an amplified specific sequence.
  • a positive amplification result is indicative of the presence of C. hominis in the biological sample, and thus of infection by C. hominis.
  • the present invention by elucidating the entire genome of C. hominis, allows the design of a much larger number of such primers. Further, primers provided by the present invention hybridize to sequences that are highly diverse from species closely related to C. hominis. Thus, the accuracy of the diagnostic methods of the present invention are superior to those of the prior art, resulting in very few false positives, and very few missed diagnoses.
  • the present invention also provides arrays of nucleotide or modified nucleotide, or protein or modified protein sequences, or antibodies to the nucleotides or proteins, for use as probes for assessing the presence or absence of genes, the expression of specific genes, the presence or absence of proteins or immune responses in C. hominis or other Cryptosporidium species, hi particular, the arrays of the invention may be used to specifically assess the differential expression of genes any of the various stages of the life cycle of C. hominis, for example, during the sporozoite stage, hi order to do so, a biological sample containing C. hominis parasites at a particular stage of development is provided and analyzed using the array. Alternatively, such arrays may be used to monitor C.
  • the arrays can be used for comparative genome analyses in which the presence or absence of specific genes are probed in different isolates of Cryptosporidium. In order to do so, DNA from the isolate of interest is analyzed using the array. Presence or absence of a particular gene is assessed via hybridization.
  • the array can also be designed to detect specific polymorphisms in genes that have clinical or other relevance. This approach can have diagnostic and clinical importance, or other relevance to infection, treatment or contamination (e.g., water contamination with C. hominis is much more serious than water contamination with other species of
  • the nucleotide probes (usually DNA or a derivative thereof) in an array typically have a length in the range of about 50 to about 90 nucleotides, and preferably about 60 to about 80 nucleotides, and most preferably the probes have a length of about 70 nucleotides.
  • These arrays can be comprehensive; i.e., be comprised of probes for all genes/ gene sequences in a genome, or targeted to specific subsets of genes/ gene sequences, depending on the application.
  • Peptides, proteins or derivatives thereof can also be used in similar arrays, hi this case, synthetic peptides, proteins (recombinant or otherwise) or derivatives are designed from the gene sequences (Table 1 and others) and used in the array. Again, these peptide/protein arrays can be of various lengths (number of amino acids or derivatives), and they can be comprehensive and include probes for all genes
  • nucleotide arrays interactions are usually detecting complementary sequences in a sample by hybridization.
  • protein/ peptide arrays and in some cases for nucleotide arrays, the array will be used for detection of interacting macromolecules (proteins, antibodies, other nucleic acids, etc.).
  • the -9.2 Mb genome of C. hominis is described.
  • the genome has 32% GC content, -3,994 protein-coding genes, 45 tRNAs, and at least four rRNAs.
  • Energy is derived largely from glycolysis and catabolism of starch or amylopectin.
  • Options for both aerobic and anaerobic metabolism are available, the latter requiring an alternative electron transport system in a simplified mitochondrion.
  • Biosynthesis capabilities are quite limited, but an extensive complement of transporters is encoded.
  • a ⁇ 12 fold sequence and ⁇ 8 fold BAC clone coverage of the genome of C. hominis isolate TU502 l is presented. Alignment 2 of these sequences with the HAPPY map 3 and chromosomes of the C. parvum genome 4 covered -9.1 Mb of the -9.2 Mb. The eight chromosomes range from -0.9 - -1.4 Mb, and exhibit 31.7% GC content compared to 30.3% and 19.4% for C. parvum and P. falciparum 5 . The density of repeats of 2-50 bp was approximately one per 2800 bp.
  • C. hominis possesses a highly tailored glycolysis-based metabolism dependent on the host for nutrients and extraordinarly adapted for its parasitic life cycle (see Figure 1). Glycolytic enzymes are present, but the TCA cycle and oxidative phosphorylation (OxPhos) are not.
  • NADP + oxidoreductase (PNO) and an aerobic pathway using an alternative oxidase (AOX) are available for recycling NAD + to NADH.
  • pyruvate is fermented to acetyl-CoA producing NADPH which is then reduced to NADP + , releasing hydrogen, by a Narf like [FE]-hydrogenase, as for Trichomonas 6 .
  • Acetyl- CoA is processed by acetate CoAsynthase to produce acetate and ATP, as in Giardia ⁇ , yielding four ATP per glucose.
  • Acetyl-CoA can also be processed to ethanol yielding no additional ATP. Under glucose-limited conditions, conversion of acetyl-CoA to acetate, generating two extra ATP per glucose, might be favored. In excess glucose, pyruvate can be converted to lactate or ethanol to regenerate NAD + but no additional ATP. C. hominis can also generate ATP by metabolism of glycerol using glycerol-3-phosphate dehydrogenase and triose phosphate isomerase.
  • C. hominis can convert pyruvate to malate and subsequently to oxaloacetate (OAA), regenerating NAD + .
  • malate shuttle enzymes e.g., aspartate amino transferase
  • cytoplasmic malate may be converted to OAA by a mitochondrial membrane bound malate dehydrogenase, like the lactate shuttle of Euglena gracilis 8 , passing electrons from malate to an electron transport system comprised of elements of Complexes I and in and an alternative oxidase system (AOX) with O 2 as electron acceptor and producing no additional ATP.
  • AOX alternative oxidase system
  • Enzymes for metabolism of glycogen, starch and amylopectin are present, consistent with suggestions that amylopectin represents an energy reserve for sporozoites 9 .
  • Lack of glucose-6-phosphate-l -dehydrogenase and other enzymes of the pentose phosphate pathway suggests that, unlike P. falciparum and other apicomplexans 10 , C. hominis cannot metabolize five-carbon sugars or nucleotides.
  • Components of beta-oxidation e.g., enoyl-
  • CoA hydratase and acetyl-CoA C-acyltransferase are also absent, precluding ATP generation from fatty acids. Enzymes for catabolism of proteins are also absent.
  • Major TCA cycle enzymes ⁇ isocitrate dehydrogenase, succinyl-CoA synthetase, succinate dehydrogenase — are absent in C. hominis.
  • ubiquinol-cytochrome C reductase NADH dehydrogenase (ubiquinone), H(+)-transporting ATPase, iron-sulfur cluster-like proteins, etc.
  • key components of Complexes II and IV are absent, precluding ATP generation by OxPhos.
  • Components of OxPhos that are present probably re-oxidize NADH in a simplified electron-transport chain, as in some plants and protozoa n . Biosynthesis.
  • Cryptosporidium lack enzymes for synthesis of key biochemical building blocks — simple sugars, amino acids and nucleotides.
  • starch, amylopectin and fatty acids can be generated from precursors.
  • these C. hominis enzymes exhibit minimal similarity to the known biosynthetic enzymes and therefore represent potential therapeutic targets.
  • Enzymes of the TCA, urea and nitrogen cycles, and the shikimate pathway are absent, suggesting that Cryptosporidium is an amino acid auxotroph.
  • the shikimate pathway has been proposed as a potential target for glyphosate-based chemotherapy in other parasites including Cryptosporidium 13 .
  • Enzymes able to interconvert amino acids are encoded in C. hominis.
  • P. falciparum 5 unlike P. falciparum 5 ,
  • C. hominis seems to have a full complement of amino acid transporters.
  • C. hominis lacks enzymes to synthesize bases or nucleosides, but encodes enzymes that convert nucleosides into nucleotides and interconvert nucleotides.
  • thymidylate synthase and dihydrofolate reductase (DHFR) of C. hominis are encoded as a bifunctional polypeptide, and novel polymorphisms at crucial sites have been proposed to explain Cryptosporidium 's resistance to antifolates (c.f. 14).
  • DHFR dihydrofolate reductase
  • Fatty acid biosynthesis in apicomplexans occurs in the apicoplast via a type II system including fatty acid synthase (FAS) 15 .
  • FOS fatty acid synthase
  • C. hominis encodes large FAS and polyketide synthase (PKS) enzymes, suggesting a type I mechanism (c.f. 17).
  • PKS polyketide synthase
  • the type I FAS and PKS enzymes of C. hominis have prokaryotic characteristics.
  • Glycerolipid and phospholipid metabolic pathways for phosphatidylinositol (PI) biosynthesis are available in C. hominis. 1,2-diacylglycerol, an intermediate, is precursor for glycosylphosphatidylinositol (GPI) anchor synthesis. Consistent with previous observations 19 , all enzymes required for synthesis of these anchors are encoded in the genome.
  • Polyamines e.g., putrescine, spermine and spermidine
  • Cryptosporidium can synthesize polyamines using arginine decarboxylase rather than ornithine decarboxylase 21 .
  • the putative arginine decarboxylase, spermidine synthase and other relevant enzymes encoded by C. hominis are significantly diverged from their homologs and represent potential therapeutic targets. Signaling and control pathways
  • C. hominis encodes adenylate cyclase, cAMP phosphodiesterase and protein kinase A, suggesting the presence of the cAMP-mediated signalling pathway (Tab.S7).
  • Trimeric G protein often involved in activation of cAMP mediated signalling, was not found in C. hominis, suggesting that, as for the Kinetoplastida 22 and pronounced of plants, this pathway is independent of this complex in C. hominis.
  • the presence of phosphatidylinositol 3-kinase and phospholipase C suggests that C. hominis utilizes phosphatidylinositol phosphate and Ca 2+ -mediated regulatory mechanisms.
  • C. hominis like another obligate intracellular parasite, the microsporidian Encephalitozoon cuniculi 26 , contains a minimal set of these proteins. These results imply significant mitochondrial function in C. hominis, and that the previously reported organelle 27 is an atypical mitochondrion.
  • Cryptosporidium apparently lacks an apicoplast 16>28 , and searches of the C. hominis genome identified no clear apicoplast-encoded genes.
  • Some putative nuclear-encoded apicoplast genes e.g., T. gondii acetyl-CoA carboxylase 1 precursor 29 , and P. falciparum adenylyl cyclase 30 , are present.
  • D-glucose-6-phosphate ketol-isomerase and 2- phospho-D-glycerate hydrolase that have highest similarity to plant genes and may be derived from ancient algal endosymbionts 31 is also suggestive that engulfment of the alga that gave rise to the apicoplast 32 preceded divergence of Cryptosporidium from other apicomplexans.
  • the C. hominis genome encodes multiple proteins specific for components of the apical complex including micronemes and rhoptries. No specific dense granule-associated proteins were observed, probably because these proteins diverge rapidly 33 . However, proteins implicated in the regulation of transport and enhancement of release of dense granule proteins 34 are present.
  • ER-Golgi-organelle machinery As for Plasmodium, a typical Golgi structure is not apparent in C. hominis 28 .
  • the presence of secretory organelles implies the existence of a functional endoplasmic reticulum (ER) and Golgi, and C. hominis encodes proteins similar to many related components; including the NSF/SNAP/SNARE/Rab machinery which participates in dense granule release 35 and the rhoptry biogenesis mediator AP-1 36 , involved in ER-Golgi-organelle protein traffic. Therefore, the ER-Golgi-organelle machinery of C. hominis is conserved and similar to that of other apicomplexans. Transporters.
  • C. hominis exhibits very limited biosynthetic capabilities and is apparently supremely dependent on its ability to import essential nutrients.
  • the genome encodes >80 genes with strong similarity to known transporters and several hundred genes with transporter-like properties. At least twelve sugar or nucleotide-sugar transporters, five putative amino acid transporters, three fatty acid transporters, 23 ABC family transporters including possible multiple drug resistance proteins 37 , and several putative mitochondrial transporters are present. Other putative transporters for choline uptake, aminophospholipid transport, ATP/ADP transporters, and others with unclear function, were also identified. These transporters represent ideal therapeutic targets. Comparison of C. hominis and C. parvum genomes.
  • a striking feature of the C. hominis genome is the concordance between its gene complement and metabolic requirements in the environmental niches of its two primary life cycle stages — the quiescent oocyst in the nutrient-poor aerobic environment of contaminated water, and the vegetative parasites in the nutrient-rich anaerobic or microaerophilic environment of the host. Oocysts probably persist by processing stores of complex carbohydrates. Metabolism is likely aerobic via the alternative electron transport system in the unconventional mitochondrion.
  • oocysts are relatively inactive, and the two ATP per glucose from glycolysis may provide sufficient energy.
  • the parasite can import sugars to directly fuel glycolysis, netting two ATP per hexose.
  • an additional two ATP per hexose can be generated by converting acetyl-CoA to acetate or via glycerol metabolism.
  • the residual mitochondrion lacks the TCA cycle and OxPhos as expected in an organism that replicates in the anaerobic / microaerophilic environments, and a simplified electron transport system for regenerating reducing power is available. Thus, a glycolysis-based metabolism is sufficient to support Cryptosporidium in all life cycle stages.
  • Cryptosporidium metabolism also consistent with the highly tailored Cryptosporidium metabolism are its limited biosynthetic options; i.e., amino acids, nucleotides, and simple sugars cannot be synthesized.
  • the parasite must import these building blocks probably explaining the significant array of transporters present in the genome.
  • apicoplast-specific activities are lacking in Cryptosporidium.
  • acquisition of the type 1 FAS by a progenitor organism obviated the fatty acid synthesis capabilities of the apicoplast 38 . Since some apicoplast-related genes remain, our observations suggest that Cryptosporidium diverged from other apicomplexans prior to loss of this organelle.
  • Cryptosporidium is a mosaic of sequences from diverse progenitors, including the hypothetical endosymbiont alga which formed the apicoplast, the mitochondrion, and numerous genes acquired from prokaryotes by lateral transfer. Cryptosporidium also exhibits modular gene loss. We assume, based on inference from other apicomplexans and earlier diverging groups like the Euglenozoa, the Heterolobosea, and the jakobids 39 , that Cryptosporidium progenitors exhibited the TCA cycle, beta-oxidation, OxPhos, amino acid, nucleotide and sugar biosynthesis, fully competent mitochondria, and a functional apicoplast.
  • C. hominis The highly tailored physiology of C. hominis suggests attractive therapeutic targets .
  • Examples include: 1) transport systems for peptides, amino acids, nucleosides, and sugars, 2) components of glycolysis; 3) the unique prokaryotic FASl and PKSl; 4) starch and amylopectin biosynthesis or catabolism; 5) nucleic acid or amino acid metabolism; 6) the AOX electron transport system; 7) the TS-DHFR; and 8) the diverged polyamine synthesis enzymes.
  • Genomic sequences from pathogenic microorganisms provide fundamentally new approaches for development of vaccines and chemotherapeutic agents.
  • reverse vaccinology invokes bioinformatics analyses to identify potential candidates from the genome data by "in silico" analysis.
  • This approach has been successfully applied to identify putative vaccine candidates from bacterial genomes that traditional vaccine development methods have not detected.
  • This approach (see Scarsellie et al, 2005, for review) has recently been applied in several bacterial systems including for example group B streptococci and Neisseria meningitidis.
  • Hood DW Jeffries AC, Saunders NJ, Granoff DM, Venter JC, Moxon ER, Grandi G, Rappuoli R. Identification of vaccine candidates against serogroup B meningococcus by whole-genome sequencing. Science. 2000 Mar 10;287(5459):1816-20.
  • C. hominis lacks genes and consequently the enzymes and metabolic pathways required for several essential functions: e.g. biosynthesis of simple sugars, amino acids, nucleotides, fatty acids, etc. Thus, these important pathogens are dependent on their environment or host for these essential compounds, and these compounds must be transported across the parasite's membrane by a host of essential transporters. A list of these transporters is given in Table 3.
  • transporters must function at the host-parasite interface; i.e., the parasite membrane exposed to the extracellular domain. This exposed location makes these molecules ideal targets for immunoprophylaxis or immunotherapy.
  • Vaccines developed against these proteins could: 1) protect relevant human populations or animal populations; 2) provide a means to treat infections.
  • active or passive immunization against pools of these proteins could: 1) prevent infection; 2) provide a therapy for the cryptosporidiosis.
  • the therapeutic effect could result from: 1) killing the parasite via normal immune mechanisms activated by immunization; 2) blocking the activity of the molecule via immune mechanisms and thereby starving the parasite until it is cleared by normal mechanisms.
  • transporters are ideal targets for vaccines, and could be used for both immuno-prophylaxis and immuno ⁇ therapy.
  • Receptors are essential for cell-cell signalling, sensing of the environment, host parasite interactions, uptake of essential nutrients, etc. Receptors by definition are located on the membrane surface in some contact with the extracellular environment. A list of C. hominis receptors is given in Table 4. Blocking of the function of these macromolecules would likely be lethal to the parasite. The extracellular location of these receptors renders them available for attack by the host or passive immune mechanisms, and available for chemotherapeutics unable to cross most membranes. Thus, receptors are excellent targets for immuno-prophylaxis and therapy, or chemotherapy.
  • C. hominis is a member of the Apicomplexan parasites, and therefore encodes genes that generate apical complex organelles responsible for invasion and pathogenesis of the parasites, and other organelles required for its survival.
  • a list of genes which are involved in organellar biosynthesis and function is given in Table 6. Since these organelles, systems and enzymes are specific to these parasites, they represent ideal targets for therapeutics. Signal transduction proteins and kinases. These proteins are required for proper, responsive and sensitive gene regulation in the parasite. Lacking the function of these proteins and enzymes, the parasites are unable to respond to their environment properly, or to differentiate correctly. Therefore, these enzymes are required for the viability of this parasite and thereby represent ideal targets for therapeutic (chemo- or irnmuno-) attack. A list of these proteins and enzymes is given in Table 7.
  • hominis genes disclosed herein and the proteins they encode are newly discovered and have not been used as targets for possible immunotherapeutic purposes, or as targets for chemotherapeutic agents, or as tools for detection/diagnosis of the parasites. As outlined above, there is no irnmuno- or chemotherapy available for C. hominis. It is essential to develop such therapies.
  • the newly identified genes and the proteins they encode provide a new approach to chemo- and/or immunotherapy. Their advantages include one or more of the following:
  • proteins /peptides thereof can be synthesized chemically or in recombinant bacteria
  • the peptides differ significantly from host molecules (both host and parasite homologs have been fully sequenced), and analogs that block the parasite version can be designed so that they do not block any host function.
  • vaccinogens can be designed so that the host immune response will act only on the parasite protein.
  • Genome Annotation The DNA sequence of C. hominis was annotated using a suite of analysis programs to identify important genes. Protein genes and their structural and functional annotations were derived. Approximately 4,000 genes were identified Table 1). Similarly, structural KNA genes (tRNA, rRNA) were identified (not shown). Vaccinology.
  • One focus of research in the Cryptosporidium vaccinology project has been application of "in silico" genome analysis to identify potential vaccine candidates from the complete genome sequence of Cryptosporidium hominis. The general steps that are followed are: 1. Apply bioinformatics tools to predict possible antigens from the whole genomic sequence.
  • the initial step was to apply bioinformatic tools to scan the whole genome sequence of C. hominis focusing on proteins that are predicted to be secreted, ER localized, surface-exposed and/or contain antigenic motifs, and that therefore represent potential vaccine targets. Since these proteins are most likely to be exposed to the immune system, they constitute the initial target of the project.
  • the best antigens for vaccines are likely to be those associated with the membrane during sporozoite stages in the development of the parasite.
  • the sporozoite form of the parasite is responsible for invasion of the intestinal epithelium causing pathology.
  • a microarray that targets every gene in the C. hominis genome has been generated. The arrays are used to identify those genes that are expressed in C. hominis sporozoites. These arrays detect mRNAs transcribed from the genes. Therefore, in parallel with the gene expression array work, proteomics analyses are performed. A database containing all C. hominis proteins has been constructed, and C. hominis oocysts and sporozoites are analyzed for those proteins that are expressed in those stages of the parasite. This information permits identification of proteins for vaccinogens.
  • the array in its current configuration consists of -4,000 70 base synthetic oligonucleotides bound to glass slides.
  • Each of the -4,000 C. hominis genes is represented by a single, specific oligonucleotide in the array.
  • Li order to assess expression of these genes in a specific stage a biological sample containing C. hominis parasites at that stage of development is provided.
  • Total RNA is isolated by standard technology, labeled with fluorescent dyes, and hybridized to the array.
  • a similar RNA sample derived from an alternative stage of the parasite's life cycle is used is labeled with an althenative fluorescent dye and used as a control.
  • Both labeled RNAs are hybridized to the same oligonucleotide array, and the arrays are washed and scanned in a fluorescence scanner.
  • the readout of the scanner provides an estimate of the amount of RNA for each gene that is present in the initial sample and a comparison between the two samples provides an estimate of the relative expression level of each gene in the two samples.
  • genes that are up or down regulated relative to the control can be identified.
  • these arrays may be used to monitor C. hominis parasites under other conditions of interest, for example, to monitor gene expression in response to an external stimulus or variable, such as introduction of a drug or other agent into a culture of the parasites; or to monitor the course of a C. hominis infection, either in culture, or in an infected individual.
  • the 70 base oligonucleotides in the array were designed by ArrayOligoSelector" 11 version 3.8.2, (http://arrayoligosel.sourceforge.net/), which selects optimal sequences by:
  • mim ' mizes self-annealing and has GC content closest to specified by the user; also tries to minimize distance to the 3' end of the gene.
  • the oligos were synthesized commercially and validated in the lab, and the process is ongoing. Initial tests were performed as follows:
  • the oligos were reconstituted to 100 pmoles with sterile distilled water; Several dilutions (10, 25 and 50 pmoles) were tested for the best printing conditions; Two test plates were printed on Corning UltraGAPS slides (amino-silane coated); These slides were stained in SYBR Green II and hybridized with Cy-dye labeled
  • proteomics analyses have also been performed.
  • a database containing all C. hominis proteins has been constructed, and C. hominis oocysts and sporozoites are characterized for those proteins that are expressed in those stages of the parasite. This information permits us to focus on the most likely proteins for vaccinogens.
  • the cloning and expression of the candidates has been carried out using the pET system from Novagen that allows the cloning of PCR products in a ligase-independent reaction (Ek/LIC cloning).
  • the proteins of interest are expressed as fusion proteins to an epitope tag that permits their detection and purification.
  • Various tags e.g. His-Tag, GST-tag and Nus-Tag, etc.
  • the Ek/LIC cloning system can be adapted and used in a high throughput pipeline for the cloning and expression of recombinant proteins.
  • LIC The cloning of PCR products by LIC requires the presence of non-complementary single-stranded overhangs in the vector that anneal to complementary single stranded overhangs on the PCR fragment. In order to create these overhangs the LIC method uses the
  • T4 DNA polymerase 3 '-5' exonuclease activity of T4 DNA polymerase, which in the presence of a single deoxyribonucleotide creates very specific 13-14 base single stranded overhangs in both vector and PCR fragment.
  • the primers used in the PCR reaction include 5' extensions that after the treatment with T4 DNA polymerase generate the overhangs complementary in the fragment to the overhangs created in the vector.
  • Antisense primer 5' GAG GAG AAG CCC GGT- insert specific sequence 3' (SEQ ID NO: 4002) After treatment with T4 DNA polymerase in the presence of dATP the PCR fragment is flanked by the overhangs as shown below:
  • the genes encoding thirteen of these antigens were PCR amplified from genomic DNA.
  • the PCR products were purified and cloned into the vector pTriEX-4, a vector that allows the expression of the proteins as 6X-His and S-tag fusion products in both prokaryotic and eukaryotic hosts.
  • the His-tagged products can be purified through nickel- activated columns.
  • the recombinant plasmids were characterized by restriction enzyme analysis and DNA sequencing to confirm the presence of the Cryptosporidium target gene.
  • Protein overexpression The recombinant plasmids were used to transform the Escherichia coli strain BL21 (DE3) or other appropriate vector for expression of the fusion proteins.
  • the target genes are cloned into pTriEX-4 under the control of the bacteriophage T7 promoter. Transcription is initiated by the enzyme T7 RNA polymerase which is present in the chromosome of the bacterial host and is under the control of an inducible promoter. In the presence of the inductor, IPTG, T7 RNA polymerase is produced in the bacterial host resulting in the expression of the target protein.
  • T7 RNA polymerase In the presence of the inductor, IPTG, T7 RNA polymerase is produced in the bacterial host resulting in the expression of the target protein.
  • IPTG IPTG
  • T7 RNA polymerase is produced in the bacterial host resulting in the expression of the target protein.
  • the level of expression is very high and can be 50 % of the total protein present in the bacterial host.
  • the expression of the recombinant genes was carried out by culturing bacteria in 3 ml of Overnight Express Instant
  • Tb medium (Novagen) at 37 0 C for 12-13 hours. This medium is designed to achieve a high level of expression with IPTG-inducible bacterial systems without the need of monitor cell growth. Expression has been achieved for all but the Zn +"1" transporter and the Thrombospondin-containing gene TSPl. The Zn transporter seems to be toxic for E. coli as bacterial cultures containing the Zn-transporter clones start to lyse after they reach early stationary phase. Most of the proteins were expressed in E. coli in an insoluble form as inclusion bodies. The exception is the gene encoding the Profilin-like protein..
  • nucleotide sequences that encode the proteins, and amino acid sequences of the proteins are as follows:
  • Zinc transporter Chro.10338, start position 677, end position 2053 is encoded by the nucleotide sequence:
  • Ribosomal protein S19 (Chro.60368, start position 13760, end position 14197) is encoded by the nucleotide sequence: ATGGCAGATACTGAACAAAAGAAGAGAACCTTCAGAACTTATAGTTACAGAGG TGTTGACCTCGACAAGCTCCTTACCATGAAATTGGATGAGGTTGTTGAGCTTTTA
  • Mucin-like glycoprotein 900 (Chro.70447, start position 855, end position 3963) is encoded by the nucleotide sequence:
  • CP15/60 (Chro.40225, start position 10793, end position 12259) is encoded by the nucleotide sequence:
  • Thrombospondin related adhesive protein (Chro.10390, start position 4021, end position 6078) is encoded by the nucleotide sequence:
  • TSPl domain-containing protein TSP7 precursor (Chrom 60103, start position 12, end position 1982) is encoded by the nucleotide sequence: 0 ATGGATTCAATTAACTTTAGAAGCATTTATATTCCATCAGCAGTGAGGTATATTA TATTACTTTTATTATGGACAATATTTACAAAAAATGTTTATAGTGAAAGTAGTGA AGAAACTTTATTGGGAAGATCAGTATTGGATTTAAACAAGAAAAATACATGTGA ATACTATGGAGAGCAGGATGGTATGTTTACTGATTCATTTCATTCAAGAATATGT ATAGTTCCAGAAGATGGATTACATGGAAAAAGGGAATATGAAAATCATCAAAA AAAAACATTTGGAACAATTAGACCAAATAATAAACAATTATCTGATAATAAATT
  • AGAATTTATATAG (SEQ DD NO. 13)
  • ABC transporter ATP-binding protein (Chro.70309, start position 5325, end position 7046) is encoded by the nucleotide sequence:
  • Sporozoite cysteine-rich protein (Chro.60102, start position 11337, end position 12380) is encoded by the nucleotide sequence: ATGTTAGAATTTAGACAATATGATTTAAAGTTTATGAAAATGAAAAGAATTTTG
  • 19K sporozoite antigen "profilin” (Chro.30189 start position 2297, end position 2785) is encoded by the nucleotide sequence:
  • C. hominis proteins have been overexpressed in E. coli and isolated, and are tested in model systems to examine their abilities to induce a protective immune response.
  • Animal models of Cryptosporidium infection have demonstrated the role of both cell and humoral immune responses (1, 2).
  • mice with targeted disruptions of genes encoding immunological important molecules have established the role of these proteins in the immune response against Cryptosporidum (1-7).
  • Other studies of the immune response against Cryptosporidium use neonatal mice and mice lacking functional T or B cell responses (1, 8, 9). These studies have demonstrated how an immune response is induced in mice that are not immuno-competent.
  • IFN ⁇ Interferon Gamma
  • mice are divided in groups: Group I mice are immunized with a pool of recombinant antigens (or plasmids in the case of DNA vaccine) in adjuvant (Freund's or other as appropriate); Group II (control animals) are immunized with Freund's adjuvant alone (or plasmid with no insert in the case of a DNA vaccine). The immunological responses in each group are followed and the response to challenge is measured.
  • a sample immunization schedule is outlined below:
  • Day 0 Immunization with a pool of recombinant antigens (2-3 ⁇ g each), DNA (20-100 ⁇ g) or controls. Immunization is performed intraperitoneally or intranasally.
  • Serum samples are collected at day 0, 7, 14 and 28 to monitor the immune response.
  • Antibody levels against fusion proteins and Cryptosporidium extract are measured by immunoblotting and indirect immunofluorescence.
  • Fecal IgA responses are measured before and after vaccination and infection.
  • Fecal shedding of Cryptosporidium is monitored by fluorescent microscopy and real time PCR three times per week after infection
  • Cytokine and lymphoproliferation responses are examined by isolation of mesenteric lymphocyte node and spleen cells to detect cytokine responses and lymphoproliferation against antigens (those that can be purified) and against a Cryptosporidium preparation.
  • IL-4 protects adult C57BL/6 mice from prolonged Cryptosporidium parvum infection: analysis of CD4+alpha beta+IFN- gamma+ and CD4+alpha beta+IL-4+lymphocytes in gut-associated lymphoid tissue during resolution of infection. J Immunol. 1998. 161: 1891-900. 16: Lehmann J, Enssle KH, Lehmann I, Emmendorfer A, Lohmann-Marthes ML. The capacity to produce IFN-gamma rather than the presence of interleukin-4 determines the resistance and the degree of susceptibility to Leishmania donovani infection in mice. J Interferon Cytokine Res. 2000.
  • the process for development of these agents includes the following steps:
  • Examples of such 'critical elements' include transporters for essential nutrients (ions, amino acids, nucleotides, sugars, etc.) for which no substitute is available, essential steps in energy metabolism (e.g., glycolysis, regeneration of NADP, etc.), intermediary metabolism (e.g., carbohydrate anabolism and catabolism), biosynthesis (nucleotide interconversion, amino acid interconversion, synthesis of amylopectin, fatty acid biosynthesis), and other essential pathways.
  • essential nutrients ions, amino acids, nucleotides, sugars, etc.
  • energy metabolism e.g., glycolysis, regeneration of NADP, etc.
  • intermediary metabolism e.g., carbohydrate anabolism and catabolism
  • biosynthesis nucleotide interconversion, amino acid interconversion, synthesis of amylopectin, fatty acid biosynthesis
  • the 3D structures are used in 'rational drug design' to identify categories of potentially inhibitory compounds.
  • the zinc transporter see above as a focus of these investigations.
  • Cryptosporidium like all living organisms, requires divalent cations like zinc. This compound must be actively imported into the cell. In the absence of zinc, or if the organism is unable to import it from its surroundings, Cryptosporidium will die.
  • Plasmid DNA was also isolated using the EndoFree plasmid Giga Kit (Qiagen) and is used as an antigen to be injected in mice to test their protective role against Cryptosporidium.
  • Animal models of Cryptosporidium infection have demonstrated the role of both cell and humoral immune responses (1, 2).
  • mice with targeted disruptions of genes encoding immunological important molecules have established the role of these proteins in the immune response against Cryptosporidum (1-7).
  • Other studies of the immune response against Cryptosporidium use neonatal mice and mice lacking functional T or B cell responses (1, 8, 9). These studies have demonstrated how an immune response is induced in mice that are not immuno-competent.
  • IFN ⁇ Interferon Gamma
  • the IFN knockdown mouse model follows a pattern of infection very similar to that seen in severe clinical infections (10). During the infection the animals lost weight and then regained it during recovery. This is also similar to what is observed in metabolically stressed children during and after diarrheal diseases. The predominant site of infection was the small intestine as it has been observed in animal and human severe infections. No parasites can be detected by day 30, thus the level of infection achieved is enough to generate an immune response, which also it is demonstrated by the detection of cellular responses against
  • Cryptosporidium antigen extracts and proteins with lymphocytes obtained from the treated animals.
  • this model offers the possibility to study the potential role of Cryptosporidium as the animal can mount a parasite specific immune response (10).
  • mice are divided in groups: Group I mice are immunized with a pool of recombinant antigens (or plasmids in the case of DNA vaccine) in adjuvant (Freund's or other as appropriate); Group II (control animals) are immunized with Freund's adjuvant alone (or plasmid with no insert in the case of a DNA vaccine). The immunological responses in each group are followed and the response to challenge is measured.
  • a sample immunization schedule is outlined below:
  • Day 0 Immunization with a pool of recombinant antigens (2-3 ⁇ g each), DNA (20-100 ⁇ g) or controls. Immunization is performed intraperitoneally or intranasally.
  • Serum samples are collected at day 0, 7, 14 and 28 to monitor the immune response.
  • Antibody levels against fusion proteins and Cryptosporidium extract are measured by immunoblotting and indirect immunofluorescence.
  • Fecal IgA responses are measured before and after vaccination and infection.
  • Fecal shedding of Cryptosporidium is monitored by fluorescent microscopy and real time PCR three times per week after infection
  • Cytokine and lymphoproliferation responses are examined by isolation of mesenteric lymphocyte node and spleen cells to detect cytokine responses and lymphoproliferation against antigens (those that can be purified) and against a Cryptosporidium preparation.
  • IL-4 protects adult C57BL/6 mice from prolonged Cryptosporidium parvum infection: analysis of CD4+alphabeta+IFN-gamma+ and CD4+alpha beta+IL-4+lymphocytes in gut-associated lymphoid tissue during resolution of infection. J Immunol. 1998. 161: 1891-900.
  • C. hominis infection are very difficult and are typically based on microscopic examination (of water supplied or stool, etc.).
  • a small number of previously characterized genes are now used for detection and diagnosis. These genes differ from their homologs in closely related parasites and therefore form the basis of a genetic signature.
  • current protocols are limited in scope and could result in errors in identification.
  • the signature nucleotide sequences are unique to C. hominis (see Table 9) . Detection of the unique, signature sequences using nucleotide probes specific for them, provides a highly reliable method of detecting the presence of C. hominis in a biological sample, and thus for the diagnosis of a C. hominis infection.
  • Cryptosporidium are common in the environment and small quantities of the organism in water samples or in fecal samples are not uncommon.
  • Table 9 it is possible to both specifically identify and to accurately quantify levels of Cryptosporidium in essentially any biological or environmental sample.
  • RT-PCR Real time PCR
  • oligonucleotide primers and probes specific for sequences of Cryptosporidium small subunit ribosomal RNA gene and the pyruvate kinase genes were designed (4,5) using Primer Express® version 2.0 software. These sequences were selected among the many available in Table 9 because of historical precedent. However, nearly all of the sequences described in Table 9 could be used by one trained in the art as specific targets in these analyses.
  • the primers are synthesized without modified bases or labels.
  • the probes are synthesized with 5' end linked FAM (6-carboxyfluoresceine) and 3' end fluorescent TAMRA (6-carboxytetramethylrhodamine) dyes. These fluorescent dyes are commonly used for TaqMan® assay system technology, but many other labeling systems are equally applicable.
  • RNA of the human cell line HCT-8 infected with Cryptosporidium.
  • this procedure is equally effective for detection and quantification of Cryptosporidium in other samples (e.g., water samples, fecal samples, sputum or bronchalveolar lavage, serum, etc.).
  • this procedure is equally effective if the target is DNA instead of RNA.
  • this example is provided as a general validation of this approach to
  • the Figure 2 shows typical amplification curve plots (A) generated by these samples and a standard curve plot of known amounts of Cryptosporidium rRNA, for measuring the absolute quantities of Cryptosporidium small sufigurebunit rRNA in the samples (B).
  • the table below shows the numerical results of the parasite RNA quantification. These results showed that the Cryptosporidium RNA is present only in the samples in which infection was mediated with live parasites. As expected, heat inactivated parasites do not infect, and no parasite RNA is observed. Moreover, the results indicate that the amount of Cryptosporidium RNA present varies from approximately 5-30 picograms, permitting a direct calculation of the number of parasites present in the sample.
  • C. hominis is the primary agent of human cryptosporidiosis.
  • C. parvum is a common cause of disease in animals, and an occasional problem in humans. It is important to differentiate between these two (and other) strains of Cryptosporidium. Our technology enables the ready discrimination of these isolates.
  • Table 9 we have demonstrated that we can use the sequences we have described in Table 9 for differentiating C. parvum from C. hominis.
  • RT PCR using primer and probe sets specific for C. hominis or C. parvum are used to amplify RNA (or DNA) purified from a sample (water, fecal material, other sample). In these amplifications, we can not only detect and discriminate different
  • Cryptosporidium strains e.g., C. hominis from C. parvum
  • each can be concurrently quantified.
  • the array consists of -4,000 70 base synthetic oligonucleotides bound to glass slides. Each of the -4,000 C. hominis genes is represented by a single, specific oligonucleotide in the array.
  • DNA is isolated by standard technology, labeled with fluorescent dyes, and hybridized to the array.
  • a similar DNA sample derived from a known Cryptosporidium sample is labeled with an alternative fluorescent dye and used as a control. Both labeled DNAs are hybridized to the same oligonucleotide array, and the arrays are washed and scanned in a fluorescence scanner. The readout of the scanner provides an estimate of the amount of DNA for each gene that is present in the initial sample and a comparison between the two samples.
  • Cryptosporidium genes that are present or absent are determined relative to the control.
  • the 70 base oligonucleotides in the array were designed by ArrayOligoSelector 1 " 1 version 3.8.2, (http://arrayoligosel.sourceforge.net/), which selects optimal sequences by:
  • Cy3 or Cy5 dyes essentially as described by the manufacturer (AmershamPharmacia Biotech).
  • the labeled DNAs were hybridized to the oligonucleotide array, which contains approximately 4000 probes representing each of the known C. hominis genes.
  • Chro.10043 58 AAEL01000091 16477 18921 cell division cycle protein 48 homolog like; Chro.10044 59 AAELO 1000091 19742 20935 hypothetical protein Ubiquitin-like; Chro.10045 60 AAELO 1000925 3 1001 .
  • Vacuolar ATP synthase 16 kDa proteolipid subunit (V-ATPase 16 kDa proteolipid subunit)Dgi
  • Chro.10198 201 AAELO 1000164 12378 14600 hypothetical protein alpha/beta knot; Chro.10199 203 AAEL01000164 11141 12385 conserved hypothetical protein HAD-like; Chro.10200 204 AAEL01000164 10222 11007 ENSANGPOOOOOO 10471 Chro.10201 205 AAELO 1000164 8519 10057 Chro.10202 206 AAEL01000164 7493 8518 hypothetical protein Chro.10203 207 AAEL01000164 5337 6719 Colicin E immunity proteins; zinc finger (C3HC4-type RING finger)
  • cytochrome cdl -nitrite reductase
  • protein id Atlg20580.1, supported by cDNA: 27792., supported by cDNA: gi_l 5724291,
  • RNA polymerase subunit 8c putative Nucleic acid-binding proteins
  • Proteasome subunit beta type 1 (20S proteasome alpha subunit F) (2OS proteasome subunit beta-
  • Methionine aminopeptidase 1 (MetAP 1) Chro.10305 307 AAELOIOOOOIO 34052 35275 (MAP 1) (Peptidase M 1) Creatinase/aminopeptidase;
  • RNA polymerase I subunit DNA-directed RNA polymerase I polypeptide 2 (RNA polymerase I subunit
  • RNA polymerase (EC 2.7.7.6) 1 135K chain - Neurospora crassaDgi
  • Acetyl-coenzyme A synthetase (Acetate-- CoA ligase) (Acyl-activating enzyme)Qgi
  • Heat shock protein 7OkD (HSP70), C- terminal substrate-binding fragment; Actin-
  • Chro.20022 440 AAELO 1000713 1842 2354 hypothetical coiled-coil protein
  • Chro.20025 443 AAELO 1000202 963 1328 CGI-141 protein Chro.20026 444 AAEL01000202 1563 2516 hypothetical protein
  • SNAP protein soluble N-ethylmaleimide-sensitive factor Attachment Protein
  • LCCL domain Scavenger receptor cysteine- rich (SRCR) domain; Concanavalin A-like lectins/glucanases; Lipase/lipooxygenase scavenger receptor protein TgSRl domain (PLAT/LH2 domain); Scavenger

Landscapes

  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Analytical Chemistry (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Wood Science & Technology (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Engineering & Computer Science (AREA)
  • Physics & Mathematics (AREA)
  • Toxicology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biotechnology (AREA)
  • Immunology (AREA)
  • Microbiology (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)

Abstract

Cryptospor

Description

CRYPTOSPORIDIUMHOMINIS GENES AND GENE PRODUCTS FOR CHEMOTHERAPEUTIC, IMMUNOPROPHYLACTIC AND DIAGNOSTIC
APPLICATIONS
DESCRIPTION
BACKGROUND OF THE INVENTION
Field of the Invention
The invention generally relates to Cryptosporidium hominis genes and gene products In particular, the invention provides Cryptosporidium hominis genes and gene products for use in chemotherapeutic, immunotherapeutic, immunoprophylactic and diagnostic applications.
Background of the Invention
Cryptosporidium species are the causative agent of cryptosporidiosis, a disease that is characterized by acute gastro-enteritis and diarrhea. The disease is rampant in many developing countries (e.g. in Latin America, Africa, and Asia). However, incidents of cryptosporidiosis occur worldwide and developing countries are not immune to such incidents. For example, an outbreak in Milwaukee, Wisconsin in the mid 1990's caused over 400,000 human infections. Thus, no site on earth is free from the threat of serious outbreaks of cryptosporidiosis. Further, the National Institutes of Health and the Center for Disease Control classify Cryptosporidium as an important "Category B" agent of potential biological terrorism.
Cryptosporidium species are members of the Apicomplexa. These protozoan pathogens invade host cells using a specialized apical complex, and are usually transmitted by an invertebrate vector or intermediate host. Unlike most Apicomplexans, Cryptosporidium completes its life cycle in a single host and is transmitted by ingestion of oocysts. Two species, C. hominis, and C. parvum, which differ in host range, genotype and pathogenicity, are most relevant to humans. C. hominis is restricted to humans whereas C. parvum also infects other mammal species. Currently, there are no effective treatments for cryptosporidiosis, and control focuses on eliminating oocysts from water supplies. However, the resistance of the organism to common inexpensive water treatments seriously hampers this method of control. Despite decades of sophisticated molecular analysis of this and related organisms (e.g., Plasmodia (malaria parasites), Babesia, Eimeria, Toxoplasma, etc.), no significant advances have been found in treatment or prevention. Thus, traditional approaches of the prior art have thus far failed to identify the proverbial 'Achilles heel' of Cryptosporidium, and to provide viable therapies for the prevention or treatment of cryptosporidiosis.
SUMMARY OF THE INVENTION
The present invention is based on the determination of the sequence of the eight chromosome ~9.2 Mb genome of C. hominis, and the analysis of that sequence. Using genomics and bioinformatic approaches, a wide array of new targets for therapeutic and diagnostic applications has been identified. Moreover, an accurate view of the overall metabolism of the organism has been obtained, permitting a realistic approach to identification of critical points of attack for therapeutics.
The complement of C. hominis protein-coding genes shows a striking concordance with the requirements imposed by the environmental niches the parasite inhabits. Energy metabolism is largely from glycolysis. Options for both aerobic and anaerobic metabolism are available, the former requiring an alternative electron transport system in a simplified mitochondrion. Biosynthesis capabilities are limited, explaining an extensive array of transporters. Evidence of an apicoplast is absent, but genes associated with apical complex organelles are present. C. hominis and C. parvum exhibit very similar gene complements and phenotypic differences between these parasites must be due to subtle sequence divergence. The invention thus provides newly identified genes and gene products of C. hominis that are of use in chemo and immunotherapy, immunoprophylaxis, and diagnostic applications.
It is an object of this invention to provide amino acid sequences as represented in SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, SEQ ID NO:
22, and SEQ ID NO: 24. It is a further object of this invention to provide nucleotide sequences as represented in SEQ DD NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ E) NO: 7, SEQ ID NO: 9, and SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, SEQ E) NO: 21, SEQ E) NO: 23 and SEQ E) NOS: 25-4000.
The invention further provides a method of detecting and diagnosing C. hominis infection in a patient in need thereof. The method comprises the step of obtaining a biological sample from said patient, and amplifying nucleotide sequences from said sample, and determining infection based on whether there are one or more amplicons are produced.
The invention further provides a method for immunizing a patient against C. hominis infection. The method comprises the step of administering to the patient a non- virulent C. hominis peptide or nucleotide in an amount sufficient to permit the patient to mount an antibody response to the non- virulent C. hominis peptide or nucleotide. By non-virulent, we mean that the peptide or nucleotide does not cause pathology (e.g. symptoms of C. hominis infection).
The invention further provides a method for detecting Cryptosporidium such as C. hominis in a sample, for example, of detecting contamination of a water supply by
Cryptosporidium. The method comprises the steps of 1) obtaining a sample; 2) amplifying nucleotide sequences from the sample; and 3) detecting amplicons produced in the step of amplifying. The production of amplicons in the amplifying step indicates the presence of C. hominis in the sample. The method may further include the step of quantifying the amount of amplicons that is produced. This amount will be indicative of the amount of
Cryptosporidium (e.g. C. hominis) in the sample. The method may be used, for example, to detect Cryptosporidium contamination in environmental samples such as water. In some embodiments, the sample may include several Cryptosporidium species other than C. hominis. In this case, the determining step permits discrimination between C. hominis and other Cryptosporidium species in the sample.
The invention further provides arrays for assessing the presence or expression of genes in C. hominis, and for detecting the interaction (e.g. binding) of C. hominis macromolecules. The array is a device comprising macromolecules such as nucleic acid probes, peptides, proteins, or antibodies, all of which originate from nucleic acid sequences of C. hominis, i.e. they are identical to or homologous to C. hominis genomic sequences; or are encoded by C. hominis genome sequences; or, in the case of antibodies, they bind to such macromolecules. In particular, the nucleic acid probes include nucleotide sequences homologous to nucleotide sequences of C. hominis. In one embodiment, the nucleic acid probes are at least 70 nucleotides in length.
BRIEF DESCRIPTION OF THE DRAWINGS
Figure 1. Schematic representation of putative cellular components and metabolic pathways in C. hominis. The cytoplasmic membrane is indicated by a broad stripe at the top of the figure, and the intracellular compartment is below the stripe. Arrows and lines indicate pathways that are present. Dotted lines indicate multi-step reactions. Numbers indicate the quantity of transporters found for a given class when there is more than one. Important components or pathways that are clearly not present in C. hominis are crossed-out. Steps or components about which the exact nature is unknown or is questionable are shown with question marks. Arrows (=*>) and names indicate proposed aerobic parts of the energy metabolism. Abbreviations: ABC, ATP-binding cassette; MRP, multi-drug resistance protein; PEP, phosphoenolpyruvate; THF, tetrahydrofolate; DHF, dihydrofolate; AOX, alternative oxidase; UQ, ubiquinone; NADH DH, NADH dehydrogenase; Hsp70, heat-shock protein 70; Cpn60, chaperone 60; TIMl 7, translocase of the inner mitochondrial membrane 17; TOM40, translocase of the outer mitochondrial membrane 40; FAS, fatty-acid synthase; PKS, polyketide synthase; GPI, glycosylphosphatidylinositol; IP, inositol phosphate; PLC, phospholipase C; PKA, protein kinase A; PKC, protein kinase C; PDK, phosphatidylinositol 3-kinase; AC, adenilate cyclase; Ado, adenosine; Cyd, cytidine; dThd, deoxythymidine; Urd, uridine; PNO-CPR, pyruvate :N ADP+ oxidoreductase fused to cytochrome P450 reductase domain; Narf-like, nuclear prelamin A recognition factor like protein. Figure 2A and B. A, typical amplification curve plots; B, standard curve plot of known amount of C. hominis rRNA. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS OF THE INVENTION
The genetic sequence of the eight chromosome -9.2 Mb genome of C. hominis has been determined and analyzed (see Table 1). By using genomics and bioinformatic approaches, a wide array of new targets for therapeutic and diagnostic applications has been identified, hi addition, the overall metabolism of the organism has been elucidated, permitting a realistic approach to identification of critical points of attack (i.e. therapeutic targets) for therapeutics directed to the prevention or treatment of cryptosporidiosis. By "therapeutic target" we mean a molecule or pathway, the function of which can be targeted for intervention (e.g. blocking or inhibition) by the administration of agents such as drugs, or by stimulation of a specific immune response (by induction or passive administration( such as an antibody production. Such an intervention results in a decreased ability of the parasite to cause disease or disease symptoms. For example, such intervention may result in total or partial inhibition of the parasite's ability to carry out normal metabolism, to reproduce, to infect cells, to escape from infected cells, to proceed through a normal life cycle, to resist treatment with other disease alleviation agents, to navigate successfully, or to otherwise exert its pathological effects and cause disease.
In addition, C. hominis proteins that have been identified (or non-toxic or inactive fragments thereof) are useful for stimulating an immune system response to antigenic determinants of the proteins in an individual to whom they are administered. The nucleotide sequences and selected amino acid sequences of such proteins are provided in the Sequence Listing, the complete contents of which is hereby incorporated by reference. An immune system response may include increased antibody titers and/or increased cellular immunity, and, in a preferred embodiment, results in immunity to C. hominis. In other words, the proteins, or regions of the proteins encompassing antigenic determinants may be administered as vaccines for immuno prophylaxis. Alternatively, antibodies to antigenic determinants of the C. hominis proteins may also be administered directly to individuals in order to treat or prevent disease symptoms caused by C. hominis, i.e. immuno therapy. In addition, such antibodies may be useful as diagnostic or laboratory tools. The highly tailored physiology of C. hominis suggests several potential therapeutic targets, examples of which include but are not limited to: 1) transport systems for peptides, amino acids, nucleosides, and sugars; 2) components of glycolysis; 3) the unique prokaryotic FASl (fatty acid synthase 1) and PKSl (polyketide synthase 1); 4) starch and amylopectin biosynthesis or catabolism; 5) nucleic acid or amino acid metabolism; 6) the AOX (alternate oxidase) electron transport system; 7) the TS-DHFR (thymidine synthase-dihydrofolate reductase); and 8) the diverged polyamine synthesis enzymes. Importantly, and unlike other protozoan parasites, no extensive arrays of potentially variant surface proteins were observed, suggesting a possible role for immunoprophylaxis for prevention of cryptosporidiosis. hi addition, the invention provides the DNA sequences that encode numerous ribosomal RNA (rRNA) molecules (SEQ ID NOS: 4003-4014; see Table 14) and transfer
RNA (tRNA) molecules (SEQ ID NOS: 4015 - 4059; see Table 13). These sequences are also provided in the Sequence Listing, the complete contents of which is hereby incorporated by reference. Those of skill in the art will recognize that rRNA and tRNA sequences may have many uses, including but not limited to: detection of Cryptosporidium in clinical samples, diagnosis of cryptosporidiosis in humans and animals, identification of
Cryptosporidium carriers, detection of Cryptosporidium in water supplies, detection of Cryptosporidium contamination in lakes, rivers or other environmental sites, etc. These targets, in particular the rRNA targets, are very useful for discrimination of Cryptosporidium strains; e.g., C. hominis and C. parvum. Finally, these targets are useful for quantification of Cryptosporidium in any of the above, or other, clinical, water or environmental samples. An example of this is shown in Example 6 below.
The practice of the present invention will employ, unless otherwise indicated, conventional techniques of molecular biology, microbiology, recombinant DNA, and immunology, which are within the skill of the art. Such techniques are explained fully in the literature eg. Sambrook Molecular Cloning; A Laboratory Manual, Second Edition (1989);
DNA Cloning, Volumes I and ii (D. N Glover ed. 1985); Oligonucleotide Synthesis (M. J. Gait ed, 1984); Nucleic Acid Hybridization (B. D. Hames & S. J. Higgins eds. 1984); Transcription and Translation (B. D. Hames & S. J. Higgins eds. 1984); Animal Cell Culture (R. I. Freshney ed. 1986); Immobilized Cells and Enzymes (IRL Press, 1986); B. Perbal, A Practical Guide to Molecular Cloning (1984); the Methods in Enzymology series
(Academic Press, Inc.), especially volumes 154 & 155; Gene Transfer Vectors for Mammalian Cells (J. H. Miller and M. P. Calos eds. 1987, Cold Spring Harbor Laboratory); Mayer and Walker, eds. (1987), Immunochemical Methods in Cell and Molecular Biology (Academic Press, London); Scopes, (1987) Protein Purification: Principles and Practice, Second Edition (Springer- Verlag, N. Y.), and Handbook of Experimental Immunology, Volumes I-IV (D. M. Weir and C. C. Blackwell eds 1986).
Standard abbreviations for nucleotides and amino acids are used in this specification. The present invention provides nucleic acid sequences from Cryptosporidium hominis, as provided in the Sequence Listing (and see Table 1). Those of skill in the art will recognize that such sequences may be used for a variety of purposes, including but not limited to translation of the amino acid sequences encoded therein, as probes for diagnostic assay for the detection of C. hominis, for expression in bacterial systems, for expression in fungal or insect cell systems, for generation of recombinant and subunit vaccines or immuno therapeutics, for generation of active enzymes, for purification for structural determination (e.g., standard biochemical and biophysical applications such as NMR, MS, XRay crystallography), for the construction of RNA and protein microarrays, for the construction of nucleic acid libraries, for comparative genome analysis, for phylogeny and taxonomy, for prediction of putative blocking peptide domains, etc. With respect to the nucleic acid sequences disclosed herein, those of skill in the art will recognize that many variants (derivatives) of the sequences may exist or be constructed which would still be suitable for use in the practice of the present invention. For example, with respect to the translation of amino acid sequences from the nucleic acid sequences, due to the redundancy of the genetic code, more than one codon may be used to code for an amino acid. Further, as described below, changes in the amino acid primary sequence may be desired, and this would necessitate changes in the encoding nucleic acid sequences. In addition, those of skill in the art will recognize that many variations of the nucleic acid sequences may be constructed for purposes related to other aspects of the invention, for example: for cloning strategies (e.g. the introduction of restriction enzyme cleavage sites for ease of manipulation of a sequence for insertion into a vector, for rendering the sequence compatible with the cloning system vector or host, for enabling fluorescent or affinity labeling technologies, etc.), for purposes of modifying transcription (e.g. the introduction of specific promoter or enhancer sequences, insertion or deletion of splice signals, for enhancing or negatively regulating transcription levels, for regulating polyadenylation, for controlling termination, and the like), or for modification of active or inactive domains, for elimination or modification of certain activities or domains, for optimizing expression due to codon usage or other compositional biases, for addition of immunologically relevant (enhancing or inhibiting) sequences or for any other suitable purpose. All such variants of the nucleic acid sequences disclosed herein are intended to be encompassed by the present invention, provided the sequences display identity in the range of about 50 to 100%, and preferably about 60 to 100%, or more preferably about 70 to 100%, or even more preferably about 80 to 100%, or most preferably about 90 to 100% or about 95 to 100% to the disclosed sequences. The identity is with reference to the portion of the nucleic acid sequence that corresponds to the original sequence, and is not intended to cover additional elements such as promoters, vector-derived sequences, restriction enzyme cleavage sites, etc. derived from other sources. Those of skill in the art are well-acquainted with methods to determine nucleic acid similarity or identity using simple software alignment tools such as FASTA, the BLAST suite of programs, CLUSTAW, Lineup, Pileup (GCG), or many others.
In addition, the nucleic acids of the present invention are not limited to DNA, but are intended to encompass other nucleic acids as well, such as RNA (e.g. mRNA, tRNA, rRNA, etc.), RNA-DNA hybrids, and various modified forms of DNA and RNA known to those of skill in the art. For example, for use in vivo, nucleic acids may be modified to resist degradation via structural modification (e.g. by the introduction of secondary structures, such as stem loops, or via phosphate backbone modifications, etc.). Alternatively, the nucleic acids may include phosphothioate or phosphodithioate rather than phosphodiesterase linkages within the backbone of the molecule, or methylphosphorothiate terminal linkages. Other variations include but are not limited to: nontraditional bases such as inosine and queosine; acetyl-, thio- and similarly modified forms of adenine, cytidine, guanine, thymine and uridine; stabilized nucleic acid molecules such as nonionic DNA analogs, alkyl- and aryl phosphonates; nucleic acid molecules which contain a diol, such as tetrahyleneglycol or hexaethyleneglycol, at either or both termini; etc. Further, the nucleic acid molecules may be either single or double stranded, or may comprise segments of both single and double strand nucleic acid.
The invention also provides vectors comprising nucleic acid sequences of the invention. Those of skill in the art are well-acquainted with various vectors that may be used e.g. for manipulation of nucleic acid sequences during genetic engineering procedures, for storage of stocks of the nucleic acid, for expression of an amino acid sequence encoded by the nucleic acid, for expression in bacterial, fungal, insect or other host systems, for delivery of DNA vaccines, for amplification of the DNA, for sequence analysis, for molecular interaction studies, etc. Many such vectors are known to those of skill in the art, and include but are not limited to plasmids, adenoviral vectors, various expression vectors (e.g. PTRIEX4, PET41, PET44, and others of the PET series, the pUC vector series, the BlueScript series, derivatives of pBR322 with CoIEl origin of replication, the TOPO vector series, the Gateway vectors, the TET repressor vectors, BAC vectors [pBeloBACs, pCCIBAC, etc.], pcDNA301 and related plasmids with the CMV promoter, pBAC insect vectors, pIEX for insect cells, and many others).
Many of the nucleotide sequences of the present invention represent open reading frames (ORFs) that encode for amino acid sequences, e.g. peptides, polypeptides, and proteins, all of which are also intended to be encompassed by the present invention, hi general, for the purposes of the present invention, a peptide comprises about 15 or fewer amino acids, a polypeptide comprises from about 15 to about 100 amino acids, and a protein comprises about 100 or more amino acids, although the terms maybe used interchangeably herein. The peptides, polypeptides and proteins of the present invention are generally provided as recombinant molecules, although the amino acid sequences may also be produced synthetically via known peptide synthesis techniques. The peptides, polypeptides and proteins of the present invention are provided in a substantially purified form, i.e. they are generally free of extraneous materials (such as other proteins, nucleic acids, lipids, cellular debris, etc.) and will generally be at least about 75% pure, preferably about 85% pure, and most preferably at least about 90-95% or more pure, as would be understood by one of ordinary skill in the art.
Importantly, the present invention comprehends all amino acid sequences that may be translated from the nucleic acid sequences of the present invention, hi general, proteins/polypeptides that are so-translated will be translated from an open reading frame. The invention also encompasses variants (derivatives) of such proteins/polypeptides. For example, variants may exist or be constructed which display: conservative amino acid substitutions; non-conservative amino acid substitutions; truncation by, for example, deletion of amino acids at the amino or carboxy terminus, or internally within the molecule; or by addition of amino acids at the amino or carboxy terminus, or internally within the molecule (e.g. the addition of a histidine tag for purposes of facilitating protein isolation, the substitution of residues to alter solubility properties, the replacement of residues which comprise protease cleavage sites to eliminate cleavage and increase stability, the replacement of residues to form a convenient protease cleavage site, the addition or elimination of glycosylation sites, and the like, for any reason). Such variants may be naturally occurring (e.g. as the result of natural variations between species or between individuals, or as a result of different expression systems used to produce the amino acid sequence, etc.); or they may be purposefully introduced (e.g. in a laboratory setting using genetic engineering techniques). The amino acid sequences may be in a variety of forms, including a neutral (uncharged) forms, or forms which are salts, and may contain modifications such as glycosylation, side chain oxidation or deamidation, phosphorylation and the like. Also included are amino acid sequences modified by additional substituents such as glycosyl units, lipids, or inorganic ions such as phosphates, as well as modifications relating to chemical conversions or the chains, such as oxidation of sulfhydryl groups.
Strategies for improving solubility of cloned proteins are known to those of skill in the art. Such strategies may be used in the practice of this invention, and include: modifying expression conditions (temperature, buffer, nutrients), modification of the promoter or its activity, linking the protein to a different fusion protein that helps it maintain its solubility, expression in the yeast system Pichiapastoris, the insect baculovirus system, or in another eukaryotic organism, etc. Expression of soluble proteins is difficult in bacterial systems, but success is much more common in Pichia, baculovirus or mammalian expression systems. All such variants of the sequences disclosed herein are intended to be encompassed by the teachings of the present invention, provided the variant protein/polypeptide displays sufficient identity to the original sequences, the original sequence being a sequence as disclosed herein, or an amino acid sequence that can be translated from a nucleic acid sequence disclosed herein, (e.g. from an ORF or portion thereof). Preferably, amino acid identity will be in the range of about 50 to 100%, and preferably about 60 to 100%, or more preferably about 70 to 100%, or even more preferably about 80 to 100%, or most preferably about 90 to 100%, or even 95 to 100%, of the disclosed sequences. The identity is with reference to the portion of the amino acid sequence that corresponds to the original amino acid sequence as translated directly from the nucleic acid sequences disclosed herein, i.e. not including additional elements that might be added, such as sequences added to form chimeric proteins, histidine tags, etc. Those of skill in the art are well acquainted with the methods available for determining the identity between amino acid sequences, for example, FASTA, FASTP, the BLAST suite of comparison software, ClustalW, Lineup, Pileup, or many other alignment software packages.
In addition, such protein/polypeptide variants retain at least about 50 to 100% or more of the activity of the original polypeptide, and preferably about 60 to 100% or more, or more preferably about 70 to 100% or more, or even more preferably about 80 to 100% or more, and most preferably about 90 to 100% or more of the activity of the original sequence. By "activity" we mean the activity or role of the amino acid sequence in C. hominis, which may include but is not limited to: enzymatic activity, activity as a structural component, activity as a transporter protein, activity in signal transduction, role as a membrane component, binding activity, activating activity, transport activity, etc.
In general, the amino acid sequences of the invention are produced in recombinant expression systems. In a preferred embodiment of the present invention, the recombinant system is an E. coli recombinant system, which can be expressed as well in mammalian cells for use, for example, as a DNA vaccine. However, the amino acid sequences may be produced in a variety of other recombinant expression systems. For example, yeast, insect cells (using for example, a baculovirus expression vector), plant cells (e.g. tobacco, potato, corn, etc.), transgenic animals, or mammalian cell culture systems can be used for expression of recombinant proteins. Any appropriate expression system that suitably produces the amino acid sequences of the invention may be used in the practice of the invention. Such systems and their use for the production of recombinant proteins are well known to those of ordinary skill in the art.
In some embodiments, vectors containing nucleic acid sequences (e.g. DNA) that encode the amino acid sequences of the invention will encode a single protein. However, this need not always be the case. Such vectors may contain DNA encoding more than one nucleic acid of the invention, either as separate, discrete sequences, or combined into a single chimeric sequence. For example, in the case of an expression vector, two or more nucleic acids according to the invention may be present in the vector, and the nucleic acids may be expressed separately, resulting in the translation of one amino acid sequence for each nucleic acid. Alternatively, a single polypeptide chain containing more than one amino acid sequence of the invention, or portions of more than one amino acid sequence of the invention, may be combined in tandem. For example, one or more highly antigenic proteins or regions of proteins of the invention may be expressed as a chimera from a single DNA sequence. Alternatively, the amino acid sequences of the invention maybe expressed as part of a chimeric protein comprising amino acid sequences from another source, e.g. antigenic sequences known to be useful as adjuvants adjuvants (e.g. PADRE [and other Pan-DR T helper cell epitope], hepatitis B core antigen, DNA sequences CPG, other chemokines, CTB or cholera toxin B subunit, Ricin B and other plant toxin subunits, LPS or lipopolysaccharide, KLH [key hole limpet hemocyanin], Freund's complete and Freund's incomplete adjuvant, and many other reagents, etc. ), sequences that permit targeting of the protein to a specific location within the cell (e.g. nucleus, nucleolus or nuclear membrane, mitochondrion/ mitosome/mitochondria-like organelle, membrane, endoplasmic reticulum, golgi, rhoptry, dense granules, calcisomes or acidocalcisomes, and other subcellular organelles compartments, etc.).
The invention also comprehends a cell or cells containing the nucleic acids and/or the amino acid sequences of the invention. For example, the cell may be a host cell that harbors one or more vectors containing nucleic acid sequences of the invention (e.g. DNA or RNA) and/or amino acid sequences of the invention translated from such vectors. Such cells may contain multiple vectors, and the vectors may be the same or different. Further, the cells may be either in vitro or in vivo. The invention also provides antibodies directed to the amino acid sequences of the present invention. As used herein, the term "antibody" refers to a polypeptide or group of polypeptides composed of at least one antibody combining site. An "antibody combining site" is the three-dimensional binding space with an internal surface shape and charge distribution complementary to the features of an epitope of an antigen, which allows binding of the antibody with the antigen. "Antibody" includes, for example, vertebrate antibodies, hybrid antibodies, chimeric antibodies, humanised antibodies, altered antibodies, univalent antibodies, Fab proteins and fragments, and single domain antibodies. Antibodies to the proteins of the invention, both polyclonal and monoclonal, maybe prepared by conventional methods that are well-known to those of skill in the art. If desired, the antibodies (whether polyclonal or monoclonal) may also be labeled using conventional techniques. Such antibodies may be used, for example, for affinity chromatography, immunoassays, and for distinguishing or identifying C. hominis proteins or portions thereof. In a preferred embodiment of the invention, such antibodies may be used therapeutically, e.g. for administration to patients suffering from cryptosporidiosis, or prophylactically in order to prevent cryptosporidiosis in patients at risk for developing the disease. The invention also comprehends pharmaceutical compositions. The pharmaceutical compositions can comprise polypeptides, antibodies, or nucleic acids of the invention, or combinations of these. The pharmaceutical compositions will comprise a therapeutically effective amount of a polypeptide, antibody, or polynucleotide of the invention. The term "therapeutically effective amount" as used herein refers to an amount of a therapeutic agent that is sufficient to treat, ameliorate, or prevent a desired disease or condition, or to exhibit a detectable therapeutic or preventative effect. The effect can be detected by, for example, chemical markers or antigen levels. Therapeutic effects also include reduction of physical symptoms of cryptosporidiosis. The precise effective amount for a subject will depend upon several parameters, including the subject's size, general health, gender, age, etc., and the therapeutics or combination of therapeutics selected for administration. Thus, it is not useful to specify an exact effective amount in advance. However, the effective amount for a given situation can be determined by routine experimentation and is within the judgement of those of skill in the art, e.g. a physician. For purposes of the present invention, an effective dose will be from about 0.01 mg/kg to 50 mg/kg or about 0.05 mg/kg to about 10 mg/kg of active, therapeutic agent.
A pharmaceutical composition can also contain a pharmaceutically acceptable carrier. The term "pharmaceutically acceptable carrier" refers to a carrier for administration of a therapeutic agent, such as antibodies or a polypeptide, genes, and other therapeutic agents. Suitable carriers maybe large, slowly metabolized macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, and inactive virus particles. Such carriers are well known to those of ordinary skill in the art. Pharmaceutically acceptable salts can be used therein, for example, mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like. A thorough discussion of pharmaceutically acceptable excipients is available in Remington's Pharmaceutical Sciences (Mack Pub. Co., NJ. 1991).
In addition, pharmaceutically acceptable carriers in therapeutic compositions may contain liquids such as water, saline, glycerol and ethanol. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present in such vehicles. Typically, the therapeutic compositions are prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection may also be prepared. Liposomes are included within the definition of a pharmaceutically acceptable carrier.
Once formulated, the compositions of the invention can be administered to the subject. The subjects to be treated can be animals; in particular, human subjects can be treated. Direct delivery of the compositions will generally be accomplished by inj ection, either subcutaneously, intraperitoneally, intravenously or intramuscularly or delivered to the interstitial space of a tissue. The compositions can also be administered into a lesion. Other modes of administration include oral and pulmonary administration, suppositories, and ' intranasal, transdermal or transcutaneous applications (eg. see WO98/20734), needles, and gene guns or hyposprays. Dosage treatment may be a single dose schedule or a multiple dose schedule.
The present invention also encompasses vaccines that provide immunity to disease caused by C. hominis. By "immunity" we mean that administration of one or more proteins, polypeptides or peptides of the present invention to an individual either prevents the development of disease symptoms in that individual when exposed to or infected by C. hominis, or the disease symptoms that develop in the individual are milder than those that would otherwise develop, for example, the disease symptoms that would develop in a matched control individual. Those of skill in the art are well acquainted with the use and meaning of "controls" when comparing results of individuals or populations that have been exposed to different variables (e.g. vaccinated or not).
According to the invention, the vaccine may either be prophylactic (i.e. to prevent or attenuate symptoms of infection) or therapeutic (i.e. to treat disease after infection). Such vaccines comprise one or more of: immunizing antigen(s), immunogen(s), polypeptide(s), protein(s) and nucleic acid(s) from C. hominis (as described herein), usually in combination with "pharmaceutically acceptable carriers," which include any carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition.
Suitable carriers are typically large, slowly metabolized macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, lipid aggregates (such as oil droplets or liposomes), and inactive virus particles. Such carriers are well known to those of ordinary skill in the art. Additionally, these carriers may function as immunostimulating agents ("adjuvants"). Furthermore, the antigen or immunogen may be conjugated to a bacterial toxoid, such as a toxoid from diphtheria, tetanus, cholera, H. pylori, etc. pathogens. Preferred adjuvants to enhance effectiveness of the composition include, but are not limited to: (1) aluminum salts (alum), such as aluminum hydroxide, aluminum phosphate, aluminum sulfate, etc; (2) oil-in-water emulsion formulations (with or without other specific immunostimulating agents such as muramyl peptides (see below) or bacterial cell wall components), such as for example (a) MF59™ (WO 90/14837; Chapter 10 in Vaccine design: the subunit and adjuvant approach, eds. Powell & Newman, Plenum Press 1995), containing 5% Squalene, 0.5% Tween 80, and 0.5% Span 85 (optionally containing various amounts of MTP-PE (see below), although not required) formulated into submicron particles using a microfluidizer such as Model HOY microfluidizer (Microfluidics, Newton, Mass.), (b) SAF, containing 10% Squalane, 0.4% Tween 80, 5% pluronic-blocked polymer L121, and thr-MDP (see below) either microfluidized into a submicron emulsion or vortexed to generate a larger particle size emulsion, and (c) Ribi™ adjuvant system (RAS), (Ribi Irnmunochem, Hamilton, Mont.) containing 2% Squalene, 0.2% Tween 80, and one or more bacterial cell wall components from the group consisting of monophosphorylipid A (MPL), trehalose dimycolate (TDM), and cell wall skeleton (CWS), preferably MPL+CWS (Detox™); (3) saponin adjuvants, such as Stimulon™ (Cambridge Bioscience, Worcester, Mass.) may be used or particles generated therefrom such as ISCOMs (immunostimulating complexes); (4) Complete Freund's Adjuvant (CFA) and Incomplete Freund's Adjuvant (IFA); (5) cytokines, such as interleukins
(eg. IL-I, IL-2, EL-4, BL-5, IL-6, IL-7, IL-12, etc.), interferons (eg. gamma interferon), macrophage colony stimulating factor (M-CSF), tumor necrosis factor c[NF), etc; and (6) other substances that act as immunostimulating agents to enhance the effectiveness of the composition. Alum and MF59™ are preferred.
The immunogenic compositions (eg. the immunizing antigen/immunogen/ polypeptide/protein/nucleic acid, pharmaceutically acceptable carrier, and adjuvant) typically will contain diluents, such as water, saline, glycerol, ethanol, etc. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, maybe present in such vehicles. Typically, the immunogenic compositions are prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection may also be prepared. The preparation also may be emulsified or encapsulated in liposomes for enhanced adjuvant effect, as discussed above under pharmaceutically acceptable carriers.
Immunogenic compositions used as vaccines comprise an immunologically effective amount of the antigenic or immunogenic polypeptides, as well as any other of the above- mentioned components, as needed. By "immunologically effective amount", it is meant that the administration of that amount to an individual, either in a single dose or as part of a series, is effective for eliciting the production of antibodies, for eliciting a cellular immune response, (or both), and/or for treatment or prevention of disease. This amount varies depending upon the health and physical condition of the individual to be treated, the taxonomic group of individual to be treated (e.g. nonhuman primate, primate, etc.), the capacity of the individual's immune system to synthesize antibodies, the degree of protection desired, the formulation of the vaccine, the treating doctor's assessment of the medical situation, and other relevant factors. It is expected that the amount will fall in a relatively broad range that can be determined through routine trials. The immunogenic compositions are conventionally administered parenterally, eg. by injection, either subcutaneously, intramuscularly, intranasally, or transdermally/transcutaneously. Additional formulations suitable for other modes of administration include oral and pulmonary formulations, suppositories, and transdermal applications. Dosage treatment may be a single dose schedule or a multiple dose schedule. The vaccine may be administered in conjunction with other immunoregulatory agents. As an alternative to protein-based vaccines, DNA vaccination maybe employed [eg. Robinson & Torres (1997) Seminars in Immunology 9:271-283; Donnelly et al. (1997) Annu Rev Immunol 15:617-648].
In a preferred embodiment of the invention, the proteins that are used in an immunogenic preparation or vaccine of the present invention include at least one of the proteins represented by SEQ ID NOS: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 (see Example 2 below).
The present invention also provides tools and methods for the diagnosis of C. hominis infections. Such tools include primers containing nucleotide sequences that specifically hybridize to nucleic acid sequences that are unique to the genome of the C. hominis species. Hybridization of the primers to such a unique sequence permits amplification of the unique sequence (for example, by polymerase chain reaction (PCR)), thus providing a means to specifically identify the presence of C. hominis in biological samples (blood, feces, sputum, urine, bronchoaveloar lavage, etc.). Amplification may be directly from the genome of the organism located in the sample, or from RNA, e.g. from ribosomal RNA (rRNA), which is typically highly expressed and thus more sensitive than DNA as a target. Because the sequences that are amplified are unique to C. hominis, it is possible to distinguish infection by C. hominis from infection with even closely related parasites. By "primer" we mean a nucleotide sequence that hybridizes to another nucleotide sequence of interest, the primer typically being a relatively short nucleotide sequence (e.g. from about 10 to about 100 base pairs) and the nucleotide sequence of interest typically being transcribed from the genome of an organism. PCR amplification techniques are well- known to those of skill in the art
In general, two primers are selected that target sites that flank the sequence of interest for diagnostics or identification. These primers are designed to recognize only the target sequence; i.e., they will hybridize only to the target sequence and to no other sequences. Thus, the sequence is screened against all other known sequences to ensure that there is no other known sequence to which it will hybridize. The primers generally range from 18-30 nucleotides in length (but can be longer or shorter), have Tm' s (melting temperatures) that are selected to be compatible with both amplification conditions and with specificity, have little or no internal structure (stem-loop structures caused by internal complementarity), little or not ability to dimerize with themselves, little or no ability to dimerize with the other primer, have few homopolymeric stretches, etc. Many computer programs (e.g., Primer3, Oligo, etc.) are available for these purposes. At times, an internal fluorescent probe is also included for specific use in even more sensitive and automated tests. The internal probe is fluorescently labeled such that it is specifically degraded and therefore fluoresces only if it specifically hybridizes to the target sequence. Alternately, other fluorescent probes can be designed that only fluoresce upon binding specifically to an amplified specific sequence.
Thus, several alternative approaches are available for the generation and detection of specific sequences amplified by PCR, and any of these can be applied for diagnostic or identification purposes. (See, for example: Mullis, K., F. Faloona, S. Scharf, R. Saki, G. Horn, and H. Erlich. (1986) Specific enzymatic amplication of DNA in vitro: The Polymerase Chain Reaction. Cold Spring Harbor Symposia on Quantitative Biology 51 : 263 ; Saiki, R.K., D.H.
Gelfand, S. Stoffel, SJ. Scharf, R. Higuchi, G.T. Horn, K.B. Mullis, and H.A. Erlich. (1988) Primer-directed enzymatic amplification of DNA with a thermostable DNA polymerase. Science239: 487; Schutzbank TE, Stern HJ. (1993) Principles and applications of the polymerase chain reaction. J Int Fed Clin Chem. 1993 Jul;5(3):96-105; Erlich HA. (1999) Principles and applications of the polymerase chain reaction. Rev Immunogenet. 1(2):127-
34; Wang,A.M., Doyle, M.V., and D.F. Mark. (1989) Quantitation of mRNA by the polymerase chain reaction. Proc Natl Acad Sci U S A. 1989 December; 86(24): 9717-9721; Kawasaki, E.S., and A.M. Wang. (1989) Detection of gene expression. In: Erlich, H.A., ed., PCR Technology: Principles and Applications of DNA Amplification. Stockton Press, hie, New York, NY, pp. 89-97; Dieter Klein (2002) Quantification using real-time PCR technology: applications and limitations. Trends in Molecular Medicine, 8(6):257-260; Buck GE. (1996) The polymerase chain reaction: a revolutionary new procedure for the laboratory diagnosis of infectious disease. J Ky Med Assoc. Apr; 94(4): 148-52.)
Because the nucleotide sequences that are being amplified are unique to C. hominis, a positive amplification result is indicative of the presence of C. hominis in the biological sample, and thus of infection by C. hominis. In contrast to current methods of C. hominis detection, the present invention, by elucidating the entire genome of C. hominis, allows the design of a much larger number of such primers. Further, primers provided by the present invention hybridize to sequences that are highly diverse from species closely related to C. hominis. Thus, the accuracy of the diagnostic methods of the present invention are superior to those of the prior art, resulting in very few false positives, and very few missed diagnoses. The present invention also provides arrays of nucleotide or modified nucleotide, or protein or modified protein sequences, or antibodies to the nucleotides or proteins, for use as probes for assessing the presence or absence of genes, the expression of specific genes, the presence or absence of proteins or immune responses in C. hominis or other Cryptosporidium species, hi particular, the arrays of the invention may be used to specifically assess the differential expression of genes any of the various stages of the life cycle of C. hominis, for example, during the sporozoite stage, hi order to do so, a biological sample containing C. hominis parasites at a particular stage of development is provided and analyzed using the array. Alternatively, such arrays may be used to monitor C. hominis parasites under other conditions of interest, for example, to monitor gene expression in response to an external stimulus or variable, such as introduction of a drug or other agent into a culture of the parasites; or to monitor the course of a C. hominis infection, either in culture, or in an infected individual. Similarly, the arrays can be used for comparative genome analyses in which the presence or absence of specific genes are probed in different isolates of Cryptosporidium. In order to do so, DNA from the isolate of interest is analyzed using the array. Presence or absence of a particular gene is assessed via hybridization. Using this approach, the array can also be designed to detect specific polymorphisms in genes that have clinical or other relevance. This approach can have diagnostic and clinical importance, or other relevance to infection, treatment or contamination (e.g., water contamination with C. hominis is much more serious than water contamination with other species of
Cryptosporidium. The nucleotide probes (usually DNA or a derivative thereof) in an array typically have a length in the range of about 50 to about 90 nucleotides, and preferably about 60 to about 80 nucleotides, and most preferably the probes have a length of about 70 nucleotides. These arrays can be comprehensive; i.e., be comprised of probes for all genes/ gene sequences in a genome, or targeted to specific subsets of genes/ gene sequences, depending on the application. Peptides, proteins or derivatives thereof (or antibodies thereto) can also be used in similar arrays, hi this case, synthetic peptides, proteins (recombinant or otherwise) or derivatives are designed from the gene sequences (Table 1 and others) and used in the array. Again, these peptide/protein arrays can be of various lengths (number of amino acids or derivatives), and they can be comprehensive and include probes for all genes
/proteins in the genome, or targeted to specific subsets of genes. These probes, nucleotides, peptides or derivatives thereof, are bound to solid phase surfaces (glass slides, microplates, micro- or nano- beads, etc.) and used to screen processed biological samples for interacting macromolecules. In the case of nucleotide arrays, interactions are usually detecting complementary sequences in a sample by hybridization. In the case of protein/ peptide arrays, and in some cases for nucleotide arrays, the array will be used for detection of interacting macromolecules (proteins, antibodies, other nucleic acids, etc.).
EXAMPLES EXAMPLE 1.
Herein, the -9.2 Mb genome of C. hominis is described. The genome has 32% GC content, -3,994 protein-coding genes, 45 tRNAs, and at least four rRNAs. There is a strikingly high concordance between the genome complement of C. hominis and the requirements imposed by the environmental niches it inhabits. Energy is derived largely from glycolysis and catabolism of starch or amylopectin. Options for both aerobic and anaerobic metabolism are available, the latter requiring an alternative electron transport system in a simplified mitochondrion. Biosynthesis capabilities are quite limited, but an extensive complement of transporters is encoded. Evidence of an apicoplast is absent, but rhoptry, microneme, dense granule, and acidocalcisome related genes are present. A panel of hypothetical signal transduction systems was identified. Comparison of the genomes of the human pathogen C. hominis and the bovine isolate C. parvum shows a high degree of synteny with no evidence of different gene complements. Phenotypic differences between these two parasites therefore seem to be due to very subtle sequence divergences. The genome composition
A ~12 fold sequence and ~8 fold BAC clone coverage of the genome of C. hominis isolate TU502 l is presented. Alignment 2 of these sequences with the HAPPY map 3 and chromosomes of the C. parvum genome 4 covered -9.1 Mb of the -9.2 Mb. The eight chromosomes range from -0.9 - -1.4 Mb, and exhibit 31.7% GC content compared to 30.3% and 19.4% for C. parvum and P. falciparum 5. The density of repeats of 2-50 bp was approximately one per 2800 bp. The distribution of repeats is biased toward chromosome ends as over 85% are in the telomere proximal thirds of five of the chromosomes. Two octamers, TGGCGCCA and TGCATGCA, over-represented in other apicomplexans 3 , are ~40 and 15 fold over-represented in C. hominis. Interestingly, over 80% of the octamers are localized in non-coding sequences, suggesting a regulatory or other conserved function. 45 tRNAs, 4 or 5 rRNA operons - at least one of each of the two known types, and two clusters of three tandem 5 S rRNA genes are present. Like P. falciparum 5 , two methionine tRNAs are present, suggesting discrete roles in initiation and extension. We estimate 3,994 genes in
C. hominis, compared to 3,952 genes in C. parvum and 5,268 in P. falciparum 5 (Table 2). Approximately 60% exhibit similarity to known genes. The distribution of GO annotations for Cryptosporidium, Plasmodium, and Saccharomyces, is remarkably similar, suggesting their phenotypic differences are a reflection of non-conserved or novel gene families of unknown function rather than to functional specialization of conserved gene families. Using
ESTs as a guide, we estimate that 5- 20% of C. hominis genes have introns.
Energy Metabolism.
C. hominis possesses a highly tailored glycolysis-based metabolism dependent on the host for nutrients and exquisitely adapted for its parasitic life cycle (see Figure 1). Glycolytic enzymes are present, but the TCA cycle and oxidative phosphorylation (OxPhos) are not.
Both an anaerobic pathway using pyruvate: NADP+ oxidoreductase (PNO) and an aerobic pathway using an alternative oxidase (AOX) are available for recycling NAD+ to NADH. In the former, pyruvate is fermented to acetyl-CoA producing NADPH which is then reduced to NADP+ , releasing hydrogen, by a Narf like [FE]-hydrogenase, as for Trichomonas 6. Acetyl- CoA is processed by acetate CoAsynthase to produce acetate and ATP, as in Giardia η, yielding four ATP per glucose.
Acetyl-CoA can also be processed to ethanol yielding no additional ATP. Under glucose-limited conditions, conversion of acetyl-CoA to acetate, generating two extra ATP per glucose, might be favored. In excess glucose, pyruvate can be converted to lactate or ethanol to regenerate NAD+ but no additional ATP. C. hominis can also generate ATP by metabolism of glycerol using glycerol-3-phosphate dehydrogenase and triose phosphate isomerase.
C. hominis can convert pyruvate to malate and subsequently to oxaloacetate (OAA), regenerating NAD+. However, malate shuttle enzymes (e.g., aspartate amino transferase) which process OAA to aspartic acid for export from the mitochondrion, are absent. We propose that cytoplasmic malate may be converted to OAA by a mitochondrial membrane bound malate dehydrogenase, like the lactate shuttle of Euglena gracilis 8, passing electrons from malate to an electron transport system comprised of elements of Complexes I and in and an alternative oxidase system (AOX) with O2 as electron acceptor and producing no additional ATP.
Enzymes for metabolism of glycogen, starch and amylopectin are present, consistent with suggestions that amylopectin represents an energy reserve for sporozoites 9. Lack of glucose-6-phosphate-l -dehydrogenase and other enzymes of the pentose phosphate pathway suggests that, unlike P. falciparum and other apicomplexans 10, C. hominis cannot metabolize five-carbon sugars or nucleotides. Components of beta-oxidation (e.g., enoyl-
CoA hydratase and acetyl-CoA C-acyltransferase) are also absent, precluding ATP generation from fatty acids. Enzymes for catabolism of proteins are also absent. Major TCA cycle enzymes ~ isocitrate dehydrogenase, succinyl-CoA synthetase, succinate dehydrogenase — are absent in C. hominis. Despite the presence of ubiquinol-cytochrome C reductase, NADH dehydrogenase (ubiquinone), H(+)-transporting ATPase, iron-sulfur cluster-like proteins, etc., key components of Complexes II and IV are absent, precluding ATP generation by OxPhos. Components of OxPhos that are present (parts of Complexes I and IH) probably re-oxidize NADH in a simplified electron-transport chain, as in some plants and protozoa n. Biosynthesis.
Consistent with previous suggestions (c.f. n), Cryptosporidium lack enzymes for synthesis of key biochemical building blocks — simple sugars, amino acids and nucleotides. However, starch, amylopectin and fatty acids can be generated from precursors. Interestingly, these C. hominis enzymes exhibit minimal similarity to the known biosynthetic enzymes and therefore represent potential therapeutic targets.
Enzymes of the TCA, urea and nitrogen cycles, and the shikimate pathway are absent, suggesting that Cryptosporidium is an amino acid auxotroph. The shikimate pathway has been proposed as a potential target for glyphosate-based chemotherapy in other parasites including Cryptosporidium 13. We found no evidence to support this hypothesis. Enzymes able to interconvert amino acids are encoded in C. hominis. However, unlike P. falciparum 5,
C. hominis seems to have a full complement of amino acid transporters. C. hominis lacks enzymes to synthesize bases or nucleosides, but encodes enzymes that convert nucleosides into nucleotides and interconvert nucleotides. As in other parasites, thymidylate synthase and dihydrofolate reductase (DHFR) of C. hominis are encoded as a bifunctional polypeptide, and novel polymorphisms at crucial sites have been proposed to explain Cryptosporidium 's resistance to antifolates (c.f. 14). As previously suggested 12, several nucleotide conversion enzymes seem to have prokaryotic origin. Fatty acid biosynthesis in apicomplexans occurs in the apicoplast via a type II system including fatty acid synthase (FAS)15. However, consistent with absence of an apicoplast in Cryptosporidium , C. hominis encodes large FAS and polyketide synthase (PKS) enzymes, suggesting a type I mechanism (c.f. 17). As previously suggested 18, the type I FAS and PKS enzymes of C. hominis have prokaryotic characteristics.
Glycerolipid and phospholipid metabolic pathways for phosphatidylinositol (PI) biosynthesis are available in C. hominis. 1,2-diacylglycerol, an intermediate, is precursor for glycosylphosphatidylinositol (GPI) anchor synthesis. Consistent with previous observations 19, all enzymes required for synthesis of these anchors are encoded in the genome.
Polyamines; e.g., putrescine, spermine and spermidine, are critical for cellular viability, and enzymes required for their synthesis are attractive therapeutic targets 20. Cryptosporidium can synthesize polyamines using arginine decarboxylase rather than ornithine decarboxylase 21 . The putative arginine decarboxylase, spermidine synthase and other relevant enzymes encoded by C. hominis are significantly diverged from their homologs and represent potential therapeutic targets. Signaling and control pathways
C. hominis encodes adenylate cyclase, cAMP phosphodiesterase and protein kinase A, suggesting the presence of the cAMP-mediated signalling pathway (Tab.S7). Trimeric G protein, often involved in activation of cAMP mediated signalling, was not found in C. hominis, suggesting that, as for the Kinetoplastida 22 and reminiscent of plants, this pathway is independent of this complex in C. hominis. The presence of phosphatidylinositol 3-kinase and phospholipase C suggests that C. hominis utilizes phosphatidylinositol phosphate and Ca2+ -mediated regulatory mechanisms. The presence of putative Ca2+ transporters, enzymes associated with acidocalcisomes, and calmodulin imply that Ca2+ transport and sequestering are functional. Protein kinase C receptors suggest that C. hominis has the ability to signal by activation of soluble cytoplasmic receptor-associated kinases. Organelles
No mitochondrial DNA sequences were found in C. hominis, and both the TCA cycle and OxPhos are absent. However, a double membrane bound organelle generates a proton gradient using cardiolipin and performs some related mitochondrial functions, and mitochondrial marker chaperonin 60 was localized to this structure 23. Core enzymes of [Fe- S] cluster biosynthesis; i.e. CpFdI, IscU, IscS, mt-HSP70, mtFNR and frataxin, have been reported in Cryptosporidium 24, and we were not surprised to observe proteins involved in electron transport. We also used the CDART 25 to identify [Fe-S] domains in HscB (JAC) and ATMl, which are possibly involved in chaperonin activity of Hsp40/DnaJ type and
ABC transport. Thus, C. hominis, like another obligate intracellular parasite, the microsporidian Encephalitozoon cuniculi 26, contains a minimal set of these proteins. These results imply significant mitochondrial function in C. hominis, and that the previously reported organelle 27 is an atypical mitochondrion. Cryptosporidium apparently lacks an apicoplast 16>28, and searches of the C. hominis genome identified no clear apicoplast-encoded genes. Some putative nuclear-encoded apicoplast genes; e.g., T. gondii acetyl-CoA carboxylase 1 precursor 29 , and P. falciparum adenylyl cyclase 30 , are present. Others; such as the conserved apicoplast 5OS ribosomal protein L33 of Plasmodium, the ribosomal L28 and S9 precursor 15 proteins of Toxoplasma,, were not found. Together, our data suggest that Cryptosporidium lost an ancestral apicoplast.
The presence of D-glucose-6-phosphate ketol-isomerase and 2- phospho-D-glycerate hydrolase that have highest similarity to plant genes and may be derived from ancient algal endosymbionts 31 is also suggestive that engulfment of the alga that gave rise to the apicoplast 32 preceded divergence of Cryptosporidium from other apicomplexans. The C. hominis genome encodes multiple proteins specific for components of the apical complex including micronemes and rhoptries. No specific dense granule-associated proteins were observed, probably because these proteins diverge rapidly 33 . However, proteins implicated in the regulation of transport and enhancement of release of dense granule proteins 34 are present. As for Plasmodium, a typical Golgi structure is not apparent in C. hominis 28. However, the presence of secretory organelles implies the existence of a functional endoplasmic reticulum (ER) and Golgi, and C. hominis encodes proteins similar to many related components; including the NSF/SNAP/SNARE/Rab machinery which participates in dense granule release 35 and the rhoptry biogenesis mediator AP-1 36 , involved in ER-Golgi-organelle protein traffic. Therefore, the ER-Golgi-organelle machinery of C. hominis is conserved and similar to that of other apicomplexans. Transporters.
C. hominis exhibits very limited biosynthetic capabilities and is apparently supremely dependent on its ability to import essential nutrients. The genome encodes >80 genes with strong similarity to known transporters and several hundred genes with transporter-like properties. At least twelve sugar or nucleotide-sugar transporters, five putative amino acid transporters, three fatty acid transporters, 23 ABC family transporters including possible multiple drug resistance proteins 37 , and several putative mitochondrial transporters are present. Other putative transporters for choline uptake, aminophospholipid transport, ATP/ADP transporters, and others with unclear function, were also identified. These transporters represent ideal therapeutic targets. Comparison of C. hominis and C. parvum genomes.
Comparison of the genomes of C. hominis and C. parvum showed that the two genomes are very similar; exhibiting only 3-5% sequence divergence with no large insertions, deletions or rearrangements evident, hi fact, the gene complements of the two species are essentially identical since the few C. parvum genes not found in C. hominis are proximal to known sequence gaps. Thus, we conclude that the significant phenotypic differences between these parasites are due to functionally significant polymorphisms in relevant protein-coding genes and subtle gene regulatory differences.
Conclusions.
A striking feature of the C. hominis genome is the concordance between its gene complement and metabolic requirements in the environmental niches of its two primary life cycle stages — the quiescent oocyst in the nutrient-poor aerobic environment of contaminated water, and the vegetative parasites in the nutrient-rich anaerobic or microaerophilic environment of the host. Oocysts probably persist by processing stores of complex carbohydrates. Metabolism is likely aerobic via the alternative electron transport system in the unconventional mitochondrion. Consistent with the lack of an energy generating TCA cycle, OxPhos, β-oxidation, and the pentose phosphate pathway, oocysts are relatively inactive, and the two ATP per glucose from glycolysis may provide sufficient energy. In the host, the parasite can import sugars to directly fuel glycolysis, netting two ATP per hexose. In limiting glucose, an additional two ATP per hexose can be generated by converting acetyl-CoA to acetate or via glycerol metabolism. The residual mitochondrion lacks the TCA cycle and OxPhos as expected in an organism that replicates in the anaerobic / microaerophilic environments, and a simplified electron transport system for regenerating reducing power is available. Thus, a glycolysis-based metabolism is sufficient to support Cryptosporidium in all life cycle stages.
Also consistent with the highly tailored Cryptosporidium metabolism are its limited biosynthetic options; i.e., amino acids, nucleotides, and simple sugars cannot be synthesized.
The parasite must import these building blocks probably explaining the significant array of transporters present in the genome.
As expected, apicoplast-specific activities are lacking in Cryptosporidium. One hypothesis is that acquisition of the type 1 FAS by a progenitor organism obviated the fatty acid synthesis capabilities of the apicoplast 38. Since some apicoplast-related genes remain, our observations suggest that Cryptosporidium diverged from other apicomplexans prior to loss of this organelle.
As previously noted, our analysis shows that Cryptosporidium is a mosaic of sequences from diverse progenitors, including the hypothetical endosymbiont alga which formed the apicoplast, the mitochondrion, and numerous genes acquired from prokaryotes by lateral transfer. Cryptosporidium also exhibits modular gene loss. We assume, based on inference from other apicomplexans and earlier diverging groups like the Euglenozoa, the Heterolobosea, and the jakobids 39, that Cryptosporidium progenitors exhibited the TCA cycle, beta-oxidation, OxPhos, amino acid, nucleotide and sugar biosynthesis, fully competent mitochondria, and a functional apicoplast.
Genes associated with these functions are dispersed throughout the genome in Plasmodium and, we assume, in the progenitor. However, these systems seem to have been deleted cleanly in Cryptosporidium, leaving few residual genes or pseudogenes. Thus, its genome is a mosaic resulting from multiple lateral gene transfers and a complex pattern of selective gene deletion.
The highly tailored physiology of C. hominis suggests attractive therapeutic targets . Examples include: 1) transport systems for peptides, amino acids, nucleosides, and sugars, 2) components of glycolysis; 3) the unique prokaryotic FASl and PKSl; 4) starch and amylopectin biosynthesis or catabolism; 5) nucleic acid or amino acid metabolism; 6) the AOX electron transport system; 7) the TS-DHFR; and 8) the diverged polyamine synthesis enzymes. Finally, many potential vaccine targets were identified in the C. hominis genome
(not shown), and unlike other protozoan parasites, no extensive arrays of potentially variant surface proteins were observed, suggesting a possible role for immunoprophylaxis for cryptosporidiosis.
The availability of the genome sequence of the human pathogen C. hominis represents a critical step forward in our understanding of the biology of this parasite. The gene complement provides very significant insight into its physiology and metabolism, validating previous hypotheses and suggesting others. New obvious targets for chemo- and immunotherapy are already apparent. In short, we anticipate that the availability of the sequence of C. hominis will stimulate very rapid progress in research on this organism, its pathogenicity, and strategies for intervention in the diseases it causes.
REFERENCES for Example 1
1. Akiyoshi, D. E., Feng, X., Buckholt, M. A., Widmer, G. & Tzipori, S. Genetic analysis of a Cryptosporidium parvum human genotype 1 isolate passaged through different host species. Infect. Immun. 70, 5670-5675 (2002). 2. Gordon, D., Abajian, C. & Green, P. Consed: a graphical tool for sequence finishing.
Genome Res. 8, 195-202 (1998).
3. Bankier, A. T. et al. Integrated mapping, chromosomal sequencing and sequence analysis of Cryptosporidium parvum.. Genome Res. 13, 1787-1799 (2003).
4. Abrahamsen, M. S. et al. Complete genome sequence of the apicomplexan, Cryptosporidium parvum. Science 304, 441-445 (2004).
5. Gardner, M. J. et al. Genome sequence of the human malaria parasite Plasmodium alciparum. Nature 419, 498-511 (2002).
6. Muller, M. Evolutionary relationships among Protozoa. Coombs,G.H., Vickerman,K., Sleigh,M.A. & Warren,A. (eds.), pp. 109-131 (Kluwer Academic Publishers, 1998). 7. Sanchez, L. B., Galperin, M. Y. & Muller, M. Acetyl-CoA synthetase from the amitochondriate eukaryote Giardia lamblia belongs to the newly recognized superfamily of acyl-CoA synthetases (Nucleoside diphosphate-forming). J. Biol. Chem. 275, 5794-5803 (2000).
8. Jasso-Chavez, R. & Moreno-Sanchez, R. Cytosol-mitochondria transfer of reducing equivalents by a lactate shuttle in heterotrophic Euglena. Eur. J. Biochem. 270, 4942-4951
(2003).
9. Petry, F. & Harris, J. R. Ultrastructure, fractionation and biochemical analysis of Cryptosporidium parvum sporozoites. Int. J. Parasitol. 29, 1249-1260 (1999).
10. Barrett, M. P. The pentose phosphate pathway and parasitic protozoa. Parasitol. Today 13, 11-16 (1997).
11. Nihei, C, Fukai, Y. & Kita, K. Trypanosoma alternative oxidase as a target of chemotherapy. Biochim. Biophys. Acta 1587, 234-239 (2002).
12. Striepen, B. et al. Gene transfer in the evolution of parasite nucleotide biosynthesis. Proc. Natl. Acad. Sd. U. S. A 101, 3154-3159 (2004). 13. Roberts, C. W. et al. The shikimate pathway and its branches in apicomplexan parasites.
J. Infect. Dis. 185 Suppl 1, S25-S36 (2002).
14. Atreya, C. E. & Anderson, K. S. Kinetic characterization of bifunctional thymidylate synthase-dihydrofolate reductase (TS-DHFR) from Cryptosporidium hominis: A paradigm shift for TS activity and channeling behavior. J. Biol. Chem. (2004). 15. Waller, R. F. et al. Nuclear-encoded proteins target to the plastid in Toxoplasma gondii and Plasmodium falciparum. Proc. Natl. Acad. Sd. U. S. A 95, 12352- 12357 (1998).
16. Zhu, G., Marchewka, M. J. & Keithly, J. S. Cryptosporidium parvum appears to lack a plastid genome. Microbiology 146 ( Pt 2), 315-321 (2000).
17. Zhu, G. et al. Expression and functional characterization of a giant Type I fattyacid synthase (CpFASl) gene from Cryptosporidium parvum.. MoI. Biochem. Parasitol. 134,
127-135 (2004).
18. Zhu, G., Marchewka, M. J., Woods, K. M., Upton, S. J. & Keithly, J. S. Molecular analysis of a Type I fatty acid synthase in Cryptosporidium parvum. MoI. Biochem. Parasitol. 105, 253-260 (2000). 19. Priest, J. W., Xie, L. T., Arrowood, M. J. & Lammie, P. J. The immunodominant 17-kDa antigen from Cryptosporidium parvum is glycosylphosphatidylinositol-anchored. MoI. Biochem. Parasitol. 113, 117-126 (2001).
20. Bacchi, C. J. & Yarlett, N. in Biochemistry and Molecular Biology of Parasites. Marr, J. J. & Miiller, M. (eds.), pp. 119-131 (Academic Press, New York,1995).
21. Keithly, J. S. et al. Polyamine biosynthesis in Cryptosporidium parvum and its implications for chemotherapy. MoI. Biochem. Parasitol. 88, 35-42 (1997).
22. Parsons, M. & Ruben, L. Pathways involved in environmental sensing in trypanosomatids. Parasitol. Today 16, 56-62 (2000).
23. Crawford, M.J., Fraunholz, M. J. & Roos, D. S. in Molecular Medical Parasitology. Marr, J. J., Nilsen, T. W. & Komuniecki, R. W. (eds.), pp. 154-169 (Academic Press, New York,2003).
24. LaGier, M. J., Tachezy, J., Stejskal, F., Kutisova, K. & Keithly, J. S. Mitochondrial-type iron-sulfur cluster biosynthesis genes (IscS and IscU) in the apicomplexan Cryptosporidium parvum. Microbiology 149, 3519-3530 (2003).
25. Geer, L. Y., Domrachev, M., Lipman, D. J. & Bryant, S. H. CDART: protein homology by domain architecture. Genome Res. 12, 1619-1623 (2002).
26. Katinka, M. D. et al. Genome sequence and gene compaction of the eukaryote parasite Encephalitozoon cuniculi. Nature 414, 450-453 (2001).
27. Riordan, C. E., AuIt, J. G., Langreth, S. G. & Keithly, J. S. Cryptosporidium parvum Cρn60 targets a relict organelle. Curr. Genet. 44, 138-147 (2003). 28. Tetley, L., Brown, S. M., McDonald, V. & Coombs, G. H. Ultrastructural analysis of the sporozoite of Cryptosporidium parvum. Microbiology 144 (Pt 12), 3249- 3255 (1998). 29. Zuther, E., Johnson, J. J., Haselkorn, R., McLeod, R. & Gornicki, P. Growth of Toxoplasma gondii is inhibited by aryloxyphenoxypropionate herbicides targeting acetyl- CoA carboxylase. Proc. Natl. Acad. ScL U. S. A 96, 13387-13392 (1999). 30. Muhia, D. K. et al. Multiple splice variants encode a novel adenylyl cyclase of possible plastid origin expressed in the sexual stage of the malaria parasite Plasmodium falciparum. J. Biol. Chem. 278, 22014-22022 (2003).
31. Dzierszinski, F. et al. The protozoan parasite Toxoplasma gondii expresses two functional plant-like glycolytic enzymes. Implications for evolutionary origin of apicomplexans. J. Biol. Chem. 274, 24888-24895 (1999).
32. Fast, N. M., Kissinger, J. C, Roos, D. S. & Keeling, P. J. Nuclear-encoded, plastid- targeted genes suggest a single common origin for apicomplexan and dinoflagellate plastids. MoI. Biol. Evol. 18, 418-426 (2001).
33. Beyer, T. V., Svezhova, N. V., Radchenko, A. I. & Sidorenko, N. V. Parasitophorous vacuole: morphofunctional diversity in different coccidian genera (a short insight into the problem). Cell Biol Int. 26, 861-871 (2002).
34. Stedman, T. T., Sussmann, A. R. & Joiner, K. A. Toxoplasma gondii Rab6 mediates a retrograde pathway for sorting of constitutively secreted proteins to the Golgi complex. J. Biol. Chem. 278, 5433-5443 (2003).
35. Chaturvedi, S. et al. Constitutive calcium-independent release of Toxoplasma gondii dense granules occurs through the NSF/SNAP/SNARE/Rab machinery. J. Biol. Chem. 274,
2424-2431 (1999).
36. Ngo, H. M. et al. AP-I in Toxoplasma gondii mediates biogenesis of the rhoptry secretory organelle from a post-Golgi compartment. J. Biol. Chem. 278, 5343- 5352 (2003).
37. Zapata, F., Perkins, M. E., Riojas, Y. A., Wu, T. W. & Le Blancq, S. M. The Cryptosporidium parvum ABC protein family. MoI. Biochem. Parasitol. 120, 157- 161
(2002).
38. Zhu, G. et al. Cryptosporidium parvum: the first protist known to encode a putative polyketide synthase. Gene 298, 79-89 (2002).
39. Simpson, A. G. et al. Evolutionary history of "early-diverging" eukaryotes: the excavate taxon Carpediemonas is a close relative of Giardia. MoI. Biol. Evol. 19, 1782-1791 (2002).
EXAMPLE 2. Identification of categories of genes and proteins of C. hominis. Introduction
Genomic sequences from pathogenic microorganisms provide fundamentally new approaches for development of vaccines and chemotherapeutic agents. Thus, reverse vaccinology invokes bioinformatics analyses to identify potential candidates from the genome data by "in silico" analysis. This approach has been successfully applied to identify putative vaccine candidates from bacterial genomes that traditional vaccine development methods have not detected. This approach (see Scarsellie et al, 2005, for review) has recently been applied in several bacterial systems including for example group B streptococci and Neisseria meningitidis. See, for example, the following references: 1) Maione D, Margarit I, Rinaudo CD, Masignani V, Mora M, Scarselli M, Tettelin H, Brettoni C, Iacobini ET, Rosini R, D'Agostino N, Miorin L, Buccato S, Mariani M, Galli G, Nogarotto R, Nardi Dei V, Vegni F, Fraser C, Mancuso G, Teti G, Madoff LC, Paoletti LC, Rappuoli R, Kasper DL3 Telford JL, Grandi G. Identification of a universal Group B streptococcus vaccine by multiple genome screen. Science. 2005 JuI 1 ,309(5731): 148-50; 2) Scarselli M, Giuliani
MM, Adu-Bobie J, Pizza M, Rappuoli R. The impact of genomics on vaccine design. Trends Biotechnol. 2005 Feb;23(2):84-91; 3) Serruto D, Adu-Bobie J, Capecchi B, Rappuoli R, Pizza M, Masignani V. Biotechnology and vaccines: application of functional genomics to Neisseria meningitidis and other bacterial pathogens. J Biotechnol. 2004 Sep 30;l 13(1- 3): 15-32. Review; 4) Kurz S, Hubner C, Aepinus C, Theiss S, Guckenberger M, Panzner U,
Weber J, Frosch M, Dietrich G. Transcriptome-based antigen identification for Neisseria meningitidis. Vaccine. 2003 Jan 30;21(7-8):768-75; and, 5) Pizza M, Scarlato V, Masignani V, Giuliani MM, Arico B, Comanducci M, Jennings GT, Baldi L, Bartolini E, Capecchi B, Galeotti CL, Luzzi E, Manetti R, Marchetti E, Mora M, Nuti S, Ratti G, Santini L, Savino S, Scarselli M, Storni E, Zuo P, Broeker M, Hundt E, Knapp B, Blair E, Mason T, Tettelin H,
Hood DW, Jeffries AC, Saunders NJ, Granoff DM, Venter JC, Moxon ER, Grandi G, Rappuoli R. Identification of vaccine candidates against serogroup B meningococcus by whole-genome sequencing. Science. 2000 Mar 10;287(5459):1816-20.
Similarly, systems wide analyses of these pathogens using genomic data leads to identification of potential 'weak links' or 'Achille's Heels' in the biological processes of the pathogen, which can be exploited for the development of inhibitors of processes essential to the parasite. Gene expression and proteomic technologies complement the "in silico " analysis of the genome data to identify potential vaccine and chemotherapeutic targets. Similar approaches lead to the identification of new biomarkers for the detection of these pathogens and diagnosis of disease caused by them.
C. hominis genes of several types that are of great potential as chemo- or immuno- therapeutics, immuno-prophylactics, and/or detection/diagnostics/quantification agents, have been identified. These genes fall into several general classes: 1) transporters; 2) receptors; 3) surface and secreted proteins; 4) organellar proteins ; 5) signal transduction proteins and kinases; 6) critical metabolic enzymes; and 7) specifies specific sequence differences. The application for each of these is outlined briefly below. Transporters. C. hominis lacks genes and consequently the enzymes and metabolic pathways required for several essential functions: e.g. biosynthesis of simple sugars, amino acids, nucleotides, fatty acids, etc. Thus, these important pathogens are dependent on their environment or host for these essential compounds, and these compounds must be transported across the parasite's membrane by a host of essential transporters. A list of these transporters is given in Table 3.
Knowledge of the sequence of these transporter genes and consequently the protein sequences permits us to predict their functions and to some degree their cellular locations and structures. Specific knowledge of the function of a transporter; e.g., a nucleotide-sugar transporter, provides a means to block the activity of that molecule. Blocking the activity of an essential transporter will prevent the parasite from importing essential compounds and the parasite will die. Thus, these transporters represent ideal targets for chemotherapeutic development.
Similarly, transporters must function at the host-parasite interface; i.e., the parasite membrane exposed to the extracellular domain. This exposed location makes these molecules ideal targets for immunoprophylaxis or immunotherapy. Vaccines developed against these proteins could: 1) protect relevant human populations or animal populations; 2) provide a means to treat infections. Thus, active or passive immunization against pools of these proteins could: 1) prevent infection; 2) provide a therapy for the cryptosporidiosis. The therapeutic effect could result from: 1) killing the parasite via normal immune mechanisms activated by immunization; 2) blocking the activity of the molecule via immune mechanisms and thereby starving the parasite until it is cleared by normal mechanisms. Thus, transporters are ideal targets for vaccines, and could be used for both immuno-prophylaxis and immuno¬ therapy. Receptors. Receptors are essential for cell-cell signalling, sensing of the environment, host parasite interactions, uptake of essential nutrients, etc. Receptors by definition are located on the membrane surface in some contact with the extracellular environment. A list of C. hominis receptors is given in Table 4. Blocking of the function of these macromolecules would likely be lethal to the parasite. The extracellular location of these receptors renders them available for attack by the host or passive immune mechanisms, and available for chemotherapeutics unable to cross most membranes. Thus, receptors are excellent targets for immuno-prophylaxis and therapy, or chemotherapy.
Surface and secreted proteins. There are many parasite proteins associated with the surface of the cell, and some that are secreted into the extracellular milieu. A list of over 1000 C. hominis proteins that are associated with the membrane or secreted is given in Table 5. Receptors and transporters will also be members of this group of proteins. Independent of the actual function of these macromolecules, they are amenable to attack by the host immune system or by passive immunization. Thus, these molecules are also idea targets for active or passive immuno-therapy or prophylaxis.
Or ganellar proteins. C. hominis is a member of the Apicomplexan parasites, and therefore encodes genes that generate apical complex organelles responsible for invasion and pathogenesis of the parasites, and other organelles required for its survival. A list of genes which are involved in organellar biosynthesis and function is given in Table 6. Since these organelles, systems and enzymes are specific to these parasites, they represent ideal targets for therapeutics. Signal transduction proteins and kinases. These proteins are required for proper, responsive and sensitive gene regulation in the parasite. Lacking the function of these proteins and enzymes, the parasites are unable to respond to their environment properly, or to differentiate correctly. Therefore, these enzymes are required for the viability of this parasite and thereby represent ideal targets for therapeutic (chemo- or irnmuno-) attack. A list of these proteins and enzymes is given in Table 7.
Critical metabolic enzymes. As outlined above, we have developed a fairly comprehensive understanding of the metabolism of Cryptosporidium simply by analysis of the genes encoded in its genome. Thus, we can see that the parasite is highly dependent on glycolysis for energy, for amino acid interconversion for generation of amino acids, for fatty acid biosynthesis and degradation, for nucleotide synthesis. Blockage or inhibition of these processes would likely be lethal for the parasite. A list of such essential metabolic enzymes and proteins is given in Table 8. These enzymes represent ideal targets for specific chemotherapeutics.
Species specific sequence differences. We now know nearly the entire genome sequence of C. hominis. Thus, we can now easily compare all of its genes to those of related parasites and pathogens. DNA/RNA of these genes provide very specific and easily readable signatures, and these signatures are generally species-specific. Thus, we have identified many sequences that can be useful for identifying C. hominis, and discriminating this parasite from other microbes (Table 9). These signature sequences can also be used for detection, quanitification and diagnostics, as well as for chemotherapeutic targets. The C. hominis genes disclosed herein and the proteins they encode are newly discovered and have not been used as targets for possible immunotherapeutic purposes, or as targets for chemotherapeutic agents, or as tools for detection/diagnosis of the parasites. As outlined above, there is no irnmuno- or chemotherapy available for C. hominis. It is essential to develop such therapies. The newly identified genes and the proteins they encode provide a new approach to chemo- and/or immunotherapy. Their advantages include one or more of the following:
1. they are essential for viability of the parasite
2. they are localized on the surface of the parasite
3. they should be accessible to the host immune system or to blocking agents 4. much is known about these processes (e.g., transport, metabolism, etc.) and analogs that block them can be designed
5. the proteins /peptides thereof can be synthesized chemically or in recombinant bacteria
6. the peptides differ significantly from host molecules (both host and parasite homologs have been fully sequenced), and analogs that block the parasite version can be designed so that they do not block any host function.
7. vaccinogens can be designed so that the host immune response will act only on the parasite protein.
In short, these new genes present novel targets for chemo- and immunotherapy and prophylaxis for Cryptosporidiosis, a disease for which no such agents currently exist.
Genome Annotation. The DNA sequence of C. hominis was annotated using a suite of analysis programs to identify important genes. Protein genes and their structural and functional annotations were derived. Approximately 4,000 genes were identified Table 1). Similarly, structural KNA genes (tRNA, rRNA) were identified (not shown). Vaccinology. One focus of research in the Cryptosporidium vaccinology project has been application of "in silico " genome analysis to identify potential vaccine candidates from the complete genome sequence of Cryptosporidium hominis. The general steps that are followed are: 1. Apply bioinformatics tools to predict possible antigens from the whole genomic sequence.
2. Focus searches for possible antigens by gene expression analysis, proteomics, and other "systems" approaches.
3. Clone, express, and purify putative candidates. 4. Validate the possible protective or biological role of the candidates in animal and
"in vitro " models.
5. Select antigens with positive results for further testing in animals and eventually in humans.
Reverse Vaccinology in Cryptosporidium Identification of potential target antigens using bioinformatics: The initial step was to apply bioinformatic tools to scan the whole genome sequence of C. hominis focusing on proteins that are predicted to be secreted, ER localized, surface-exposed and/or contain antigenic motifs, and that therefore represent potential vaccine targets. Since these proteins are most likely to be exposed to the immune system, they constitute the initial target of the project. This approach has been successfully used for several ne recombinant vaccines (see, for example, Scarsellie et al, 2005, fore review.) Screening of the genome has been carried out using various programs that predict the following characteristics: presence of a signal peptide possible membrane protein by presence of transmembrane domains GPI- anchor domains antigenicity similarity to virulence factors characterized in other pathogens no similarity to human proteins. role in transport of ions or essential metabolitesions or essential metabolites.
Using various bioinformatics tools, close to 500 Cryptosporidium candidate proteins that are most likely exposed to the immune system were identified (Table 10). Priority is given to those that present a single transmembrane domain, as those are less likely to be toxic to E. coli or other vector hosts used for cloning and expression of the recombinant proteins. Focus searches using gene expression and proteomics
The best antigens for vaccines are likely to be those associated with the membrane during sporozoite stages in the development of the parasite. The sporozoite form of the parasite is responsible for invasion of the intestinal epithelium causing pathology. To identify those proteins, a microarray that targets every gene in the C. hominis genome has been generated. The arrays are used to identify those genes that are expressed in C. hominis sporozoites. These arrays detect mRNAs transcribed from the genes. Therefore, in parallel with the gene expression array work, proteomics analyses are performed. A database containing all C. hominis proteins has been constructed, and C. hominis oocysts and sporozoites are analyzed for those proteins that are expressed in those stages of the parasite. This information permits identification of proteins for vaccinogens.
The array in its current configuration consists of -4,000 70 base synthetic oligonucleotides bound to glass slides. Each of the -4,000 C. hominis genes is represented by a single, specific oligonucleotide in the array. Li order to assess expression of these genes in a specific stage, a biological sample containing C. hominis parasites at that stage of development is provided. Total RNA is isolated by standard technology, labeled with fluorescent dyes, and hybridized to the array. A similar RNA sample derived from an alternative stage of the parasite's life cycle is used is labeled with an althenative fluorescent dye and used as a control. Both labeled RNAs are hybridized to the same oligonucleotide array, and the arrays are washed and scanned in a fluorescence scanner. The readout of the scanner provides an estimate of the amount of RNA for each gene that is present in the initial sample and a comparison between the two samples provides an estimate of the relative expression level of each gene in the two samples. Thus, genes that are up or down regulated relative to the control can be identified. hi addition to examining gene expression differences in various life cycle stages, these arrays may be used to monitor C. hominis parasites under other conditions of interest, for example, to monitor gene expression in response to an external stimulus or variable, such as introduction of a drug or other agent into a culture of the parasites; or to monitor the course of a C. hominis infection, either in culture, or in an infected individual.
The 70 base oligonucleotides in the array were designed by ArrayOligoSelector"11 version 3.8.2, (http://arrayoligosel.sourceforge.net/), which selects optimal sequences by:
1. Examining every possible 70mer sequence from every gene;
2. Using BLASTN (against the whole genome) to check the uniqueness of each 70mer.
3. Uniqueness is scored as the theoretical binding energy of a candidate oligo to its most similar genome sequence. The binding energy is calculated using a nearest- neighbour model with the established thermodynamic parameters;
4. Using the LZW compression algorithm to calculate the sequence complexity score in bytes between the oligo sequence and the its compressed version;
5. Determining the self-annealing score, calculated as the alignment score of the optimum local alignment between the oligo sequence and its reverse compliment using the Smith- Waterman algorithm;
6. Calculating the GC content of the oligo;
7. Choosing, for each gene, the oligo that maximizes uniqueness and sequence complexity, mim'mizes self-annealing and has GC content closest to specified by the user; also tries to minimize distance to the 3' end of the gene.
The oligos were synthesized commercially and validated in the lab, and the process is ongoing. Initial tests were performed as follows:
The oligos were reconstituted to 100 pmoles with sterile distilled water; Several dilutions (10, 25 and 50 pmoles) were tested for the best printing conditions; Two test plates were printed on Corning UltraGAPS slides (amino-silane coated); These slides were stained in SYBR Green II and hybridized with Cy-dye labeled
RNAs.
The results of the initial prints indicated that the oligos were intact and the hybrodization was strong. The relatively even staining indicated that that hybridization of each gene was essentially equivalent. Finally, lack of hybridization to the negative control confirms specificity of the hybridization. Thus, use of the array to identify genes that are expressed in C. hominis sporozoites by detecting transcribed niRNAs was validated. Cloning and expression of protein candidates in Escherichia coli
In parallel with the gene expression array work, proteomics analyses have also been performed. A database containing all C. hominis proteins has been constructed, and C. hominis oocysts and sporozoites are characterized for those proteins that are expressed in those stages of the parasite. This information permits us to focus on the most likely proteins for vaccinogens.
The cloning and expression of the candidates has been carried out using the pET system from Novagen that allows the cloning of PCR products in a ligase-independent reaction (Ek/LIC cloning). The proteins of interest are expressed as fusion proteins to an epitope tag that permits their detection and purification. Various tags (e.g. His-Tag, GST-tag and Nus-Tag, etc.) are known and available. In addition the Ek/LIC cloning system can be adapted and used in a high throughput pipeline for the cloning and expression of recombinant proteins.
The cloning of PCR products by LIC requires the presence of non-complementary single-stranded overhangs in the vector that anneal to complementary single stranded overhangs on the PCR fragment. In order to create these overhangs the LIC method uses the
3 '-5' exonuclease activity of T4 DNA polymerase, which in the presence of a single deoxyribonucleotide creates very specific 13-14 base single stranded overhangs in both vector and PCR fragment. The primers used in the PCR reaction include 5' extensions that after the treatment with T4 DNA polymerase generate the overhangs complementary in the fragment to the overhangs created in the vector.
Sense primer: 5' GAC GAC GAC AAG ATX- insert specific sequence 3'
(SEQ ID NO: 4001)
Antisense primer: 5' GAG GAG AAG CCC GGT- insert specific sequence 3' (SEQ ID NO: 4002) After treatment with T4 DNA polymerase in the presence of dATP the PCR fragment is flanked by the overhangs as shown below:
5' GACGACGACAAGATX-Target protein-xxA (SEQ ID NO: 4001) AX-Target protein-xxTGGCCCGAAGAGGAG 3' (SEQ ID NO: 4002)
As a first step, the genes encoding thirteen of these antigens were PCR amplified from genomic DNA. The PCR products were purified and cloned into the vector pTriEX-4, a vector that allows the expression of the proteins as 6X-His and S-tag fusion products in both prokaryotic and eukaryotic hosts. The His-tagged products can be purified through nickel- activated columns. The recombinant plasmids were characterized by restriction enzyme analysis and DNA sequencing to confirm the presence of the Cryptosporidium target gene. Protein overexpression: The recombinant plasmids were used to transform the Escherichia coli strain BL21 (DE3) or other appropriate vector for expression of the fusion proteins. The target genes are cloned into pTriEX-4 under the control of the bacteriophage T7 promoter. Transcription is initiated by the enzyme T7 RNA polymerase which is present in the chromosome of the bacterial host and is under the control of an inducible promoter. In the presence of the inductor, IPTG, T7 RNA polymerase is produced in the bacterial host resulting in the expression of the target protein. This gives this system an excellent way to regulate the production of the target protein under controlled conditions, which is a point to consider in case that the protein has a toxic effect in E. coli. The level of expression is very high and can be 50 % of the total protein present in the bacterial host. The expression of the recombinant genes was carried out by culturing bacteria in 3 ml of Overnight Express Instant
Tb medium (Novagen) at 370C for 12-13 hours. This medium is designed to achieve a high level of expression with IPTG-inducible bacterial systems without the need of monitor cell growth. Expression has been achieved for all but the Zn+"1" transporter and the Thrombospondin-containing gene TSPl. The Zn transporter seems to be toxic for E. coli as bacterial cultures containing the Zn-transporter clones start to lyse after they reach early stationary phase. Most of the proteins were expressed in E. coli in an insoluble form as inclusion bodies. The exception is the gene encoding the Profilin-like protein..
Therefore, these proteins were expressed using a different vector since the same PCR product can be cloned in different vectors. Two additional epitope tags were assayed, GST and NUS. The proteins expressed from clones in the GST-tag vector were also insoluble. The proteins obtained from the NUS-tag expressed the protein in higher amount compared to the previous two vectors and the fusion proteins can be detected in the soluble fraction by Western blot. Very high levels of expression have been achieved with the Nus-tag clones which results in proteins becoming soluble as detected by gel staining. The results for the experiments are summarized in Table 11.
The nucleotide sequences that encode the proteins, and amino acid sequences of the proteins, are as follows:
1) Zinc transporter (Chro.10338, start position 677, end position 2053) is encoded by the nucleotide sequence:
ATGAAAGACTCAGGTCTGGAAAAGCCATTACTTAATGGGAATGGATTTAAAATA TTTGCAAGTACAGAGAGTGTTCAGAAGAGGTTAATATATGCAATCTTTTTCTGTC TAGTCTTTACATTGATAGAGGTTGTTGTGGGTATATTATCAAACTCACTGGCACT AATATCAGATGCATCTCACCTCATTTCAGATATATGTAGCTATTTCATTTCTCTG CTTGGTATCCACCTTTCCAAAAGAAAGGCCACAAACACAATGTCATTTGGTTAT
AACAGAGCTGAAATATTAGGGGCTTTGTTAAGCATTCTACTAATATGGTTCATG ACAATCATGCTTGTTTACGAGGCTATTCAAAGAATGTTATATCCTGTGAATGTTG ATGGGTTTTCTATGTTTATTACCGCTATTTTTGGTACTTTGTCCAACTTATTTATT AGCTTTGTGTTATCTGTTCACAATCATGGAATAGGTTCAATTGGAGCAGATTGTA CCCAACACAATCATACACATGAACATATGCATGAACACGACTGTAAGCAAGCTC
AAACTCATTTTCAGGATGATTCACTGTATTGCAAAGATCAACAACTAGTAGAAA ATCAAGAACAAATTGGAGGAATTAACACTACTTTACTTGAATACCACCATAGAA GCCAAATGAGAACTAAGGATTTAGATCATGAACTTAATAATTATACTAATTTAA TGAACTCTCCAGTTATAAGAAGAGTCAATTCTGGTTTAAAAGAGTGTTCAGAAC GTCAAAATGACTATTCTCATCTCCATAGTAATAATCACTATCCAAGTAAACATTC
CTCTGAACAAGAAAGCTTAGCGCTTAAGTCTGCTTATATCCATGTTTTAGGGGAT ATTTTACAGAACATCGGAGTAATGATTGCTGGATTACTGATTTTATACAATCCAG CATGGACAATCGCCGATCCTCTATGTACTATTCTATTCTCCTTCTTTGTCCTCGCA ACAACCATCAAAATCCTAAAAGATTCCGCCAATGTTCTAATGGAAGGAGCCCCT ATAGGAATTGATTGTGAATCCATTCAAAACGACTTTCTAAAGCTTTCTTCAGTGC TTGAAGTTCACGATCTACATGTTTGGTCTGTATCTGTTGGAGTTCCTGCATTATCT TGTCATATTGTCGTAGCATCAGAAGATAATGCTAGATTTACATTAAGATATGCA ACGGATCTCTGTCAAAAGAAATATGGAATATTTCACACCACCATTCAAATTGAC TATTCTCCAAATAAAGCCACTTGTGAAACAATACATCATCAAAAATGTCTAGTT GGCTCTAATAACCAAAATAAAAGTGAAATTCACCAAATAATTCATCCCGTTGAC
TATTCTGCTTAG (SEQ ID NO: 1)
and has amino acid sequence:
MKDSGLEKPLLNGNGFKIFASTESVQKRLIYAIFFCLVFTLFFIWVGILSNSLALISDAS HLISDICSYFISLLGFFLLSKRKATNTMSFGYNRAEE.GALLSLLLIWFMTIMLVYEAIQR MLYPVNVDGFSMFITAIFGTLSNLFISFVLSVHNHGIGSIGADCTQHNHTHEHMHEHD CKQAQTHFQDDSLYCKDQQLVENQEQIGGINTTLLEYHHRSQMRTKDLDHELNNYT NLMNSPVIRRVNSGLKECSERQNDYSHLHSNNHYPSKHSSEQESLALKSAYIHVLGD ILQMGVMIAGLLILYNPAWTIADPLCTILFSFFVLATTIKΓLKDSANVLMEGAPIGIDCE siQNDFLKLSSVLEVHDLHVWSVSVGVP ALSCHΓVVASEDNARFTLRYATDLCQKK YGIFHTTIQIDYSPNKATCETIHHQKCLVGSNNQNKSEIHQIIHPVDYS A (SEQ ID NO.
2) ;
2) Ribosomal protein S19 (CP15) (Chro.60368, start position 13760, end position 14197) is encoded by the nucleotide sequence: ATGGCAGATACTGAACAAAAGAAGAGAACCTTCAGAACTTATAGTTACAGAGG TGTTGACCTCGACAAGCTCCTTACCATGAAATTGGATGAGGTTGTTGAGCTTTTA
CCAGCACGTAAAAGACGTAAGATAGCCAGAGGTTGTCTTAACAGAAGAACTGC AGCTTTTATCGCAAAGCTTCGCAAATCTAAGGCTGAATGTCCAATGGGTGAGAA ACCTGTTGCTGTTCGTACCCATTTACGTAATATGGTTATCCTCCCAGAAATGGTT GGTTCTGTTGCAGGTGTCTACAATGGTAAGACTTATGTTACCGTTGAAATTAAGC CAGAAATGATTGGGATGTACCTTGGAGAGTTCTCTATCACCTACAAGCCAGTAC
GTCATGGTAAGCCAGGTGTTGGTTCAACCAGTTCTTCCAGATTCATTCCTCTAAA GTAA (SEQ ID NO. 3) and has amino acid sequence:
MADTEQKKRTFRTYSYRGVDLDKLLTMKLDEVVELLPARKEIRKIARGCLNRRTAA FIAiαi^SKAECPMGEKPVAVRTHLRNMVILPEMVGSVAGVYNGKTYVTVEIKPEM IGMYLGEFSITYKPVRHGKPGVGSTSSSRFIPLK (SEQ ID NO. 4);
3) Mucin-like glycoprotein 900 (Chro.70447, start position 855, end position 3963) is encoded by the nucleotide sequence:
ATGACAACAACAACAACACCACCATTACCTGATATCGGTGACATTGAAATTACA CCAATCCCAATTGAAAAGATGTTGGATAAGTATACAAGAATGATTTATGACTAT AACAGTGGTTTATTATTAGACTCTAATGATGAACCAATTCCAGGTTCTCAAGCAG GACAAATAGCTGATACAAGCAATTTATTCCCAACTCAAACTCACAAGAGTACTG
GTTTACCAATTGATCCAATGGTTGGTCTTCCATTTGATCCAAAATCAGGTAATTT AGTACATCCATATACCAATCAAACAATGTCTGGTTTATCAGTATCATATCTTGCT GCTAAGAATTTGACAGTTGATACTGATGAAACCTACGGTTTACCAATTGATACA CTCACTGGTTACCCATTAGATCCAGTTAGTTTGATTCCATTCAATCCAGAAACTG GTGAATTGTTTGATCCAATCTCAGATGAGATCATGAATGGAACAATTGCAGGTA
TTGTTTCAGGAATTTCTGCAAGTGAGTCATTATTATCTCAGAAATCAGCTCAAAT CGACCCAGCAACAAATATGGTTGTTGGCGAATTTGGTGGATTGTTGAACCCAGC AACAGGAGTGATGATTCCAGGTTCTTTAGGTCCATCAGAGCAAACTCCATTCTC CCCTGAAATTGAAGATGGTGGTATTATTCCTCCAGAAGTAGCAGCAGCAAATGC TGATAAATTCAAGTTATCTATTCCTCCAAGCGTACCAGAATCAATTCCAGAAAA
GGATCAGAAGATCGATTCTATTTCTGAATTGATGTATGATATTGAGTCAGGTAG ACTTATTGGTCAAGTATCAAAGAGACCAATCCCAGGTTCAATTGCTGGTGATTTG AACCCAATAATGAAGACACCAACACAAACTGACAGTGTAACTGGTAAGCCAAT CGATCCAACCACAGGTTTACCTTTCAATCCACCAACTGGTCATTTGATTAACCCA ACAAATAATAATACCATGGATTCTTCATTTGCTGGTGCATACAAATATGCAGTTT
CAAATGGTATCAAGACTGATAATGTTTATGGTTTACCAGTTGATGAAATAACAG GTTTGCCAAAGGATCCAGTCTCAGATATTCCATTTAACTCAACTACAGGTGAATT GGTTGATCCATCAACAGGAAAGCCAATTGACAATTCTACTGCTGGTATTATTAGT GGAAAACCTGGCTTACCACCTATTAAAGATGAAAATGGCAATTTGTTTGATCCA TCAACTAACTTGCCAATAGATGGTAATAACCAATTAATTAACCCAGAAACCAAC AGTACTGTCCCAGGATCAACTTCAGGTACTACAAAACCAAAGCCAGGAATTCCA GTCAATGGTGGAGGTGTTGTACCTAATGAAGAAGCTAAAGATCAAGCTGATAAG GGTAAGGATGGATTAATTGTTCCACCAACTAATTCTATCAATAAGGATCCAGTA ACAAATGCTCAATACAGTAATAGTACTGGTAACATTATTAACCCAGAAACAGGA AAAGTTATTCCAGGCTCACTTCCAGGCTCTCTCAACTATCCATCATTCAATACTC
CACAACAAACTGATGAGATTACAGGAAAGCCAGTTGATACTGTTACTGGTTTGC CATATGATCCATCTACAGGTGAAATTATCGATCCAGCAACTAAATTACCAATTC CAGGATCGGTTGCAGGTGATGAAATTCTCACTGAAGTATTGAACATTACAACAG ATGAAGTAACAGGTTTGCCAATTGATCCTGAAACCGGTCTTCCAAGAGATCCAG TATCAGGACTCCCACAACTTCCAAATGGTACTTTGGTTGATCCATCAAATAAAA
AACCAATTCCAGGTTCACATTCTGGATTTATTAATGGTACATCTGGAGAACAATC ACACGAGAAAGATCCAGGTACTGGTAAGCCACTTGATCCAAATACAGGTTTACC ATTCGATGAAGATTCTGGTAGTTTAATTAACCCAGAGACTGGAGATAAACTTCA AGGATCACATTCTGGTACATTTATGCCAGTGCCAGGTAAGCCACAAGGTGAAAA TGGAGGTATCATGACACCTGAGCAGATATTGGAAGCATTAAATAAATTGCCAAC
AAGTAATGAAGCAAAATATTTCACCAAAACCAAGTTCAGATGCTGTTCCAGACA AACCAACAAATACTTGGTGGAATAAGATTTCTGGTCAAACCTACCAGGTTGATG GAGAGAAGACTATTCCAGGTTCTGCAGCTTCAGTAATTCACACTGCTCTTGGAA CACCAACTCAAACTGATCCAACAACAGGACTTCCATCTGATCCATCAACAGGTT TACCATTCATTCCAGGATTTAACGTACTTGTAGATCCTCAGACTGGAGAGCAAA
TGAAGGGTTCTGTTCCfTATGTTTCATTGTACGTTAAGGAAAAGAACATTGTAAC AGAAGCTGCTTATGGTCTACCAGTTGATCCAAAGACTGGTTTCCCAATTGATCCA ATTAGTTACCTCCCATTTGCTAAGAATGGTGAATTAATTGATCCTATCTCTGGTA AATATTTCAGTGGTTCAATTGCTGGATTCATTTCTGGTAAAGCTGGTACACAATC TAAATCATCTGATGAGTCAGGTAATCCAATTGATCCATCAACAAATATGCCTTA
CGATCCAAAAACAGGCAAATTAATTGATCCAGAATCTGGCATTGCTATTGATAA TTCTATTTCAGGTGTATTTGCAACTGTACCTGGTACTGCTGCACCGAAAAAGGGT GGTGTCATTCCAGAGTCAGTTGCAGCTGAGGCAGCAAAGAAATACTTTGCAGCC AATGTTGAAGGAGGAGAAGGAGAAAAAGTTCCACCACCACCAGAATCATCTAG TAACATTGCAATCCAAGCTGCTGGTGGTGCTTCTGCTGCTGTAGGTCTCGTAGCT
GCTGGTGTTGGTGCATGGTATGCAAGCAGAAACAGACAAGAAGGAGAAGATGA TGATGACTATGCAGATGGATTTGAAGCAGAATATGAAGAAGAAGAGGAAGAAG AGGGTGATGAAGCAGCAAATGAAACTGTTGTTACAATTGAGCGTGATTCATCAT TCTGGAACGAATCTTAA (SEQ ID NO. 5)
and has amino acid sequence: MTTTTTPPLPDIGDIEITPIPIEKMLDKYTRMΓYDYNSGLLLDSNDEPIPGSQAGQIADT SNLFPTQTHKSTGLPΓDPMVGLPFDPKSGNLVHPYTNQTMSGLSVSYLAAKNLTVDT DETYGLPΠDTLTGYPLDPVSLIPFNPETGELFDPISDEIMNGTIAGIVSGISASESLLSQK SAQiDP ATNMVVGEFGGLLNPATGVMIPGSLGPSEQTPFSPEIEDGGΠPPEVAAANA DKFKLSIPPSVPESIPEKDQKIDSISELMYDFFISGRLIGQVSKRP]PGSIAGDLNP]MKTP TQTDSVTGKPIDPTTGLPFNPPTGHLINPTNNNTMDSSFAGAYKYAVSNGIKTDNVY GLPVDEITGLPKDPVSDIPFNSTTGELVDPSTGKPIDNSTAGΠSGKPGLPPIKDENGNL FDPSTNLPΠDGNNQLINPETNSTVPGSTSGTTKPKPGIPVNGGGVVPNEEAKDQADKG KDGLIVPPTNSINKDPVTNAQYSNSTGNIINPETGKVIPGSLPGSLNYPSFNTPQQTDEI TGKPVDTVTGLPYDPSTGEΠDPATKLPIPGSVAGDEILTEVLNITTDEVTGLPIDPETG LPRDPVSGLPQLPNGTLVDPSNKKPIPGSHSGFINGTSGEQSHEKDPGTGKPLDPNTG LPFDEDSGSLINPETGDKLQGSHSGTFMPVPGKPQGENGGIMTPEQILEALNKLPTSN EAKYFTKTKFRCCSRQTNKYLVEMKQNISPKPSSDAVPDKPTNTWWNKISGQTYQV DGEKTIPGSAASVIHTALGTPTQTDPTTGLPSDPSTGLPFIPGFNVLVDPQTGEQMKG SVPYVSLYVKEKNIVTEAAYGLPVDPKTGFPIDPISYLPFAKNGELIDPISGKYFSGSIA GFISGKAGTQSKSSDESGNPIDPSTNMPYDPKTGKLIDPESGIAIDNSISGVFATVPGT AAPKKGGVIPESVAAEAAKKYFAANVEGGEGEKVPPPPESSSNIAIQAAGGASAAVG LVAAGVGAWYASRNRQEGEDDDDYADGFEAEYEEEEEEEGDEAANETVVTIERDS SFWNES (SEQ ID NO. 6);
4) CP15/60 (Chro.40225, start position 10793, end position 12259) is encoded by the nucleotide sequence:
ATGTTCGAGTTTATTTCAGAAATGTTTCATTCATGTTGCAAATTAAAAAAAAATC AAAAGAATGATGAATACATTTTTATCTTGTGCCCTACCCCAAGTGATTTAGAAG AGGAATATATTGATCAAGAAGGAAATGTCAAAAAAAAGAAGCTCGAAAAAATT AGAGGAACTGCCAGAAATATTGTCGATAAGGAAATTGTCAGGGAGTGGAGTGG AAGGGAAATTGGAAGCTGTATTTGCTGTCATTTAATATATGAAGACGAAATGAA TGTTTATAGAGCTGATAAATATGGCAGACATATTGGTAAGGACCATGAAGAATA TGAAGGTAGCCAAACAAGAGAAGAAAACCGTGTTAACTCAGTTGAATCTCTGAG CTCATATGGCTCAAGAAAACATTTTTCTGAGGAGCCAAATAGCGCAGATTCCAA CTCTACCTCAATAAGTTCAGATGAAAATAATAATGCAGTTGAGAATAAGAGTAA
AAAAACAAGAGAAAGGAGGAAGTTAAATATCAGTAGATCCCCAAGCGTAATTG AGAAGGAAATAGATGAAAAAGAAAAGAAGAACAAAAAACTAAAAGAAACAAA AGATGCCAATAATAAAGAATGCTCCACAATTAGTTCTGATATAAATAATGATAT CCATAACGCGGATGAGAAAACAACTGATAATAGAAATAACAAAAAGCTAGAGA ATACTAATGTAAAGAATGACGAGCAAATTCCATTCTCCGATCAAAAAAAATATT
CTAAATCTTCTCCACTCTCAAAGAATCAATGCCCTCCAAAGTTAGGAAAAAGGC CACCCATGAAGAATGAATTATTGGCTATGAATGGTCAGAAAAACAATTCACTTA AGTCATCAATTGCAAATAGTAAAAAATGTAGTAAAAAAATATCAAGTACTCCGA AAAATGAATTTAACAAAATAATTTTGGAAAAAGAAAAGGTAGAAAGTAATTCTC GCGATACTCATAAAGATGACAAAAATCAAACTGGAAATAATAATGACCAGCAA
ATCAACCACATTACTAGCAGTTCTAATTCTGATAAAGAAATGATTGATAACAGT GGGGAAATTAAATATGAAGAGGAAGAGATGAAGTTTAACAAAGATATTTCTTCG AAAATAATACGTCACAGAGCATTAATAGGAATTCAAGCCGAAATTATTCTAAAA GATGGATCGACAACGGACTGTAAAGTTAGCTTCTCAGATGAGGAAGATGATCTT TCATTTATTTGCAACGATAAAGTTAAAGCTGTTCCTTGGAGTAACATTAAAGAG
ATTTTTACAACAAAAAGTGAACTTAGAATGGTGAATACACGAGCACCTATTTTT AAAGACCCAACATTAATTATTGCACTACATTTAAAAGATACAGGAAATTGTATA CCTTTGAAATTTGATTCTAAGAAAAGCAAAGAAGATTTTTTAAATTTCGCCCTCA GAATGATTGGGTAA (SEQ ID NO. 7)
and has amino acid sequence:
MFEFISEMFHSCCKLKK-NQKM)EYIFILCPTPSDLEEEYroQEGNVKKXKLEKIRTAR NIVDKEIVREWSGREIGSCICCHLrYEDEMNVYRADKYGRHIGKDHEEYEGSQTREE NRVNSVESLSSYGSRKHFSEEPNSADSNSTSISSDENNNAVENKSKKTRERRKLNISR SPSVffiKEIDEKEKKNKKLKETKDANNKECSTISSDINNDIHNADEKTTDNRNNKKLE NTNVKNDEQIPFSDQKKYSKSSPLSKNQCPPKLGKRPPMKNELLAMNGQKNNSLKS SIANSKKCSKKISSTPKNEFNKΠLEKEKVESNSRDTHKDDKNQTGNNNDQQINHITSS SNSDKEMRONSGEIKYEEEEMKFNKDISSKIIRHRALIGIQAEIILKDGSTTDCKVSFSD EEDDLSFICNDKVKAVPWSNIKEIFTTKSELRMVNTRAPIFKDPTLIIALHLKDTGNCI PLKFDSKKSKEDFLNFALRMIG (SEQ ID NO. 8)
5) Thrombospondin related adhesive protein (TRAP Cl) (Chro.10390, start position 4021, end position 6078) is encoded by the nucleotide sequence:
ATGAAAAAGTTAATACTTTATTTAGTATTACTACATATATATATTGTTCAGAAAT ATGTAATATGTTCAAAATTAACTCATTATTCAGTAGGTGGTCATGCATCAACATC AAGAGTGAAGGGAAGAAGTAGTAGTGGTAGTAGTAGTAGTAGTGGCGATTTTA
ATGTACCAGGATTAAATGGATATTTATGTCCAAGCTATAATAGAGACCCAAGAG GATTTGGTTGTTTTGGTATGAATACAGCATATACGGTTAAAAAGAATAGTTGGC AAGAATGTGCAAATCAATGCTATTGGAGTAAATATACAGTATTTGGTAATTGTC AAAGATCTGTATATAATTCAAATAATAAAGATTGCTATATTAAAAGTGGTGATA ACAGATGCGTGAAGTCTCCAGATGGAATGATTTTAACAAATAGGCAATCATATA
TGATCGGAGAGTGTGCGACAACATGTACTGTTTCAACTTGGTCAAGTTGGACTA CATGCTCAGGGGTATGTGGTGAGATGAGATCAAGAACAAGAAGTGTGTTATCAT TTCCAAGATACGATTATGAATATTGTCCACATCTGATAGAGTATTCAAATTGTGT AGTACAAAATAAATGCCCAGAAAATTGCCCACAGTATGGGGTTTCAATATTGGG ATGGGGATGTCAGTTTGAATCAACTTTTTCATTTAATAAAAATTTATTTGTTAGT
TATGAAGAAGATTGGAGGGGTTGCATGTCAACTTGCAAACAGGATCCATTTTGT GTAGCTTGGTCGTATAATGCAACTTTATCAGAAGGACCAGATTCTGTTGGATTTT CAAGAGAATATCGTCCATGTTATACACATAGATTTGCTTCAGGATGTCAAGCTTT AGCACCAGGATGGGTATCAGGTAATAAGAATACAATAAATGTTGATTGTGAAAC TGGTACTTGTATACATAATGAATGGTCATCTTGGACAACATGTAAAGATCCTTGT
AGTAATACTGAAACAATGAGTAGAAATAGGACAGTAAAGACTGTATCTCAGAA TTGGGCAAGTACACCTTGTAGGGATGAGACTCAAATTCAACTTTGTTCAGAAAA CCCACAAAGTATTGAAACTTGTAAAACTTGTTTAGTAGGTGGTTGGTCAGAATG GTCAGATTGTTCAACAAGTTGTGGAGAAGGTAATAGAGTTAGAACACGTGAAGT TACTAAACCTCCATTGAATGGAGATGATTCAACATGCCCAGAATTAATTGAGAA AGAAAGTTGTAATAAAGATGTGGAATGTCCACATGTTCAATGTGAATTGGGAGA ATGGTCTTCTTGGTCACCTTGTAGTGTAACTTGTGGATGCGGAACAACTACAAGA AATAGGGAAGTAAAGGGAGAGAATTGTACAGAATTATCAACAGAATCAAAGAA GTGTAATTTGGCAAATTGTGACGATAACTCTGCATCATGTACTGCAGTTATGTCA GTTTGGTCAGAATGGTCAGTTTGTAGTGAGAAATGTGATCAGGGAGTAGTAAGA
AGGTATCGTGATTTTGATTTTACAAAAATTGGGGTTTTTGGTTATAATCCACCCG GTACATCAGAAGAACAAAATAAAGTGAGAGAAATATGCAAGGATACTCCAACA TTAGAAGAGGAGCCATGTACTTCAGGAGTTGCATGTACTCCAGGATGTAAATAT ACTGAATGGAGTACTTGGTCAAGCTGTGATTGTTCTGGAACTCAAACTAGAGAT 0 AGAGTTGTTACTTTCCCTGAAGGTGTAATTGATGCAACTTGTCAGAGTTCTAAAG
ATACAAGATCATGTAGCAAGCCTGAAGGTTGTACAGAAACTGCTCCAGATTCTG GAGACGCTACACTTGCCATTGCTATTGGATTACCAGTTGGTATTCTTGGATTATG CATTATTGCTGGTTCTTTGTTTTTAATTGGTGGGAGATCAGGTGATCAGGAGGAG GATGAGACAAGTTATCAATACTTTGATCAACCTTCTGCTACTTTAGATCAAGACT 5 CAGAATATGTTCAAGAAATTGGTCCAGAGAGTCAGAACTGGGCTAGTTGA (SEQ
ID NO. 9)
and has amino acid sequence:
MKKLILYLVLLHIYIVQKYVICSKLTHYSVGGHASTSRVKGRSSSGSSSSSGDFNVPG LNGYLCPSYNRDPRGFGCFGMNTAYTVKKNSWQECANQCYWSKYTVFGNCQRSV O YNSNNKDCYIKSGDNRCVKSPDGMEVTNRQSYMIGECATTCTVSTWSSWTTCSGVC
GEMRSRTRS VLSFPRYD YEYCPHLffiYSNCVVQNKCPENCPQYGVSILGWGCQFEST FSFNKNLFVSYEEDWRGCMSTCKQDPFCVAWSYNATLSEGPDSVGFSREYRPCYTH RFASGCQALAPGWVSGNKNTINVDCETGTCIHNEWSSWTTCKPCSNTETMSRNRTV KTVSQNWASTPCRDETQIQLCSENPQSIETCKTCLVGGWSWSDCSTSCGEGNRVRT 5 REVTKPPLNGDDSTCPELIEKESCNKD VECPHVQCELGEWSSWSPCSVTCGCGTTTR
NREVKGENCTELSTESKKCNLANCDDNSASCTAVMSVWSEWSVCSEKCDQGVVR RYRDFDFTKIGVFGYNPPGTSEEQNKVREICKDT (SEQ ID NO. 10)
6) TSPl domain-containing protein TSP7 precursor (Chrom 60103, start position 12, end position 1982) is encoded by the nucleotide sequence: 0 ATGGATTCAATTAACTTTAGAAGCATTTATATTCCATCAGCAGTGAGGTATATTA TATTACTTTTATTATGGACAATATTTACAAAAAATGTTTATAGTGAAAGTAGTGA AGAAACTTTATTGGGAAGATCAGTATTGGATTTAAACAAGAAAAATACATGTGA ATACTATGGAGAGCAGGATGGTATGTTTACTGATTCATTTCATTCAAGAATATGT ATAGTTCCAGAAGATGGATTACATGGAAAAAGGGAATATGAAAATCATCAAAA AAAAACATTTGGAACAATTAGACCAAATAATAAACAATTATCTGATAATAAATT
ATATAGGAAAGATGATCATTTAACTTCTTCAATTGCAGATTTTGATAGTAATTCT GTGAGAATACAGAGAAAAAACGTGGATTTAGAAGCTATGTTTGGAATAGGAAA AGATAACAACAGAATGAATCTTAATAATGAAGCAATTCAAAGTTTCTATTCAAA TAATGAAACAGAAAGCCAAGATAAGAATGCGACAAACGACTATTTTTTATTTAA AGAAGGACTTTTGAAATTTCAAGAGAAAAAGATATTAAGATATTATTTATATGA
TGTAGGAAATAAAGTCTATTCAGATACTATAGCTTATCCAGAAAATGTTATATC AGAAAACTCTGCATTTAACTATTTGGGGAATTATGTAGATGTTTATGAAATTAGT AAAGTATCAGATCCACCAGTAATTTCATGGCCAAATAATCACATAGTTTTTATAC ACTCTCAGGTAAAATCTGATGGTACATTTAAATTTCAAGTATATACTAGCTCAGG AGAGATAGGATTTTATTTTGAAGTAACTGATAATAGTTATAAAACAGGTTGTGG
TAGTTATTCTAGAGTTGATAAAAGCAAATTTACTCACTCTGCAAATTCTTTAATT CAAGTTCAATTAGTAAGAAGAAAGTTTGGATTTAATGTATTTGTTGATGGTACTA GAAGAACACAACTAGATATAATTGATTGTATTGCAAGTGTTCCAACTAAAGTTC AAATAACTAGTGGATCAGGATCACAAATTTATCCAAAAGTAGAAGATTGTCAAA TTTCACAGTGGACAGATTGGTCAACTTGTTCAAAAACTTGCTCAACTGGTTCAAA
AGCTAGATACCGTTCAGTAATTATGCCAAGTATGAATGGTGGTTTACCATGTCCT AAATTACTTGATTCAAGTCCTTGTAATGCTGATATTTCATGCTCATCATGCCAAT ATTCGGAATGGACAATGTGGGGTGAGTGCTCAGCTACTTGTGGATCAGGATCAA CAACCAGAACAAGAAAGTTATTAAGTGCAGCATATTTTATTGAAAGCTGTATTG ATACATTCCAATTAAAATCTTGCCATGGTGTTTCTTGCGCTAGTGATTGTATTGT
AACAGAATGGTCAGATTGGAGCGAATGTAGTACAACTTGCGGTGTTGGAAGTCA AATTTCCACAAGATCCATAGTTGTTCCAGAACAAAATGGTGGAAAATGTGATTA TGATCTTAGCAAAATCCAAGAATGCAATGTTTCTGTTTGCTCCAAGTCTTGTGAT CCTTCTCCATGCTTAAATGGCGGTATTTGTAGTGAACTACCAAAGTCAAACTTCG CTTGTACATGCCCGCCATTTTACGGAGGTGAAACTTGTGATCAATTTGAATTTCC
TTGGTGGTTTTATAGTGTTATAATTGTTTTAGTTGTTTTGGCTATTGGGATATTTT ATAAGTCACAAATTTCAAATATAGTTACTCCAAATACAATGGATCCTTCATATGC AGGAGATGGGGATTATGCCTTCAGTCAAGGCCCTGCTCCCCCAGATCCATTGCA AGCAGCAAATGGACAACCTCAATACTACCAAAATACGTATAATTACAACTATGG GTATTATGACAATTCTAATGAAGGATATTTGGTAAATAATGATGAAGGAAATTG GATGTACTAG (SEQ ID NO. 11)
and has amino acid sequence:
MDSMFRSIYIPSAVRYΠLLLLWTIFTKNVYSESSEETLLGRSVLDLNKKNTCEYYGE QDGMFTDSFHSMCIVPEDGLHGK]^YE]S[HQKKTFGT]I^NNKQLSDNKLYREI)DH LTSSIADFDSNSVRIQRKNVDLEAMFGIGKDNNRMNLNNEAIQSFYSNNETESQDKN ATNDYFLFKEGLLKFQEKKILRYYLYDVGNKVYSDTIAYPENVISENSAFNYLGNYV DVYEISKVSDPPVISWPNNHIVFIHSQVKSDGTFKFQVYTSSGEIGFYFEVTDNSYKT GCGSYSRVDKSKFTHSANSLIQVQLVRRKFGFNVFVDGTRRTQLDΠDCIASVPTKVQ ITSGSGSQIYPKVEDCQISQWTDWSTCSKTCSTGSKARYRSVMPSMNGGLPCPKLL DSSPCNADISCSSCQYSEWTMWGECSATCGSGSTTRTRKLLSAAYFIESCIDTFQLKS CHGVSCASDCIVTEWSDWSECSTTCGVGSQISTRSIVVPEQNGGKCDYDLSKIQECN VSVCSKSCDPSPCLNGGICSELPKSNFACTCPPFYGGETCDQFEFPWWFYSVI[VLVV LAIGIFYKSQISNTVTPNTMDPSYAGDGDYAFSQGPAPPDPLQAANGQPQYYQNTYN YNYGYYDNSNEGYLVNNDEGNWMY (SEQ ID NO. 12)
7) Protein similar to riken cDNA 5830420c20 gene (Chrom 60194, start position 15004, end position 16041) is encoded by the nucleotide sequence:
ATGAAAGAATCAGGCACAATTAATTATCTAATAACATTTACATTCATTATTCCTT TCGTACTTTCCCAGTCAACATTATTAAATCTTGGTGCAGGGGGTATACAGGAAA GGAGGGTTTGCACTGACGAAATGCCATGTAACTTTAGATTGGTTGCTGATTTAG ATATGAAGTCAAAGCCAGGGAGTGGGGAAAAGAATTACAAAAGTTTATTTCAA AAAGGGTCAATAATACAAGACAAAAGGGGCAACTATCGAGTGTACTGGGGAGA
AAGTCTGGAACTTAAAAGCGGATATAATGAATATGGGAGAGGGATGGAATTAA GTGAGTTGATTTCATATAATGGAATGATGCTTGCGGGCGACGACCGTACAGGAA TAATTTTTGAAATAACTGATGATGGAAAAGGAGTAGCACCAAGATATATATTAT CTGAAGGTAATGGAAGAACAGCTAAGGGAATGAAGATTGAGTGGTTTGCTGTA AGAGATGGAATATTGTGGGTTGGCAGTTTTGGAAAAGAGTTCGTATCAAACGGC ATAATAGAAAAAAGAGATAATATGTGGGTAGCCACAATTGATAAAAGAGGATA TGTTTCACGATTTAATTGGAGTTTTGTTTATGAAAAAATTAGGAATTCACTGGGG GCGCAATATCCAGGTTATTGCATTCATGAAGCAGTGATTTGGAGTCATTTAATGA GAAAGTGGATATTTTTACCAAGAAGAGTTAGCTTCGATGAGTATGATGAGGAGA
AAGACGAAAAGAGAGGTTCCAATAAAATGATAATTATGACAGATGATTTTGAA ATTCTTGAAATTATTGACGTAGGATTGATAATACCTGAAAGAGGTTTTTCTTCTT TAAAATTTCTTCCTGGGTCGTTTGACCAGATAATAGTTGCAACAAAAAGCGTTG AAGAATCAATTTCAGACACTCAAAAGTCTTTCTTAACTATATTCACAATAAATGG AAAAATTTTAATGGAAGATTTAGAAGTGCCTGGAGACTACAAATACGAGGGGAT
AGAATTTATATAG (SEQ DD NO. 13)
and has amino acid sequence:
MKESGTINYLITFTFΠPFVLSQSTLLNLGAGGIQERRVCTDEMPCNFRLVADLDMKS
KPGSGEKNYKSLFQKGSΠQDKRGNYRVYWGESLELKSGYNEYGRGMELSELISYN GMMLAGDDRTGIIFEITDDGKGVAPRYILSEGNGRTAKGMKIEWFAVRDGILWVGS
FGKEFVSNGIffiKRDNMWVATroKRGYVSRFNWSFVYEKIRNSLGAQYPGYCfflEAV
IWSHLMRKWIFLPRRVSFDEYDEEKDEKRGSNKMΠMTDDFEILEIIDVGLIIPERGFSS LKFLPGSFDQΫVATKSVEESISDTQKSFLTIFTINGKILMEDLEVPGDYKYEGFFIFI
(SEQ ID NO. 14)
8) SPFH domain / Band 7 family protein (Chrom 50147, start position 5008, end position
5850) is encoded by the nucleotide sequence:
ATGTCGAGAATTGAAAAAGGTTTTAACATCTTAGCTAACTTGGGGATAATGCTG GTTGCAGGTGGAAGCATTTTGGCGTCTAATAGTATGTATAACGTGGATGCTGGA CACAGAGCAATAAAGTTCTCAAGAATACATGGAGTTCAAAAAAGGATTTATGGA GAAGGAACTCATTTTATGCTACCTTGGATTGAAAGACCAGTGATATTTGACATC
AGAGCGAGACCTCGAGTTGTTGTATCTCTAACGGGAAGTAAAGATCTTCAAATG GTGAATATTACGTGCAGAGTTTTATCAAGGCCTGATAAAGATAAGCTGGTGGAA ATATATAGAAATATAGGGCTGGATCACGATGAGAAGATTCTTCCATCAATAATT AATGAAGTGCTAAAATCAGTAGTGGCTCAGTATAATGCTTCTCAACTACTAACT ATGAGAGAAGACGTGAGCAAAACAATCCGAGATTTACTGGTAAAAAGAGCCCA AGAGTTTAATATTATTCTGGATGATGTCTCTTTAACCCATTTAAGCTTTTCTCAGG ATTATGAAAAGGCTGTAGAGTCCAAGCAAGTTGCTCAACAACAAGCAGAAAGA GCGAAATATCTTGTTCTCAAGGCAAACGAAGAGAAAAAAAGTACTATTATTAAG GCTGAAGGCGAAGCAAAAGCTGCAAAACTAATTGGAGATGCGATAAATGAGAA
TCCTGCCTTTATTGCTCTTAAACAGGTGGAGACTTATAGAGAAATCTCTAATATT TTAGCAAAATCAACTTCTAAATCGCTTATAAATCTTTCATCATTTTTGCCAAACC TCCCAAATAGTAATTTACAATCATCTTGTTAG (SEQ ID NO. 15)
and has amino acid sequence: MSRIEKGFNILANLGMLVAGGSILASNSMYNVDAGHRAIKFSRIHGVQKRIYGEGTH FMLPWIERPVIFDIRARPRVVVSLTGSKDLQMVNITCRVLSRPDKDKLVEΓYRNIGLD HDEKiLPSiiNEVLKS WAQYNASQLLTMREDVSKTIRDLLVKRAQEFNIILDDVSLTH LSFSQDYEKAVESKQVAQQQAERAKYLVLKANEEKKSTΠKAEGEAKAAKLIGDAIN ENPAFIALKQVETYREISNILAKSTSKSLINLSSFLPNLPNSNLQSSC (SEQ ID NO. 16)
9) UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase T4 protein (Chrom 70457, start position 44914, end position 46158) is encoded by the nucleotide sequence:
ATGAGGAACGCATTCCCTCTCGGGCTGTCAATATGTTATTTGATGTTGAAAGTTG CATTGACTACTTTTGTTTTTGGGTCAAAAGAAGAGTTTACAACACTCCCTAGAGA ATTAATAAACTCTTGGTTGGAAGAAAATGAATATGCTGGATTATATGGAAAATC
AGATATTTTTTCAATTGTAATAATACCAGACTGTGAAGATAATGAATTGATTGAT GTTACAATAAATAGTATACTTTTGACTGCAAATCGAAATTTACTTCATGAAATAA TAATTATTTCAAATGATTGTCAAGACTCTGGAAAAGATATTAAAAGTTATTTGGG TGAGAAATTCTTGGATAAGCCTTTGATTAAAATAATTGAGACTGAATTACAAGA ATTGGGAGAATTACAGAATCTTGGAGCAAATAATTCAACTGGGGAAATCATTTT
ATTTGTTCCGTCTGCAACTCTTTTTCCAAAAAATTGGATGTCACCAATAATGAGG AGTTTAAGTGATAATTATAAATCAATAATAGTTCCAAGATTTAAAAAATTGAAT AAAAACAAATGGGCATTTTCGAACAATGATCCTGTATATTCACCAAAAATGATG TTCACAAAAGAATTTGAATTAACAAATATCCATACATTAGATAATAAAGTTCCA ATGTTCTATTCAAAAΛTCTTTGC AATAACAAAATCATGGTGGTTAAATATATCAA AGCTTTCAGATCCAACAATTAACCTGATATTCAAAACGAGTATTAACTTTGATAT TTCTCTAAGATCATGGAATTGTGGTGGGCGAGTAGCTCAGATAGCAGAACTGTC ATTTGGTGTAACTAAGGTAAAAATCTCACAACCTTCGTTAGAAATAAGACAAGT TCTATTGGAATCTTGGATAGATGAGCCAACCAAGCAGATGATTATGAATAATAG
TGAGAAGCTGGCTAACTATATGAAACTATCATCAGGATTATTTGAGGTATTGAT AAATAAACGTAAGGAACTCATTAAAGAGTATGAATGTGACCAAAAGTCAATATT TACTTCAAAATTTTATAATGAGTTGAGCGAATTTGGACTAATAGAATATCCAAA AAGTCAAATAGTTTTTAGTGGTAATGGCAAATGCTTCACATTAATTGGGAACGA 0 GAAAAAAAGTGGAGAAAAGAATTTCGAGTTAAAGTTATCAGAATGTAAACCAA
ATGAAAATGCACAAATATTCTACATTGACAATGAGAGTAAGTTGATCTAG (SEQ ID NO. 17)
and has amino acid sequence:
MRNAFPLGLSICYLMLKVALTTFVFGSKEEFTTLPRELINSWLEENEYAGLYGKSDIF 5 SΓVΠPDCEDNELIDVTINSILLTANRNLLHEΠΠSNDCQDSGKDIKSYLGEKFLDKPLIKΠ ETELQELGELQNLGANNSTGEΠLFVPSATLFPKNWMSPIMRSLSDNYKSΠVPRFKKL NKNKWAFSNNDPVYSPKMMFTKEFELTNFFLTLDNKVPMFYSKIFAITKSWWLNISK LSDPTINLFKTSINFDISLRSWNCGGRVAQIAELSFGVTKVKISQPSLEIRQVLLESWID EPTKQMIMNNSEKLANYMKLSSGLFEVLINKRKELIKEYECDQKSIFTSKFYNELSEF O GLIEYPKSQIVFSGNGKCFTLIGNEKKSGEKNFELKLSECKPNENAQFYIDNESKLI
(SEQ ID NO. 18)
10) ABC transporter ATP-binding protein (Chro.70309, start position 5325, end position 7046) is encoded by the nucleotide sequence:
ATGCTTATTATAAACGGAGCAATTAATTGTGCTAGAACTGATATGTCGATTCGA 5 ATTCAAATTGATTTAAGGATGTGGCTAACTAATTTGATTTTGAAACAATATTATT
CTGATTTAACTTACTATCAGTTCTCAATAAATAAAACGATTGATAATCCTGACCA AAGAATTGGAGAGGACATTTCACTGTTTTCATCACATTTATTATTGTTAATATGT CGTTGTATAGACAACTTATTTGACTTTTTTGTTTATTCAATCTTGCTATACAATGT TAATTTCAAATTGTTTATTTCAGCAATTATTTATTCTTGTTTTGGCACATTTTTAA CTGCTAAATTAGGCATGAATATAATATTATTAAAAGTTCAAGAAAAAAAGCTTG AAAGTGATTTTAGATATTCAATTATGAGAGTTGGTGAAAATGCAGAAAATGTTG CAATGTATGGAGGAGCTCAGTGCGAGATGGAAAGACATGAACAAATTTTAAATT CATTGCTTCTCAACTTAACTACGAAAAGATCATTTGAATCTAAAATGGGACTCTT TGGAAGTATTTTTAGAAACCTAATACGTGTTCTGCCTATTGCGGTTATTTCAGGA
GACTACTTTTCAGGAAATATCCAACTTGGAAGAATTAATCAGTGTAGCCTTGCAT TTAACAGTATAGTTGAAGATATTTCAATTTTGGTCAATACTTTTAGAGAAATAAG TAATCTACTTTCTTCAATAGATAGAGTAGGACATTTTATTGCATTGATGGCAGAT AACTATATTGAATCTCAATCTATAAATATTGGAGAGAAATTGATTAGTAGTTTTG AGAGTGATTCTAAAACTAGCAAAAAAATTGATTTCTTACATCTTGAAAGCGAGT
TTTCAAGACAAATGAAGGAAAAATCTTTAGAATTTAAACTTAATTTCTCGACAG GAATTGCTTCTAAGTCATTAAAAAATTGTGTTAAATTAGAATTTACAAACACTCA GGGGAAATCTTCGGTTAATATACGTGGAAAAATTAGATCAGTAATATGGCCAGA ACCAAAAATTAAGTTTGAAAGTGTATCGATTAATACTCCGGAAGAATATCCCAG GAAACTTCTTTTTAATATAAACTTTATGATTGAACAAAGCGATAAAGTCTTAATA
ACAGGGGACTCCGGTGTTGGGAAATCATCACTCTTAAAGGTAATTTGTGGGATT TGGAATAATGGGTCAGGAAATATTTATAGGCCACCTTCTAGTGAATTATTATTTA TACCGCAAAAACCCTACTGTACCCAAGCAACGCTAAGGGAACAACTGTTTTATC CGCAAATACCCTCAATTAAAACTAATGGTTATGAATATAAAAATAAGGAAGAAC TAGATTCATATCTATTGAAAATTCTTGAGGAAGTTGGGCTGAAATATCTATGTGA
TCGACTTTCTGAAAGTGAAACAGTTAATTGCTTAGACACCATTAAAGACTGGTC AACAATACTTTCGCTTGGAGAACAGCAAAGACTTGCATTTGCAAGAATATTTAT TTTCAAACCATCTATTTGTTTCCTTGATGAAGCTACAAGTGCGTTAGACATGGAG ACTGAAACAAAATTATATTCAATGCTAAATAAAAAAAACTTTACATACGTTAGT GTAGGTCACAGGCCCTCAATATCAATATTTCACAACAAAAAAGTCCTTATAAAA
AATGGTAATATAATTTTTGAATGTATATGA (SEQ ID NO. 19)
and has amino acid sequence:
MLΠNGAINCARTDMSIRIQIDLRMWLTNLILKQYYSDLTYYQFSINKTIDNPDQRIGE
DISLFSSHLLLLICRCRONLFDFFVYSILLYNVNFKLFISAIIYSCFGTFLTAKLGMNIILL KVQEKKLESDFRYSIMRVGENAENVAMYGGAQCEMERHEQELNSLLLNLTTKRSFE SKMGLFGSIFRNLrRVLPIAVISGDYFSGNIQLGRINQCSLAFNSIVEDISE.VNTFREISN LLSSmRVGHFIALMADNYffiSQSIMGEKLISSFESDSKTSKKlDFLHLESEFSRQMKE
KSLEFKLNFSTGIASKSLKNCVKLEFTNTQGKSSVNIRGKIRSVΓWPEPKIKFESVSINT PEEYPRKLLFNINFMFFIQSDKVLITGDSGVGKSSLLKVICGIWNNGSGMYRPPSSELL FIPQKPYCTQATLREQLFYPQIPSIKTNGYEYKNKEELDSYLLKILEEVGLKYLCDRLS ESETVNCLDTIKDWSTILSLGEQQRLAFARIFIFKPSICFLDEATSALDMETETKLYSM LNKKNFTYVSVGHRPSISIFHNKKVLIKNGNIIFECI (SEQ ID NO. 20)
11) Sporozoite cysteine-rich protein (Chro.60102, start position 11337, end position 12380) is encoded by the nucleotide sequence: ATGTTAGAATTTAGACAATATGATTTAAAGTTTATGAAAATGAAAAGAATTTTG
TATTTTATATTAATACATATTCTTATATTTAATATTTTAGAAATAAATTCTTTACC ACCAAGTTTTAGTTGGACAAAAGCATGGAAAGATATTACCAGTGAAGGGTTAGT ATATACATTTAGTTCAAATAAGCTACCTTGGTATTCTGGAGTATCTTTTAGGATT GTGGGTAAATTTAACGCAGAAAATGATAAAGAAACTTTGGTAACAATTCAGAAT GGTGATTTATACCACTGTAAGTTGATTATAAATTTTGCAGCACAAACAGTAGAT
GTGGAATCTACAGGATATACTGCAGAAGAGAGATGGGCTAGATCTTATGCTTAC TTTCCATTTCCATATAAGCCAAAATTGATGGATCTTGACTTGGTAGTTGAGAAAT TAAGATGGCCAGGAGGGTTTTACTTTTATATTTCAGGAAGTGGACCATATTATCC TTGTCATAGCATAGTGTATTCAAATGTGAATAAATTAACTTTTGGTAATGGACAA AATAACTTTAGTAAATATAAAATTACAAGAAATGTTCCTTTGGCAGATCCTTATA
GAAGGACTTATTTCTGGGACGAATTTCAACAAAGATACTATTTTGATGATAAAA ATTTGTATTATGTAAATAGCACCGGAATTGATGAGAAATCTGGAGTACCAAATG GTGATAGAATTCCAAAACATTATAAATCTTGGCCAGAAGAACTAGAAATACATG TACATTCAGCAAGTATGTACCCAGTTAATGATAAAAGATACGGATGGGGAGGTA CGGTAGCAGTATTTACAAGCGATCAGAGTCAGTTTTATTATAGAATGAATGGAT
TTTTTGCAACTTTGTCAAGTAATTCATATTGTTTAAGTTCGAGTGTATTATTAAGT GGGACAAGTTATACAGTTAGTGGAGATTATCCTTTTGATTTTGATAATCCAGGTC AACCTTTCAATGTAAGTTTACTTATGATTATTAAGATAATAAGCCTATTTATTAT GAGGTAG (SEQ ID NO. 21) and has amino acid sequence:
MLEFRQYDLKTMKMKRILYFILfflILIFNILEINSLPPSFSWTKAWKDITSEGLVYTFSS NKLPWYSGVSFRIVGKFNAENDKETLVTIQNGDLYHCKLIINFAAQTVD VESTGYTA EERWARSYAYFPFPYKPKLMDLDLVVEKLRWPGGFYFYISGSGPYYPCHSIVYSNV NKLTFGNGQNNFSKYKITRNVPLADPYRRTYFWDEFQQRYYFDDKNLYYVNSTGID
EKSGVPNGDRΓPKHYKSWPEELEIHVHSASMYPVNDKRYGWGGTVAVFTSDQSQF YYRMNGFFATLSSNSYCLSSSVLLSGTSYTVSGDYPFDFDNPGQPFNVSLLMUKΠSL FMR (SEQ ID NO. 22)
12) 19K sporozoite antigen "profilin" (Chro.30189 start position 2297, end position 2785) is encoded by the nucleotide sequence:
ATGTCTGAATGGGATGATATGGTCAAAGAATGGTTAATTGACACCGGTAGTGTA TGTGCTGGTGGTCTTTGTTCAATAGATGGTGCATTCTATGCTGCTTCTGCTGATC AAGGTGATGCCTGGAAGACTCTTGTTAGAGAAGATCATGAAGAAAATGTTATTC AATCCGACGGAGTTTCAGAGGCTGCTGAATTAATTAATGATCAAACTACACTAT GCCAAGCTATCTCTGAGGGTAAGGCACCAAACGGCGTTTGGGTCGGAGGAAAC
AAATATAAGATTATCCGCGTAGAGAAGGACTTCCAACAAAACGATGCTATTGTT AATGTTACATTCTGTAACAAACCTCAAGGTGGATGTTTTTTAGTTGATACTCAAA ACGGTACTGTTGTCGTTGCGGTTTACGACGAATCCAAAGATCAATCATCAGGTA ATTGCAAGAAGGTTGCTTTGCAACTGGCCGAGTACCTCGTATCTCAGGGATACT AA (SEQ ID NO. 23)
and has amino acid sequence:
MSEWDDMVKEWLIDTGSVCAGGLCSIDGAFYAASADQGDAWKTLVREDHEENVI QSDGVSEAAELINDQTTLCQAISEGKAPNGVWVGGNKYKΠRVEKDFQQNDAΓVNV TFCNKPQGGCFLVDTQNGTVVVAVYDESKDQSSGNCKKVALQLAEYLVSQGY (SEQ ID NO. 24)
EXAMPLE 3. Immunotherapy
C. hominis proteins have been overexpressed in E. coli and isolated, and are tested in model systems to examine their abilities to induce a protective immune response. Animal models of Cryptosporidium infection have demonstrated the role of both cell and humoral immune responses (1, 2). Thus, mice with targeted disruptions of genes encoding immunological important molecules have established the role of these proteins in the immune response against Cryptosporidum (1-7). Other studies of the immune response against Cryptosporidium use neonatal mice and mice lacking functional T or B cell responses (1, 8, 9). These studies have demonstrated how an immune response is induced in mice that are not immuno-competent. Adult mice are resistant to the infection with Cryptosporidum but the injection of an antibody against Interferon Gamma (IFN γ) prior to infection render them susceptible to Cryptosporidium (10, 13). IFN γ plays an important role in the induction of an immune response against many microorganisms, and many studies have shown that it is one of the key components of the immune response against Cryptosporidium infections (11-17). Thus the temporary neutralization of IFN γ by the administration of the antibody in adult mice is an excellent tool to study and characterize the immune response in the context of an immunocompetent animal (10). The IFN knockdown mouse model follows a pattern of infection very similar to that seen in severe clinical infections (10). During the infection the animals lost weight and then regained it during recovery. This is also similar to what is observed in metabolically stressed children during and after diarrheal diseases. The predominant site of infection was the small intestine as it has been observed in animal and human severe infections. No parasites can be detected by day 30, thus the level of infection achieved is enough to generate an immune response, which also it is demonstrated by the detection of cellular responses against Cryptosporidium antigen extracts and proteins with lymphocytes obtained from the treated animals. Thus this model offers the possibility to study the potential role of Cryptosporidium as the animal can mount a parasite specific immune response (10). We use this model (and alternative models such as a malnourished mouse model, unpublished) to study the potential role of Cryptosporidum recombinant proteins and plasmid DNA containing Cryptosporidium genes to induce an immune response. Our protocol to carry out this study is outlined in brief below. Subject mice are divided in groups: Group I mice are immunized with a pool of recombinant antigens (or plasmids in the case of DNA vaccine) in adjuvant (Freund's or other as appropriate); Group II (control animals) are immunized with Freund's adjuvant alone (or plasmid with no insert in the case of a DNA vaccine). The immunological responses in each group are followed and the response to challenge is measured. A sample immunization schedule is outlined below:
1) Day 0: Immunization with a pool of recombinant antigens (2-3 μg each), DNA (20-100 μg) or controls. Immunization is performed intraperitoneally or intranasally.
2) Day 14: Boost Immunization with the same antigens (protein, DNA, control). Boost is administered intranasally.
3) Day 28: Anti-IFN-γ Ab inoculation, intraperitoneally, 2h prior to Cryptosporidium infection.
4) Day 28 (2 hr after inoculation of anti-IFN-γ Ab) : Infection with Cryptosporidium.
The immune response and protection to infection is monitored. A sample protocol is outlined below:
1) Serum samples are collected at day 0, 7, 14 and 28 to monitor the immune response. Antibody levels against fusion proteins and Cryptosporidium extract are measured by immunoblotting and indirect immunofluorescence.
2) Fecal IgA responses are measured before and after vaccination and infection. 3) Fecal shedding of Cryptosporidium is monitored by fluorescent microscopy and real time PCR three times per week after infection
4) Cytokine and lymphoproliferation responses are examined by isolation of mesenteric lymphocyte node and spleen cells to detect cytokine responses and lymphoproliferation against antigens (those that can be purified) and against a Cryptosporidium preparation.
These results indicate proteins which induce an antibody (mucosal or humoral) or cellular immune response. More important, these results indicate which immune response is protective and reduces infection (and shedding) by the exposed animal.
References for Example 3. 1. Riggs MW. Recent advances in cryptosporidiosis: the immune response. Microbes Infect.
2002. (10): 1067-80. 2. Lean IS, McDonald V, Pollok RC. The role of cytokines in the pathogenesis of Cryptosporidium infection. Curr Opin Mect Dis. 2002. 15(3): 229-34. 3. Ehigiator HN, Romagnoli P, Borgelt K, Fernandez M, McNair N, Secor WE3 Mead JR. Mucosal cytokine and antigen-specific responses to Cryptosporidium parvum in IL-12p40 KO mice. Parasite Immunol. 2005. 27(1-2): 17-28. 4. Chen W, Harp JA, Harmsen AG. Cryptosporidium parvum infection in gene-targeted B cell-deficient mice. J Parasitol. 2003. 89(2): 391-3.
5. Davami MH, Bancroft GJ, McDonald V. Cryptosporidium infection in major histocompatibility complex congeneic strains of mice: variation in susceptibility and the role of T-cell cytokine responses. Parasitol Res. 1997 . 83(3): 257-63. 6: Lacroix S, Mancassola R, Naciri M, Laurent F. Cryptosporidium parvum-speciήc mucosal immune response in C57BL/6 neonatal and gamma interferon-defϊcient mice: role of tumor necrosis factor alpha in protection. Infect Immun. 2001. 69(3): 1635-42.
7. McDonald SA, O'Grady JE, Bajaj-Elliott M, Notley CA, Alexander J, Brombacher F, McDonald V. Protection against the early acute phase of Cryptosporidium parvum infection conferred by interleukin-4-induced expression of T helper 1 cytokines. J Infect Dis. 2004.
190(5): 1019-25.
8. McDonald V, Deer R, Uni S, Iseki M, Bancroft GJ. Immune responses to Cryptosporidium muris and Cryptosporidium parvum in adult immunocompetent or immunocompromised (nude and SCID) mice. Infect Immun. 1992. 60(8): 3325-31. 9. Kuhls TL, Greenfield RA, Mosier DA, Crawford DL, Joyce WA. Cryptosporidiosis in adult and neonatal mice with severe combined immunodeficiency. J.Comp Pathol. 1992. 106(4): 399-410.
10. Theodos CM, Sullivan KL, Griffiths JK, Tzipori S. Profiles of healing and nonhealing Cryptosporidium parvum infection in C57BL/6 mice with functional B and T lymphocytes: the extent of gamma interferon modulation determines the outcome of infection. Infect
Immun. 1997 65(11): 4761-9.
11. You X, Mead JR. Characterization of experimental Cryptosporidium parvum infection in IFN-gamma knockout mice. Parasitology. 1998. 117: 525-31.
12. Mead JR, You X. Susceptibility differences to Cryptosporidium parvum infection in two strains of gamma interferon knockout mice. J Parasitol. 1998. 84(5): 1045-8
13. Griffiths JK, Theodos C, Paris M, Tzipori S. The gamma interferon gene knockout mouse: a highly sensitive model for evaluation of therapeutic agents against Cryptosporidium parvum. J Clin Microbiol. 1998. .36(9): 2503-8.
14. Pollok RC, Farthing MJ, Bajaj -Elliott M, Sanderson IR, McDonald V. Interferon gamma induces enterocyte resistance against infection by the intracellular pathogen Cryptosporidium parvum. Gastroenterology. 2001. 20: 99-107.
15. Aguirre SA, Perryman LE, Davis WC, McGuire TC. IL-4 protects adult C57BL/6 mice from prolonged Cryptosporidium parvum infection: analysis of CD4+alpha beta+IFN- gamma+ and CD4+alpha beta+IL-4+lymphocytes in gut-associated lymphoid tissue during resolution of infection. J Immunol. 1998. 161: 1891-900. 16: Lehmann J, Enssle KH, Lehmann I, Emmendorfer A, Lohmann-Marthes ML. The capacity to produce IFN-gamma rather than the presence of interleukin-4 determines the resistance and the degree of susceptibility to Leishmania donovani infection in mice. J Interferon Cytokine Res. 2000. 20: 63-77. 17. Lacroix S, Mancassola R, Naciri M, Laurent F. Cryptosporidium parvum-spocific mucosal immune response in C57BL/6 neonatal and gamma interferon-deficient mice: role of tumor necrosis factor alpha in protection. Infect Immun. 2001. 69: 1635-42.
EXAMPLE 4. Development of Chemotherapeutic Agents
The approach to the development of chemotherapeutic intervention strategies parallels the selection of candidate vaccinogens using genome sequence data and informatics approaches. The rationale is that weak links in the parasite's biology can be identified by examining its genome. For example, several hundred likely essential transporter proteins that are responsible for importing essential nutrients into the parasite have been identified (see Table 3). Without these transporters, the parasite is unable to obtain required building blocks and therefore is unable to survive. Inhibition of one or more transporters (for example, by small molecule inhibitors or by antibodies) is a useful strategy for prevention or treatment of the C. hominis related disease.
The process for development of these agents includes the following steps:
1) Informatic pathway annotation and analysis to identify the processes known to be active in the parasite. This work has been completed, although updates are included with technology advances. 2) Network and topological analysis are applied to identify nodes that are considered 'critical elements' or 'essential steps'. This analysis involves a series of mathematical and computational steps to identify those proteins that, when inhibited, are most likely to result in death or growth inhibition of the parasite. Examples of such 'critical elements' include transporters for essential nutrients (ions, amino acids, nucleotides, sugars, etc.) for which no substitute is available, essential steps in energy metabolism (e.g., glycolysis, regeneration of NADP, etc.), intermediary metabolism (e.g., carbohydrate anabolism and catabolism), biosynthesis (nucleotide interconversion, amino acid interconversion, synthesis of amylopectin, fatty acid biosynthesis), and other essential pathways.
3) Genes that encode proteins that are deemed likely to be 'critical elements' according to step 2, are cloned and expressed in bacterial systems as outlined above. The gene products (proteins) are then tested for activity and examined for inhibition by libraries of potential inhibitory compounds. This is performed in collaboration with pharmaceutical companies that maintain batteries of such compounds.
4) In parallel with #3, the proteins are crystallized and subjected to X - Ray crystallography to identify their 3D structures.
5) The 3D structures are used in 'rational drug design' to identify categories of potentially inhibitory compounds. For example, we have identified the zinc transporter (see above) as a focus of these investigations. Cryptosporidium, like all living organisms, requires divalent cations like zinc. This compound must be actively imported into the cell. In the absence of zinc, or if the organism is unable to import it from its surroundings, Cryptosporidium will die. Thus, we have cloned and expressed the Cryptosporidium zinc transporter and will now search for compounds that inhibit its activity, hi parallel, the structure of the transporter will be determined to further guide selection of potential inhibitory compounds.
EXAMPLE 5. Development of DNA Vaccine
Plasmid DNA was also isolated using the EndoFree plasmid Giga Kit (Qiagen) and is used as an antigen to be injected in mice to test their protective role against Cryptosporidium. Animal models of Cryptosporidium infection have demonstrated the role of both cell and humoral immune responses (1, 2). Thus, mice with targeted disruptions of genes encoding immunological important molecules have established the role of these proteins in the immune response against Cryptosporidum (1-7). Other studies of the immune response against Cryptosporidium use neonatal mice and mice lacking functional T or B cell responses (1, 8, 9). These studies have demonstrated how an immune response is induced in mice that are not immuno-competent. Adult mice are resistant to the infection with Cryptosporidum but the injection of an antibody against Interferon Gamma (IFN γ) prior to infection render them susceptible to Cryptosporidium (10, 13). IFN γ plays an important role in the induction of an immune response against many microorganisms, and many studies have shown that it is one of the key components of the immune response against
Cryptosporidium infections (11-17). Thus the temporary neutralization of IFN γ by the administration of the antibody in adult mice is an excellent tool to study and characterize the immune response in the context of an immunocompetent animal (c.f, 10).
The IFN knockdown mouse model follows a pattern of infection very similar to that seen in severe clinical infections (10). During the infection the animals lost weight and then regained it during recovery. This is also similar to what is observed in metabolically stressed children during and after diarrheal diseases. The predominant site of infection was the small intestine as it has been observed in animal and human severe infections. No parasites can be detected by day 30, thus the level of infection achieved is enough to generate an immune response, which also it is demonstrated by the detection of cellular responses against
Cryptosporidium antigen extracts and proteins with lymphocytes obtained from the treated animals. Thus this model offers the possibility to study the potential role of Cryptosporidium as the animal can mount a parasite specific immune response (10).
We use this model (and alternative models such as a malnourished mouse model, unpublished) to study the potential role of Cryptosporidum recombinant proteins and plasmid DNA containing Cryptosporidium genes to induce an immune response. Our protocol to carry out this study is outlined in brief below. Subject mice are divided in groups: Group I mice are immunized with a pool of recombinant antigens (or plasmids in the case of DNA vaccine) in adjuvant (Freund's or other as appropriate); Group II (control animals) are immunized with Freund's adjuvant alone (or plasmid with no insert in the case of a DNA vaccine). The immunological responses in each group are followed and the response to challenge is measured. A sample immunization schedule is outlined below:
1) Day 0: Immunization with a pool of recombinant antigens (2-3 μg each), DNA (20-100 μg) or controls. Immunization is performed intraperitoneally or intranasally.
2) Day 14: Boost Immunization with the same antigens (protein, DNA, control). Boost is administered intranasally.
3) Day 28: Anti-IFN-γ Ab inoculation, intraperitoneally, 2h prior to Cryptosporidium infection.
4) Day 28 (2 hr after inoculation of anti-IFN-γ Ab) : Infection with Cryptosporidium.
The immune response and protection to infection is subsequently monitored. A sample protocol is outlined below:
5) Serum samples are collected at day 0, 7, 14 and 28 to monitor the immune response. Antibody levels against fusion proteins and Cryptosporidium extract are measured by immunoblotting and indirect immunofluorescence.
6) Fecal IgA responses are measured before and after vaccination and infection. 7) Fecal shedding of Cryptosporidium is monitored by fluorescent microscopy and real time PCR three times per week after infection
8) Cytokine and lymphoproliferation responses are examined by isolation of mesenteric lymphocyte node and spleen cells to detect cytokine responses and lymphoproliferation against antigens (those that can be purified) and against a Cryptosporidium preparation.
These results indicate proteins which induce an antibody (mucosal or humoral) or cellular immune response. More important, these results indicate which immune response is protective and reduces infection (and shedding) by the exposed animal.
References for Example 5.
1. Aguilar-Be I, da Silva Zardo R, Paraguai de Souza E, Borja-Cabrera GP, Rosado-Vallado M, Mut-Martin M, Garcia-Miss Mdel R, Palatnik de Sousa CB, Dumonteil E. Cross-protective efficacy of a prophylactic Leishmania donovani DNA vaccine against visceral and cutaneous murine leishmaniasis. Infect Immun. 2005 Feb;73(2):812-9. 2. Aguiar JC, LaBaer J, Blair PL, Shamailova VY, Koundinya M, Russell JA, Huang F, Mar W, Anthony RM, Witney A, Caruana SR, BrizuelaL, Sacci JB Jr, Hoffman SL, Carucci DJ. High- throughput generation of P. falciparum functional molecules by recombinational cloning. Genome Res. 2004 Oct;14(10B):2076-82. 3. Wu SQ, Wang M, Liu Q, Zhu YJ, Suo X, Jiang JS. Construction of DNA vaccines and their induced protective immunity against experimental Eimeria tenella infection. Parasitol Res.2004 Nov;94(5):332-6.
4. Iborra S, Soto M, Carrion J, Alonso C, Requena JM. Vaccination with a plasmid DNA cocktail encoding the nucleosomal histones of Leishmania confers protection against murine cutaneous leishmaniosis. Vaccine. 2004 Sep 28;22(29-30):3865-76.
5. Sagodira S, Iochmann S, Mevelec MN, Dimier-Poisson I, Bout D. Nasal immunization of mice with Cryptosporidium parvum DNA induces systemic and intestinal immune responses. Parasite Immunol. 1999 Oct;21(10):507-16.
6. Sagodira S, Buzoni-Gatel D, Iochmann S, Naciri M, Bout D. Protection of kids against Cryptosporidium parvum infection after immunization of dams with CP 15 -DNA. Vaccine. 1999
May 14;17(19):2346-55.
7. Jenkins M, Kerr D, Fayer R, Wall R. Serum and colostrum antibody responses induced by jet-injection of sheep with DNA encoding a Cryptosporidium parvum antigen. Vaccine. 1995 Dec;13(17):1658-64. 8. Huygen K. Plasmid DNA vaccination. Microbes Infect. 2005 May;7(5-6):932-8.
9. Barouch DH, Letvin NL, Seder RA. The role of cytokine DNAs as vaccine adjuvants for optimizing cellular immune responses. Immunol Rev. 2004 Dec;202:266-74.
10. Sukumaran B, Madhubala R. Leishmaniasis: current status of vaccine development. Curr MoI Med. 2004 Sep;4(6):667-79. 11. Barry MA, Howell DP, Andersson HA, Chen JL, Singh RA. Expression library immunization to discover and improve vaccine antigens. Immunol Rev. 2004 Jun; 199:68-83.
12. Leifert JA, Rodriguez-Carreno MP, Rodriguez F, Whitton JL. Targeting plasmid-encoded proteins to the antigen presentation pathways. Immunol Rev. 2004 Jun; 199:40-53.
13. Howarth M, Elliott T. The processing of antigens delivered as DNA vaccines. Immunol Rev. 2004 Jun;199:27-39.
14. Xu F, Ulmer JB. Attenuated salmonella and Shigella as carriers for DNA vaccines. J Drug Target. 2003;l l(8-10):481-8.
15. Aguirre SA, Perryman LE, Davis WC, McGuire TC. IL-4 protects adult C57BL/6 mice from prolonged Cryptosporidium parvum infection: analysis of CD4+alphabeta+IFN-gamma+ and CD4+alpha beta+IL-4+lymphocytes in gut-associated lymphoid tissue during resolution of infection. J Immunol. 1998. 161: 1891-900.
16. Lehmann J, Enssle KH, Lehmann I, Emmendorfer A, Lohmann-Matthes ML. The capacity to produce IFN-gamma rather than the presence of interleukin-4 determines the resistance and the degree of susceptibility to Leishmania donovani infection in mice. J Interferon Cytokine Res. 2000. 20(1): 63-77.
EXAMPLE 6. Detection and diagnostics
Detection and diagnosis of C. hominis infection are very difficult and are typically based on microscopic examination (of water supplied or stool, etc.). A small number of previously characterized genes are now used for detection and diagnosis. These genes differ from their homologs in closely related parasites and therefore form the basis of a genetic signature. However, current protocols are limited in scope and could result in errors in identification. We have compared all the genes of C. hominis to many other related parasites, have identified important signature nucleotide sequences, which serve as the basis for the development of improved diagnostic tools. The signature nucleotide sequences are unique to C. hominis (see Table 9) . Detection of the unique, signature sequences using nucleotide probes specific for them, provides a highly reliable method of detecting the presence of C. hominis in a biological sample, and thus for the diagnosis of a C. hominis infection.
As important as detection and diagnosis, it is important to quantify Cryptosporidium in an infected sample to assess the seriousness of the disease or contamination. Thus, Cryptosporidium are common in the environment and small quantities of the organism in water samples or in fecal samples are not uncommon. Using the signature nucleotide sequences described in Table 9, it is possible to both specifically identify and to accurately quantify levels of Cryptosporidium in essentially any biological or environmental sample.
An example of such use is described below. Real time PCR (RT-PCR) analysis of detection, quantification and diagnosis The example below used TaqMan® assay system technology (Applied Biosystems, Foster City, CA), but any fluorescent real time PCR technology (of many that are commercially available) can be similarly applied (1,2,3). Ih brief, oligonucleotide primers and probes specific for sequences of Cryptosporidium small subunit ribosomal RNA gene and the pyruvate kinase genes were designed (4,5) using Primer Express® version 2.0 software. These sequences were selected among the many available in Table 9 because of historical precedent. However, nearly all of the sequences described in Table 9 could be used by one trained in the art as specific targets in these analyses. For each target, two primers (forward and reverse) flanking one internal probe are synthesized. The primers are synthesized without modified bases or labels. The probes are synthesized with 5' end linked FAM (6-carboxyfluoresceine) and 3' end fluorescent TAMRA (6-carboxytetramethylrhodamine) dyes. These fluorescent dyes are commonly used for TaqMan® assay system technology, but many other labeling systems are equally applicable.
Primers and probes for the small subunit rRNA gene and the pyruvate kinase gene.
Small Subunit rRNA Name (forward): 18S#2-295F
Sequence: CAGCTTTAGACGGTAGGGTATTGG (SEQ ID NO: 4060)
Name (reverse): 18S#2-368R
Sequence: TCTCCGGAATCGAACCCTAAT (SEQ ID NO: 4061)
Name (probe): 18S#2-324T Sequence: CCCGTTACCCGTCATTGCCACG (SEQ ID NO: 4062)
Pyruvate kinase
Name (forward): pyruvate kinase-1016F
Sequence: GGCCAACAAGGGCAGAAA (SEQ ID NO: 4063)
Name (reverse) : pyruvate kinase- 1091 R Sequence: TCTCCAGATAGCATAACACAATCTGA (SEQ ED NO: 4064) Name (probe): pyruvate kinase- 1040T
Sequence: ATGTTGCAAACGCTGTTTTAGATG (SEQ ID NO: 4065)
Synthesis of all primers and probes were performed at the VCU Nucleic Acids Research Facilities.
We tested the effectiveness of the primers above to detect parasite sequences in total
RNA of the human cell line HCT-8 infected with Cryptosporidium. However, with insignificant modifications, this procedure is equally effective for detection and quantification of Cryptosporidium in other samples (e.g., water samples, fecal samples, sputum or bronchalveolar lavage, serum, etc.). In addition, this procedure is equally effective if the target is DNA instead of RNA. Thus, this example is provided as a general validation of this approach to
Cryptosporidium detection and quantification.
Live (LV) and heat inactivated (HI) parasites were used to infect monolayers of cultured HCT-8 human cell line. RNA was isolated from these infected cell lines using standard procedures for purification of total RNA. Assays to quantify the Cryptosporidium RNA in these cells using the primers described above were performed in VCU' s Nucleic Acids Research
Facilities in an ABI Prism® 7900 Sequence Detection System (SDS) (Applied Biosystems, Foster City, CA) using the TaqMan® One Step PCR Master Mix Reagents Kit (P/N: 4309169). Again, any other real time PCR system would be equally applicable to this technological approach. All samples were processed in triplicate following standard procedures established in the Nucleic Acids Research Facilities.
The Figure 2 shows typical amplification curve plots (A) generated by these samples and a standard curve plot of known amounts of Cryptosporidium rRNA, for measuring the absolute quantities of Cryptosporidium small sufigurebunit rRNA in the samples (B). The table below shows the numerical results of the parasite RNA quantification. These results showed that the Cryptosporidium RNA is present only in the samples in which infection was mediated with live parasites. As expected, heat inactivated parasites do not infect, and no parasite RNA is observed. Moreover, the results indicate that the amount of Cryptosporidium RNA present varies from approximately 5-30 picograms, permitting a direct calculation of the number of parasites present in the sample. C. hominis is the primary agent of human cryptosporidiosis. C. parvum is a common cause of disease in animals, and an occasional problem in humans. It is important to differentiate between these two (and other) strains of Cryptosporidium. Our technology enables the ready discrimination of these isolates. Thus, we have demonstrated that we can use the sequences we have described in Table 9 for differentiating C. parvum from C. hominis. In brief, the same technology outlined above; e.g., RT PCR using primer and probe sets specific for C. hominis or C. parvum are used to amplify RNA (or DNA) purified from a sample (water, fecal material, other sample). In these amplifications, we can not only detect and discriminate different
Cryptosporidium strains (e.g., C. hominis from C. parvum), but each can be concurrently quantified.
References for Example 6
1. Wang,A.M., Doyle, M. V., andD.F. Mark. (1989) Quantitation of mRNA by the polymerase chain reaction. Proc Natl Acad Sci U S A. 1989 December; 86(24): 9717-9721.
2. Kawasaki, E.S., and A.M. Wang. (1989) Detection of gene expression. In: Erlich, H. A., ed., PCR Technology: Principles and Applications of DNA Amplification. Stockton Press, Inc., New
York, NY, pp. 89-97.
3. Dieter Klein (2002) Quantification using real-time PCR technology: applications and limitations. Trends in Molecular Medicine, 8(6):257-260.
4. Xu P, Widmer G, Wang Y, Ozaki LS, Alves JM, Serrano MG, Puiu D, Manque P, Akiyoshi D, Mackey AJ, Pearson WR, Dear PH, Bankier AT, Peterson DL, Abrahamsen MS, Kapur V,
Tzipori S, Buck GA. (2004) The genome of Cryptosporidium hominis. Nature 431:1107-12.
5. Abrahamsen MS, Templeton TJ, Enomoto S, Abrahante JE, Zhu G, Lancto CA, Deng M, Liu C, Widmer G, Tzipori S, Buck GA, Xu P, Bankier AT, Dear PH, Konfortov BA, Spriggs HF, Iyer L, Anantharaman V, Aravind L, Kapur V. (2004) Complete genome sequence of the apicomplexan, Cryptosporidium parvum. Science 304(5669):441-5.
EXAMPLE 7. Nucleotide arrays for detection of Cryptosporidium genes
The array consists of -4,000 70 base synthetic oligonucleotides bound to glass slides. Each of the -4,000 C. hominis genes is represented by a single, specific oligonucleotide in the array. In order to assess presence or absence of these genes in a biological sample containing putative Cryptosporidium parasites, DNA is isolated by standard technology, labeled with fluorescent dyes, and hybridized to the array. A similar DNA sample derived from a known Cryptosporidium sample is labeled with an alternative fluorescent dye and used as a control. Both labeled DNAs are hybridized to the same oligonucleotide array, and the arrays are washed and scanned in a fluorescence scanner. The readout of the scanner provides an estimate of the amount of DNA for each gene that is present in the initial sample and a comparison between the two samples. Thus, Cryptosporidium genes that are present or absent are determined relative to the control.
The 70 base oligonucleotides in the array were designed by ArrayOligoSelector1"1 version 3.8.2, (http://arrayoligosel.sourceforge.net/), which selects optimal sequences by:
1. Examining every possible 70mer sequence from every gene;
2. Using BLASTN (against the whole genome) to check the uniqueness of each 70mer.
3. Uniqueness is scored as the theoretical binding energy of a candidate oligo to its most similar genome sequence. The binding energy is calculated using a nearest-neighbour model with the established thermodynamic parameters;
4. Using the LZW compression algorithm to calculate the sequence complexity score in bytes between the oligo sequence and the its compressed version;
5. Determining the self-annealing score, calculated as the alignment score of the optimum local alignment between the oligo sequence and its reverse compliment using the Smith-Waterman algorithm;
6. Calculating the GC content of the oligo;
7. Choosing, for each gene, the oligo that maximizes uniqueness and sequence complexity, minimizes self-annealing and has GC content closest to specified by the user; also tries to minimize distance to the 3' end of the gene.
The approximately 4000 oligos and controls designed in this fashion were synthesized commercially and validated in the lab. In the Figure 3, a hybridization of the array with DNA from C. hominis and C. parvum was performed to identify C. hominis genes that are present or absent in C. parvum. Therefore, DNA was purified from C. hominis and C. parvum, labeled with the fluorescent dyes Cy3 and Cy5, respectively, by indirectly incorporating amino-allyl (aa)-dUTP (Ambion) followed by coupling with fluorescent dyes. Briefly, four micrograms of genomic DNA from each of the two Cryptosporidium species was digested with restriction enzyme Hae m, translated with Klenow Exonuclease-free polymerase using random hexamers (pdN6 from Pharmacia) in the presence of aminoallyl-dUTP, and purified to remove the unincorporated nucleotides. The amino-allyl-dUTP labeled DNA samples were dried, dissolved in 0.1 M NaHCO3, pH 9.0, and fluorescently labeled by coupling of the amino allyl-dUTP to
Cy3 or Cy5 dyes essentially as described by the manufacturer (AmershamPharmacia Biotech). The labeled DNAs were hybridized to the oligonucleotide array, which contains approximately 4000 probes representing each of the known C. hominis genes. These results demonstrate that the gene complements of C. hominis and C. parvum show expected similarities, but permit identification of specific genetic differences.
While the invention has been described in terms of its preferred embodiments, those skilled in the art will recognize that the invention can be practiced with modification within the spirit and scope of the appended claims. Accordingly, the present invention should not be limited to the embodiments as described above, but should further include all modifications and equivalents thereof within the spirit and scope of the description provided herein.
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.lOOlO 25 AAELO 1000099 17573 18886 .
Chro.lOOl l 26 AAELO 1000099 16058 17374 .
Chro.10012 27 AAEL01000099 10634 15586 . solute carrier family 35, member 2,
Chro.10013 " 28 AAEL01000099 9428 10441 putative
Chro.10014 29 AAEL01000099 6229 9099 hypothetical protein TPR-like;
Chro.10015 30 AAELO 1000099 5065 5964 putative cyclin dependent kinase A Protein kinase-like (PK-like);
Chro.10016 31 AAEL01000099 4515 4871 .
Chro.10017 32 AAELO 1000099 3836 4279 .
Chro.10018 33 AAEL01000099 1419 3695 . Histone-fold;
Chro.10019 34 AAEL01000099 3 1232 .
Chro.10020 35 AAELO 1000806 1080 1901 .
-J Chro.10021 36 AAELO 1000305 7602 8906 .
Chro.10022 37 AAEL01000305 5265 7157 .
Chro.10023 38 AAEL01000305 3294 4067 .
Chro.10024 39 AAELOlOOl 121 443 877 .
Chro.10025 40 AAEL01000964 190 555 .
Chro.10026 41 AAEL01000721 147 2313 .
Chro.10027 42 AAEL01000336 5957 6814 .
Chro.10028 43 AAEL01000336 3921 5486 .
Chro.10029 44 AAEL01000336 1973 3655 putative Fe-hydrogenase Fe-only hydrogenase;
ADP-ribosylation factor-like protein 2 P-loop containing nucleotide triphosphate
Chro.10030 45 AAEL01000336 1290 1745 (ARL2) *' hydrolases;
Chro.10031 46 AAEL01000336 1 306 .
Chro.10032 47 AAELO 1000091 147 1427 GPI-anchor transamidase (TJ32517) -r<
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
UDP-Glycosyltransferase/glycogen
Chro.10033 48 AAEL01000091 1678 3069 ENSANGP00000013950 phosphorylase;
Cbro.10034 49 AAELO 1000091 3128 4192 .
P-loop containing nucleotide triphosphate
Chro.10035 50 AAELO 1000091 4466 5965 putative ATP-dependent hydrolases;
Chro.10036 51 AAELO 1000091 6235 7617 •
Chro.10037 52 AAELO 1000091 8033 8245 hypothetical protein C2H2 and C2HC zinc fingers;
Chro.10038 53 AAELO 1000091 8590 8832 . dehydrogenase/reductase (SDR family) member 7; CGI-86 protein; retinal short- chain dehydrogenase/reductase 4;
Chro.10039 54 AAEL01000091 8833 9936 2310016E22Rik NAD(P)-binding Rossmann-fold domains; tRNA-guaninine transglycosylase, putative,
Chro.10040 55 AAELO 1000091 10098 11564 putative Cysteine proteinases; Ubiquitin-like; Chro.10041 56 AAEL01000091 12339 13388 apurinic/apyrimidinic endonuclease Apnl Xylose isomerase-like; protein 3 isoform a; oxysterol-binding protein-related protein 3; oxysterol-binding
Chro.10042 57 AAEL01000091 13644 15392 protein 3; OSBP-related protein 3
P-loop containing nucleotide triphosphate hydrolases; Cdc48 domain 2-like; ADC-
Chro.10043 58 AAEL01000091 16477 18921 cell division cycle protein 48 homolog like; Chro.10044 59 AAELO 1000091 19742 20935 hypothetical protein Ubiquitin-like; Chro.10045 60 AAELO 1000925 3 1001 . Snake toxin-like; Chro.10047 61 AAELO 1000727 686 2297 similar to Carboxypeptidase A2 precursor Zn-dependent exopeptidases;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Ubiquinone biosynthesis protein COQ4 homolog (Coenzyme Q biosynthesis protein 4 homolog) (CGI-
92)Dgi|15080258|gb|AAHl 1895.1| CGI-92
Chro.10049 62 AAELO 1000257 9758 10225 protein
Chro.10050 63 AAELO 1000257 8109 8921 similar to Golgi coiled coil protein GCCl 85.
Chro.10051 64 AAEL01000257 5656 7851 protein kinase, putative Protein kinase-like (PK-like);
Chro.10052 65 AAEL01000257 5344 5631 ubiquitin conjugating enzyme E2, putative UBC-like;
Chro.10053 66 AAEL01000257 5127 5402
N-terminal nucleophile aminohydrolases
Chro.10054 67 AAEL01000257 3717 3968 2OS proteasome beta subunit D2 (PBD2) (Ntn hydrolases);
Chro.10055 68 AAELO 1000257 658 1383 .
-4 IsJ Chro.10056 69 AAELO 1000100 17957 19723 hypothetical protein
Chro.10057 70 AAELO 1000100 13988 16888 .
Chro.10058 71 AAELOIOOOIOO 12348 12845 .
Chro.10059 72 AAELO 1000100 11956 12348 .
Chro.10060 73 AAELOIOOOIOO 8880 10220 hypothetical protein
Chro.10061 74 AAELOIOOOIOO 6786 8570 .
Chro.10062 75 AAELOIOOOIOO 5460 5957 vacuolar ATP synthetase, putative FIFO ATP synthase subunit C;
Vacuolar ATP synthase 16 kDa proteolipid subunit (V-ATPase 16 kDa proteolipid subunit)Dgi|1208770|gb|AAB67833.1| V- type ATPase 16 kDa proteolipid subunitDgi|2149129|gb|AAB58498.1|
Chro.10063 76 AAELOIOOOIOO 3644 4141 vacuolar-type H(+)-ATPase FIFO ATP synthase subunit C;
Chro.10064 77 AAEL01000867 12 1298 .
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.10065 78 AAELO 1000049 274 3138 .
Diisopropylfluorophosphatase
Chro.10066 79 AAELO 1000049 3942 4319 . (phosphotriesterase, DFP);
Chro.10067 80 AAELO 1000049 4539 4949 .
Chro.10068 81 AAEL01000049 5146 5850 .
P-loop containing nucleotide triphosphate
Chro.10069 82 AAEL01000049 7388 9646 dynamin-like protein hydrolases;
Ankyrin repeat; Quinoprotein alcohol
Chro.10070 83 AAEL01000049 10971 18911 . dehydrogenase-like; putative oxoglutarate/malate translocator
Chro.10071 84 AAELO 1000049 19611 20435 protein
Chro.10072 85 AAELO 1000049 21145 21573 expressed protein
~4 Chro.10073 86 AAEL01000049 21558 21908 .
Chro.10074 87 AAEL01000049 22159 23475 .
Chro.10075 88 AAEL01000049 24022 24951 .
Chro.10076 89 AAELO 1000049 25788 27572 .
Chro.10077 90 AAELO 1000440 2930 3181 .
Chro.10078 91 AAEL01000440 150 2294 .
Chro.10079 92 AAEL01000462 2012 3028 .
Chro.10080 93 AAELO 1000489 3668 4555 .
Chro.10081 94 AAEL01000489 1723 2910 .
Chro.10082 95 AAEL01000489 810 1304 .
Chro.10083 96 AAEL01000864 106 1209 ATP-binding cassette protein
P-loop containing nucleotide triphosphate
Chro.10084 97 AAEL01000765 324 1769 ATP-binding cassette protein hydrolases;
Chro.10085 98 AAELOlOOl 125 26 889 .
Chro.10086 99 AAEL01000775 668 1831 hypothetical protein
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superf amity
Chro.10087 100 AAEL01000775 3 215 .
Chro.10089 101 AAEL01000860 89 1126 hypothetical protein
Chro.10090 102 AAEL01000499 138 371 .
Chro.10092 103 AAELO 1000499 1007 1369 similar to ash2
P-loop containing nucleotide triphosphate
Chro.10093 104 AAELO 1000979 143 772 cytoplasmic dynein 1 -related hydrolases;
Chro.10094 105 AAEL01000290 6690 9230 dynein heavy chain, putative Ribosomal protein L29 (L29p);
(Phosphotyrosine protein) phosphatases II;
Chro.10095 106 AAELO 1000290 1528 3735 MAP kinase phosphatase Actin depolymerizing proteins;
Chro.10096 107 AAELO 1000269 9603 9950 .
Chro.10097 108 AAEL01000269 7920 8567 .
Chro.10098 109 AAEL01000269 2813 7009 . RNI-like;
Chro.10099 110 AAELO 1000269 1 1860 Protein disulfide isomerase CG6988-PA Thioredoxin-like;
Chro.10100 111 AAELO 1000298 7615 9230 serine/threonine-protein kinase Protein kinase-like (PK-like);
Chro.lOlOl 112 AAEL01000298 4130 6424 binding protein, putative Ankyrin repeat; Zn2/Cys6 DNA-binding doi similar to Neurospora crassa. Related to P-loop containing nucleotide triphosphate
Chro.10103 113 AAEL01000298 794 3778 SENl protein hydrolases;
Chro.10105 114 AAEL01000298 127 423
Chro.10106 115 AAELO 1000084 1996 2448 Unknown (protein for MGC:73211) Winged helix DNA-binding domain;
Chro.10107 116 AAEL01000084 3586 4218 cyclophilin homolog Ta cyp Cyclophilin (peptidylprolyl isomerase); Eukaryotic initiation factor 4A (eIF4A) (eIF-4A) D gi|2150025|gb|AAB58726.11 P-loop containing nucleotide triphosphate
Chro.10108 117 AAELO 1000084 5068 6285 translation initiation factor hydrolases;
Chro.10109 118 AAEL01000084 6992 10981 Protein kinase domain, putative Protein kinase-like (PK-like); putative zinc finger transcription factor
Cnro.lOl lO 119 AAELO 1000084 13275 13850 ZFP33
Chro.10111 120 AAEL01000084 14656 15855 actin, putative Actin-like ATPase domain;
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.10112 121 AAELO 1000084 16718 17611 hypothetical protein, conserved L domain-like;
Chro.10114 122 AAELO 1000084 17866 18405 hypothetical predicted transmembrane
Chro.10115 123 AAELO 1000084 19423 20868 protein, unknown function Ankyrin repeat;
Chro.10118 124 AAELO 1000274 947 3403 • RING finger domain, C3HC4;
P-loop containing nucleotide triphosphate
Chro.10119 125 AAELO 1000274 4566 6422 RNase L inhibitor-like protein hydrolases; 4Fe-4S ferredoxins; iNΛU^r; τransnyαrogenase oeta suounrc, i/tiύ-uκe iNΛJU/rΛJj-Dmαmg αomam;
Chro.10120 126 AAELO 1000274 7200 9845 putative Formate/glycerate dehydrogenase catalytic
Chro.10121 127 AAELO 1000779 236 1132 t-snare proteins;
Chro.10122 128 AAELO 1000965 534 1229
Chro.10123 129 AAELO 1000965 1 105
^ Chro.10124 130 AAELO 1000945 653 967
Chro.10125 131 AAELO 1000599 2 1153
Chro.10126 132 AAEL01001221 71 754
Chro.10127 133 AAEL01000347 2635 2904
Chro.10128 134 AAELO 1000347 2985 3476 RNA recognition motif, putative RNA-binding domain, RBD;
Chro.10129 135 AAEL01000347 4150 4473 ,
Chro.10130 136 AAEL01000347 5002 7299 SET domain; alpha/beta-Hydrolases; Galactose-binding
Chro.10131 137 AAELO 1000008 48278 51118 hypothetical protein RvI 835c domain-like;
Chro.10133 138 AAEL01000008 46405 47769 Hypothetical protein CBGO 1950
Chro.10134 139 AAELO 1000008 43966 45687 hypothetical protein ENTH/VHS domain;
Chro.10135 140 AAEL01000008 42884 43597 sf-assemblin-like protein, possible similar to proteasome 26S subunit, non-
Chro.10136 141 AAELO 1000008 41695 42501 ATPase, 10-related Ankyrin repeat; Acyl-CoA binding protein;
Chro.10137 142 AAEL01000008 41004 41384
Table 1
Ch_Gene SEQ ID Start End Description Superfamily
Chro.10138 143 AAELO 1000008 39676 40569 .
Chro.10139 144 AAELO 1000008 38392 39516 UCHL5 protein Cysteine proteinases;
P-loop containing nucleotide triphosphate
Chro.10140 145 AAELO 1000008 35552 38185 DNA repair protein RAD54-like hydrolases;
Chro.10141 146 AAEL01000008 33860 34783 .
Chro.10142 147 AAEL01000008 32111 33799 .
Chro.10143 148 AAEL01000008 29162 31438 CBKl Protein kinase-like (PK-like);
Chro.10144 149 AAEL01000008 27901 28956 .
C-terminal domain of phosphatidylinositol transfer protein secl4p; N-terminal domain of phosphatidylinositol transfer protein
~4 Chro.10145 150 AAELO 1000008 23762 25147 hypothetical protein secl4p;
Chro.10146 151 AAEL01000008 15896 23227 .
Chro.10147 152 AAEL01000008 14954 15811 .
Chro.10148 153 AAELO 1000008 13084 14265 hypothetical protein UBA-like;
£,uκaryoπc τype jvti-αomam
Figure imgf000078_0001
Chro.10149 154 AAEL01000008 11347 12729 . domain); Eukaryotic type KH-domain
Chro.10150 155 AAELO 1000008 10395 11195 hypothetical protein .
Chro.10151 156 AAELO 1000008 9203 9874 SPY protein TPR-like;
Chro.10152 157 AAEL01000008 5164 6015 cleavage stimulation factor, putative RNA-binding domain, RBD;
Chro.10153 157 AAELO 1000008 4817 4975 .
Chro.10154 159 AAEL01000008 4337 4723 .
SWI/SNF-related, matrix associated, actin- dependent regulator of chromatin subfamily A containing DEAD/H box 1 P-loop containing nucleotide triphosphate
Chro.10155 160 AAEL01000008 1269 3692 (Enhancer trap locus homolog 1) (EtI-I) hydrolases;
Chro.10156 161 AAELO 1000008 217 1272 .
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
P-loop containing nucleotide triphosphate
Chro.10157 162 AAEL01000270 1941 4253 abc transporter (1D44) hydrolases;
Chro.10158 163 AAEL01000270 4287 4823
Chro.10159 164 AAEL01000270 5592 6068 protein phosphatase 2B regulatory subi EF-hand; cell cycle regulator with zn-fϊnger dom
Chro.10160 165 AAELO 1000270 6370 7410 putative Zn2/Cys6 DNA-binding domain;
Chro.10161 166 AAEL01000270 7913 9304
Chro.10162 167 AAEL01000270 9336 9638
Chro.10163 168 AAEL01000061 982 1725
DNA repair and meiosis protein Mrel 1
Chro.10164 169 AAEL01000061 2226 3767 (emb|CAB50793.1) Metallo-dependent phosphatases;
Chro.10165 170 AAEL01000061 4290 4643 .
^ Chro.10166 171 AAEL01000061 4712 5572
^ Chro.10167 172 AAEL01000061 5765 8119 ORF MSV156 hypothetical protein
Chro.10168 173 AAELO 1000061 8676 11828 chloroquine resistance marker protein
Chro.10170 174 AAEL01000061 11962 13959
Chro.10171 175 AAEL01000061 14113 14796
Chro.10172 176 AAEL01000061 15290 16957 NEK2 protein Protein kinase-like (PK-like);
Chro.10173 177 AAELO 1000061 17414 18151
Chro.10174 178 AAEL01000061 18233 19153
Chro.10175 179 AAELOlOOl 172 180 551
Chro.10176 180 AAELO 1000064 42 1082 Concanavalin A-like lectins/glucanases;
Chro.10177 181 AAEL01000064 1179 2861 hypothetical protein
Chro.10178 182 AAELO 1000064 3257 5290 dynein intermediate chain 2, cytosolic WD40-repeat;
Chro.10179 183 AAELO 1000064 7267 7839 hypothetical protein
Chro.10180 184 AAEL01000064 8001 9188 E2f3 protein Winged helix DNA-binding domain;
Chro.10181 185 AAELO 1000064 9566 11278
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.10182 186 AAELO 1000064 11424 14216 HC-23 protein RING finger domain, C3HC4; Chro.10183 187 AAELO 1000064 15114 15692 protein kinase c inhibitor-like protein,
Cliro.10184 188 AAEL01000064 16078 16431 putative HIT-like; Chro.10185 189 AAEL01000064 16613 18010 Chro.10186 190 AAEL01000064 18157 18927 . Nucleic acid-binding proteins; Chro.10187 191 AAEL01000064 19375 19872 Chro.10188 192 AAELO 1000064 20960 24898 Chro.10189 193 AAELO 1000326 61 4074 FYVE/PHD zinc finger; Chro.10190 194 AAELO 1000326 4190 4648 . Chro.10191 195 AAELO 1000326 5145 5468 Ribosomal protein L36e Chro.10192 196 AAELO 1000326 6675 7208 Unknown (protein for MGC:63889) Chro.10193 197
-4 AAEL01000326 7327 8397 LuxS/MPP-like metallohydrolase;
OO Chro.10194 198 AAELO 1000684 274 885 Tudor/PWWP; FYVE/PHD zinc finger;
Glucocorticoid receptor-like (DNA-binding
Chro.10195 199 AAEL01000338 1327 3657 domain); Chro.10196 200 AAEL01000338 4284 5096 phosphoglycerate mutase family, putative Phosphoglycerate mutase-like; Chro.10197 201 AAEL01000338 6203 8224 . Chro.10198 201 AAELO 1000164 12378 14600 hypothetical protein alpha/beta knot; Chro.10199 203 AAEL01000164 11141 12385 conserved hypothetical protein HAD-like; Chro.10200 204 AAEL01000164 10222 11007 ENSANGPOOOOOO 10471 Chro.10201 205 AAELO 1000164 8519 10057 Chro.10202 206 AAEL01000164 7493 8518 hypothetical protein Chro.10203 207 AAEL01000164 5337 6719 Colicin E immunity proteins; zinc finger (C3HC4-type RING finger)
Chro.10204 208 AAEL01000164 2607 4589 protein family RING finger domain, C3HC4; Chro.10205 209 AAELO 1000164 993 2477 transducin / WD-40 repeat protein family WD40-repeat;
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Effector domain of the protein kinase
Chro.10206 210 AAELO 1000164 3 785 hypothetical protein pkn/prkl;
Chro.10207 211 AAEL01001320 206 361 .
Chro.10208 212 AAEL01000191 1188 1805 conserved protein, putative
Chro.10209 213 AAEL01000191 2141 4933 .
Chro.10210 214 AAEL01000191 4949 5398 G-patch domain, putative translation initiation factor EIF-2b alpha
Chro.10211 215 AAEL01000191 5584 6714 subunit, putative
Chro.10212 216 AAEL01000191 7128 8591 hypothetical protein
Chro.10213 217 AAEL01000191 8845 9456 .
Chro.10214 218 AAEL01000191 9644 10150 vesicle transport protein, putative SNARE-like;
Chro.10215 219 AAEL01000191 10171 10377 hypothetical protein
-4 Uracil phosphoribosyltransferase (UMP pyrophosphorylase) (UPRTase)
(UPRT)Dgi|499106|gb|AAB60213.1| ur∑
Chro.10216 220. AAEL01000191 10573 11286 phosphoribosyl transferase PRTase-like;
Chro.10217 221 AAEL01000191 11454 12449 . Chaperone J-domain;
Chro.10218 222 AAEL01000493 111 1529 .
Chro.10219 223 AAEL01000934 264 737 .
Ubiquitin-protein ligase E3a, Hect catalytic
Chro.10220 224 AAEL01000147 1017 1787 hect domain and RLD 2 domain (E6ap);
WD-40 repeat protein
MSIl Dgi|7444288[pir||T04324 Gl/S transition control protein-binding protein MSIl - tomato D gi|2394227|gb|AAB70241.11 WD-
Chro.10221 225 AAEL01000147 1969 3198 40 repeat protein WD40-repeat;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.10222 226 AAEL01000147 3260 3493 wd-40 repeat protein msi3 WD40-repeat; Chro.10223 227 AAEL01000147 3567 4124 Homo sapiens HSPC236, putative Ran-binding protein moglp;
RING finger domain, C3HC4; Cdc48
Chro.10224 228 AAEL01000147 4189 5430 hypothetical protein domain 2-like; Chro.10225 229 AAEL01000147 5527 6129 hypothetical protein, conserved Nucleic acid-binding proteins; Chro.10226 230 AAEL01000147 6755 7324 i^nam n, structure ui rpt Jtsounα io i erpenoiα cyiases/rrotein
Chro.10227 231 AAEL01000147 7899 9392 GgppDgi|30749820|pdb|lOlS|B Chain B, prenyltransferases; Chro.10228 232 AAEL01000147 9993 10487 hypothetical protein Chro.10229 233 AAEL01000147 10703 12796 expressed protein similar to Plasmodium falciparum (isolate
Chro.10230 234 AAELO 1000147 12853 14751 3D7). Hypothetical protein Chro.10232 235 AAEL01000147 15140 15760
OO
O Chro.10233 236 AAELO 1000218 10532 12088
Phosphoenolpyruvate/pyruvate domain;
Chro.10234 237 AAEL01000218 8703 10283 pyruvate kinase Pyruvate kinase, C-terminal domain; Chro.10235 238 AAELO 1000218 7228 7992 . WD40-repeat;
P-loop containing nucleotide triphosphate
Chro.10236 239 AAEL01000218 6719 6937 putative Rab2 GTPase hydrolases; Chro.10237 240 AAELO 1000218 4214 5713 . Tudor/PWWP; Chro.10238 241 AAEL01000218 3470 4162 .
Chro.10239 242 AAEL01000218 2211 3326 hypothetical protein Adenine nucleotide alpha hydrolases-like; Chro.10240 243 AAELO 1000218 726 1775 hypothetical protein AN7301.2
Chro.10241 244 AAEL01000555 1970 3619 hypothetical protein AN0576.2 Protein kinase-like (PK-like); ARM repeat; C-terminal (heme dl) domain of Chro.10242 245 AAEL01001236 163 819 . cytochrome cdl -nitrite reductase;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.10243 246 AAEL01000367 4585 7389 . ARM repeat;
Nucleotidylyl transferase; Ribosomal
Chro.10244 247 AAELO 1000367 2627 4549 glutaminyl-tRNA synthetase, putative protein L25-like;
Chro.10245 248 AAEL01000367 1648 2493.
Chro.10246 249 AAEL01000367 261 1556. POZ domain;
Chro.10247 250 AAEL01000532 1088 3337. GYF domain; POZ domain;
Chro.10248 251 AAEL01000532 373 1011 hypothetical protein L240.08 SET domain;
P-loop containing nucleotide triphosphate
Chro.10249 252 AAEL01000587 2177 3346 vesicle transfer ATPase -related hydrolases;
Chro.10250 253 AAEL01000220 1111224422 11916 putative potassium/proton antiporter
Chro.10251 254 AAELO 1000220 9679 11055 .
Chro.10252 255 AAELO 1000220 9267 9626 .
OO Chro.10253 256 AAELO 1000220 8390 9031 hypothetical protein
Chro.10254 257 AAEL01000220 7175 8371 Similar to WD40 protein Ciaol WD40-repeat;
Chro.10255 258 AAELO 1000220 5706 6653 aspartyl protease-like Acid proteases;
similar to expressed protein; protein id: Atlg20580.1, supported by cDNA: 27792., supported by cDNA: gi_l 5724291,
Chro.10256 259 AAELO 1000220 4935 5321 supported by cDNA: gi_20334747 Sm-like ribonucleoproteins;
Chro.10257 260 AAEL01000220 4386 4820 RNA polymerase subunit 8c, putative Nucleic acid-binding proteins;
Chro.10258 261 AAEL01000220 2989 3546 dnaJ Chaperone J-domain;
Chro.10259 262 AAEL01000220 589 2580 .
Chro.10260 263 AAELO 1000022 225 2324 .
Chro.10261 264 AAELO 1000022 3494 4816 hypothetical protein Cyclin-like;
Chro.10262 265 AAEL01000022 5999 6841 . Homeodomain-like;
Chro.10263 266 AAELOl 000022 7074 7619 . DNA clamp;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.10264 267 AAEL01000022 8095 9780 . protein phosphatase 4 (formerly X), catalytic subunit; Protein phosphatase 4,
Chro.10265 268 AAEL01000022 10148 11062 catalytic subunit Metallo-dependent phosphatases;
Chro.10266 269 AAELO1000022 11162 12133 ENSANGP00000009305
Chro.10267 270 AAELO1000022 12552 14240 WD40-repeat; F-box domain;
Chro.10268 271 AAEL01000022 14913 15572
Chro.10269 272 AAELO1000022 16060 17070
Chro.10270 273 AAELO1000022 19740 20036 RAD50 DNA repair protein -related
Chro.10271 274 AAEL01000022 20080 20859 RAD50 homolog
Chro.10272 275 AAELO1000022 21370 22539 hypothetical protein PH0435 YrdC/RibB;
Chro.10273 276 AAELO1000022 22753 23688 similar to actin related protein Ml Actin-like ATPase domain;
00 Chro.10274 277 AAELO1000022 24107 25492 hypothetical protein
Chro.10275 278 AAELO1000022 25519 28266 hypothetical protein Acyl-CoA N-acyltransferases (Nat);
Chro.10276 279 AAELO1000022 29328 29900 phosphotyrosyl phosphatase activator
Chro.10277 280 AAELO1000022 30220 31170 protein -related
Chro.10278 281 AAEL01000022 31417 32607 hypothetical protein Actin-like ATPase domain;
Proteasome subunit beta type 1 (20S proteasome alpha subunit F) (2OS proteasome subunit beta-
6) D gi|3608485|gb|AAC35983.11 N-terminal nucleophile aminohydrolases
Chro.10279 282 AAEL01000022 33084 33407 proteasome beta subunit (Ntn hydrolases);
Chro.10280 283 AAELO1000022 34176 36074 signal recognition particle 68 TPR-like;
Chro.10281 284 AAELO1000022 36120 36998
Chro.10282 285 AAELO1000022 37757 38077
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily
P-loop containing nucleotide triphosphate
Chro.10283 286 AAEL01000833 16 1710 hydrolases; Chro.10284 287 AAEL01000630 806 2902 Chro.10285 288 AAEL01000598 781 3264 Chro.10286 289 AAEL01000598 2 520 hypothetical protein probable mitochondrial import receptor
Chro.10287 290 AAEL01000491 3595 4524 subunit tom40 homolog Chro.10288 291 AAELO 1000283 75 2303
ADP-ribosylation factor-like protein 2 P-loop containing nucleotide triphosphate
Chro.10289 292 AAEL01000283 2498 3241 (ARL2) hydrolases; Chro.10290 293 AAELO 1000283 3261 4031 expressed protein RING finger domain, C3HC4; Chro.10291 294 AAEL01000283 4290 6548 transcription initiation factor TFIID subunit WD40-repeat;
OO Chro.10292 295 AAELO 1000283 6723 7247. Chro.10294 296 AAELO 1000673 16 2157. Chro.10295 297 AAELO 1000010 47003 47341. Chro.10296 298 AAELOIOOOOIO 45515 46936 calcium antiporter, putative Chro.10297 299 AAELOIOOOOIO 43578 44315 hypothetical protein Protein kinase-like (PK-like); putative APCIl anaphase-promoting
Chro.10298 300 AAELOIOOOOIO 43048 43338 complex subunit RING finger domain, C3HC4;
P-loop containing nucleotide triphosphate
Chro.10299 301 AAELOIOOOOIO 40102 42699 Unknown (protein for MGC:55590) hydrolases; Chro.10300 302 AAELOIOOOOIO 39507 39986 ENSANGP00000020842 Acyl-CoA N-acyltransferases (Nat); Chro.10301 303 AAELOIOOOOIO 38679 38966 Chro.10302 304 AAELOIOOOOIO 37112 38623 ankyrin-related protein Ankyrin repeat; TPR-like; s-adenosylmethionine-dependent S-adenosyl-L-methionine-dependent
Chro.10303 305 AAELOIOOOOIO 35911 36534 methyltransferase, putative methyltransferases;
Table 1 Ch_Gene SEQ ED NO. Ch Accession Start End Description Superfamily hypothetical protein ( related to snRNP
Chro.10304 306 AAELOIOOOOIO 35587 35790 protein SMX3 Sm-like ribonucleoproteins;
Methionine aminopeptidase 1 (MetAP 1) Chro.10305 307 AAELOIOOOOIO 34052 35275 (MAP 1) (Peptidase M 1) Creatinase/aminopeptidase;
Chro.10306 308 AAELOIOOOOIO 32700 33767 conjugation stage-specific protein, putative RBPI l -like subunits of RNA polymerase; Chro.10307 309 AAELOIOOOOIO 30211 32490 . Chro.10308 310 AAELOIOOOOIO 28007 29329 RNA-binding protein SiahBP RNA-binding domain, RBD; Chro.10309 311 AAELOIOOOOIO 24171 26756 centromere protein ZWlO
P-loop containing nucleotide triphosphate
Chro.10310 312 AAELOIOOOOIO 22099 23985 . hydrolases;
P-loop containing nucleotide triphosphate
OO 4- Chro.10311 313 AAELOIOOOOIO 20814 22007 conserved GTP-binding protein, putative hydrolases; TGS-like;
DNA-directed RNA polymerase I polypeptide 2 (RNA polymerase I subunit
2) D gi|7493960|pir||T30515 DNA-directed
RNA polymerase (EC 2.7.7.6) 1 135K chain - Neurospora crassaDgi|3668171|dbj|BAA33445.1[ RNA beta and beta-prime subunits of DNA
Chro.10312 314 AAELOIOOOOIO 16656 20501 polymerase I second-largest subunit dependent RNA-polymerase;
Chro.10313 315 AAELOIOOOOIO 15342 16208 .
Chro.10314 316 AAELOIOOOOIO 13888 14112 Hypothetical protein CBG12253 Ubiquitin-like;
Chro.10315 317 AAELOIOOOOIO 13212 13733 OSJNBa0084K01.4
Chro.10316 318 AAELOIOOOOIO 11468 12562 .
Chro.10317 319 AAELOIOOOOIO 10158 11135 syntaxin 5, putative t-snare proteins;
Chro.10318 320 AAELOIOOOOIO 5578 10059 ENSANGP00000003051
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.10319 321 AAELOIOOOOIO 1627 5094 Protein kinase domain, putative Protein kinase-like (PK-like);
S-adenosyl-L-methionine-dependent
Chro.10320 322 AAELOIOOOOIO 3 665 co-enzyme Q deficient; Coq5p methyltransferases;
Chro.10321 323 AAELO 1000029 31536 33614 cgl protein Mannose 6-phosphate receptor domain;
C-terminal (heme dl) domain of cytochrome cdl -nitrite reductase; WD40-
Chro.10322 324 AAEL01000029 26280 29225 probable WD-repeat membrane protein repeat;
Chro.10323 325 AAEL01000029 24170 25942 . similar to Arabidopsis thaliana (Mouse-ear cress). Similarity to small nuclear ribonucleoprotein (Unknown protein)
Chro.10324 326 AAELO1000029 23664 24083 (Hypothetical 27.0 kDa protein) Sm-like ribonucleoproteins;
OO Chro.10325 327 AAEL01000029 22657 23319 Golgi SNARE protein, putative
Ul
Chro.10326 328 AAELO1000029 21902 22306
Chro.10327 329 AAELO1000029 21052 21828 ORF2
Chro.10328 330 AAEL01000029 18611 19261 CG12259-PA
Chro.10329 331 AAELO1000029 16075 18330 Protein kinase domain, putative Protein kinase-like (PK-like);
DNAJ-like molecular chaperone protein,
Chro.10330 332 AAELO1000029 14292 15461 putative Chaperone J-domain;
Chro.10331 333 AAEL01000029 13276 14004 Unknown (protein for MGG77351) 14-3-3 protein;
Chro.10332 334 AAEL01000029 12448 12858
Chro.10333 335 AAEL01000029 11432 11869 ribosomal protein L27, putative ER lumen protein retaining receptor-like
Chro.10334 336 AAELO1000029 10002 10856 protein, putative
Chro.10335 337 AAELO1000029 8244 9320 fructose-l,6-bisphosphate aldolase Aldolase;
Chro.10336 338 AAEL01000029 6495 8 8112266 Similar to hypothetical protein MGC47001 WD40-repeat; RING finger domain, C3HC4
Table 1
ChjGene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.10337 339 AAEL01000029 2935 3687 triose-phosphate isomerase Triosephosphate isomerase (TIM);
Chro.10338 1 AAELO 1000029 677 2053 zinc transporter
Chro.10339 340 AAELO 1000029 30 569 .
Chro.10340 341 AAELO 1000620 2981 3202 .
Chro.10341 342 AAEL01000620 81 2735 . DNA clamp;
Chro.10342 343 AAELO 1000969 99 1034 .
Chro.10343 344 AAEL01000469 104 4066 . ARM repeat;
Chro.10344 345 AAEL01000181 144 635 .
Chro.10345 346 AAEL01000181 846 1709 19096-22891 RNA-binding domain, RBD;
Chro.10346 347 AAEL01000181 1888 3108 .
Chro.1'0348 348 AAEL01000181 3782 5614 . WD40-repeat;
Chro.10349 349 AAEL01000181 5620 8157 .
OO Chro.10350 350 AAEL01000181 8762 10510 . CoA-dependent acyltransferases;
Chro.10351 351 AAEL01000181 10607 10813 .
Chro.10352 352 AAEL01000181 11194 13272 similar to CG11030-PA
Chro.10354 353 AAEL01000756 4 846 . Cyclin-like;
Chro.10355 354 AAEL01001215 314 814 .
Chro.10356 355 AAELO 1000803 34 1188 hypothetical protein similar to Plasmodium falciparum (isolate
Chro.10357 356 AAELO 1000485 299 1669 3D7). Hypothetical protein
Chro.10358 357 AAEL01000485 2057 4282 .
Chro.10359 358 AAEL01000312 8327 8950 .
Chro.10360 359 AAEL01000312 3910 7023 . •
Chro.10362 360 AAELO 1000312 1241 3280 erythrocyte membrane-associated antigen EF-hand;
Chro.10363 361 AAEL01000735 628 1815 .
Chro.10364 362 AAEL01000742 1266 1994 .
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.10365 363 AAELO 1000504 2084 2791 .
Chro.10366 364 AAELO 1000504 3202 4239 .
Chro.10367 365 AAEL01001006 467 772 .
Chro.10371 366 AAELO 1000514 2738 3319 carboxylesterase alpha/beta-Hydrolases; transcription/repair factor TFIIH subunit
Chro.10372 367 AAEL01000514 358 1248 Tfb3 RING finger domain, C3HC4;
Chro.10373 368 AAEL01001200 3 521 cyclin, putative Cyclin-like;
Chro.10374 369 AAELO 1000404 35 835 ENSANGP00000021884 RING finger domain, C3HC4;
Chro.10375 370 AAEL01000404 1773 2339 .
Chro.10376 371 AAELO 1000404 2539 3456 predicted hydrolase HAD-like;
Chro.10377 372 AAEL01000404 5186 5704 .
Chro.10378 373 AAELO 1000404 5731 6060 hypothetical protein
Chro.10379 374 AAEL01000411 6 251 .
∞ Chro.10380 375 AAEL01000411 405 1229 phosphatidylinositol-glycan-class c Nuclear receptor coactivator Src-1; P-loop containing nucleotide triphosphate
Chro.10381 376 AAEL01000411 2464 3846 putative AAA-family ATPase hydrolases;
Chro.10382 377 AAEL01000411 4271 5404 .
CCAAT-box DNA binding protein subunit. DNA polymerase beta, N-terminal domain-
Chro.10383 378 AAEL01000563 54 1982 B like;
Chro.10384 379 AAEL01000563 2554 3708 ENSANGPOOOOOO 19228 FMN-linked oxidoreductases;
Chro.10385 380 AAEL01000813 471 899 .
Chro.10386 381 AAEL01000813 1648 1812 .
Chro.10387 382 AAEL01001094 73 942 .
Chro.10388 383 AAELO 1000209 295 1659 unknown protein, putative
Chro.10389 384 AAEL01000209 2553 2966 .
Chro.10390 9 AAELO 1000209 4021 6078 thrombospondin related adhesive protein TSP-I type 1 repeat;
Table 1
Ch Gene SEQ BD NO. Ch_Accession Start End Description Superfamily
TSPl domain-containing protein TSP3 TSP-I type 1 repeat; Hairpin loop
Chro.10391 385 AAELO 1000209 6853 8376 precursor containing domain-like;
ERYTHROCYTE MEMBRANE
Chro.10392 386 AAELO 1000209 9193 10866 PROTEIN PFEMP3 putative single stranded G-strand telomeric
Chro.10393 387 AAEL01000167 1663 2259 DNA-binding protein RNA-binding domain, RBD;
Chro.10394 388 AAELO 1000167 4231 8625 Protein prenylyltransferase; TPR-like;
Chro.10395 389 AAEL01000167 9344 9619
Chro.10396 390 AAELO 1000167 11104 11319
Chro.10397 391 AAELO 1000167 11354 14095 Hairpin loop containing domain-like;
Chro.10398 392 AAELO 1000167 14681 14815
Chro.10401 393 AAEL01001341 308 652 χ Chro.10402 394 AAEL01000547 2951 3385
00 Chro.10403 395 AAEL01000547 561 2045 SRF-like;
Chro.10404 396 AAELO 1000654 1045 2253
Chro.10405 397 AAELO 1000654 2457 2789
Chro.10406 398 AAEL01000777 271 2037
Chro.10407 399 AAEL01000128 203 1309 hypothetical protein
Chro.10408 400 AAEL01000128 1691 3946
Chro.10410 401 AAEL01000128 4392 5966
Chro.10411 402 AAEL01000128 6724 7779
Chro.10412 403 AAEL01000128 8080 8697 hypothetical protein, conserved chromodomain-helicase-DNA-binding P-loop containing nucleotide triphosphate
Chro.10413 404 AAEL01000128 9377 15454 protein, CHD-I -related hydrolases;
Chro.10415 405 AAEL01000128 16416 16715 EGF/Laminin;
Chro.10416 406 AAELO 1000346 5498 7882 aspartyl (acid) protease, putative Acid proteases;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.10417 407 AAEL01000346 2765 4126 cell cycle switch protein Quinoprotein alcohol dehydrogenase-like;
Acetyl-coenzyme A synthetase (Acetate-- CoA ligase) (Acyl-activating enzyme)Qgi|886027|gb|AAC47128.1|
Chro.10418 408 AAELO1000346 468 2555 acetyl-CoA synthetase Firefly luciferase-like;
Chro.10419 409 AAELOlOOOlll 16877 17908 mannosyltransferase-related glucosamine-fructose-6-phosphate SIS domain; N-terminal nucleophile
Chro.10420 410 AAELOlOOOlll 14520 16313 aminotransferase aminohydrolases (Ntn hydrolases);
Chro.10421 411 AAELOlOOOlll 9595 13818 hypothetical protein AN8767.2 Ankyrin repeat;
Chro.10422 412 AAELOlOOOlll 8614 9348 Unknown (protein for MGC:75683) alpha/beta-Hydrolases;
Chro.10423 413 AAELOlOOOlll 4787 8296
00 retinitis pigmentosa GTPase regulator-like
Chro.10424 414 AAELOlOOOlll 1268 3706 protein
Chro.10425 415 AAELOlOOOlll 95 1093
Chro.10426 416 AAELO1000183 9717 10289 hypothetical protein, conserved hypothetical predicted transmembrane
Chro.10427 417 AAELO1000183 6656 9385 protein, unknown function
Chro.10429 418 AAEL01000183 2963 5953
Chro.10430 419 AAELO1000183 2294 2605
Chro.10431 420 AAELO1000183 179 1768 LuxS/MPP-like metallohydrolase;
Chro.10432 421 AAEL01000340 633 3404
Chro.10433 422 AAEL01000340 5638 5889 deoxyuridine 5 '-triphosphate Deoxyuridine 5'-triphosphate
Chro.10434 423 AAELO1000340 5921 6481 nucleotidohydrolase, putative nucleotidohydrolase (dUTPase);
Chro.11000 424 AAEL01000489 1888 2361
Chro.11001 425 AAELO1000985 2 1252 similar to Noc2p N-terminus
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.11002 426 AAEL01000499 2 304 . Chro.11003 427 AAELO 1000727 1 68 . Chro.11004 428 AAEL01001006 1 113 . Chro.11005 429 AAELO 1001006 214 346 .
Heat shock protein 7OkD (HSP70), C- terminal substrate-binding fragment; Actin-
Chro.20010 430 AAEL01000158 12080 14113 heat shock protein like ATPase domain; Chro.20011 431 AAEL01000158 9504 11015 molybdenum cofactor sulfurase PLP-dependent transferases; Chro.20012 432 AAEL01000158 7926 9422 dna-(apurinic or apyrimidinic site) lyase DNase I-like; Chro.20013 433 AAEL01000158 5517 7016 Hypothetical protein CBG09590 Nucleic acid-binding proteins;
P-loop containing nucleotide triphosphate
Chro.20014 434 AAEL01000158 150 4757 ATP-binding cassette protein 2 hydrolases;
O P-loop containing nucleotide triphosphate
Chro.20017 435 AAEL01000120 12762 17519 ATP-binding cassette protein 2 hydrolases; Chro.20018 436 AAEL01000120 5 721 .
P-loop containing nucleotide triphosphate
Chτo.20019 437 AAEL01000487 4614 4821 Dead Box Protein 6; Dbp6p hydrolases; Chro.20020 438 AAEL01000487 2013 2351 acidic ribosomal protein P2 Chro.20021 439 AAEL01000487 321 689 . Chro.20022 440 AAELO 1000713 1842 2354 hypothetical coiled-coil protein
40S ribosomal subunit protein S24,
Chro.20023 441 AAEL01000713 797 1192 putative Chro.20024 442 AAEL01000713 269 427 . Chro.20025 443 AAELO 1000202 963 1328 CGI-141 protein Chro.20026 444 AAEL01000202 1563 2516 hypothetical protein
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
NAD(P)-binding Rossmann-fold domains; glycerol-3 -phosphate dehydrogenase, 6-phosphogluconate dehydrogenase C-
Chro.20028 445 AAEL01000202 3123 4373 putative terminal domain-like;
Chro.20029 446 AAELO 1000202 5155 6591 Gas41 homologue, putative
Chro.20030 447 AAEL01000202 7083 11870 hypothetical protein MG04549.4 DNase I-like;
Chro.20031 448 AAEL01000262 9774 10094 .
Chro.20032 449 AAEL01000262 9262 9654 vacuolar ATP synthase subunit g, putative
Chro.20033 450 AAEL01000262 7945 8601 . eukaryotic translation initiation factor 3
Chro.20034 451 AAEL01000262 5892 7529 subunit 7, putative
60S RIBOSOMAL PROTEIN L15-
2 Dgi|2982318|gb|AAC32144.11 probable
Chro.20035 452 AAEL01000262 4756 5373 60S ribosomal protein L15 Ribosomal proteins L23 and L15e;
Chro.20036 453 AAEL01000262 4076 4627 .
Chro.20038 454 AAEL01000374 30 782 hypothetical protein
Chro.20039 455 AAEL01000374 1652 3001 CG31911-PA
Chro.20040 456 AAEL01000374 3929 5536 notchless WD40-repeat;
Chro.20041 457 AAEL01000097 18509 20482 hypothetical protein
Dipeptidyl peptidase IV/CD26, N-terminal
Chro.20043 458 AAELO 1000097 15015 17189 hypothetical protein domain;
Chro.20044 459 AAEL01000097 13535 14356 hypothetical protein ARM repeat;
P-loop containing nucleotide triphosphate
Chro.20045 460 AAELO 1000097 12649 13005 COG0237: Dephospho-CoA kinase hydrolases;
Chro.20046 461 AAEL01000097 9899 10363 .
Chro.20047 462 AAEL01000097 8061 8630 .
Chro.20048 463 AAELO 1000097 6598 7383 .
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.20049 464 AAEL01000097 4750 5328 .
Chro.20050 465 AAELO 1000097 3340 3936 .
Chro.20051 466 AAEL01000097 2492 2896 .
Chro.20052 467 AAELO 1000097 1530 2090 .
Chro.20054 468 AAEL01000572 164 2932 .
Chro.20055 469 AAEL01000952 269 1138 .
Chro.20056 470 AAEL01000951 452 1135 .
Chro.20057 471 AAEL01000151 90 1517 . BRCT domain;
Chro.20058 472 AAEL01000151 2094 2285 .
Chro.20059 473 AAEL01000151 2342 3247 hypothetical protein Prefoldin;
Chro.20060 474 AAEL01000151 3722 4648 PfMDPC
N-terminal nucleophile aminohydrolases
KJ Chro.20061 475 AAEL01000151 5752 6360 putative proteasome component (Ntn hydrolases);
Chro.20062 476 AAEL01000151 7358 9010 .
Chro.20063 477 AAEL01000151 10080 10781 MPUIp
Chro.20064 478 AAEL01000300 118 1392 .
Chro.20065 479 AAEL01000300 1608 2249 OBP33pep like protein alpha/beta knot;
Chro.20066 480 AAEL01000300 3103 8793 .
Chro.20067 481 AAEL01000203 10515 11795 nucleotide-sugar transporter (2A681)
GroEL equatorial domain-like chaperone
Chro.20068 482 AAEL01000203 8202 9905 t-complex protein 1, alpha subunit, putative equatorial domain;
Chro.20069 483 AAELO 1000203 6299 7132 .
Voltage-gated potassium channels; E set
Chro.20070 484 AAEL01000203 2674 3855 . domains;
Chro.20071 485 AAEL01000203 858 1778 acid phosphatase, putative Metallo-dependent phosphatases;
Chro.20072 486 AAELOlOOl 139 74 328 .
Chro.20073 487 AAELO 1000549 228 1256 .
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.20074 488 AAEL01000549 1751 3079 .
Chro.20075 489 AAELO 1000792 1217 1978 .
Chro.20076 490 AAEL01000792 24 713 .
Chro.20077 491 AAELO 1000243 7994 10903 putative
Chro.20079 492 AAEL01000243 3219 6659 . RING finger domain, C3HC4;
DNA mismatch repair protein, C-terminal
Chro.20080 493 AAELO 1000243 6 1097 domain, putative
Chro.20081 494 AAELO 1000046 26068 26877 hypothetical protein
Chro.20082 495 AAEL01000046 24388 25323 .
Chro.20083 496 AAELO 1000046 23050 24273 hypothetical protein
Chro.20084 497 AAEL01001202 149 493 .
Chro.20085 498 AAEL01000046 22062 22331 cut up CG6998-PA Dynein light chain 8 (DLC8);
Chro.20086 499 AAELO 1000046 20588 21856 Hypothetical protein CBG20696 WD40-repeat;
SNAP protein (soluble N-ethylmaleimide- sensitive factor Attachment Protein),
Chro.20087 500 AAEL01000046 19349 20359 putative TPR-like;
Chro.20088 501 AAELO 1000046 17896 19248 .
Chro.20089 502 AAELO 1000046 15882 16982 .
LCCL domain; Scavenger receptor cysteine- rich (SRCR) domain; Concanavalin A-like lectins/glucanases; Lipase/lipooxygenase scavenger receptor protein TgSRl domain (PLAT/LH2 domain); Scavenger
Chro.20090 503 AAEL01000046 11382 15125 precursor receptor cysteine-rich (SRCR) domain;
Chro.20091 504 AAEL01000046 8771 10585 hypothetical protein
Chro.20092 505 AAELO 1000046 7455 7904 calmodulin EF-hand;
Chro.20093 506 AAEL01000046 6237 6575 translation initiation factor SUIl elFl-like;
Table 1
Ch_Gene SEQ ED NO. Ch_Accession Start End Description Superfamily
Hypothetical FAM18-like proteinDgi|28829725|gb|AAO52232.1| similar to Mus musculus (Mouse).
Chro.20094 507 AAELO 1000046 4801 55448811 1810036I24Rikprotein
Chro.20095 508 AAELO 1000046 3703 4323 similar to Homo sapiens (Human). NPDOlO .
Chro .20096 509 AAEL01000046 2669 3607
N-terminal nucleophile aminohydrolases
Chro.20097 510 AAELO 1000046 1442 2074 proteasome B type subunit (Ntn hydrolases);
Chro.20098 511 AAEL01000046 586 963 ENSANGP00000014638 HMG-box;
Chro.20099 512 AAELO 1000525 98 1990 hypothetical protein RING finger domain, C3HC4;
Chro.20100 513 AAELO 1000525 3089 4105
GroEL equatorial domain-like chaperone
Chro.20101 514 AAELO 1000009 48403 49986 hypothetical protein equatorial domain;
Chro.20102 151 AAELO 1000009 46558 47688 hypothetical protein MG08547.4 Protein kinase-like (PK-like);
Chro.20103 516 AAEL01000009 43145 46225 involved in a-factor processing; Ste23p LuxS/MPP-like metallohydrolase;
Chro.20104 517 AAELO 1000009 39678 42719 ENSANGP00000016000 LuxS/MPP-like metallohydrolase;
Chro.20105 518 AAEL01000009 35949 39137
Chro.20106 519 AAELO 1000009 34087 35403
Chro.20107 520 AAEL01000009 32047 33873
Chro.20108 521 AAEL01000009 30146 31945
Eukaryotic RPB5 N-terminal domain;
Chro.20109 522 AAEL01000009 28511 29128 DNA-directed RNA polymerase 2, putative RPB5-like RNA polymerase subunit;
Chro.20110 523 AAEL01000009 26095 27993 hypothetical protein tRNA-guanine transglycosylase;
Chro.20111 524 AAEL01000009 23689 25596 RNA recognition motif, putative RNA-binding domain, RBD;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily similar to Probable RNA-dependent helicase p68 (DEAD-box protein p68) P-loop containing nucleotide triphosphate
Chro.20112 525 AAELO 1000009 22090 22659 (DEAD-box protein 5) hydrolases;
Chro.20113 526 AAELO 1000009 19952 20158
Chro.20114 527 AAEL01000009 18480 19772 26S proteasome subunit P40.5, putative
Chro.20115 528 AAEL01000009 17228 18172 putative mitochondrial carrier protein similar to Homo sapiens (Human). Flavohemoprotein b5+b5R (DJ676J13.1) (Flavohemoprotein b5+b5R cytochrome b-
Chro.20116 529 AAELO 1000009 16425 17000 type NAD(P)H oxidoreductase) Cytochrome b5;
Chro.20117 530 AAEL01000009 14953 15996
Chro.20118 531 AAEL01000009 12665 14821 CDPK2 Protein kinase-like (PK-like); EF-hand;
Chro.20119 532 AAELO 1000009 11271 11591 Hypothetical protein CBG09459
Chro.20120 533 AAELO 1000009 9317 11071 acyl-CoA:diacylglycerol acyltransferase 1-
Chro.20121 534 AAEL01000009 7660 9177 related enzyme
P-loop containing nucleotide triphosphate
Chro.20122 535 AAELO 1000009 4435 7347 DNA replication licensing factor MCM2 hydrolases; similar to Mus musculus (Mouse). Silencer-
Chro.20123 536 AAELO 1000009 2420 3616 associated factor Phospholipase D/nuclease; Molybdenum cofactor biosynthesis protein MoeB; Rhodanese/Cell cycle control
Chro.20124 537 AAEL01000009 1389 2333 ENSANGP00000008492 phosphatase;
Chro.20125 538 AAELO 1000009 292 816 .
Chro.20126 539 AAELO 1000205 365 1333 syntaxin, putative t-snare proteins;
Chro.20127 540 AAELO 1000205 2639 3646 unnamed protein product C2H2 and C2HC zinc fingers;
Table 1
Ch Gene SEQ ED NO. Ch_Accession Start End Description Superfamily
Drosophila melanogaster RE21692p,
Chro.20128 541 AAELO 1000205 3868 5886 putative
Chro.20129 542 AAEL01000205 6381 7361 zinc finger protein-related Cytochrome c;
Chro.20130 543 AAELO 1000205 7336 7863 zinc-finger protein zprl
S-adenosyl-L-methionine-dependent
Chro.20131 544 AAEL01000205 7860 9722 CLL-associated antigen KW-2 methyltransferases;
Chro.20132 545 AAELO 1000205 10049 10978 Hypothetical protein CBGl 1196 Ubiquitin-like;
Chro.20133 546 AAELO 1000205 11299 12063 CG33057-PA
Chro.20134 547 AAEL01000690 2 1162 hypothetical protein Protein kinase-like (PK-like);
Chro.20135 548 AAELO 1000317 315 1439 .
Chro.20136 549 AAEL01000317 1799 3076 hypothetical protein EF-hand;
P-loop containing nucleotide triphosphate
Chro.20137 550 AAEL01000317 3097 5781 DNA replication licensing factor, putative hydrolases;
Chro.20138 551 AAELO 1000317 6408 8843 .
Adenylyl and guanylyl cyclase catalytic
Chro.20139 552 AAELO 1000240 8832 11032 adenylyl cyclase domain;
Chro.20140 553 AAELO 1000240 6407 8461 hypothetical protein alpha/beta-Hydrolases;
Chro.20141 554 AAELO 1000240 5065 6330 .
Chro.20142 555 AAEL01000240 2761 4794 calcium-dependent protein kinase Protein kinase-like (PK-like); EF-hand;
Chro.20143 556 AAELO 1000240 879 2327 hypothetical protein
Chro.20144 557 AAELO 1000240 304 606 Pfjl Chaperone J-domain;
Chro.20145 558 AAELO 1000024 35551 36102 Pfjl HSP40/DnaJ peptide-binding domain; hypothetical protein; hypothetical protein,
Chro.20146 559 AAELO 1000024 32643 34679 conserved
26S protease subunit regulatory subunit 6a, P-loop containing nucleotide triphosphate
Chro.20147 560 AAELO 1000024 31293 32570 putative hydrolases;
Table 1
Ch Gene SEQ ED NO. Ch Accession Start End Description Superfamily
P-loop containing nucleotide triphosphate
ATP synthase beta chain, mitochondrial hydrolases; N-terminal domain of alpha
Chro.20148 561 AAEL01000024 29834 30859 precursor, putative and beta subunits of Fl ATP synthase; C-terminal domain of alpha and beta
Chro.20149 562 AAEL01000024 29093 29500 A ATTPP s syynntthhaassee F Fll s seeccttoorr b beettaa s suubbuunniitt subunits of Fl ATP synthase;
Chro.20150 563 AAELO 1000024 26314 29007 h hyyppootthheettiiccaall p prrootteeiinn,, e exxpprreesssseedd t-snare proteins;
Chro.20151 564 AAEL01000065 15677 16561
Chro.20152 565 AAELO 1000065 15005 15595 hypothetical protein
Chro.20153 566 AAEL01000065 13110 14951
Chro.20154 567 AAELO 1000065 12525 12953 CG15432-PA
Chro.20155 568 AAELO 1000065 10979 11785 Chaperone J-domain;
Chro.20156 569 AAEL01000065 10075 10869
-4 Chro.20157 570 AAELO 1000065 8693 10078 Dynactin 4 (p62) Multiheme cytochromes;
Proteasome subunit alpha type 7
(Proteasome component
DD5)Dgi|347511 |gb|AAA33234.11 N-terminal nucleophϊle aminohydrolases
Chro.20158 571 AAELO 1000065 7817 8551 proteasome (Ntn hydrolases);
Chro.20159 572 AAELO 1000065 5962 7686 transporter, putative
Similar to SUMO-I activating enzyme Molybdenum cofactor biosynthesis protein
Chro.20160 573 AAEL01000065 3983 5896 subunit 2 MoeB;
Chro.20161 574 AAELO 1000065 3410 3976 Histone-fold;
Chro.20162 575 AAEL01000065 2073 3389 U2 snRNP auxiliary factor, putative KNA-binding domain, RBD;
Chro.20163 576 AAELO 1000065 1023 2024
Chro.20164 577 AAELO 1000268 9153 9728 hypothetical protein
Chro.20165 578 AAEL01000268 6561 8978 hypothetical protein
Chro.20166 579 AAELO 1000268 4747 6525 hypothetical protein
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.20167 580 AAELO 1000268 3467 4678 CG9104-PA Chro.20168 581 AAELO 1000268 2722 3177 hypothetical protein MGOO 143.4 Chro.20169 582 AAELO 1000268 1633 2730 transmembrane protein 15; cDNA sequence
Chro.20170 583 AAEL01000268 317 1081 BC026973 Chro.20171 584 AAEL01000071 23055 23462 vps26 protein homolog dual-specificity protein phosphatase,
Chro.20172 585 AAEL01000071 22218 22583 putative
Hairpin loop containing domain-like; Chro.20173 586 AAEL01000071 20025 21869 fibrillin 2; syndatyly ems EGF/Laminin;
P-loop containing nucleotide triphosphate
Chro.20174 587 AAELO 1000071 17357 19945 replication origin activator 2 hydrolases;
OO Chro.20175 588 AAEL01000071 15443 16993 Protein kinase domain, putative Protein kinase-like (PK-like); Chro.20176 589 AAEL01000071 14098 14856 cytidine and deoxycytidylate deaminase
Chro.20177 590 AAEL01000071 12844 13140 family, putative
Chro.20178 591 AAELO 1000071 10440 12566 protein serine/threonine phosphatase alpha Metallo-dependent phosphatases; EF-hand; dolichyl-di-phosphooligosaccharide-protein glycotransferase
Chro.20179 592 AAELO 1000071 8135 9541 (oligosaccharyltransferase)-related
Chro.20180 593 AAEL01000071 7373 7882 cyclophilin-like protein Cyclophilin (peptidylprolyl isomerase);
Chro.20181 594 AAEL01000071 6962 7315 . Histone-fold;
Chro.20182 595 AAEL01000071 5757 6767 . FYVE/PHD zinc finger;
Chro.20183 596 AAELO 1000071 4975 5271 hypothetical protein
Chro.20184 597 AAELO 1000071 3671 4174 calmodulin EF-hand;
Chro.20185 598 AAELO 1000071 1858 3513 hypothetical protein EF-hand;
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.20186 599 AAELO 1000224 172 462 .
Chro.20187 600 AAEL01000224 1531 2265 .
Chro.20188 601 AAELO 1000224 2342 3484 . .
ERYTHROCYTE MEMBRANE
Chro.20189 602 AAELO 1000224 3668 6085 PROTEIN PFEMP3 Homeodomain-like;
Chro.20190 603 AAELO 1000224 6347 7792 CG12099-PB RING finger domain, C3HC4;
Pyk2-associated protein beta ARF-GAP
Chro.20191 604 AAELO 1000224 8025 9032 homeobox-containing protein domain;
Chro.20192 605 AAEL01000224 9088 10365 GDP-mannose pyrophosphorylase (4N40) Nucleotide-diphospho-sugar transferases;
Chro.20193 606 AAELO 1000224 10578 11894 hypothetical protein Thioredoxin-like;
Chro.20194 607 AAEL01000950 49 528 . .
HSP40/DnaJ peptide-binding domain;
Chro.20195 608 AAEL01000073 1829 2671 heat shock 40 kDa protein, putative Chaperone J-domain; .
Chro.20196 609 AAELO 1000073 3168 3383 . .
Chro.20197 610 AAELO 1000073 3849 4154 CysQ protein Sugar phosphatases;
Chro.20198 611 AAELO 1000073 6079 7008 CBKl Protein kinase-like (PK-like);
Chro.20199 612 AAEL01000073 7028 7273 .
Chro.20200 613 AAEL01000073 7328 8878 . .
Chro.20201 614 AAEL01000073 9038 10018 stress-induced protein stil-like protein TPR-like;
Chro.20202 615 AAELO 1000073 10277 14014 . Ypt/Rab-GAP domain of gyp Ip; guanine nucleotide-binding protein,
Chro.20203 616 AAEL01000073 14254 15195 putative Quinoprotein alcohol dehydrogenase-like;
Chro.20204 617 AAELO 1000073 15885 16232 protein kinase, putative Protein kinase-like (PK-like);
Chro.20205 618 AAEL01000073 17291 17998 hypothetical protein •
Chro.20206 619 AAELO 1000073 18006 19013 dTDP-glucose 4-6-dehydratase-like protein NAD(P)-binding Rossmann-fold domains;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Histone H3 K4-specific methyltransferase
Chro.20207 620 AAEL01000073 19366 20967 hypotheticalprotein SET7/9 N-terminal domain; Chro.20208 621 AAEL01000073 22515 22742. Chro.20209 622 AAEL01000771 60 896. Chro.20210 623 AAEL01000771 1095 1592. RmlC-like cupins;
P-loop containing nucleotide triphosphate
Chro.20211 624 AAEL01000364 6517 6729. hydrolases;
FYVE/PHD zinc finger; RING finger Chro.20212 625 AAEL01000364 4311 6290 Drosophila melanogaster LD27861p domain, C3HC4; mitogen-activated protein kinase 1,
Chro.20213 626 AAELO 1000364 2136 4268 serine/threonine protein kinase Protein kinase-like (PK-like);
O Chro.20214 627 AAEL01000364 82 1479 O Chro.20215 628 AAEL01000248 9353 10465 Chro.20216 629 AAEL01000248 8583 9284 Chro.20217 630 AAELO 1000248 7755 8315 hypothetical protein Chro.20218 631 AAEL01000248 6221 7024 hypothetical protein EF-hand; Chro.20219 632 AAELO 1000248 5363 5980 hypothetical protein Chro.20220 633 AAEL01000248 4710 5264 . Chro.20221 634 AAEL01000248 3346 4566 hypothetical protein ARM repeat;
N-terminal nucleophile aminohydrolases
Chro.20222 635 AAEL01000248 1957 2736 proteasome A type subunit (Ntn hydrolases); Chro.20223 636 AAELO 1000248 1 1359 hypothetical protein translation elongation factor EF-I, subunit EF-Tu/eEF-1 alpha/eIF2-gamma C-terminal
Chro.20224 637 AAEL01001032 228 785 alpha, putative domain; Translation proteins; Chro.20225 638 AAELO 1000826 450 1028 hypothetical protein ARM repeat;
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Metalloproteases ("zincins"), catalytic
Chro.20226 639 AAEL01001071 106 897 probable mitotic control protein dis3 domain;
Chro.20227 640 AAELO 1000258 625 2538 probable mitotic control protein dis3 Nucleic acid-binding proteins;
Chro.20228 641 AAEL01000258 3216 3752 .
Chro.20229 642 AAELO 1000258 4074 4832 .
Chro.20230 643 AAELO 1000258 5060 5347 high mobility group protein HMG-box; pyrophosphate-dependent
Chro.20231 644 AAEL01000258 5515 9795 phosphofructokinase Phosphofructokinase;
Chro.20232 645 AAELO 1000560 0 3654 . Family A G protein-coupled receptor-like;
Chro.20233 646 AAEL01000772 377 2068 .
P-loop containing nucleotide triphosphate
Chro.20234 647 AAELO 1000704 13 1458 Ii973-prov protein hydrolases;
Chro.20235 648 AAEL01000535 195 665 .
DHHCl protein; Golgi apparatus-specific
Chro.20236 649 AAEL01000535 731 1933 protein with DHHC zinc finger domain Zn2/Cys6 DNA-binding domain;
Chro.20237 650 AAEL01000535 2470 2760 Ribosomal protein L37e, putative Zn-binding ribosomal proteins;
Chro.20238 651 AAEL01000535 3106 3321 Unknown (protein for MGC:56471)
Chro.20239 652 AAELO 1000075 21629 22483 . similar to Sestrin 1 (p53-regulated protein
Chro.20240 653 AAEL01000075 19088 21592 PA26)
Chro.20241 654 AAEL01000075 17543 18928 .
Chro.20242 655 AAELO 1000075 14202 16223 zuotin related factor-1 Chaperone J-domain; Homeodomain-like;
Chro.20243 656 AAELO 1000075 13130 14167 .
Protein serine/threonine phosphatase 2C,
Chro.20244 657 AAEL01000075 11231 12910 . catalytic domain;
Chro.20245 658 AAEL01000075 10108 11031 PREG-like protein Cyclin-like;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Carbamate kinase-like; Archaeosine tRNA-
Glutamate 5 -kinase (Gamma-glutamyl guanine transglycosylase, C-terminal
Chro.20246 659 AAEL01000075 8284 9600 kinase) (GK) additional domains;
Chro.20247 660 AAELO 1000075 6395 8026 Protein kinase domain, putative Protein kinase-like (PK-like); similar to Plasmodium berghei heat shock related protein, encoded by GenBank C2 domain (Calcium/lipid-binding domain, Accession Number L04508, and CaLB); C2 domain (Calcium/lipid-binding Trypanosoma cruzi heat shock protein 70, domain, CaLB); C2 domain (Calcium/lipid- Swiss-Prot Accession Number P05456- binding domain, CaLB); C2 domain
Chro.20248 661 AAEL01000075 1175 6235 related (Calcium/lipid-binding domain, CaLB);
Chro.20249 662 AAEL01000075 479 985 .
Chro.20250 663 AAELO 1000075 88 453 starch associated protein Rl
Glutathione synthetase ATP-binding
S Chro.20251 664 AAEL01000625 193 3147 Rl domain-like;
Chro.20252 665 AAEL01000231 1410 3098 hypothetical protein, conserved ARM repeat;
Chro.20253 666 AAEL01000231 3167 9076 unnamed protein product
Chro.20254 667 AAEL01000231 9831 10232 .
ERYTHROCYTE MEMBRANE
Chro.20255 668 AAELO 1000231 10562 11490 PROTEIN PFEMP3
Chro.20256 669 AAELOlOOl 153 106 807 .
ATPas, class π, type 9B; ATPase, class 2, Calcium ATPase, transduction domain A; member b; ATPase 9B, p type; ATPase 9B, HAD-like; Calcium ATPase, ATP-binding
Chro.20257 670 AAELO 1000311 4780 8658 class II domain N;
Chro.20258 671 AAELO 1000311 4231 4698 seroreactive antigen BMNl-9B-related RING finger domain, C3HC4;
Table 1
Ch Gene SEQ BD NO. Ch Accession Start End Description Superfamily
N-terminal part related to RNA:pseudouridine (psi)-synthases C- terminal portion contains the deaminase domain implicated in Riboflavin synthesis;
Chro.20259 672 AAELO 1000311 2559 4004 Rib2p Alpha-L RNA-binding motif;
Chro.20260 673 AAEL01000311 284 787 .
Chro.20261 674 AAELO 1000311 119 187 .
Chro.20262 675 AAELO 1000321 7661 8365 . methionine aminopeptidase, type IL
Chro.20263 676 AAEL01000321 5819 7237 putative Creatinase/aminopeptidase;
Chro.20264 677 AAELO 1000321 3689 4573 .
Chro.20265 678 AAELO 1000321 1772 3055 hypothetical protein
FAD-lmked reductases, C-terminal domain;
S Chro.20266 679 AAELO 1000321 76 1707 alcohol oxidase 2 FAD/NAD(P)-binding domain;
Chro.20267 680 AAEL01000334 854 1429 .
Chro.20268 681 AAEL01000334 2766 3794 .
Chro.20269 682 AAEL01000334 4442 4648 .
Chro.20270 683 AAEL01000334 4812 5117 glutaredoxin Thioredoxin-like;
Chro.20271 684 AAEL01000334 5511 6419 .
Chro.20272 685 AAEL01000310 28 2247 .
Chro.20273 686 AAELO 1000310 3796 5790 . Spectrin repeat;
Chro.20274 687 AAELO 1000310 6232 6774 .
Chro.20276 688 AAELO 1000095 15484 20517 .
Chro.20277 689 AAELO 1000095 14068 14817 .
Chro.20278 690 AAEL01000095 6020 13858 .
Chro.20279 691 AAEL01000095 5175 5555 .
Chro.20280 692 AAEL01000095 1523 3457 .
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.20281 693 AAELO 1000095 577 1134 . Chro.20282 694 AAEL01000188 12564 13394 . solute carrier family 35 (UDP-N- acetylglucosamine (UDP-GIcNAc) transporter), member A3; solute carrier family 35 (UDP-N-acetylglucosamine
Chro.20283 695 AAEL01000188 12104 12331 (UDP-GIcNAc) transporter), member 3 solute carrier family 35 (UDP-N- acetylglucosamine (UDP-GIcNAc)
Chro.20284 696 AAEL01000188 9260 10504 transporter), member 3
HAD-like; Calcium ATPase, transduction
Chro.20285 697 AAELO 1000188 8659 9042 Hypothetical protein CBG24344 domain A;
Chro.20286 698 AAELO 1000188 3539 4150 Hypothetical protein CBG04495 Bromodomain; similar to yeast nuclear segregation protein Bfrl involved in Mitosis and Vesicular
Chro.20287 699 AAEL01000188 1499 2986 transport Ribosome recycling factor, RRF;
S-adenosyl-L-methionine-dependent
Chro.20288 700 AAEL01000188 295 1359 unnamed protein product methyltransferases;
Chro.20289 701 AAEL01000126 654 3662 hypothetical protein ARM repeat;
Chro.20290 702 AAEL01000126 4468 7956 . Nucleotidyltransferase;
Xenopus 14s cohesin smcl subunit P-loop containing nucleotide triphosphate
Chro.20291 702 AAEL01000126 10258 14307 homolog hydrolases;
Chro.20292 704 AAEL01000126 14758 16803 hypothetical protein LuxS/MPP-like metallohydrolase;
DEAD box helicase; with strong similarity P-loop containing nucleotide triphosphate
Chro.20293 705 AAEL01000138 2 5989 to yeast U5 snRNP-associated Brr2p hydrolases;
Chro.20294 706 AAEL01000138 6500 7621 dCMP deaminase; Dcdlp Cytidine deaminase-like;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.20295 707 AAEL01000138 7696 8718 hypothetical protein
Chro.20296 708 AAEL01000138 9018 9860 expressed protein
Chro.20297 709 AAEL01000138 9989 10678 CG12343-PA
S-adenosyl-L-methionine-dependent
Chro.20298 710 AAEL01000138 11706 12626 Coenzyme Q3 homolog, methyltransferase methyltransferases;
Chain S, Cryo-Em Structure Of The Heavy
Meromyosin Subfragment Of Chicken
Gizzard Smooth Muscle Myosin With
Regulatory Light Chain In The
Dephosphorylated State. Only C Alphas
Provided For Regulatory Light Chain. Only
O Backbone Atoms Provided For S2 Ul Fragment.Dgi|13786879|pdb|lI84|V Chain
V, Cryo-Em Structure Of The Heavy
Meromyosin Subfragment Of Chicken
Gizzard Smooth Muscle Myosin With
Regulatory Light Chain In The
Dephosphorylated State. Only C Alphas
Provided For Regulatory Light Chain. Only
Backbone Atoms Provided For S2
Chro.20299 711 AAEL01000138 15416 16099 Fragment Ankyrin repeat; PH domain-like;
Chro.20300 712 AAEL01000102 19131 19481 .
Chro.20301 713 AAELO 1000102 18184 18750 .
Chro.20302 714 AAELO 1000102 16303 17424 WD-40 repeat protein WD40-repeat;
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Class π aaRS and biotin synthetases; C- putative transcriptional repressor of the terminal domain of transcriptional
Chro.20303 715 AAEL01000102 15251 16147 biotm operon birA repressors;
Chro.20304 716 AAEL01000102 14616 15131 .
WD40-repeat; 3 -carboxy-cis,cis-mucoante lactonizing enzyme; Soluble quinoprotein
Chro.20305 717 AAEL01000102 10816 13833 WD repeat protein glucose dehydrogenase; er lumen protein retaining receptor 1,
Chro.20306 718 AAEL01000102 9420 10346 putative
P-loop containing nucleotide triphosphate
Chro.20307 719 AAEL01000102 7436 9220 predicted cytoskeletal protein hydrolases;
Eukaryotic type KH-domain (eKH-
5 Chro.20308 720 AAEL01000102 3121 6519 . domain);
Λ Chro.20309 721 AAELO 1000102 368 1678 unknown RING finger domain, C3HC4;
Chro.20310 722 AAEL01000136 4245 5822 phospho protein phosphatase -related Metallo-dependent phosphatases; TPR-like;
Chro.20311 723 AAEL01000136 6784 10086 .
Chro.20312 724 AAEL01000136 10513 11046 60s ribosomal protein Ll 3
Chro.20313 725 AAEL01000136 11689 12123 4OS ribosomal protein S 16 Ribosomal protein S5 domain 2-like; P-loop containing nucleotide triphosphate
N-ethylmaleimide-sensitive factor; NSF; hydrolases; ADC-like; Cdc48 domain 2-
Chro.20314 726 AAEL01000136 12536 14767 Seclδp like;
Chro.20315 727 AAEL01000136 15034 15561 .
Chro.20316 728 AAEL01000136 16027 16461 .
Chro.20317 729 AAELOIOOOIOI 438 1826 .
Chro.20318 730 AAELOIOOOIOI 1948 2442 .
Chro.20319 731 AAELOIOOOIOI 3334 3540 .
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.20320 732 AAELO 1000101 3871 4299 .
• Chro.20321 733 AAELOIOOOIOI 4352 4828 . Snake toxin-like;
Chro.20322 734 AAELOIOOOIOI 5758 6306 Similar to high mobility group box 1 HMG-box;
TSPl domain-containing protein TSPlO
Chro.20323 735 AAELOIOOOIOI 7312 8487 precursor Kringle-like; TSP-I type 1 repeat;
Chro.20324 736 AAELOIOOOIOI 9168 10595 . Single hybrid motif;
Chro.20325 737 AAELOIOOOIOI 12133 13206 .
Chro.20326 738 AAELOIOOOIOI 14170 17292 .
Chro.20327 739 AAELOIOOOIOI 18130 19541 .
Chro.20329 740 AAEL01000389 1235 6175 . hypothetical protein - Arabidopsis Cysteine-rich DNA binding domain, (DM thalianaD gi|2244899|emb|CAB 10321.11 domain); TRAF domain-like; Zinc beta-
Chro.20330 741 AAELO 1000093 19825 20868 UFDl like protein ribbon;
-1 Chro.20331 742 AAEL01000093 19389 19811 .
Chro.20332 743 AAELO 1000093 16010 18046 hypothetical protein B 11B22.30 Ypt/Rab-GAP domain of gyp Ip;
P-loop containing nucleotide triphosphate
Chro.20333 744 AAEL01000093 14320 14925 replication factor C subunit 5, putative hydrolases;
P-loop containing nucleotide triphosphate
Chro.20334 745 AAEL01000093 13974 14261 LD06837t> hydrolases: protein kinase (EC 2.7.1.-) p46XlEg22 -
African clawed frogDgi|609280|emb|CAA78914.11
Chro.20335 746 AAEL01000093 12355 13413 p46XlEg22 Protein kinase-like (PK-like);
Chro.20336 747 AAELO 1000093 9740 11443 glucose-6-phosphate isomerase SIS domain;
Chro.20337 748 AAEL01000093 8599 9492 .
Chro.20338 749 AAELO 1000093 5824 6957 alphaSNBP(A) Sm-like ribonucleoproteins;
Chro.20339 750 AAELO 1000093 3000 4814 heat shock protein DnaJ homologue Pfj2 Chaperone J-domain; Thioredoxin-like;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.20340 751 AAELOlOOl 127 38 283 . Chaperone J-domain;
ARF GAP-like zinc finger-containing Pyk2-associated protein beta ARF-GAP
Chro.20341 752 AAEL01000093 840 2084 protein (ZIGA2) domain;
Chro.20342 753 AAEL01000038 107 2716 unnamed protein product TPR-like;
Phosphoglucomutase, C-terminal domain;
Chro.20343 754 AAEL01000038 3580 5286 phosphoglucomutase -related Phosphoglucomutase, first 3 domains;
Phosphoglucomutase, C-terminal domain;
Chro.20344 755 AAEL01000038 7222 7500 phosphoglucomutase -related Phosphoglucomutase, first 3 domains; Chro.20345 756 AAELO 1000038 8990 10708 . Prefoldin; Chro.20346 757 AAELO 1000038 11900 13618 . Chro.20347 758 AAELO 1000038 16289 16507 .
Cysteine proteinases; Dipeptidyl peptidase
Chro.20348 759 AAEL01000038 17061 19535 Homo sapiens P3ECSL-related I (cathepsin C), exclusion domain; Actin-like ATPase domain; Heat shock protein 7OkD (HSP70), C-terminal
Chro.20349 760 AAEL01000038 20657 23437 putative HSP protein substrate-binding fragment;
PABPl -dependent poly A-specific ribonuclease subunit PAN3; PABP-
Chro.20350 761 AAELO1OOOO38 24255 26546 dependent ρoly(A) nuclease 3 Protein kinase-like (PK-like); Chro.20351 762 AAEL01000038 27686 28552 hypothetical protein Chro.20352 763 AAEL01000038 29006 29323 . Chro.20353 764 AAEL01000149 1397 2401 . Chro.20354 765 AAELO 1000149 3430 3921 . Chro.20355 766 AAELO 1000149 4678 6237 RIKEN cDNA 2810485105
Table 1
Ch_Gene SEQ m NO. Ch_Accession Start End Description Superfamily
Chro.20356 767 AAEL01000149 6530 7024 .
dynamin-related protein; possibly controls morphology and cortical localization of
Chro.20357 768 AAEL01000149 9233 9520 mitochondria by similarity to yeast dnml
P-loop containing nucleotide triphosphate
Chro.20358 769 AAEL01000149 10097 10333 dynamin-related protein hydrolases;
P-loop containing nucleotide triphosphate
Chro.20360 770 AAEL01000149 10827 11375 ADP ribosylation factor 1 hydrolases;
Chro.20361 771 AAEL01000149 11799 12146 Pdcd2-prov protein
Chro.20362 772 AAEL01000149 12170 13051 programmed cell death 2
Chro.20363 773 AAEL01000149 13473 15953 Severe Depolymerization of Actin; Sdalp Thioredoxin-like; o
Chro.20364 774 AAEL01000045 27131 27577 .
Chro.20365 775 AAELO 1000045 22706 27112 telomerase reverse transcriptase DNA/RNA polymerases;
Chro.20366 776 AAELO 1000045 20644 21792 ubiquitin specific protease 66 Cysteine proteinases;
Chro.20367 777 AAEL01000045 18015 20189 hypothetical protein Homeodomain-like; Zinc beta-ribbon;
Chro.20368 778 AAEL01000045 16850 17911 .
Chro.20369 779 AAEL01000045 14518 16497 .
Chro.20370 780 AAEL01000045 10121 13939 hypothetical protein
Chro.20371 781 AAEL01000045 7256 9373 .
Chro.20372 782 AAELO 1000045 4489 6291 spliceosome associated protein - like
Chro.20373 783 AAEL01000045 3551 4462 .
Chro.20375 784 AAELO 1000045 1206 2624 .
Chro.20376 785 AAELO 1000651 666 2252 .
Chro.20377 786 AAEL01001207 218 748 .
Chro.20378 787 AAELO 1000423 4485 5705 hypothetical protein FYVE/PHD zinc finger;
Table1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.20379 788 AAELO 1000423 1185 2510 . Prefoldin;
Chro.20380 789 AAEL01000370 5 145 .
Uncharacterized protein family UPF0034,
Chro.20381 790 AAEL01000370 325 1920 putative FMN-linked oxidoreductases;
Chro.20382 791 AAEL01000370 2313 4103 .
Chro.20383 792 AAELO 1000569 140 3685 .
Chro.20384 793 AAEL01000496 1234 4488 ubiquitin-protein ligase 1, putative
Chro.20385 794 AAELO 1000544 1298 3769. ARM repeat;
Chro.20386 795 AAELO 1000544 103 789. WD40-repeat;
Chro.20387 796 AAEL01000106 2277 3365. F-box domain;
Chro.20388 797 AAEL01000106 4620 6104.
Chro.20389 798 AAEL01000106 6749 8410 ABC transporter Bromodomain;
Chro.20390 799 AAEL01000106 9004 9972. HAD-like;
Chro.20391 800 AAEL01000106 10785 10988.
Chro.20392 801 AAELO 1000106 12825 14900.
Chro.20393 802 AAELO 1000106 15236 16798 Eukaryotic Ribosome Biogenesis; Erblp WD40-repeat;
Chro.20394 803 AAEL01001019 14 1165 hypothetical protein
SNF2 domain/helicase domain-containing P-loop containing nucleotide triphosphate
Chro.20395 804 AAELO 1000152 12147 14069 protein hydrolases;
Chro.20396 805 AAEL01000152 6783 8270 hypothetical protein
Chro.20397 806 AAEL01000152 6186 6578
Glutathione S-transferase (GST), C-
Chro.20398 807 AAEL01000152 4782 5588 . terminal domain;
Chro.20399 808 AAELO 1000152 2953 4341 .
Chro.20400 809 AAEL01000152 1937 2308 .
Chro.20401 810 AAELO 1000409 88 540 hypothetical protein SNARE-like;
Chro.20402 811 AAEL01000409 1214 2344 .
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.20403 812 AAELO 1000409 3452 4714 .
Chro.20404 813 AAELO 1000409 5712 6026 PC20A EF-hand;
Chro.20406 814 AAEL01001261 216 767 .
Chro.20407 815 AAEL01000736 24 878 .
Chro.20408 816 AAELOlOOl 154 33 851 .
Chro.20409 817 AAEL01000358 7082 7459 .
Chro.20411 818 AAEL01000358 2907 6365 RNA recognition motif, putative
ADP-ribosylation; B-box zinc-binding
Chro.20412 819 AAEL01000358 846 2420 zinc finger protein, putative domain;
Chro.20413 820 AAELOlOOl 138 138 905 .
Chro.20414 821 AAEL01001369 69 320 .
Chro.20415 822 AAELOlOOlOll 155 694 . Protein kmase-like (PK-like);
Chro.20416 823 AAELO 1000781 950 1939 .
Chro.20417 824 AAEL01000906 124 1380 .
Chro.20418 825 AAEL01000239 8341 8601 .
Plasmodium falciparum asparagine-rich
Chro.20419 826 AAEL01000239 3707 7438 protein ARM repeat;
Chro.20420 827 AAEL01000239 1706 2440 deoxyhypusine synthase DHS-like NAD/FAD-binding domain;
Chro.20421 828 AAEL01000239 633 1007 .
Chro.20422 829 AAEL01000239 67 342 .
Chro.20423 830 AAELO 1000574 3183 3605 elongation factor 1 (EF-I); putative eEF-lbeta-like;
Chro.20424 831 AAELO 1000574 1214 2695 vacuolar ATP synthase subunit h, putative ARM repeat;
Chro.20425 832 AAELO 1000574 6 101 . •
Chro.20426 833 AAELO 1000397 3605 5362 MYB-related transcription factor CCCAD Homeodomain-like:
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily membrane-associated calcum-binding
Chro.20427 834 AAEL01000397 1554 2903 protein EF-hand;
Chro.20428 835 AAEL01000639 1 441 .
Chro.20429 836 AAEL01000639 1014 1745 .
Chro.20430 837 AAEL01000905 232 681 .
Chro.20431 838 AAELOlOOl 149 135 773 .
Chro.20432 839 AAEL01000591 37 2502 hypothetical protein MG05933.4
Chro.20433 840 AAEL01000494 76 660 .
Chro.20434 841 AAEL01000494 849 1493 .
Chro.20435 842 AAEL01000494 2257 3345 replication protein A2; CpRPA2 Nucleic acid-binding proteins;
P-loop containing nucleotide triphosphate
Chro.20436 843 AAELO 1000055 25096 26910 putative GTP-binding protein hydrolases;
Chro.20437 844 AAELO 1000055 24515 24862 .
Chro.20438 845 AAELO 1000055 23369 23605 .
Chro.20439 846 AAELO 1000055 23010 23285 . .
Chro.20440 847 AAEL01000055 20237 22531 similar to putative odorant receptor UBC-like;
20k cyclophilin - Toxoplasma gondii
(fragment)Qgi|436959|gb|AAA17998.1| 20
Chro.20441 848 AAEL01000055 19340 19858 kDa cyclophilin precursor Cyclophilin (peptidylprolyl isomerase);
ORF 73, contains large complex repeat CR Rho termination factor, N-terminal domai:
Chro.20442 849 AAEL01000055 17969 18991 73 Moesin tail domain; mitochondrial import inner membrane
Chro.20443 850 AAELO 1000055 16861 17352 translocase subunit timl7 m
Chro.20444 851 AAELO 1000055 14599 15777 hypothetical protein
Chro.20445 852 AAELO 1000055 11995 12684 hemolysin
Chro.20446 853 AAELO 1000055 11547 11906 .
Chro.20447 854 AAELO 1000055 9833 10300 .
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
P-loop containing nucleotide triphosphate
Chro.20448 855 AAELO 1000055 6231 9692 DNA hehcase HEL308 hydrolases;
Chro.20450 856 AAEL01000055 4141 5460 unnamed protein product
Chro.20451 857 AAELO 1000055 2267 3580 CTCL tumor antigen se2-l
Chro.20452 858 AAEL01000055 277 2211 .
Chro.20453 859 AAEL01001066 88 309 .
Chro.20455 860 AAELO 1000442 4877 5323 .
Calcium ATPase, transduction domain A; Calcium ATPase, transmembrane domain
Chro.20456 861 AAELO 1000442 2 4450 P-type ATPase3 M;
Chro.20457 862 AAEL01000341 6716 8156 .
Chro.20458 863 AAEL01000341 5331 5996 Ribosomal protein S6e, putative
Chro.20459 864 AAEL01000341 1078 4818 ENSANGPOOOOOO 16000 LuxS/MPP-like metallohydrolase;
W Chro.20460 865 AAELO 1000341 1 699 hypothetical protein GIY-YIG endonuclease;
Chro.20461 866 AAELO 1000190 12089 12913 .
Chro.20462 867 AAELO 1000190 10654 11289 Unknown protein Maf/Haml;
Chro.20463 868 AAEL01000190 10040 10549 .
FAD/NAD(P)-binding domain; FALVNAD- linked reductases, dimerisation (C-
Chro.20464 869 AAEL01000190 8361 9926 putative thioredoxin reductase terminal) domain;
Chro.20465 870 AAEL01000190 5314 7014 mitogen-activated protein kinase 2 Protein kinase-like (PK-like); hypothetical protein F55F8.1 - Multidrug efflux transporter AcrB
Chro.20466 871 AAEL01000190 856 4701 Caenorhabditis elegans transmembrane domain;
Chro.20467 872 AAELO 1000838 618 1610 .
Chro.20468 873 AAELO 1000327 6218 7354 . similar to glucose-methanol-choline
Chro.21000 874 AAEL01000334 3 509 (GMC) oxidoreductase family
Table 1 Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily unspecifϊc monooxygenase (EC 1.14.14.1) - common tobaccoDgi|1545805|dbj|BAA10929.1|
Chro.21001 875 AAELO 1000065 17384 18213 cytochrome P450 likeJTBP Chro.21002 876 AAEL01000262 3072 3137 . Chro.21003 877 AAEL01000243 6781 6977 .
Chro.30010 878 AAELO 1000507 558 3725 . Quinoprotein alcohol dehydrogenase-like; Chro.30011 879 AAEL01000396 793 1923 . Chro.30012 880 AAEL01000396 2262 3590 . Chro.30013 881 AAEL01000396 4363 5844 putative casein kinase I Protein kinase-like (PK-like); Chro.30014 882 AAEL01000207 8474 12100 ZW18 protein alpha/beta-Hydrolases; Chro.30015 883 AAELO 1000207 7684 8433 . Chro.30016 884 AAELO 1000207 6871 7524 .
Formate/glycerate dehydrogenase catalytic
Chro.30017 885 AAELO 1000207 5266 6747 adenosylhomocysteinase domain-like;
Chro.30018 886 AAEL01000207 2119 4338 erythrocyte membrane-associated antigen
Chro.30019 887 AAEL01000207 778 1971 .
Chro.30020 AAEL01000465 3710 5065 putative asparagine synthase Adenine nucleotide alpha hydrolases-like; Chro.30021 889 AAEL01000465 2821 3507 . developmentally regulated GTP-binding P-loop containing nucleotide triphosphate
Chro.30022 890 AAEL01000465 1652 2758 protein 2 hydrolases; Chro.30023 891 AAEL01000421 1467 2075 . ARM repeat;
Chro.30024 892 AAEL01000421 2265 3743 . KNase HI endonuclease catalytic domain;
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.30025 893 AAEL01000421 4174 5904 . Chro.30026 894 AAEL01000506 3273 4073 hypothetical protein MG06938.4 Chro.30027 895 AAEL01000506 2633 3145 . Chro.30028 896 AAEL01000506 2373 2579 . latent transforming growth factor beta
Chro.30029 897 AAEL01000506 318 1610 binding protein like (3F865) EGF/Laminin; Chro.30030 898 AAEL01000519 3 410 . Chro.30031 899 AAEL01000519 962 2170 . WD40-repeat; Chro.30032 900 AAELO 1000519 2552 3880 . Chro.30033 901 AAELO 1000259 3096 3593 . Chro.30034 902 AAEL01000259 7884 9710 . TPR-like; Chro.30035 903 AAELO 1001343 234 596 . Chro.30036 904 AAEL01000236 10073 11092 . Chro.30037 905 AAEL01000236 8988 9647 .
Metallo-dependent phosphatases;
Chro.30038 906 AAEL01000236 5897 8221 protein serine/threonine phosphatase alpha Galactose oxidase, central domain; Chro.30039 907 AAEL01000236 903 4445 calmodulin-domain protein kinase 2 Protein kinase-like (PK-like); EF-hand; Chro.30040 908 AAEL01000956 157 417 . Chro.30041 909 AAEL01000279 7492 9342 .
P-loop containing nucleotide triphosphate
Chro.30042 910 AAELO 1000279 2120 6385 putative DEALVDEAH box helicase hydrolases; Chro.30043 911 AAEL01000279 11 1315 Chro.30044 912 AAEL01000063 301 1020 Chro.30045 913 AAEL01000063 1621 3084 NTF2-like; RNA-binding domain, RBD; Chro.30046 914 AAEL01000063 4334 9970 hect domain and RLD 2 RCCl/BLIP-H;
Acyl-CoA N-acyltransferases (Nat); Acyl-
Chro.30047 915 AAEL01000063 10007 11407 N-myristoyltransferase CoA N-acyltransferases (Nat);
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.30048 916 AAELO 1000063 11969 12823 scully CG7113-PA NAD(P)-binding Rossmann-fold domains;
Chro.30049 917 AAELO 1000063 13390 14514 .
Chro.30050 918 AAEL01000063 14430 14639 .
Chro.30051 919 AAEL01000063 14797 15030 .
Chro.30052 920 AAELO 1000063 15004 15837 hypothetical protein Ribonuclease H-like;
Chro.30053 921 AAEL01000063 16532 16936 . .
Chro.30055 922 AAEL01000063 18897 22085 . RNA-binding domain, RBD;
P-loop containing nucleotide triphosphate
Chro.30056 923 AAEL01000063 23272 25065 DNA helicase (recQ13) hydrolases;
Chro.30057 924 AAEL01000014 485 3220 . STAT;
P-loop containing nucleotide triphosphate
Chro.30058 925 AAEL01000014 3878 8824 ATP-binding cassette protein 2 hydrolases;
Chro.30059 926 AAEL01000014 9454 12129 . Secl/muncl8-like (SM) proteins;
putative vacuolar protein sorting-associated P-loop containing nucleotide triphosphate
Chro.30060 927 AAEL01000014 12171 25412 protein hydrolases; Protein kinase-like (PK-like);
Chro.30061 928 AAEL01000014 26198 27544 .
Chro.30062 929 AAEL01000014 29161 30156 . mRNA triphosphatase CETl;
Chro.30063 930 AAEL01000014 31058 31660 glutathione peroxidase Thioredoxin-like;
Transmembrane amino acid transporter
Chro.30064 931 AAEL01000014 31807 33411 protein, putative
Chro.30065 932 AAELO 1000014 34041 35141 . similar to Homo sapiens (Human). GDP-
Chro.30069 933 AAEL01000014 40277 41446 fucose transporter 1
Chro.30070 934 AAEL01000014 41968 44019 . Hairpin loop containing domain-like;
Chro.30071 935 AAEL01000053 24417 26999 . •
Table 1
Ch Gene SEQ ED NO. Ch_Accession Start End Description Superfamily
Chro.30072 936 AAEL01000053 22747 24222 hypothetical protein .
Chro.30073 937 AAELO 1000053 20747 22228 .
Chro.30074 938 AAELO 1000053 18682 20334 .
Chro.30075 939 AAELO 1000053 16412 17755 . .
Chro.30076 940 AAEL01000053 13988 16054 .
Chro.30077 941 AAEL01000053 9837 13355 hypothetical protein
Chro.30078 942 AAELO 1000053 4999 9288 . m
Chro.30079 943 AAEL01000053 2587 3675 .
Chro.30081 944 AAELO 1000053 19 1425 .
Chro.30084 945 AAELO 1000523 1803 3860 putative acyl-CoA synthetase Firefly luciferase-like;
Chro.30085 946 AAELO 1000523 80 1135 .
Chro.30086 947 AAEL01000081 113 1645 .
Chro.30087 948 AAEL01000081 2101 4761 .
Glutathione S-transferase (GST), C-
Chro.30088 949 AAELO 1000081 6403 8151 . terminal domain;
P-loop containing nucleotide triphosphate
Chro.30090 950 AAEL01000081 10765 15525 ATP-binding cassette protein 2 hydrolases;
Chro.30091 951 AAEL01000081 15926 18916 .
Chro.30092 952 AAEL01001248 411 764 .
Chro.30095 953 AAEL01000185 15 380 .
Chro.30096 954 AAEL01000185 868 7656 .
Chro.30097 955 AAELO 1000709 116 2314 .
Chro.30098 956 AAEL01000546 217 3816 .
Chro.30099 957 AAELOlOOl 137 13 873 . m
Chro.30100 958 AAEL01000454 477 4820 .
Chro.30101 959 AAEL01000362 402 1661 RIKEN cDNA 1110065L07 alpha/beta-Hydrolases;
Chro:30102 960 AAEL01000362 1908 2963 .
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superf amity
Chro.30103 961 AAEL01000362 3357 3941 .
Chro.30104 962 AAELO 1000362 6366 6656 .
Nucleolar protein, possibly involved in ribosomal RNA pseudouridinylation, in
Chro.30105 963 AAEL01000362 6691 7197 association with snRNAs L30e-like;
Chro.30106 964 AAELO 1000693 90 974 . Cysteine proteinases;
Chro.30107 965 AAELO 1000693 1227 1751 hypothetical protein, conserved
Chro.30108 966 AAEL01000339 7572 7985 .
POP4 (processing of precursor , S.
Chro.30109 967 AAEL01000339 6432 7244 cerevisiae) homolog
Chro.30110 968 AAEL01000339 3316 6267 hypothetical protein
Chro.30111 969 AAEL01000339 2057 2485 .
Chro.30112 970 AAEL01000144 204 584 60S ribosomal protein L35 (RPL35C) Ribosomal orotein L;
OO
SWI/SNF-related matrix-associated actin- dependent regulator of chromatin d3; Rsc6p; mammalian chromatin remodeling complex BRGl -associated factor 6OC; Swp73-like protein; chromatin remodeling complex BAF60C subunit; SWI/SNF
Chro.30113 971 AAEL01000144 803 2116 complex 60 kDa sum*
Chro.30114 972 AAEL01000144 2943 3311 .
P-loop containing nucleotide triphosphate
Chro.30115 973 AAEL01000144 3963 4514 ADP ribosylation fact hydrolases;
DFP DNA/pantothenate metabolism
Chro.30116 974 AAEL01000144 5288 5626 Flavoprotein, putative flavoprotein;
Chro.30117 975 AAEL01000144 6488 6898 .
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily
S-adenosyl-L-methionine-dependent
Chro.30118 976 AAEL01000144 7654 8481 cell division - like protein methyltransferases;
Chro.30119 977 AAEL01000144 8500 9144 .
Chro.30120 978 AAEL01000144 9641 10477 .
Chro.30121 979 AAEL01000144 11972 13588 calmodulin-domain protein kinase 1 Protein kinase-like (PK-like); EF-hand;
Chro.30122 980 AAEL01000144 14828 15133 .
Chro.30124 981 AAEL01000144 15070 15564 hypothetical protein Chaperone J-domain;
Chro.30125 982 AAEL01000144 15615 15821 .
Chro.30126 983 AAELO 1000291 625 2745 hypothetical protein
Chro.30127 984 AAEL01000291 2766 3326 .
Chro.30128 985 AAELO 1000291 3930 4403 .
Chro.30129 986 AAELO 1000291 4637 4888 .
VO Chro.30130 987 AAELO 1000291 5327 5554 .
Chro.30131 988 AAELO 1000291 7320 7847 .
Chro.30132 989 AAEL01000291 8050 8805 . putative cytoplasmic protein of ancient
Chro.30133 990 AAEL01000291 8960 9355 origin (92.4 kD) (3D707) Adenine nucleotide alpha hydrolases-like;
Chro.30134 991 AAEL01000461 681 2024 hypothetical protein TPR-like;
Chro.30135 992 AAEL01000461 7 279 .
Chro.30136 993 AAEL01000455 3432 5165 expressed sequence AW742551
Chro.30137 994 AAEL01000455 2435 3028 hypothetical protein, conserved C2H2 and C2HC zinc fingers;
Chro.30140 995 AAELO 1000277 652 2187 .
Adenylyl and guanylyl cyclase catalytic
Chro.30141 996 AAELO 1000277 2275 9726 guanylyl cyclase-related domain;
Chro.30142 997 AAEL01000430 1636 1962 .
Chro.30143 998 AAEL01000430 553 1071 myb-related transcription factor Homeodomain-like;
Chro.30144 999 AAELO 1000232 357 1046 .
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.30145 1000 AAELO 1000232 2550 3275 .
Chro.30146 1001 AAEL01000232 4341 5330 .
Chro.30147 1002 AAEL01000232 5993 7474 .
Chro.30148 1003 AAELO 1000232 8341 8712 .
Ubiquitin-protein ligase E3a, Hect catalytic
Chro.30149 1004 AAEL01000232 9854 11353 ubiquitin-protein ligase 1, putative domain (E6ap);
Chro.30151 1005 AAEL01000223 12 11771 hypothetical protein WD40-repeat;
Chro.30152 1006 AAELO 1000067 20137 20493 Unknown (protein for MGC:66282) Prefoldin;
Chro.30153 1007 AAELO 1000067 17503 18897 hypothetical protein
Chro.30154 1008 AAEL01000067 16422 17294 .
Chro.30155 1009 AAELO 1000067 14949 16058 coronin binding protein
Chro.30156 1010 AAEL01000067 13221 14591 .
60S RIBOSOMAL PROTEIN
O L14Dgi|2760015|emb|CAAl 1176.11 60S
Chro.30157 1011 AAEL01000067 12455 12745 ribosomal protein L14
Chro.30158 1012 AAEL01000067 10599 11399 B1045D11.20 RING finger domain, C3HC4;
Chro.30159 1013 AAEL01000067 9891 10481 centrin, putative EF-hand;
Myosin π heavy chain, non muscleDgi|84128|ρir||A26655 myosin
Chro.30160 1014 AAELO 1000067 7529 9667 heavy chain
14-3-3-LKE PROTEINB (14-3-
3B)Dgi|7435024|pir||T04406 14-3-3b protein - barleyDgi|1070354|emb|CAA63658.1|
Chro.30161 1015 AAEL01000067 5736 6500 Hvl4-3-3b 14-3-3 protein;
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Ribosomal protein Ll 1, C-terminal domain; Ribosomal protein Ll 1, N-
Chro.30162 1016 AAEL01000067 4026 4529 probable 60s ribosomal protein 112 terminal domain;
Chro.30163 1017 AAEL01000067 2504 3424 . Ubiquitin-like; UBA-like;
Chro.30164 1018 AAELO 1000067 1438 2037 .
Chro.30165 1019 AAELO 1000297 7890 8507 .
Chro.30166 1020 AAELO 1000297 5875 7641 putative Upflp-interacting protein;
Chro.30167 1021 AAEL01000297 4477 4722 hypothetical protein
S-adenosyl-L-methionine-dependent
Chro.30168 1022 AAEL01000297 189 1052 P0700D12.13 methyltransferases;
P-loop containing nucleotide triphosphate
Chro.30169 1023 AAEL01000044 1161 2627 . hydrolases;
P-loop containing nucleotide triphosphate
Chro.30170 1024 AAEL01000044 3317 5275 . hydrolases;
Chro.30171 1025 AAELO 1000044 6304 8712 . pyrophosphate-dependent
Chro.30172 1026 AAELO 1000044 9168 13154 phosphofructokinase Phosphofructokinase;
Chro.30173 1027 AAEL01000044 14160 14534 unknown protein
Chro.30174 1028 AAELO 1000044 15350 16027 .
P-loop containing nucleotide triphosphate hydrolases; DNA polymerase IE clamp
Chro.30175 1029 AAEL01000044 16305 17288 replication factor c subunit 4 loader subunits, C-terminal domain;
Chro.30176 1030 AAEL01000044 18138 19754 . GAF domain-like; dual specificity protein phosphatase,
Chro.30177 1031 AAELO 1000044 19904 20848 putative (Phosphoryrosine protein) phosphatases II;
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Protein serine/threonine phosphatase 2C,
Chro.30178 1032 AAEL01000044 21517 23343 hypothetical protein catalytic domain;
Chro.30180 1033 AAELO 1000044 23359 23769 .
Chro.30181 1034 AAEL01000044 24752 25729 .
Chro.30182 1035 AAEL01000044 25911 26906 cyclin-dependent kinase 3 Protein kinase-like (PK-like);
Chro.30183 1036 AAEL01000044 27802 28245 .
Chro.30184 1037 AAEL01000584 1430 2044 .
Chro.30185 1038 AAEL01000584 2447 3310 .
Chro.30186 1039 AAEL01000446 82 3690 .
Chro.30187 1040 AAEL01000386 5388 6341 .
Chro.30188 1041 AAELO 1000386 4015 4611 hypothetical protein
Chro.30189 23 AAEL01000386 2297 2785 profilin Profilin (actin-binding protein);
Chro.30190 1042 AAEL01000764 99 2012 glucosidase π (Trans)glycosidases;
K) Chro.30191 1043 AAEL01000810 31 555 .
P-loop containing nucleotide triphosphate
Chro.30192 1044 AAEL01000810 hydrolases;
P-loop containing nucleotide triphosphate
Chro.30193 1045 AAELO 1000146 47 1051 Unknown (protein for MGC:33209) hydrolases;
Chro.30194 1046 AAEL01000146 2127 3401 .
Chro.30195 1047 AAEL01000146 3888 6458 . Bet vl -like;
Chro.30196 1048 AAEL01000146 7265 8302 ribonuclease P (3OkD)
Chro.30197 1049 AAEL01000146 8572 9060 hypothetical protein, conserved
Chro.30198 1050 AAELO 1000146
P-loop containing nucleotide triphosphate hydrolases; Translation proteins; EF- Tu/eEF-lalpha/eIF2-gamma C-terminal
Chro.30199 1051 AAEL01000146 12193 13584 translation initiation factor eIF-2 domain;
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.30200 1052 AAEL01000146 15081 15911 .
Chro.30202 1053 AAELO 1000582 3 362 .
Chro.30203 1054 AAELO 1000827 233 469 .
Chro.30204 1055 AAEL01000247 8583 10688 .
Chro.30205 1056 AAEL01000247 7348 8250 .
Chro.30206 1057 AAELO 1000247 6098 6910 .
Chro.30207 1058 AAELO 1000247 3127 4023 .
Chro.30208 1059 AAEL01000247 1581 2708 .
Chro.30209 1060 AAEL01000247 438 1286 .
Chro.30210 1061 AAELO 1000086 20512 21390 .
Chro.30211 1062 AAEL01000086 17763 19355 .
Chro.30212 1063 AAELO 1000086 15328 17031 .
Similar to cellular apoptosis susceptibility
W
Chro.30213 1064 AAEL01000086 11597 14971 gene product ARM repeat;
Chro.30214 1065 AAEL01000086 9499 11184 .
Chro.30215 1066 AAELO 1000086 7058 8353 casein kinase i Protein kinase-like (PK-like);
vWA-like; C-terminal, gelsolin-like domain of Sec23/24; beta-sandwich domain of
Chro.30216 1067 AAEL01000086 3857 6130 transport protein Sec23/24; Helical domain of Sec23/24;
Chro.30217 1068 AAEL01000086 507 3806 .
Chro.30218 1069 AAELOIOOOOOI 2 5233 .
Chro.30219 1070 AAELO 1000001 6231 7247 protein kinase Ck2-beta Casein kinase II beta subunit;
Chro.30220 1071 AAELOIOOOOOI 7512 9221 ENSANGP00000004359 EGF/Laminin;
DNA-directed RNA polymerase 2 subunit,
Chro.30221 1072 AAELOIOOOOOI 9293 9796 putative Zinc beta-ribbon;
Chro.30222 1073 AAELOIOOOOOI 10378 13788 RNA-binding protein, putative RNA-binding domain, RBD;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily transmembrane phosphatase with tensin
Chro.30223 1074 AAELO1000001 13920 16163 homology isoform C (Phosphotyrosine protein) phosphatases II; Chro.30224 1075 AAELOIOOOOOI 17018 17893 hypothetical protein Acyl-CoA N-acyltransferases (Nat); Chro.30225 1076 AAELO1000001 18248 19294 CG32297-PA Chro.30226 1077 AAELOIOOOOOI 19624 20409 hypothetical protein Chro.30227 1078 AAELOIOOOOOI 20849 21835. Chro.30228 1079 AAELOIOOOOOI 22007 22525 histamine-releasing factor, putative Mss4-like; Chro.30229 1080 AAELOIOOOOOI 23652 24506. Chro.30230 1081 AAELOIOOOOOI 24778 25134. Spectrin repeat; Chro.30233 1082 AAELOIOOOOOI 26620 29454. Chro.30234 1083 AAELOIOOOOOI 29908 33006. Chro.30235 1084 AAELOIOOOOOI 33491 35872. WD40-repeat; Chro.30236 1085 AAELOIOOOOOI 36141 36683. Chro.30237 1086 AAELOIOOOOOI 36864 39458 hypothetical protein
Protein serine/threonine phosphatase 2C,
Cbro.30238 1087 AAELOIOOOOOI 40620 42542 Ppmlg-prov protein catalytic domain; choline kinase GmCK2p-like protein, Chro.30240 1088 AAELOIOOOOOI 43038 44240 putative Protein kinase-like (PK-like); tRNA CCA-adding enzyme, C-terminal
Chro.30241 1089 AAELOIOOOOOI 46567 46830 tRNA adenylyltransferase -related domains; Nucleotidyltransferase; Chro.30242 1090 AAELOIOOOOOI 46831 47772 gene_id:MJMl 8.3~unknown protein Chro.30243 1091 AAELOIOOOOOI 48687 49469 hypothetical protein RING finger domain, C3HC4; Chro.30244 1092 AAELOIOOOOOI 49991 50470 . Chro.30245 1093 AAELOIOOOOOI 52358 57700 Ion transport protein, putative Voltage-gated potassium channels; Chro.30246 1094 AAELOIOOOOOI 58201 58971 putative ribosomal protein S2 Ribosomal protein S2; Chro.30247 1095 AAELOIOOOOOI 60686 61195 phosphatidylserine decarboxylase
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.30248 1096 AAELOIOOOOOI 61303 62700 Putative snoRNA binding domain, putative Nucleic acid-binding proteins;
P-loop containing nucleotide triphosphate
Chro.30249 1097 AAELOIOOOOOI 63525 69767 hypothetical protein hydrolases; RCC1/BLIP-II;
Chro.30250 1098 AAELOIOOOOOI 70031 71005 .
Chro.30251 1099 AAELOIOOOOOI 71022 72353 .
Chro.30252 1100 AAELOIOOOOOI 72764 73507 similar to NM_072339 Tl 5B7
Chro.30253 1101 AAELOIOOOOOI 73812 74351 DKFZP547N043 protein
N-terminal nucleophile aminohydrolases
Chro.30254 1102 AAELOIOOOOOI 74618 74917 2OS proteasome subunit PAAl (Ntn hydrolases);
Proteasome subunit alpha type 6 (2OS proteasome alpha subunit A) (2OS proteasome subunit alpha- 1) (Proteasome iota subunit)Dgi|7435869|pir||T06142 C 3.4.25.1 proteasome endopeptidase complex () iota chain - soybean D gi|3377794|gb|AAC28135.11 N-terminal nucleophile aminohydrolases
Chro.30255 1103 AAELOIOOOOOI 75087 75437 proteasome IOTA subunit (Ntn hydrolases); type I fatty acid synthase homolog - Cryptosporidium ρarvumDgi|4092069|gb|AAC99407.1| type Probable ACP-binding domain of malonyl-
Chro.30256 1104 AAELOlOOl 178 153 371 I fatty acid synthase CoA ACP transacylase;
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
FabD/lysophospholipase-like; Thiolase- like; NAD(P)-binding Rossmann-fold type I fatty acid synthase homolog - domains; GroES-like; NAD(P)-binding
Cryptosporidium Rossmann-fold domains; ACP-like; parvumDgi|4092069|gb|AAC99407.1| type NAD(P)-binding Rossmann-fold domains;
Chro.30258 1105 AAEL01000076 13023 22868 I fatty acid synthase NAD(P)-bmdmg Rossmann-fold domains;
Chro.30259 1106 AAELO 1000076 11822 12976 hypothetical protein Acid proteases; Ubiquitin-like; UBA-like;
Proteasome subunit alpha type N-terminal nucleophile aminohydrolases
Chro.30260 1107 AAELO 1000076 10851 11606 3Dgi|1408304|gb|AAB03671.1| PrtD (Ntn hydrolases);
Chro.30261 1108 AAELO 1000076 8834 10255 replication protein A large subunit Nucleic acid-binding proteins;
Chro.30262 1109 AAELO 1000076 8177 8629 ubiquitin-conjugating enzyme, putative UBC-like;
O\
Chro.30263 1110 AAEL01000076 7263 7901 01, putative
Chro.30264 1111 AAEL01000076 6627 6863 .
Chro.30265 1112 AAELO 1000076 5115 5537 .
WD40-repeat; Prolyl oligopeptidase, N-
Chro.30266 1113 AAEL01000076 3344 4993 FIj 12787-prov protein terminal domain;
Chro.30267 1114 AAEL01000076 1445 3100 . .
P-loop containing nucleotide triphosphate
Chro.30268 1115 AAEL01000256 3 1337 . hydrolases;
Catalytic domain of cyclic nucleotide
Chro.30269 1116 AAEL01000256 2214 5207 cGMP phosphodiesterase A4, putative phosphodiesterase 4b2b;
Chro.30271 1117 AAEL01000256 5219 5893 .
Chro.30272 1118 AAEL01000256 5958 6254 .
P-loop containing nucleotide triphosphate
Chro.30274 1119 AAELO 1000256 7814 10419 DEALVDEAH box helicase, putative hydrolases;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily type ii proteins geranylgeranyltransferase Terpenoid cylases/Protein
Chro.30275 1120 AAEL01001038 202 819 beta subunit prenyltransferases; Chro.30276 1121 AAELO 1001296 211 567 .
Chro.30277 1122 AAEL01000171 8140 8454 F12A21.14 NAD(P)-binding Rossmann-fold domains;
Chro.30278 1123 AAEL01000171 6380 7525 nuclear DNA-binding protein G2p -related Creatinase/aminopeptidase;
Chro.30279 1124 AAEL01000171 3944 5836 CG9351-PA
Chro.30280 1125 AAEL01000171 3469 3675 . PH domain-like;
Chro.30281 1126 AAEL01000171 362 3010 hypothetical protein RING finger domain, C3HC4;
Chro.30282 1127 AAEL01000068 22905 23849 .
Chro.30283 1128 AAEL01000068 21778 22239 ribosomal protein S 18 S13-like H2TH domain;
K> Chro.30284 1129 AAEL01000068 19915 21444 . GYF domain; -4 UbiA prenyltransferase family member
Chro.30285 1130 AAELO 1000068 19522 19878 (3127)
Chro.30286 1131 AAELO 1000068 17849 18490 .
Chro.30287 1132 AAELO 1000068 16307 17734 .
Chro.30288 1133 AAELO 1000068 15023 16189 .
Chro.30289 1134 AAEL01000068 13495 14829 . Thioredoxin-like;
Chro.30290 1135 AAELO 1000068 13072 13494 .
Chro.30291 1136 AAEL01000068 11394 12695 Hypothetical ORF; YdrO26cp Homeodomain-like;
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Subunit of the anaphase-promoting complex/cyclosome (APC/C), which is a ubiquitin-protein ligase required for degradation of anaphase inhibitors, including mitotic cyclins, during the metaphase/anaphase transition; required for
Chro.30292 1137 AAELO 1000068 9574 11295 sporulation; Cdcl6p TPR-like; Protein prenylyltransferase;
N-terminal nucleophile aminohydrolases
Chro.30293 1138 AAELO 1000068 8658 9497 putative proteasome component precursor (Nm hydrolases);
Chro.30294 1139 AAEL01000068 8120 8527 H3 histone, family 2; histone 2, H3cal Histone-fold;
Chro.30295 1140 AAELO 1000068 5695 6804 TBC domain, putative Ypt/Rab-GAP domain of gyp Ip;
S-adenosyl-L-methionine-dependent
Chro.30296 1141 AAELO 1000068 4555 5664 methyltransferases;
00
Chro.30297 1142 AAELO 1000068 3114 4298 probable KNA-binding protein RNA-binding domain, RBD;
P-loop containing nucleotide triphosphate
Chro.30298 1143 AAELO 1000068 1430 3061 kinesin-related protein K2 hydrolases;
Chro.30299 1144 AAEL01000895 142 1506
Chro.30300 1145 AAELO 1000273 9263 9838
DNA-directed RNA polymerase (EC beta and beta-prime subunits of DNA
Chro.30301 1146 AAELO 1000273 3309 8996 2.7.7.6) π largest chain dependent RNA-polymerase;
Chro.30302 1147 AAEL01000273 1730 3271 diacylglycerol kinase, putative Cysteine-rich domain;
Chro.30303 1148 AAELO 1000752 2068 2181
Chro.30304 1149 AAEL01000752 1361 2035 probable microsomal signal peptidase 22
Chro.30306 1150 AAELOlOOl 198 362 882 kDa subunit, putative
Chro.30307 1151 AAEL01000197 1 1605 hypothetical protein Chaperone J-domain; Thioredoxin-like;
Chro.30308 1152 AAEL01000197 1639 1956
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.30309 1153 AAEL01000197 2615 5239 . RmlC-like cupins;
Chro.30310 1154 AAEL01000197 6426 6641 .
ATPase, aminophospholipid transporter- like, class I, type 8A, member 2; ATPase, HAD-like; Calcium ATPase, ATP-binding class 1, member a; ATPase 8A2, p type; domain N; Calcium ATPase, transduction
Chro.30311 1155 AAEL01000197 6823 10359 ATPase 8A2, class 1 domain A;
Cbro.30312 1156 AAEL01000197 10386 12014 Krox-like protein
Chro.30313 1157 AAEL01000197 12147 13057 hypothetical protein Ankyrin repeat;
Chro.30314 1158 AAEL01000660 1146 1847 hypothetical protein
Chro.30315 1159 AAEL01000660 78 308 . Zinc beta-ribbon;
Chro.30316 1160 AAEL01000501 352 3639 hypothetical protein L domain-like;
Chro.30317 1161 AAEL01000501 3797 4180 . Culin repeat;
KJ
Chro.30318 1162 AAEL01000590 2527 3117 .
Chaperone J-domain; HSC20 (HSCB), C-
Chro.30319 1163 AAEL01000590 1722 2456 chaperone protein - related terminal oligomerisation domain;
Chro.30320 1164 AAEL01000900 270 701 .
Chro.30321 1165 AAELO 1000900 704 1498 .
Chro.30322 1166 AAEL01000510 3780 4430 .
Chro.30323 1167 AAEL01000510 3449 3742 .
Chro.30324 1168 AAELO 1000510 2154 3263 .
Chro.30325 1169 AAEL01000510 353 1897 . EF-hand;
Chro.30326 1170 AAEL01001092 88 306 .
Chro.30327 1171 AAEL01000150 2 511 Leucine Rich Repeat, putative L domain-like;
Chro.30328 1172 AAELO 1000150 768 7793 ENSANGP00000005722
Chro.30329 1173 AAEL01000150 8137 10035 putative protein Roco7 Protein kmase-like (PK-like);
Chro.30330 1174 AAEL01000150 10085 10753 .
Chro.30331 1175 AAEL01000150 11129 11911 hypothetical protein
Table 1
Ch_Gene 5 SEQ JD NO. Ch_Accession Start End Description Superfamily mitochondrial import inner membrane
Chro.30332 1176 AAEL01000150 11930 13204 translocase, putative
Chro.30333 1177 AAEL01000150 13389 14786 cardiolipin synthetase, putative Phospholipase D/nuclease; strong similarity to yeast cell division and Eukaryotic type KH-domain (eKH-
Chro.30334 1178 AAEL01000150 14901 15930 spore germination protein Krrlp domain);
Chro.30335 1179 AAEL01000472 252 4175
Chro.30336 1180 AAEL01000650 1620 2693
Chro.30337 1181 AAELO 1000448 1157 4735 hypothetical protein SET domain; Cysteine-rich domain;
Chro.30338 1182 AAEL01000219 504 1769 ENSANGP00000011856
Chro.30339 1183 AAEL01000219 1843 5055
Chro.30340 1184 AAEL01000219 5177 6808 hypothetical protein, conserved Ypt/Rab-GAP domain of gyplp;
Chro.30341 1185 AAEL01000219 6891 11801
U) guanine nucleotide exchange factor eIF-2B
Chro.30342 1186 AAEL01000245 8122 9195 delta chain, long form - mouse
Chro.30343 1187 AAEL01000245 6224 7924 putative MAPK Protein Hnase-like (PK-like);
protein kinase (EC 2.7.1.37), cAMP- dependent, catalytic chain - Plasmodium yoeliiDgi|1089793|dbj|BAA08284.1| cAMP-
Chro.30344 1188 AAEL01000245 4472 5650 dependent protein kinase catalytic subunit Protein kinase-like (PK-like);
Chro.30345 1189 AAELO 1000245 3341 4303 .
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Exportin 1 (Chromosome region maintenance protein 1) (Caffeine resistance protein 2)Dgi|l 1281652|pir||T50137 chromosome region maintenance protein 1 - fission yeast (Schizosaccharomyces pombe)Dgi|6137058[emb|CAB40824.2|
Chro.30346 1190 AAEL01000245 925 3102 crml ARM repeat;
Chro.30347 1191 AAELO 1000668 967 2436 .
Chro.30348 1192 AAEL01000668 2370 2720 . homolog of C. elegans smu-1; brain-
Chro.30349 1193 AAEL01000801 797 1918 enriched WD-repeat protein
Chro.30350 1194 AAEL01000318 7077 8609 .
W P-loop containing nucleotide triphosphate
Chro.30351 1195 AAEL01000318 5172 7076 similar to hypothetical protein FLJ37300 hydrolases;
Chro.30352 1196 AAEL01000318 3587 4837 hypothetical protein, conserved
Chro.30353 1197 AAELO1O0O318 1525 2796 hypothetical protein vWA-like; Cysteine-rich domain;
Chro.30354 1198 AAELO 1000318 265 1272 alternative oxidase
Chro.30355 1199 AAELOlOOl 113 1 669 . ARM repeat;
Chro.30356 1200 AAEL01000114 25 1032 hypothetical protein
P-loop containing nucleotide triphosphate
Chro.30357 1201 AAELO 1000114 1136 1792 Rab5 hydrolases;
Chro.30358 1202 AAEL01000114 2292 3227 .
P-loop containing nucleotide triphosphate hydrolases; DNA polymerase IH clamp
Chro.30359 1203 AAEL01000114 3456 4589 replication factor C3 loader subunits, C-terminal domain;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.30360 1204 AAEL01000114 5407 7434 . Protein kinase-like (PK-like);
Bromodomain; Acyl-CoA N-
Chro.30361 1205 AAEL01000114 7757 9724 histone acetyltransferase acyltransferases (Nat);
Chro.30362 1206 AAEL01000114 10224 11099 . Aldolase;
Chro.30363 1207 AAEL01000114 11163 11492 . .
Chro.30364 1208 AAEL01000114 11996 12235 . .
Chro.30365 1209 AAEL01000114 12582 12794 .
Chro.30366 1210 AAEL01000114 12870 14597 PV1H14O8O_P HAD-like;
Chro.30367 1211 AAELO 1000114 15124 16095 putative actin-related complex protein Arp2/3 complex subunits;
Chro.30368 1212 AAEL01000114 17077 18162 .
Metalloproteases ("zincins"), catalytic
Chro.30369 1213 AAEL01000888 379 1038 hypothetical protein PHl 820 domain;
Chro.30371 1214 AAEL01000888 980 1348 .
" Chro.30372 1215 AAEL01000020 135 422 . .
P-loop containing nucleotide triphosphate
Chro.30373 1216 AAEL01000020 630 1169 protein ad-004 hydrolases;
Chro.30374 1217 AAEL01000020 1613 2662 . Viral coat and capsid proteins;
Chro.30375 1218 AAELO 1000020 2757 3260 .
Chro.30376 1219 AAEL01000020 3791 4150 similar to CGI-125 protein
Chro.30377 1220 AAELO 1000020 4567 6699 hypothetical protein Chorismate mutase II;
Chro.30378 1221 AAELO 1000020 7195 8724 phenylalanyl-trna synthetase - like protein Class π aaRS and biotin synthetases;
Chro.30379 1222 AAEL01000020 9299 12190 .
Chro.30380 1223 AAELO 1000020 13505 17833 SECIS binding protein 2 L30e-like;
Chro.30381 1224 AAELO 1000020 18902 20413 .
Chro.30382 1225 AAEL01000020 21009 22664 .
Chro.30383 1226 AAELO 1000020 24003 28526 .
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily
P-loop containing nucleotide triphosphate
Chro.30384 1227 AAEL01000020 29804 31789 ENSANGP00000021948 hydrolases;
Chro.30385 1228 AAELO 1000020 3 311886699 3355558855 synthetic antigen of P.falciparum, putative
Chro.30386 1229 AAEL01000132 15668 16768
Chro.30387 1230 AAEL01000132 14305 15507 EF-hand;
Copper amine oxidase, domain 3
Chro.30388 1231 AAEL01000132 8422 13737 amiloride binding protein 1 (catalytic); dnaK-type molecular chaperone hsp70, organellar - Eimeria Heat shock protein 7OkD (HSP70), C- tenellaDgi|603814|emb|CAA87086.1| terminal substrate-binding fragment; Actin-
Chro.30389 1232 AAEL01000132 5696 7747 organellar heat shock protein like ATPase domain;
Chro.30390 1233 AAEL01000132 4420 5034
Chro.30391 1234 AAEL01000132 2587 4341 RING finger domain, C3HC4;
Chro.30392 1235 AAEL01000132 1061 1846 proliferating cell nuclear antigen DNA clamp;
Chro.30393 1236 AAEL01000132 137 1069
Chro.30394 1237 AAEL01000201 9960 12095
Chro.30395 1238 AAEL01000201 8585 9634 hypothetical protein RNA-binding domain, RBD;
Chro.30396 1239 AAELO 1000201 7955 8320
Chro.30397 1240 AAEL01000201 4931 7753 cation exchanger, putative (CAXIl)
Chro.30398 . 1241 AAEL01000201 3738 3953
Chro.30399 1242 AAELO 1000201 2968 3273
Chro.30400 1243 AAEL01000891 957 1304
Chro.30401 1244 AAEL01000891 346 582 hypothetical protein
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
similar to Mus musculus (Mouse). 13 days embryo heart cDNA, RIKEN full-length enriched library, clone:D330046B13 product:minichromosome maintenance deficient (S. cerevisiae) 3 -associated
Chro.30403 1245 AAELO 1000427 1435 5698 protein, lull insert sequence (Fragment)
P-loop containing nucleotide triphosphate
Chro.30404 1246 AAELO 1000246 9170 10276 GTP-binding-like protein hydrolases; TGS-like;
Chro.30405 1247 AAELO 1000246 8353 8550 . .
Chro.30406 1248 AAELO 1000246 6042 7922 hypothetical protein alpha-L-arabinanase;
Galactose oxidase, central domain; POZ
C Chro.30407 1249 AAELO 1000246 4048 5628 hypothetical protein domain;
Chro.30408 1250 AAEL01000246 1932 3329 Unknown (protein for MGC:55944) Zn-dependent exopeptidases;
Chro.30409 1251 AAEL01000512 1295 4252 hypothetical protein
Chro.30410 1252 AAELO 1000512 144 656 .
Chro.30411 mutant green fluorescent protein
Chro.30412 1253 AAEL01001016 31 1116 . Protein kinase-like (PK-like);
Chro.30413 1254 AAELO 1000652 1469 2308 .
Chro.30414 1255 AAELO 1000652 61 321 Yersinia pestis BolA-like protein BolA-like;
Chro.30416 1256 AAEL01001049 44 913 .
P-loop containing nucleotide triphosphate
Chro.30417 1257 AAELO 1001046 147 1013 U5 snRNP 100 kD protein hydrolases;
Chro.30418 1258 AAELO 1000706 2134 2346 .
Chro.30420 1259 AAELO 1000706 14 1951 .
Chro.30421 1260 AAEL01000597 721 2361 .
Chro.30422 1261 AAELO 1000597 2883 3236 .
Table 1
Ch_Gene SEQ BD NO. Ch_Accession Start End Description Superfamily
Chro.30424 1262 AAEL01000836 1013 1681 P-type ATPase 2 Calcium ATPase, transduction domain A; lambda repressor-like DNA-binding
Chro.30426 1263 AAEL01000398 5073 5513 multiprotein bridging factor type 1 domains;
ATPase domain of HSP90 chaperone/DNA heat shock protein 83 - Trypanosoma topoisomerase H/histidine kinase; 4-helical
Chro.30427 1264 AAEL01000398 635 2734 brucei cytokines;
Chro.30428 1265 AAEL01000530 3390 4037 . .
Chro.30429 1266 AAEL01000530 2357 2806 60S ribosomal protein L19, putative Ribosomal protein L19 (L19e);
Chro.30430 1267 AAEL01000530 2 1207 . WD40-repeat;
Chro.30432 1268 AAEL01000886 365 1543 DNA ligase l
U)
Chro.30433 1269 AAELO 1000880 188 1441 . (Phosphotyrosine protein) phosphatases II;
Nucleotidylyl transferase; Anticodon- binding domain of a subclass of class I
Chro.30434 1270 AAEL01000627 129 2504 isoleucine-tRNA synthetase aminoacyl-tRNA synthetases;
Chro.30435 1271 AAEL01000322 631 2187 hypothetical protein, conserved Pseudouridine synthase;
Chro.30436 1272 AAEL01000322 3075 4520 hypothetical protein t-snare proteins; Spectrin repeat;
Chro.30437 1273 AAEL01000322 5097 5687 hypothetical protein, conserved .
U5 small nuclear ribonuclear protein,
Chro.30438 1274 AAEL01000791 348 785 putative EF-G/eEF-2 domains m and V;
Chro.30440 1275 AAEL01000254 896 2347 hypothetical protein
Chro.30441 1276 AAEL01000254 2415 4571 hypothetical protein .
DEAD/DEAH box ATP-dependent RNA P-loop containing nucleotide triphosphate
Chro.30442 1277 AAEL01000254 5005 6564 helicase, putative hydrolases;
Chro.30443 1278 AAELO 1000254 7790 8068 ribosomal protein L22 Ribosomal proteins L15p and L18e;
Chro.30444 1279 AAEL01000254 9238 10557 .
Table 1
Ch Gene SEQ BD NO. Ch Accession Start End Description Superfamily
Chro.30445 1280 AAELO 1000773 267 1166 expressed protein UBA-like;
Chro.30446 1281 AAELO 1000267 8963 9982 .
Chro.30447 1282 AAEL01000674 751 1188 .
Archaeosine tRNA-guanine transglycosylase, C-terminal additional
Chro.30448 1283 AAEL01000125 16766 17305 uncharacterized domain 2, putative domains;
Chro.30449 1284 AAEL01000125 14076 16436 hypothetical protein
Glucocorticoid receptor-like (DNA-binding
Chro.30450 1285 AAEL01000125 12534 14075 . domain);
Chro.30451 1286 AAEL01000125 11935 12294 .
Chro.30452 1287 AAEL01000125 10999 11736 similar to calcyclin binding protein HSP20-like chaperones;
Chro.30453 1288 AAEL01000125 9821 10510 CG10306-PA
Chro.30454 1289 AAELO 1000125 7641 8390 Grina-prov protein
Chro.30455 1290 AAEL01000125 6272 6907 .
Chro.30456 1291 AAEL01000125 4739 5746 mitotic cyclin-CYC2 Cyclin-like;
MEMBRANE NUCLEASE,
Chro.30457 1292 AAEL01000125 1817 4483 LIPOPROTEIN WD40-repeat; Cytokine;
Chro.30458 1293 AAEL01000287 8261 9106 hexose transporter
Chro.30459 1294 AAEL01000287 6716 7705 AI196514 protein
RING finger domain, C3HC4; Proteasome
Chro.30460 1295 AAELO 1000287 992 6355 hypothetical protein activator reg(alpha);
Similar to RHCEN cDNA 5730427N09
Chro.30461 1296 AAELO 1000554 2440 3222 gene
Chro.30462 1297 AAEL01000174 606 1229 .
Chro.30463 1298 AAELO 1000174 1339 1674 .
Chro.30464 1299 AAELO 1000174 3245 4780 . WD40-repeat;
Table 1
Ch_Gene S SEQ ID NO. Ch_Accession Start End Superfamily
Calcium ATPase, transduction domain A; HAD-like; Calcium ATPase, ATP-binding
Chro.30465 1300 AAEL01000174 5621 9913 Hypothetical ORF; Yor291wp domain N; similar to Nectria haematococca. Cutinase
Chro.30466 1301 AAEL01000174 11993 12691 negative acting protein KNA-binding domain, RBD;
Chro.30467 1302 AAELO 1000174 13259 14293 Cp22.4.1 protein Retrovirus zinc finger-like domains;
Chro.30468 1301 AAEL01000226 1377 2387 insulin degrading enzyme LuxS/MPP-like metallohydrolase;
Chro.30469 1304 AAEL01000226 2739 6119 insulin-degrading enzyme LuxS/MPP-like metallohydrolase;
Chro.30470 1305 AAELO 1000226 7139 10396 LuxS/MPP-like metallohydrolase;
Chro.30471 1306 AAEL01000226 11237 11683
Chro.30472 1307 AAEL01001244 65 559
Chro.30474 1308 AAEL01000304 4920 8684 peptidase, Ml 6 family LuxS/MPP-like metallohydrolase;
Chro.30475 1309 AAEL01000304 429 4256 peptidase, insulinase family LuxS/MPP-like metallohydrolase;
Chro.30476 1310 AAEL01000788 64 1632
Chro.30478 1311 AAEL01000610 1005 3080 LuxS/MPP- ■like metallohydrolase;
Chro.30479 1312 AAELO 1000600 373 1983 zinc protease, possible LuxS/MPP- ■like metallohydrolase;
Chro.30480 1313 AAEL01000698 195 749 LuxS/MPP- ■like metallohydrolase;
Chro.30482 1314 AAELO 1000649 1822 2739 zinc protease, possible LuxS/MPP- ■like metallohydrolase;
Chro.30483 1315 AAEL01000521 2520 3305 ENSANGP00000016000 LuxS/MPP- ■like metallohydrolase;
Chro.30484 1316 AAEL01000200 552 2222 DNA polymerase alpha, DNAPoI alpha DNA/RNA polymerases;
Chro.30485 1317 AAELO 1000200 2406 3074 hypothetical protein
Protein kinase-like (PK-like); SAM/Pointed domain; Histone H3 K4-specific methyltransferase SET7/9 N-terminal
Chro.30486 1318 AAEL01000200 3154 5436 sexual stage-specific protein kinase domain;
Chro.30487 1319 AAEL01000200 6959 8023 ENSANGPOOOOOO 13430 Metallo-dependent phosphatases;
Chro.30488 1320 AAEL01000200 9196 9807 .
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.30489 1321 AAEL01000200 10172 11791 hypothetical protein AN4477.2
Chro.30490 1322 AAELO 1000200 12204 12939 .
Chro.31001 1323 AAELOIOOOOOI 76265 90442 type I fatty acid synthase
Chro.31002 1324 AAELO 1000766 1820 2107 hypothetical protein cgd3_3730 hypothetical protein, within locus of
Chro.31003 1325 AAEL01000582 3 707 Cryptosporidium paralogs
Chro.31004 1326 AAEL01000762 1710 2123 hypothetical protein cgd3_2660
Chro.31005 1327 AAELO 1000455 1883 2068 hypothetical protein cgd3_1080
Chro.31006 1328 ' AAEL01000053 2221 2475 .
Chro.31007 1329 AAEL01001400 2 91 hypothetical protein with signal peptide
Chro.31008 1330 AAELO 1000706 2136 2340 .
Chro.40010 1331 AAEL01000613 1730 2209 .
C Chro.40011 1332 AAELO 1000879 752 1573 .
Chro.40012 1333 AAEL01000127 427 651 .
Chro.40013 1334 AAEL01000127 1872 2876 .
Chro.40014 1335 AAEL01000127 3231 3497 .
Chro.40015 1336 AAEL01000127 4176 5150 .
Chro.40016 1337 AAEL01000127 5402 5644 .
Molybdenum cofactor biosynthesis protein
Chro.40017 1338 AAEL01000127 5726 7435 Hypothetical protein CBG06001 MoeB;
Chro.40018 1339 AAEL01000127 7495 8043 . .
EGF/Laminin; TNF receptor-like; Plant
Chro.40019 1340 AAEL01000127 8187 9320 hypothetical protein inhibitors of proteinases and amylases; elFl-like; Archaeosine tRNA-guanine transglycosylase, C-terminal additional
Chro.40020 1341 AAEL01000127 12699 14123 hypothetical protein domains;
Chro.40021 1342 AAEL01000127 14385 16898 hypothetical protein, conserved
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.40022 1343 AAEL01000127 16965 17210 . Chro.40023 1344 AAEL01000416 5799 6017 . Chro.40024 1345 AAELO 1000416 3533 5389 . Chro.40025 1346 AAEL01000416 1505 3229 Hypothetical protein CBG21312 WD40-repeat; Chro.40026 1347 AAEL01000416 8 331 .
Eukaryotic type KH-domain (eKH-
Chro.40027 1348 AAEL01000744 319 1914 hypothetical protein domain); RNA-binding domain, RBD; P-loop containing nucleotide triphosphate Chro.40028 1349 AAEL01000460 269 3979 DNA repair protein rhp 16, putative hydrolases;
Chro.40029 1350 AAELO 1000460 4450 5088 Putative snoRNA binding domain, putative Chro.40030 1351 AAEL01000577 1897 2778 Chro.40031 1352 AAEL01000577 1458 1781 Chro.40032 1353 AAEL01000577 357 1373 Chro.40033 1354 AAELO 1001077 389 949 similar to Entamoeba histolytica. Myosin
Chro.40034 1355 AAEL01000271 829 5643 heavy chain Chro.40035 1356 AAELO 1000271 6821 7276 ubiquitin-conjugating enzyme, putative UBC-like; UBA-like; Chro.40036 1357 AAEL01000271 8073 8420 . Chro.40037 1358 AAEL01000271 8773 9924 tRNA-binding arm; Chro.40038 1359 AAELO 1000663 1 1029 protein kinase 3 Protein kmase-like (PK-like); N-terminal nucleophile ammohydrolases
Chro.40039 1360 AAELO 1000642 1815 2600 proteasome subunit, putative (Ntn hydrolases);
Chro.40040 1361 AAELO 1000293 436 4509 hypothetical protein, conserved Prolyl oligopeptidase, N-terminal domain; Tudor/PWWP; Ribosomal protein L29 Chro.40041 1362 AAEL01000293 4985 5842 hypothetical protein (L29p);
Table 1
Ch_Gene SEQ ED NO. Ch_Accession Start End Description Superfamily
Chro.40042 1363 AAEL01000293 6026 7813 unnamed protein product Homeodomain-like; protein phosphatase 2A regulatory subunit
Chro.40043 1364 AAEL01000924 5 619 isoforniB delta
Chro.40044 1365 AAEL01000848 1 291 .
Chro.40045 1366 AAEL01000276 4 759 hypothetical protein Histone-fold;
Chro.40046 1367 AAEL01000276 1221 1442 Rabll
Chro.40047 1368 AAELO 1000276 2580 3038 . EF-hand;
Chro.40048 1369 AAELO 1000276 3212 5035 .
Chro.40049 1370 AAEL01000276 5444 6289 .
Chro.40050 1371 AAEL01000276 7823 9484 . TPR-like;
Chro.40051 1372 AAELO 1000634 1411 1668 SET domain, putative SET domain;
Chro.40052 1373 AAELO 1000634 2512 3071 hypothetical protein
Chro.40053 1374 AAELO 1000299 7607 8680 hypothetical protein MG03690.4 .
Chro.40054 1375 AAELO 1000299 5578 7077 FK506-binding protein FKBP51 TPR-like; similar to ORF YJR070C from S. Lipovitellin-phosvitin complex,
Chro.40055 1376 AAELO 1000299 3775 4932 cerevisiae superhelical domain;
Chro.40056 1377 AAEL01000299 2444 3229 CG4196-PC .
Chro.40057 1378 AAEL01000299 111 2333 .
Resolvase-like; 5' to 3' exonuclease, C-
Chro.40058 1379 AAEL01000522 402 3878 RAD2 terminal subdomain;
Chro.40059 1380 AAEL01000522 3871 4296 hypothetical protein
Chro.40060 1381 AAELO 1000995 2 1114 . .
Chro.40061 1382 AAELO 1000173 12684 13988 .
Chro.40062 1383 AAEL01000173 11841 12404 Eukaryotic ribosomal protein Ll 8, putative Ribosomal proteins L15p and L18e;
Chro.40063 1384 AAEL01000173 7319 11350 KIAA0866 protein beta-catenin-interacting protein ICAT;
Chro.40064 1385 AAELO 1000173 1550 5110 PE_PGRS Homeodomain-like;
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Growth factor receptor domain;
Chro.40066 1386 AAELO 1000062 1429 2304 oocyst wall protein 7 precursor EGF/Laminin;
Chro.40067 1387 AAELO 1000062 3432 8864 hypothetical protein Homeodomain-like;
Chro.40068 1388 AAELO 1000062 10788 11942
26S proteasome regulatory subunit S5A • common ice plantϋgi|3202042|gb|AAC19402.1| 26S
Chro.40069 1389 AAELO 1000062 12137 13288 proteasome regulatory subunit S5A vWA-like;
Chro.40070 1390 AAEL01000062 14285 15556 vacuolar ATP synthase, putative
Chro.40071 1391 AAELO 1000062 15782 16873 SMALVFHA domain;
Chro.40072 1392 AAEL01000062 17585 18505
Chro.40073 1393 AAEL01000062 19696 20052 ubiquitin-conjugating enzyme UBC-like;
Chro.40074 1394 AAEL01000062 21795 24038 hypothetical protein SmR repressor dimerisation domain-like; Nuclear transport factor 2 (NTF- 2)Dgi|5360221|dbj|BAA81910.1| nuclear
Chro.40075 1395 AAELO 1000402 5602 5991 transport factor 2 (NTF2) NTF2-like;
Chro.40076 1396 AAEL01000402 3155 5113
Chro.40077 1397 AAELO 1000402 28 2010 Hypothetical protein CBG12063
Chro.40078 1398 AAEL01000835 440 739 LexA/Signal peptidase;
Chro.40079 1399 AAELO 1000835 1154 1612 hypothetical protein Putative DNA-binding domain;
Chro.40080 1400 AAEL01000719 31 2238
Chro.40081 1401 AAEL01000083 102 2120
Bromodomain; Retrovirus zinc finger-like
Chro.40082 1402 AAELO 1000083 2374 8 8227744 Bromodomain, putative domains; HybD-like;
Chro.40083 1403 AAEL01001260 58 363
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Archaeosine tRNA-guanine transglycosylase, C-terminal additional
Chro.40084 1404 AAELO 1000083 8726 9268 unnamed protein product domains;
Chro.40085 1405 AAEL01000083 1111997777 12498 oocyst wall protein 3 precursor Growth factor receptor domain;
Chro.40086 1406 AAEL01000083 13025 15067 .
Ferredoxin reductase-like, C-terminal NADP-linked domain; Riboflavin synthase
Chro.40087 1407 AAELO 1000575 2751 3557 Pyruvate dehydrogenase domain-like;
Chro.40088 1408 AAELO 1000575 982 2265 bll4978
Chro.40089 1409 AAELO 1000575 307 450 MGC52939 protein
Chro.40090 1410 AAELO 1000679 360 1361 nucleosome assembly protein
Chro.40091 1411 AAEL01000679 2445 2627 .
Chro.40092 1412 AAEL01000451 3973 4998 .
Chro.40093 1413 AAEL01000451 3184 3774 thioredoxin peroxidase Thioredoxin-like;
Chro.40094 1414 AAELO 1000451 3 1838 serine proteinase inhibitor Ovomucoid/PCI-1 like inhibitors;
Chro.40095 1415 AAEL01000811 1310 1867 similar to Drosophila melanogaster asfl
Chro.40097 1416 AAELO 1000500 1288 4497 DNA topoisomerase π, putative Type π DNA topoisomerase;
Chro.40098 1417 AAELO 1000500 696 929 hypothetical protein
Chro.40099 1418 AAEL01000500 76 639 CG12404-PA
Nucleotide-diphospho-sugar transferases;
UDP-N-acetylglucosamine Succinate dehydrogenase/fumarate
Chro.40100 1419 AAEL01000475 1722 3506 pyrophosphorylase; Qrilp reductase flavoprotein C-terminal domain;
Chro.40101 1420 AAELOlOOl 106 139 765 Cstfl-prov protein WD40-repeat;
Chro.40102 1421 AAEL01000437 4209 5186 hypothetical protein
Glucocorticoid receptor-like (DNA-binding
Chro.40103 1422 AAEL01000437 3093 3494 Ribosomal protein L24e, putative domain);
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.40104 1423 AAEL01000437 26 2488 . Thioredoxin-like;
Chro.40105 1424 AAEL01000211 2868 6611 .
Chro.40106 1425 AAELO 1000211 7638 10712 .
Chro.40107 1426 AAELO 1000211 10814 12289 ADA2-like protein similar to Arabidopsis thaliana (Mous<
Chro.40108 1427 AAEL01000897 103 750 cress). WD40-repeat protein WD40-repeat; similar to transducin beta-like 3; WD-
Chro.40109 1428 AAEL01000659 1706 2401 repeat protein SAZD
Chro.40110 1429 AAEL01000659 166 1176 . Phosphoglycerate mutase-like;
Chro.40111 1430 AAEL01000937 71 1373 acid phosphatase Phosphoglycerate mutase-like;
Chro.40112 1431 AAELO 1000859 678 1625 . PoIy(A) polymerase, C-terminal domain;
Chro.40113 1432 AAELO 1000263 1717 2598 .
Chro.40114 1433 AAELO 1000263 2860 4515 will die slowly CG17437-PA WD40-repeat; w Chro.40115 1434 AAEL01000263 4757 4969 unnamed protein product
Chro.40116 1435 AAEL01000263 5180 5416 . HAD-like; minichromosome maintenance protein P-loop containing nucleotide triphosphate
Chro.40117 1436 AAEL01000263 5790 8363 mcm7p hydrolases;
Chro.40118 1437 AAELO 1000263 8418 9617 .
Chro.40119 1438 AAELO 1000633 28 1041 Protein kinase domain, putative Protein kinase-like (PK-like);
Chro.40121 1439 AAEL01001241 519 752 .
Chro.40122 1440 AAEL01000821 18 1829 . eukaryotic translation initiation factor,
Chro.40123 1441 AAEL01000814 297 1355 putative RNA-binding domain, RBD;
Chro.40124 1442 AAELO 1000903 733 1203 .
Chro.40126 1443 AAELO 1000720 1020 1310 MYND finger domain protein
Chro.40127 1444 AAELO 1000720 66 467 protein disulphide isomerase Thioredoxin-like;
Chro.40128 1445 AAELO 1000669 400 933 hypothetical orotein
Table 1
Ch_Gene SEQ H) NO. Ch Accession Start End Description Superfamily
Chro.40129 1446 AAELOlOOl 105 82 660 .
ERYTHROCYTE MEMBRANE
Chro.40131 1447 AAEL01000559 1 2184 PROTEIN PFEMP3
Chro.40132 1448 AAEL01000559 3064 3744 hypothetical protein WD40-repeat;
Chro.40133 1449 AAELO 1000678 6 122 .
Chro.40135 1450 AAEL01000678 1083 2186 hypothetical protein
Chro.40136 1451 AAEL01000424 5446 5691 .
Chro.40137 1452 AAEL01000424 3542 5344 expressed protein
26S proteasome AAA-ATPase subunit P-loop containing nucleotide triphosphate
Chro.40138 1453 AAELO 1000424 1366 2703 RPT2a hydrolases;
Chro.40139 1454 AAELO 1000424 605 937 .
Chro.40140 1455 AAELO 1000424 2 217 . ubiquitin fusion degradation (UFD)
Chro.40141 1456 AAEL01000561 3 413 protein, putative ADC-like;
Eukaryotic type KH-domain (eKH- transcription or splicing factor-like protein, domain); Retrovirus zinc finger-like
Chro.40142 1457 AAEL01000561 1064 2482 putative domains;
Chro.40143 1458 AAELO 1000561 2965 3756 Hypothetical protein CBG04617
60S ribosomal protein
L28Dgi|l 1245768|gb|AAG32533.1|
Chro.40144 1459 AAEL01000958 602 985 ribosomal protein L28
Chro.40145 1460 AAEL01000926 723 1411 hypothetical protein
Chro.40147 1461 AAELO 1000288 8605 9441 hypothetical protein Homeodomain-like;
Chro.40148 1462 AAEL01000288 7770 8027 .
Chro.40149 1463 AAELO 1000288 5728 7170 .
Chro.40150 1464 AAEL01000288 3130 4923 .
Chro.40151 1465 AAEL01000288 319 2724 hypothetical protein Cutinase-like;
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.40153 1466 AAEL01000923 558 1244 . Bromodomain;
Regulator of chromosome condensation,
Chro.40154 1467 AAEL01000105 808 2859 putative RCC1/BLIP-II; hypothetical protein C0740c - malaria
Chro.40155 1468 AAELO 1000105 3197 5251 parasite (Plasmodium falciparum) RING finger domain, C3HC4;
P-loop containing nucleotide triphosphate
Chro.40156 1468 AAELO 1000105 5836 10308 ATP-binding cassette protein 2 hydrolases;
P-loop containing nucleotide triphosphate
Chro.40157 1470 AAELO 1000105 10851 15260 ABC multidrug or ion efflux transporter hydrolases;
P-loop containing nucleotide triphosphate
Chro.40158 1471 AAELO 1000105 16022 19129 ATP-binding cassette protein 1 hydrolases;
Chro.40159 1472 AAEL01000725 1567 1815 inorganic pyrophosphatase precursor Inorganic pyrophosphatase;
£ Chro.40160 1473 AAELO 1000748 256 492 .
Ul
S-adenosyl-L-methionine-dependent
Chro.40162 1474 AAEL01000748 877 1989 hypothetical protein methyltransferases;
Chro.40163 1475 AAEL01001183 2 358 .
Chro.40164 1476 AAEL01000235 523 1380 hypothetical protein
Chro.40165 1477 AAEL01000235 2296 5058 .
Chro.40166 1478 AAEL01000235 5120 5545 . vacuolar proton translocating ATPase 116
Chro.40167 1479 AAEL01000235 6740 9466 kDa subunit a isoform 1
P-loop containing nucleotide triphosphate
Chro.40168 1480 AAEL01000235 10447 10866 expressed protein hydrolases;
Chro.40169 1481 AAEL01000881 785 1543 hypothetical protein
Chro.40170 1482 AAEL01000881 154 732 small subunit DNA primase DNA primase;
Chro.40171 1483 AAEL01000917 101 340 DNA primase small subunit DNA primase;
Chro.40174 1484 AAEL01000892 464 1462 ENSANGP00000021112
Table 1
ChjGene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.40175 1495 AAEL01000837 302 1051 .
Chro.40177 1486 AAEL01000457 4436 4612 hypothetical serine-rich repeat protein
Chro.40178 1487 AAEL01000457 3401 3652 .
Chro.40179 1488 AAEL01000457 1607 2185 .
Chro.40180 1489 AAEL01001235 217 546 CG6686-PA
Chro.40181 1490 AAEL01000882 703 1464 Fts J cell division protein, putative
P-loop containing nucleotide triphosphate hydrolases; Bromodomain; Chromo
Chro.40182 1491 AAELO 1000187 3975 10778 RIKEN cDNA A730019I05 gene domain-like;
Chro.40183 1492 AAELO 1000187 11983 13519 CG15040-PA
Chro.40184 1493 AAEL01001091 433 912 .
Chro.40185 1494 AAELO 1000637 417 1619 .
Chro.40186 1495 AAEL01001225 239 424 .
OV Chro.40187 1496 AAEL01000363 95 1720 .
Chro.40188 1497 AAEL01000363 2434 2646 thioredoxin; Trxlp Thioredoxin-like;
Chro.40189 1498 AAEL01000363 3865 4488 .
Chro.40190 1499 AAELO 1000363 5051 6064 hypothetical protein AN7182.2
Chro.40191 1500 AAEL01000363 6703 7581 .
Chro.40193 1501 AAEL01000734 1596 2237 hypothetical protein MG07136.4
Chro.40194 1502 AAELO 1000502 523 1707 .
CCAAT-box DNA binding protein subunit
Chro.40195 1503 AAELO 1000502 2343 3596 B Histone-fold;
P-loop containing nucleotide triphosphate
Chro.40196 1504 AAELO 1000502 3622 4515 ATPases of the AAA+ class hydrolases;
Chro.40199 1505 AAELO 1000552 105 275 hypothetical protein
Chro.40200 15-6 AAEL01000552 526 1875 hypothetical protein
Chro.40201 1507 AAELO 1000552 2167 2895 . •
Table 1
Ch_Gene SEQ ED NO. Ch Accession Start End Description Superfamily
Chro.40202 1508 AAEL01000432 5 1255 hypothetical protein RING finger domain, C3HC4;
Chro.40203 1509 AAELO 1000432 1496 2209 hypothetical protein
Chro.40204 1510 AAEL01000432 2541 3188 .
Chro.40205 1511 AAEL01000466 40 963 hypothetical protein dynein light chain Tctexl - Chlamydomonas reinhardtiiDgi|3170164|gb|AAC18035.1|
Chro.40206 1512 AAEL01000466 1260 11771155 dynein light chain Tctexl
P-loop containing nucleotide triphosphate
Chro.40207 1513 AAEL01000466 1972 4464 CG8611-PB hydrolases; hypothetical protein CO85Oc - malaria
Chro.40208 1514 AAEL01000261 110 1999 parasite (Plasmodium falciparum) DNase I-like;
Chro.40209 1515 AAEL01000261 2222 4213
Chro.40210 1516 AAEL01000261 4328 4996
Chro.40211 1517 AAEL01000261 5115 5321
Plasmodium falciparum asparagine-rich
Chro.40212 1518 AAEL01000261 8114 9154 protein
Chro.40213 1519 AAEL01000261 9572 10222
Chro.40214 1520 AAEL01000039 27959 29275 AMP deaminase homolog Metallo-dependent hydrolases;
Chro.40215 1521 AAEL01000039 26432 26863
Chro.40216 1522 AAELO 1000039 24730 26175 expressed protein alpha/beta-Hydrolases;
Chro.40217 1523 AAEL01000039 21858 24209 hypothetical protein DNase I-like;
Chro.40218 1524 AAEL01000039 20078 21145 origin recognition complex protein
Chro.40219 1525 AAEL01000039 18990 19442 putative nucleoside diphosphate kinase Nucleoside diphosphate kinases;
Chro.40220 1526 AAEL01000039 18181 18900 expressed protein Ribosomal protein S5 domain 2-like; Molybdenum cofactor biosynthesis protein
Chro.40221 1527 AAEL01000039 16993 18066 MoeB;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.40222 1528 AAEL01000039 15788 16474 .
Chro.40223 1529 AAELOl 000039 14569 15648 plant adhesion molecule 1 -related Ypt/Rab-GAP domain of gyp Ip;
Chro.40224 1530 AAEL01000039 12869 14350 NNP-1/Nop52, novel nuclear protein 1
Chro.40225 7 AAEL01000039 10793 12259 CP15/60 similar to unknown protein; protein id: At3g22590.1, supported by cDNA:
Chro.40226 1531 AAELO 1000039 8909 10342 gi_17529301
Chro.40227 1532 AAEL01000039 6833 8827 hypothetical protein MG03859.4 WD40-repeat;
Chro.40228 1533 AAEL01000039 4868 5149 .
Chro.40229 1534 AAEL01000039 3937 4173 .
Chro.40230 1535 AAEL01000039 893 3712 235 kDa rhoptry protein C2H2 and C2HC zinc fingers;
Chro.40231 1536 AAEL01000090 2 307 .
Chro.40232 1537 AAEL01000090 564 1877 . Cyclin-like;
OO Chro.40233 1538 AAELO 1000090 1942 2967 unnamed protein product Zn2/Cys6 DNA-binding domain;
Chro.40234 1539 AAELO 1000090 3341 5089 hypothetical protein SET domain;
Chro.40235 1540 AAELO 1000090 5785 6048 .
n-acetylglucosaminyl-phosphatidylinositol UDP-Glycosyltransferase/glycogen
Chro.40236 1541 AAELO 1000090 6497 7831 biosynthetic protein, putative phosphorylase; Chro.40237 1542 AAELO 1000090 7937 8218 . Chro.40238 1543 AAEL01000090 8384 8623 .
Cysteine proteinases; Dipeptidyl peptidase
Chro.40239 1544 AAEL01000090 8859 10766 preprocathepsin c precursor, putative I (cathepsin C), exclusion domain; Chro.40240 1545 AAEL01000090 11516 12997 . PX domain; Chro.40241 1546 AAEL01000090 13090 14118 hypothetical protein Yp1/Rab-GAP domain of gyp Ip; Chro.40243 1547 AAEL01000090 14429 15595 .
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.40244 1548 AAEL01000090 15677 17860 . similar to Ribonuclease HI large subunit
Chro.40245 1549 AAELO 1000090 18305 18739 (RNase HI large subunit) Ribonuclease H-like;
Chro.40246 1550 AAEL01000090 19063 19308 ribonuclease Hl large subunit, putative Ribonuclease H-like;
Chro.40247 1551 AAEL01000090 19758 21128 .
Chro.40248 1552 AAEL01000785 121 1965 hypothetical protein
Chro.40249 1553 AAEL01000337 273 1925 aspartyl protease-like Acid proteases;
P-loop containing nucleotide triphosphate
Chro.40250 1554 AAEL01000337 2149 5859 SMC2 protein hydrolases;
Chro.40251 1555 AAEL01000337 6037 6354 .
Chro.40252 1556 AAEL01000018 39141 39389 .
Chro.40253 1557 AAEL01000018 38706 39098 apoptosis-related protein Hypothetical protein MTHl 615;
Chro.40254 1558 AAELO 1000018 36553 38208 hypothetical protein
Chro.40255 1559 AAEL01000018 32523 36488 .
Chro.40256 1560 AAEL01000018 31305 32231 ENSANGP00000013327
Chro.40257 1561 AAEL01000018 29466 30398 ribosomal P protein
Chro.40258 1562 AAEL01000018 27871 29013 ENSANGP00000010899 NAD(P)-binding Rossmann-fold domains;
Chro.40259 1563 AAEL01000018 27049 27810 .
Molybdenum cofactor biosynthesis protein
Chro.40260 1564 AAEL01000018 22597 25785 ubiquitin-activating enzyme el, putative MoeB;
Chro.40261 1565 AAELO 1000018 21765 22451 .
Chro.40262 1566 AAELO 1000018 18754 21243 Arabidopsis thaliana At3gl8860/MCB22_3 WD40-repeat;
Chro.40263 1567 AAEL01000018 18401 18715 .
Chro.40264 1568 AAEL01000018 17820 18269 .
Chro.40265 1569 AAEL01000018 16302 17339 .
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Required with RAD23 for duplication of Chro.40266 1570 AAEL01000018 14565 15629 the spindle pole body; Dsk2p Ubiquitin-like; UBA-like; Class π aaRS and biotin synthetases;
Chro.40267 1571 AAEL01000018 12806 14404 Kars protein Nucleic acid-binding proteins;
Chro.40268 1572 AAEL01000018 10019 12739 . ARM repeat;
Drosophila melanogaster CGl 1926 gei
Chro.40269 1573 AAEL01000018 8461 9876 product, putative
Chro.40270 1574 AAEL01000018 5417 7846 putative vacuolar sorting protein 35
Chro.40271 1575 AAEL01000018 2404 4332 .
Chain A, 4ank: A Designed Ankyrin
Repeat Protein With Four Identical Ankyrin repeat; Complement control
Chro.40272 1576 AAEL01000018 531 2330 Consensus Repeats module/SCR domain;
O Chro.40273 1577 AAEL01000849 695 1618 .
Chro.40274 1578 AAEL01000533 2619 3206 .
Chro.40275 1579 AAEL01000533 2052 2561 similar to RIKEN cDNA 2810055C19
Chro.40276 1580 AAEL01000533 1113 2012 .
Chro.40277 1581 AAEL01000533 162 968 .
Chro.40278 1582 AAEL01000617 1227 1829 .
Chro.40279 1583 AAEL01000617 154 867 .
Chro.40280 1584 AAELOlOOl 193 472 888 .
Chro.40281 1585 AAEL01000058 25053 25874 .
Chro.40282 1586 AAEL01000058 23694 24515 .
Chro.40283 1587 AAEL01000058 22629 23321 .
26S proteasome AAA-ATPase subunit P-loop containing nucleotide triphosphate
Chro.40284 1588 AAEL01000058 20709 21914 RPT3 hydrolases;
Chro.40285 1589 AAEL01000058 19643 20704 putative farnesyl pyrophosphate synthε
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.40286 1590 AAELO 1000058 19172 19393 .
Phosphatidylinositol-specific phospholipase C (PI-PLC); EF-hand; C2 domain (Calcium/lipid-binding domain,
Chro.40288 1591 AAEL01000058 15344 17992 Similar to phospholipase C, delta CaLB); PH domain-like;
Chro.40289 1592 AAEL01000058 13367 14863 Involved in Processing ITS2; YnIl 82cp WD40-repeat;
Chro.40290 1593 AAELO 1000058 10618 13062 Similar to RIKEN cDNA C130070J12 gene PH domain-like; glycerophosphodiester phosphodiesterase - Phosphatidylinositol-specific
Chro.40291 1594 AAEL01000058 9555 10601 related phospholipase C (PI-PLC);
Chro.40292 1595 AAELO 1000058 8335 9372 UDP-glucose 4-epimerase NAD(P)-binding Rossmann-fold domains;
Chro.40293 1596 AAEL01000058 7374 8057 hypothetical protein
Chro.40294 1597 AAELO 1000058 6373 7347 .
Chro.40295 1598 AAEL01000058 5527 6000 .
Chro.40296 1599 AAELO 1000058 4753 5127 .
Chro.40297 1600 AAEL01000058 2767 4647 . Nucleic acid-binding proteins;
Chro.40298 1601 AAEL01000058 1654 2484 Similar to hypothetical protein MGC13096 .
Chro.40299 1602 AAEL01000058 227 1288 .
Chro.40300 1603 AAEL01000885 475 1521 . ataxia telangiectasia and Rad3-related
Chro.40301 1604 AAEL01000295 3151 6834 protein Protein kinase-like (PK-like);
N-methyl-D-aspartate receptor-associated
Chro.40302 1605 AAELO 1000295 6872 7621 protein CG3798-PC
Chro.40303 1606 AAELO 1000295 7860 9059 .
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Nitric-oxide synthase
(NOS)Dgi 7522082|pir||T31331 nitric- oxide synthase (EC 1.14.13.39) -
Anopheles Ferredoxin reductase-like, C-terminal stephensiDgi|3790537|gb[AAC68577.1| NADP-linked domain; Flavoproteins;
Chro.40304 1607 AAEL01000078 2719 4674 nitric oxide synthase Riboflavin synthase domain-like;
Chro.40305 1608 AAEL01000078 4931 5164 ENSANGP00000016613 Sm-like ribonucleoproteins;
ATPase homolog - Cryptosporidium parvumDgi|1513210|gb|AAC47833.1| P- Calcium ATPase, transmembrane domain
Chro.40306 1609 AAELO 1000078 5341 9927 ATPase M; HAD-like; interaptin - slime mold (Dictyostelium discoideum) D gi|3549261 |gb|AAC34582.1
S Chro.40307 1610 AAEL01000078 10278 13238 interaptin Winged helix DNA-binding domain;
Chro.40308 1611 AAELO 1000078 13262 14128 putative U3 snoRNP protein MP4
Chro.40309 1612 AAELO 1000078 14256 15545 hypothetical protein WD40-repeat;
Chro.40310 1613 AAELO 1000078 15849 16049 .
Chro.40312 1614 AAELO 1000078 16260 17933 .
Chaperone J-domain; HSP40/DnaJ peptide-
Chro.40313 1615 AAEL01000078 17940 19022 DNAJ domain protein, putative binding domain;
Chro.40314 1616 AAELO 1000078 19280 20566 ethanolaminephosphotransferase, putative
Chro.40315 1617 AAEL01000078 20815 21951 hypothetical protein
Chro.40316 1618 AAEL01000360 4288 7599 .
Chro.40317 1619 AAEL01000360 2954 3946 . ribosome biogenesis protein nepl
Chro.40319 1620 AAEL01000360 954 1487 homologue, putative
Chro.40320 1621 AAEL01000368 175 981 .
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.40321 1622 AAELO 1000368 1086 1817 .
Tubulin, GTPase domain; Tubulin, C-
Chro.40322 1623 AAEL01000368 2078 3442 alpha-tubulin terminal domain;
Chro.40323 1624 AAEL01000368 3525 5042 facilitative hexose transporter
Chro.40324 1625 AAEL01000368 5055 6365 chromosome assembly protein homolog
Chro.40325 1626 AAEL01000281 8629 9546 hypothetical protein
Thiolase-like; GroES-like; NAD(P)-
Chro.40326 1627 AAEL01000379 1661 7048 polyketide synthase binding Rossmann-fold domains; ACP-like;
Chro.40327 1628 AAEL01000695 1859 2473 polyketide synthase
Chro.40328 1629 AAEL01001228 56 715 polyketide synthase Thiolase-like;
Chro.40329 1630 AAELO 1000680 1058 1855 polyketide synthase
Ul
W
Thiolase-like; FabD/lysophospholipase- like; NAD(P)-binding Rossmann-fold domains; GroES-like; NAD(P)-binding Rossmann-fold domains; NAD(P)-binding Rossmann-fold domains; NAD(P)-binding
Chro.40330 1632 AAELO 1000182 Rossmann-fold domains; ACP-like; Creatinase/aminopeptidase;
Chro.40331 1632 AAEL01000182 10620 12671 aminopeptidase Creatinase/prolidase N-terminal domain;
Chro.40332 1633 AAELO 1000182 12685 13770 .
Chro.40333 1634 AAEL01000002 86164 86574 .
Chro.40334 1635 AAEL01000002 83793 85838 putative Vps52 / Sac2 family protein
Similar to RIKEN cDNA 2610100K07
Chro.40335 1636 AAELO 1000002 82977 83297 gene TPR-like;
Chro.40336 1637 AAEL01000002 81024 82091 .
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.40337 1638 AAEL01000002 80343 81020 repair endonuclease (gb|AAF01274.1) RuvA domain 2-like;
Chro.40338 1639 AAELO 1000002 77974 79872 UV endonuclease; Radlp
GTPase activation domain, GAP; C- terminal domain of phosphatidylinositol
Chro.40339 1640 AAEL01000002 transfer protein secl4p;
UDP-Glycosyltransferase/glycogen
Chro.40340 1641 AAELO 1000002 74102 75445 putative glycosyl transferase phosphorylase;
DEAD box polypeptide, Y chromosome- P-loop containing nucleotide triphosphate
Chro.40341 1642 AAEL01000002 71858 73966 related hydrolases;
Chro.40342 1643 AAELO 1000002 71074 71331 .
COGl 196: Chromosome segregation
Chro.40343 1644 AAELO 1000002 70227 71042 ATPases
Chro.40344 1645 AAEL01000002 68967 70121 . alpha/beta-Hydrolases;
Chro.40345 1646 AAELO 1000002 67678 68670 . alpha/beta-Hydrolases;
Chro.40346 1647 AAELO 1000002 66170 67486 NifS-like protein PLP-dependent transferases;
Chro.40347 1648 AAELO 1000002 64868 65968 . alpha/beta-Hydrolases;
Chro.40348 1649 AAEL01000002 64174 64389 .
Chro.40349 1650 AAELO 1000002 63720 64148 .
Chro.40350 1651 AAEL01000002 62769 63239 ubiquitin Ubiquitin-like;
Growth factor receptor domain;
Chro.40351 1652 AAEL01000002 EGF/Laminm;
Adenylyl and guanylyl cyclase catalytic
Chro.40352 1653 AAELO 1000002 55123 60018 Dictyostelium discoideum SgcA domain; similar to GDP-fucose transporter 1;
Chro.40354 1654 AAEL01000002 52413 54626 multispan transmembrane protein fuctl
Chro.40356 1655 AAEL01000002 50219 51808 glucosyltransferase
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily eukaryotic translation initiation factor 6-
Chro.40357 1656 AAELO 1000002 49444 50202 like protein Pentein;
Chro.40358 1657 AAELO 1000002 48304 49245 ENSANGP00000010898 WD40-repeat;
Culin homology domain; Culin repeat;
Chro.40359 1658 AAEL01000002 45593 48073 cullin 1 protein -related "Winged helix" DNA-binding domain;
Chro.40360 1659 AAELO 1000002 44024 44812 4OS ribosomal protein S3 A, putative
Chro.40361 1660 AAEL01000002 43321 43557 .
P-loop containing nucleotide triphosphate
Chro.40362 1661 AAELO 1000002 41505 42830 DEAD box protein hydrolases;
Chro.40363 1662 AAEL01000002 40627 40947 small nuclear ribonucleoprotein, putative Sm-like ribonucleoproteins;
Chro.40364 1663 AAEL01000002 39174 39470 . RBPIl -like subunits of RNA polymerase;
Ul Ul Chro.40365 1664 AAEL01000002 38250 38927 .
Chro.40366 1665 AAEL01000002 37564 37971 H3 histone, family 2; histone 2, H3cal Histone-fold;
Chro.40367 1666 AAELO 1000002 34509 36587 . Protein kinase-like (PK-like);
Chro.40368 1667 AAELO 1000002 32417 33595 ENSANGP00000011443
S-adenosyl-L-methionine-dependent
Chro.40369 1668 AAEL01000002 31826 32368 ENSANGP00000010185 methyltransferases; heat shock 105kD; heat shock 105kD Actin-like ATPase domain; Heat shock alpha; heat shock 105kD beta; heat shock protein 7OkD (HSP70), C-terminal
Chro.40370 1669 AAEL01000002 26341 28761 105kDa protein 1 substrate-binding fragment;
Glucocorticoid receptor-like (DNA-binding
Chro.40371 1670 AAEL01000002 24111 25793 . domain);
Chro.40372 1671 AAELO 1000002 20269 21816 membrane skeletal protein MCl
Chro.40373 1672 AAEL01000002 18283 19077 hypothetical protein
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Phosphoglucomutase, first 3 domains;
Chro.40374 1673 AAEL01000002 16193 18124 Hypothetical protein CBG16451 Phosphoglucomutase, C-terminal domain;
Chro.40375 1674 AAEL01000002 15464 15742 .
Chro.40376 1675 AAEL01000002 13097 15184 hypothetical protein 1-2 .
Chro.40377 1676 AAELO 1000002 10284 12152 hypothetical protein Protein kinase-like (PK-like); EF-hand;
Chro.40378 1677 AAEL01000002 6200 8425 41 Kd oocyst wall protein PH domain-like;
Chro.40379 1678 AAELO 1000002 4483 5067 . .
Chro.40380 1679 AAEL01000002 4057 4296 .
Chro.40381 1680 AAELO 1000002 3784 4002 .
Chro.40382 1681 AAEL01000002 1374 2804 Unknown (protein for MGC:76117) WD40-repeat;
Chro.40383 1682 AAEL01000002 471 1070 . .
Os Chro.40384 1683 AAEL01000002 13 258 .
Chro.40385 1684 AAELO 1000107 241 4221 hypothetical protein BEACH domain; PH domain-like;
Chro.40386 1685 AAELO 1000107 5854 6939 long chain fatty acid synthetase Firefly luciferase-like;
Chro.40387 1686 AAEL01000107 9257 11968 RNA binding protein, putative RNA-binding domain, RBD;
Chro.40389 1687 AAEL01000107 13132 15999 ENSANGP00000011444
Chro.40390 1688 AAEL01000107 17505 18863 . .
Chro.40391 1689 AAELO 1000315 8116 8691 repeat organellar protein-related Prefoldin;
Chro.40392 1690 AAEL01000315 2181 4568 .
Chro.40393 1691 AAEL01000315 4 1011 .
Chro.40394 1692 AAEL01001267 666 757 .
Chro.40395 1693 AAEL01000198 8727 10967 .
Chro.40396 1694 AAEL01000198 11526 12845 .
Chro.40397 1695 AAEL01000812 400 1503 .
Chro.40398 1696 AAEL01000812 22 267 .
Chro.40399 1697 AAELO 1001024 10 618 .
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superf amity
Chro.40400 1698 AAEL01000089 591 1007 .
Chro.40401 1699 AAEL01000089 1068 1691 .
Chro.40402 1700 AAEL01000089 1924 4968 .
Chro.40403 1701 AAEL01000089 11451 11933 . t-snare proteins;
Chro.40404 1702 AAELO 1000089 12985 13707 hypothetical protein hypothetical protein T13C2.5
Chro.40405 1703 AAEL01000089 14447 18346 Caenorhabditis elegans Ovomucoid/PCI- 1 like inhibitors;
Chro.40407 1704 AAELO 1000089 19482 21071 .
Chro.40408 1705 AAELO 1000476 3884 4816 .
Chro.40409 1706 AAELO 1000476 561 3224 . Protein kinase-like (PK-like);
Chro.40410 1707 AAELO 1000604 30 2531 .
^ Chro.40411 1708 AAELO 1000604 2863 3198 .
-1 Chro.40412 1709 AAELO 1000216 3004 4749 .
Chro.40414 1710 AAEL01000216 5348 5683 immunodominant antigen Cμ
Chro.40415 1711 AAEL01000216 6883 10011 .
Chro.40416 1712 AAEL01001219 5 283 .
Chro.40417 1713 AAEL01000697 1481 1981 .
Chro.40418 1714 AAEL01000436 175 1131 .
Chro.40419 1715 AAEL01000436 3418 3792 .
Chro.40420 1716 AAEL01000436 4403 5263 .
Chro.40421 1717 AAEL01000206 1625 4414 .
Chro.40422 1718 AAEL01000206 5883 6650 .
Serine/threonine protein kinase mphl Dgi|l 1359342|pir||T43539 spindle
Chro.40423 1719 AAEL01000206 6993 10229 checkpoint protein kinase Mpsl homolog Protein kinase-like (PK-like);
Chro.40424 1720 AAEL01000206 11299 12660 .
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.40425 1721 AAELO 1000508 2797 2907 .
Chro.40427 1722 AAELO 1000508 2116 2532 hypothetical protein
S-adenosyl-L-methionine-dependent
Chro.40428 1723 AAEL01000508 956 1720 unknown protein methyltransferases;
Chro.40429 17224 AAEL01000307 7313 8812 . eukaryotic translation initiation factor 3
Chro.40430 1725 AAEL01000307 1845 4973 subunit 8
Chro.40431 1726 AAEL01000307 1277 1645 .
Chro.40432 1727 AAEL01000463 4713 5045 .
S-adenosyl-L-methionine-dependent
Chro.40433 1728 AAEL01000463 3219 4328 expressed protein methyltransferases; transcription initiation factor iie, alpha
∞ Chro.40434 1729 AAELO 1000463 1227 2738 subunit, putative Winged helix DNA-binding domain;
Chro.40435 1730 AAELO 1000463 116 1150 .
Chro.40436 1731 AAEL01000349 2658 5081 ankyrin-related protein, possible Ankyrin repeat;
Chro.40437 1732 AAELO 1000784 1526 1909 .
Chro.40438 1733 AAEL01001053 537 1043 .
GroEL equatorial domain-like chaperone
Chro.40439 1734 AAELO 1000594 604 2277 CCT chaperonin gamma subunit equatorial domain;
GroEL equatorial domain-like chaperone
Chro.40440 1735 AAEL01000666 642 2315 T-complex protein 1 equatorial domain;
Chro.40441 1736 AAEL01000966 113 1054 .
Chro.40442 1737 AAEL01001057 55 1080 .
Chro.40443 1738 AAEL01000825 157 429 .
Nuclejc acid-binding proteins; Glutathione
Chro.40444 1739 AAEL01000825 474 1673 similar to tyrosvl-tRNA synthetase S-transferase (GST), C-terminal domain;
Table 1
Ch_Gene SEQ BD NO. Ch_Accession Start End Description Superfamily
Chro.40445 1740 AAEL01000536 373 1080 . .
Chro.40446 1741 AAEL01000536 1087 2058 hypothetical protein Ypt/Rab-GAP domain of gyp Ip;
Chro.40447 1742 AAEL01000536 2432 2644 .
Chro.40448 1743 AAELO 1000702 709 1722 .
Putative exosome complex exonuclease
Chro.40450 1744 AAEL01000783 551 883 RRP41 Ribosomal protein S5 domain 2-like;
Chro.40451 1745 AAEL01000783 1110 1490 .
Chro.40452 1746 AAEL01000324 563 3790 PSMDl protein ARM repeat;
Chro.40453 1747 AAELO 1000324 4343 4816 .
Chro.40454 1748 AAEL01000324 5339 7909 .
Chro.40455 1749 AAEL01001332 0 663 asparagine-rich protein
^^ Chro.40458 1750 AAEL01000447 3014 5407 Vacuolar protein sorting 11 RING finger domain, C3HC4;
Ul
<o Ribosomal protein S5 domain 2-like;
Chro.40460 1751 AAELO 1000447 1143 1673 ribosomal protein S5 dsRNA-binding domain-like;
Chro.40461 1752 AAEL01000447 2 310 p47 protein isoform a Ubiquitin-like;
P-loop containing nucleotide triphosphate
Chro.40462 1753 AAELO 1000481 3559 4800 putative GTPase hydrolases;
Chro.40463 1754 AAEL01000481 1918 2562 RIKEN cDNA 1200003006
Chro.40464 1755 AAEL01001009 0 1056 Krueppel-like protein .
FAD/NAD(P)-binding domain; FAD-
Chro.40465 1756 AAELO 1000968 1 1077 rabGDI protein linked reductases, C-terminal domain;
Chro.40468 1757 AAEL01000722 664 1629 hypothetical protein, conserved Prefoldin;
Chro.40469 1758 AAEL01000805 240 1862 hypothetical protein Caspase-like;
Chro.40470 1759 AAEL01001276 166 555 . .
Cysteine rich protein B (HcpB); Cysteine
Chro.40471 1760 AAELO 1000776 0 1769 hypothetical protein rich protein B (HcpB);
Chro.40472 1761 AAEL01000932 44 256 GLP 162 33604 32963 Maf/Haml;
Table 1
Ch_Gene SEQ ED NO. Ch Accession Start End Description Superfamily
Chro.40476 1762 AAEL01001278 0 663 .
Chro.40479 1763 AAELO 1000480 21 1100 hypothetical protein TPR-like;
Chro.40480 1764 AAELO 1000480 1588 3939 .
Chro.40481 1765 AAELO 1000480 4112 4870 .
Chro.40482 1766 AAEL01001073 49 717 HeID protein-related
Chro.40483 1767 AAELO 1000757 354 1928 .
Chro.40484 1768 AAELO 1000566 1613 2170 . ARM repeat;
Chro.40485 1769 AAEL01000566 2363 2983 .
Chro.40486 1770 AAELOlOOl 141 424 939 .
Chro.40487 1771 AAEL01000449 639 1574 .
Chro.40488 1772 AAELO 1000449 2886 4577 hypothetical protein
Adapter-related protein complex 1 beta 1 subunit (Beta-adaptin 1) (Adaptor protein complex AP-I beta-1 subunit) (Golgi adaptor HAl/APl adaptin beta subunit) (Clathrin assembly protein complex 1 beta large chain) D gi|2119251 |pir| [154360 beta adaptin - humanQgi|520828|gb|AAC98702.1| beta-
Chro.40489 1773 AAEL01000675 115 1911 prime-adaptin ARM repeat;
Chro.40490 1774 AAEL01000417 961 2352 asparagine-rich protein RING finger domain, C3HC4;
Origin recognition complex subunit P-loop containing nucleotide triphosphate
Chro.40491 1775 AAEL01000417 3853 4947 1 Dgi|l 113099|gb|AAC49130.1| KlORCl hydrolases;
Chro.40492 1776 AAEL01000135 237 1979 .
Chro.40493 1777 AAEL01000135 3457 4533 diacylglycerol kinase variant A
Table 1
Ch_Gene S 5 SEEQQ I IDD N NOC ).. C Chh__AAcccceessssiioonn Start End Description Superfamily
Chro.40494 1778 AAEL01000135 7273 7668 . Bet vl -like;
Chro.40495 1779 AAEL01000135 8040 10016 hypothetical protein RING finger domain, C3HC4;
Chro.40496 1780 AAEL01000135 11550 12782 .
Chro.40497 1781 AAEL01000135 13468 14160 .
Chro.40498 1782 AAEL01000135 14239 15057 .
Chro.40499 1783 AAEL01000135 15977 16084 .
FYVE/PHD zinc finger; RING finger
Chro.40500 1784 AAELO 1000486 561 3362 similar to KIAA1542 protein domain, C3HC4;
Chro.40501 1785 AAEL01000486 3885 4349 .
Chro.40502 1786 AAELO 1000486 4658 4821 .
Chro.40503 1787 AAEL01000855 344 1483 ATP-binding cassette protein 2
P-loop containing nucleotide triphosphate
Chro.40504 1788 AAEL01000355 50 940 putative ABC transporter hydrolases;
Chro.40505 1789 AAEL01000355 1282 2964 hypothetical protein AN4477.2
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chain A, Crystal Structure Of Dhfr-Ts From Cryptosporidium Hominisϋgi|39654757|pdb|lQZF|B Chain
B, Crystal Structure Of Dhfr-Ts From Cryptosporidium HominisDgi|39654758|pdb|lQZF|C Chain
C, Crystal Structure Of Dhfr-Ts From Cryptosporidium HominisDgi|39654759|pdb|lQZF|D Chain
D, Crystal Structure Of Dhfr-Ts From Cryptosporidium
Hominis ϋ gi|39654760|pdb| 1 QZF|E Chain
E, Crystal Structure Of Dhfr-Ts From Cryptosporidium
HominisDgi|1480451|gb|AAC47230.1| Thymidylate synthase/dCMP bifunctional dihydrofolate reductase- hydroxymethylase; Dihydrofolate
Chro.40506 1790 AAEL01000355 3431 4996 thymidylate synthase reductases;
Chro.40507 1791 AAEL01000355 6292 7356
Chro.40508 1792 AAELO 1000196 315 1346
Chro.40510 1793 AAEL01000196 3780 5174
Chro.40511 1794 AAEL01000196 7562 8452
Chro.41000 1795 AAEL01000281 2 8212 Cryptosporidium polyketide synthase
Chro.41001 1796 AAEL01001278 2 664 hypothetical protein cgd4_4180 possible tRNA-INTRON
Chro.41002 1797 AAEL01000629 2836 3108 ENDONUCLEASE
Chro.41003 1798 AAELO 1000508 2807 2905
Chro.41004 1799 AAELO 1000720 2266 2314
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.41005 1800 AAEL01001240 2 59 .
Chro.41006 1801 AAEL01000633 1099 1443 .
Chro.41007 1802 AAEL01001278 397 740 .
Chro.41008 1803 AAEL01000904 1 43 .
Chro.50010 1804 AAEL01000267 1661 3742 .
Chro.50011 1805 AAEL01000413 1798 3267 .
Chro.50012 1806 AAELO 1000670 3 1166 .
Chro.50013 1807 AAEL01000670 1822 2664 sbmA sensitivity to microcin B 17, possibly
Chro.50014 1808 AAEL01000042 27175 28197 envelop protein
Chro.50015 1809 AAEL01000042 22152 26624 .
S-adenosyl-L-methionine-dependent
G\ W Chro.50016 1810 AAEL01000042 19309 21543 FLJ20303 protein methyltransferases;
Chro.50017 1811 AAEL01000042 18390 19127 glycolipid transfer protein, putative
Chro.50018 1812 AAELO 1000042 16150 18090 transcription factor IHb subunit, putative Cyclin-like; Zinc beta-ribbon; protein with DNAJ domain, dnj 1/sisl
Chro.50019 1813 AAELO 1000042 14510 15040 family Chaperone J-domain;
Chro.50020 1814 AAELO 1000042 13877 14218 chaperone, putative Chaperone J-domain;
Head domain of nucleotide exchangf
GrpE; DsrC, the gamma subunit of
Chro.50021 1815 AAEL01000042 13012 13716 co-chaperone GrpE, putative dissimilatory sulfite reductase;
Chro.50022 1816 AAEL01000042 10988 12430 hypothetical protein MG01634.4
Chro.50023 1817 AAEL01000042 9808 10701 .
Thioesterase/thiol ester dehydrase-
Chro.50024 1818 AAEL01000042 8247 8873 . isomerase;
Chro.50025 1819 AAELO 1000042 . 6658 7629 blr4459
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Metallo-dependent phosphatases; 5'- nucleotidase (syn. UDP-sugar hydrolase),
Chro.50026 1820 AAEL01000042 4364 6496 RIKEN cDNA 4933425L06 C-terminal domain;
Chro.50027 1821 AAELO 1000042 3187 3777 hypothetical protein MG02660.4
Chro.50028 1822 AAELO 1000042 984 2255 CG3061-PA Chaperone I-domain; TPR-like;
TSPl domain-containing protein TSP2
Chro.50029 1823 AAELO 1000042 317 682 precursor .
Chro.50030 1824 AAEL01000155 11378 12865 hypothetical protein mitochondrial processing peptidase beta
Chro.50031 1825 AAEL01000155 13753 14880 subunit LuxS/MPP-like metallohydrolase;
Chro.50032 1826 AAEL01000155 14956 15228 . LuxS/MPP-like metallohydrolase;
Chro.50033 1827 AAEL01000931 187 789 .
Chro.50034 1828 AAEL01000564 1732 3609 . Ovomucoid/PCI- 1 like inhibitors;
Chro.50035 1829 AAEL01000564 298 747 .
Chro.50036 1830 AAEL01000328 105 1220 .
P-loop containing nucleotide triphosphate
Chro.50037 1831 AAEL01000328 1713 2375 type 2 adenylate kinase hydrolases;
20k cyclophilin - Toxoplasma gondii
(fragment)Dgi|436959|gb|AAA17998.1| 20
Chro.50038 1832 AAEL01000328 2824 3327 kDa cyclophilin precursor Cyclophilin (peptidylprolyl isomerase);
Chro.50039 1833 AAELO 1000328 4265 5452 ATP synthase (C/AC39) subunit, putative similar to XM_028438 CGI-101 protein in
Chro.50040 1834 AAEL01000328 5909 6541 Homo sapiens
Chro.50041 1835 AAELO 1000328 6975 7298 .
Chro.50042 1836 AAEL01000328 7480 8280 . WD40-repeat;
Chro.50043 1837 AAEL01000350 899 7114 hypothetical protein FYVE/PHD zinc finger;
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.50045 1838 AAEL01000643 98 508 .
RNA recognition motif (RRM)-containing
Chro.50046 1839 AAELO 1000643 1617 2225 I RNA-binding domain, RBD;
Chro.50047 1840 AAEL01000450 113 355 . Nucleotide-diphospho-sugar transferases;
Chro.50048 1841 AAEL01000450 1018 1998 .
Fe5Mn superoxide dismutase (SOD), C- terminal domain; Fe,Mn superoxide
Chro.50049 1842 AAELO 1000450 2938 3603 £ dismutase (SOD), N-terminal domain;
N-terminal nucleophile aminohydrolases (Nm hydrolases); N-terminal nucleophile
Ά Chro.50050 1843 AAEL01000450 4053 4892 beta 7 subunit of 20S proteasome aminohydrolases (Ntn hydrolases);
Chro.50051 1844 AAEL01000715 1175 2275 .
Chro.50052 1845 AAEL01000701 288 2339 long-chain fatty acid CoA ligase, putative Firefly luciferase-like;
Chro.50053 1846 AAELO 1000266 8465 9469 .
Chro.50054 1847 AAEL01000266 6966 8300 hypothetical protein Protein kinase-like (PK-like);
Chro.50055 1848 AAEL01000266 6182 6529 histone H2B Histone-fold;
ACTINDgi|323089|pir||A45634 actin - Cryptosporidium
Chro.50056 1849 AAEL01000266 3503 4633 parvumDgi|156695|gb|AAA28295.1| actin Actin-like ATPase domain;
(Trans)glycosidases; alpha-Amylases, C-
Chro.50057 1850 AAEL01000156 13791 14840 putative glycan synthetase terminal beta-sheet domain;
Chro.50058 1851 AAELO 1000156 5154 7406 .
Chro.50059 1852 AAEL01001335 95 301 .
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.50060 1853 AAEL01000435 4835 5200 .
Chro.50061 1854 AAEL01000435 3623 4807 .
P-loop containing nucleotide triphosphate
Chro.50062 1855 AAEL01000435 22 2451 hypothetical protein hydrolases;
Chro.50063 1856 AAEL01000538 128 1552 . Culin repeat;
Chro.50064 1857 AAEL01000538 2339 2824 N-acetyltransferase, putative Acyl-CoA N-acyltransferases (Nat);
Chro.50065 1858 AAEL01000538 3074 3331 .
Chro.50066 1859 AAEL01000538 3438 3950 . .
Chro.50067 1860 AAEL01000214 10449 12170 slr8023 alpha/beta-Hydrolases;
Chro.50068 1861 AAEL01000214 8996 9928 .
Chro.50069 1862 AAEL01000214 7844 8464 hypothetical protein
4OS ribosomal protein S7 homologue,
» Chro.50070 1863 AAEL01000214 6251 6853 putative
Chro.50071 1864 AAEL01000214 5789 6130 .
Chro.50072 1865 AAELO 1000214 2858 5371 hypothetical protein
Chro.50073 1866 AAEL01000214 334 2454 . similar to Protein required for cell viability;
Chro.50074 1867 AAELO 1000661 7 1602 YjlOlOcp
Chro.50075 1868 AAEL01000661 1838 2683 Hypothetical protein CBG07909
P-loop containing nucleotide triphosphate
Chro.50077 1869 AAEL01000608 2541 2756 unnamed protein product hydrolases;
Chro.50078 1870 AAELO 1000795 340 666 . C2H2 and C2HC zinc fingers;
Chro.50079 1871 AAEL01000795 692 1480 . SMALVFHA domain;
Chro.50080 1872 AAELO 1000809 0 1436 .
Chro.50081 1873 AAEL01000840 33 446 .
(Trans)glycosidases; alpha-Amylases, C-
Chro.50082 1874 AAELO 1000292 7232 7882 Possible maltodextrin εlucosidase terminal beta-sheet domain:
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Protein serine/threonine phosphatase 2C,
Chro.50083 1875 AAEL01000292 5614 6900 hypothetical protein catalytic domain;
Chro.50084 1876 AAEL01000292 3857 4897 . pre-mRNA cleavage complex ii protein P-loop containing nucleotide triphosphate
Chro.50085 1877 AAELO 1000292 1292 3115 clpl-related hydrolases;
Chro.50086 1878 AAEL01000292 40 1110 D13
Chro.50087 1879 AAEL01000829 674 916 .
Chro.50088 1880 AAELOlOOl 148 35 835 .
Chro.50089 1881 AAEL01000458 862 2868 . Spectrin repeat;
Chro.50090 1882 AAEL01000458 2852 3310 .
Chro.50091 1883 AAEL01000458 4893 5147 .
Chro.50092 1884 AAELO 1000464 78 2396 .
Chro.50093 1885 AAELO 1000464 3475 3993 .
Chro.50094 1886 AAEL01000464 4360 4938 hypothetical protein Cysteine proteinases;
Chro.50095 1887 AAEL01000213 11175 11579 actin depolymerizing factor -related Actin depolymerizing proteins;
P-loop containing nucleotide triphosphate
Chro.50096 1888 AAELO 1000213 8494 10104 AAA family ATPase, putative hydrolases;
Chro.50097 1889 AAELO 1000213 7626 8012 ribosomal protein SlO
P-loop containing nucleotide triphosphate
Chro.50098 1890 AAEL01000213 6447 7232 ADP-ribosylation factor, putative hydrolases;
Chro.50100 1891 AAELO 1000213 4553 5443 .
Chro.50101 1892 AAEL01000213 1213 3771 .
Chro.50102 1893 AAEL01000780 1 1113 .
Chro.50103 1894 AAEL01000987 17 1018 .
Chro.50104 1895 AAEL01001360 144 359 .
Chro.50105 1896 AAEL01000601 287 3190 .
Chro.50106 1897 AAEL01000032 32498 33220 .
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.50107 1898 AAELO 1000032 31184 32182 .
Chro.50108 1899 AAEL01000032 28518 30455 .
Chro.50109 1900 AAELO 1000032 26148 27947 . .
Chro.50110 1901 AAEL01000032 22479 23543 ENSANGP00000000281 GroES-like;
Chro.50111 1902 AAEL01000032 18271 22089 . LuxS/MPP-like metallohydrolase;
Chro.50112 1903 AAEL01000032 14151 16379 .
Chro.50113 1904 AAELO 1000032 12208 13011 similar to RIKEN cDNA 1500016H10 Ribosomal protein L30p/L7e;
Chro.50114 1905 AAEL01000032 9620 11599 hypothetical protein ARM repeat; similar to Bifidobacterium longum
NCC2705. Hypothetical protein possibly in
Chro.50115 1906 AAELO 1000032 8305 9399 the phosphoglycerate mutase family Phosphoglycerate mutase-like;
C\ Zn-dependent exopeptidases; Leucine
OO aminopeptidase (Aminopeptidase A), N-
Chro.50116 1907 AAEL01000032 6014 7588 leucine aminopeptidase, putative terminal domain;
Chro.50118 1908 AAEL01000032 3902 4990 dolichyl phosphate glucosyltransferase Nucleotide-diphospho-sugar transferases;
Chro.50119 1909 AAELO 1000032 2848 3090 .
Chro.50120 1910 AAELO 1000032 2255 2656 .
Chro.50121 1911 AAEL01000032 408 1514 .
ATPase domain of HSP90 chaperone/DNA topoisomerase π/histidine kinase;
Chro.50122 1912 AAEL01000070 4 1332 Unknown (protein for MGC:66301) Ribosomal protein S5 domain 2-like;
Chro.50123 1913 AAEL01000070 2085 2774 ubiquitin B Ubiquitin-like;
Chro.50124 1914 AAELO 1000070 3951 7304 . WD40-repeat;
Chro.50125 1915 AAEL01000070 8112 10811 hypothetical protein
Chro.50126 1916 AAEL01000070 11538 11747 .
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.50127 1917 AAELO 1000070 12578 13462 cdc2-like protein kinase Protein kinase-like (PK-like); Chro.50128 1918 AAEL01000070 16592 19168 USP31 protein Cysteine proteinases; Chro.50129 1919 AAEL01000070 19512 20474 expressed protein Chro.50130 1920 AAELO 1000070 21222 23876 . Ubiquitin-like; F-box domain; S-adenosyl-L-methionine-dependent
Chro.50131 1921 AAEL01000314 1831 2772 similar to CG14544 gene product, putative methyltransferases; Chro.50132 1922 AAEL01000314 3204 5804 . RNA-binding domain, RBD; Chro.50133 1923 AAEL01000314 6314 8935 . Chro.50134 1924 AAEL01000605 2 2035 Unknown (protein for MGC:76275) FMN-linked oxidoreductases; Chro.50136 1925 AAEL01000275 1080 5060 .
Chro.50137 1926 AAELO 1000275 5392 7242 hypothetical protein beta-Lactamase/D-ala carboxypeptidase;
Chro.50138 1927 AAELO 1000275 7603 8571 hypothetical protein Protein kinase-like (PK-like);
Chro.50139 1928 AAELO 1000275 9012 9824 hypothetical protein
Chro.50140 1929 AAEL01000134 13925 15010 hypothetical protein Galactose-binding domain-like; acidic ribosomal protein Pl - hydromedusa
(Polyorchis penicillatus) D gi|227678|prf]j 170916OA
Chro.50141 1930 AAEL01000134 13015 13389 acidic ribosomal protein Al
Homo sapiens proteasome (prosome,
Chro.50142 1931 AAELO 1000134 12190 12903 macropain) 26S subunit, non-ATPase, 9 PDZ domain-like;
Chro.50143 1932 AAEL01000134 10325 11602 unknown protein Cysteine proteinases;
Chro.50144 1933 AAELO 1000134 9775 10041 .
Chro.50145 1934 AAELO 1000134 7937 9511 . SET domain;
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily
ARPl actin-related protein 1 homolog A, centractin alpha; ARPl (actin-related protein 1, yeast) homolog A (centractin alpha); centractin alpha; actin-RPV; centrosome-associated actin homolog;
Chro.50146 1935 AAELO 1000134 5924 7111 ARPl, yeast homolog A Actin-like ATPase domain;
Chro.50147 15 AAEL01000134 5008 5850 SPFH domain / Band 7 family, putative
Chro.50148 1936 AAEL01000134 76 3549 transcriptional regulatory - like protein Cyclin-like;
Chro.50149 1937 AAEL01000539 122 520 defender against cell death protein
Chro.50150 1938 AAEL01000539 898 2802
Similar to maternal embryonic leucine
Chro.50152 1939 AAELO 1000539 2869 3852 zipper kinase Protein kinase-like (PK-like);
-4
O Chro.50153 1940 AAEL01000747 308 865
Chro.50155 1941 AAEL01000074 31 1368 hypothetical protein N-acetylglucosamine- 1 -phosphate
Chro.50156 1942 AAELO 1000074 1948 3222 transferase, putative
Chro.50157 1943 AAEL01000074 3568 4668 transmembrane protein 17 Thioredoxin-like;
Chro.50158 1944 AAELO 1000074 5305 5685 small nuclear ribonucleoprotein smdl Sm-like ribonucleoproteins;
4OS RIBOSOMAL PROTEIN S13Dgi|419802|pir||S30146 ribosomal protein S 13, cytosolic - maizeDgi|288059|emb|CAA44311.1|
Chro.50159 1945 AAEL01000074 6146 6601 cytoplasmatic ribosomal protein S13 S15/NS1 RNA-binding domain;
Chro.50160 1946 AAELO 1000074 7454 9253 RNA-binding protein, putative RNA-binding domain, RBD;
Chro.50161 1947 AAELO 1000074 10183 11601 endonuclease G-like 1 His-Me finger endonucleases; S-adenosyl-L-methionine-dependent
Chro.50162 1948 AAELO 1000074 12287 17053 methyltransferases;
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.50163 1949 AAEL01000074 17751 18125 . Chro.50164 1950 AAEL01000074 20594 21655 hypothetical protein Chro.50165 1951 AAELO 1000316 414 1247 . Chro.50166 1952 AAEL01000316 1830 5057 Pddlp Chromo domain-like; Chro.50167 1953 AAEL01000316 5565 6353 .
Glucocorticoid receptor-like (DNA-binding
Chro.50168 1954 AAELO 1000316 6496 7242 hypothetical protein, conserved domain);
DNA methyltransferase PMTl - like S-adenosyl-L-methionine-dependent Chro.50169 1955 AAEL01000316 8151 8768 protein methyltransferases;
Chro.50170 1956 AAEL01000019 37757 39443 Arabidopsis thaliana BRAHMA ortholog . Chro.50171 1957 AAELO 1000019 31792 37203 . ARM repeat;
P-loop containing nucleotide triphosphate
Chro.50172 1958 AAEL01000019 24617 30988 DEAD/DEAH box helicase, putative hydrolases; Chro.50173 1959 AAEL01000019 21940 23790 . Chro.50174 1960 AAEL01000019 19398 21713 similar to RIKEN cDNA 5730484M20 SMALVFHA domain; dolichyl-phosphate b-D-
Chro.50175 1961 AAELO 1000019 18276 18500 mannosyltransferase, putative Nucleotide-diphospho-sugar transferases; Chro.50176 1962 AAEL01000019 17336 17941 unknown protein
Cysteine-rich secretory protein-3 precursor (CRISP-3)Dgi|2388785|emb|CAA04729.1|
Chro.50177 1963 AAEL01000019 15759 17000 cysteine-rich secretory protein-3 PR-1-like;
P-loop containing nucleotide triphosphate
Chro.50178 1964 AAEL01000019 13357 15429 AAA ATPase hydrolases; extragenic suppressor of the bimD6
Chro.50179 1965 AAELO 1000019 11125 13131 mutation-related Protein kinase-like (PK-like);
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.50180 1966 AAEL01000019 8219 10552 .
Chro.50181 1967 AAEL01000019 7428 8015 .
Chro.50182 1968 AAEL01000019 4751 7399 .
Chro.50183 1969 AAEL01000019 4059 4418 expressed protein PH domain-like;
Enolase C-terminal domain-like; Enolase N-
Chro.50184 1970 AAELO 1000019 3124 3696 enolase terminal domain-like;
Chro.50185 1971 AAEL01000019 1402 2280 .
Chro.50186 1972 AAELO 1000013 5865 6197 hypothetical protein
Chro.50187 1973 AAELO 1000013 6551 7489 -
Chro.50188 1974 AAEL01000013 7702 8328 .
Chro.50189 1975 AAEL01000013 9772 10041 . EF-hand;
P-loop containing nucleotide triphosphate
^ Chro.50190 1976 AAEL01000013 10576 11208 XPA binding protein 1, putative hydrolases;
M Chro.50191 1977 AAELO 1000013 11233 11604 .
Chro.50192 1978 AAELO 1000013 11641 12606 . Chromo domain-like;
GroEL equatorial domain-like chaperone
Chro.50193 1979 AAELO 1000013 13002 14612 chaperonin containing TCP-I de equatorial domain;
Chro.50194 1980 AAEL01000013 14734 15645 hypothetical protein
Chro.50195 1981 AAEL01000013 16594 17865 GLP_382_1054_2538
Chro.50196 1982 AAELO 1000013 18069 20081 hypothetical protein MG00894.'
Chro.50197 1983 AAEL01000013 21949 22311 hypothetical protein
Chro.50198 1984 AAEL01000013 22365 23402 zf-CCCH zinc finger protein
Chro.50199 1985 AAEL01000013 23699 23995 .
N-terminal nucleophile aminohydrolases
Chro.50200 1986 AAEL01000013 24491 25057 proteasome subunit alpha type 5 (Ntn hydrolases);
Chro.50201 1987 AAEL01000013 25260 25874 hypothetical protein
Chro.50202 1988 AAELO 1000013 26391 28523 .
Table 1
Ch_Gene I SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.50203 1989 AAELO 1000013 29120 29623 hypothetical protein
Chro.50204 1990 AAEL01000013 29958 34085 hypothetical protein, conserved
P-loop containing nucleotide triphosphate
Chro.50205 1991 AAEL01000013 34993 35550 GTPase, putative hydrolases;
Chro.50206 1992 AAEL01000013 35893 36441 small nucleolar RNP proteins; Garlp
The spindle assembly checkpoint protein
Chro.50207 1993 AAELO 1000013 36508 37665 essential protein for meiotic synapsis mad2;
Chro.50208 1994 AAELO 1000013 37944 39305 unnamed protein product
S-adenosyl-L-methionine-dependent
Chro.50209 1995 AAEL01000013 39377 40492 hypothetical protein methyltransferases;
Chro.50210 1996 AAELO 1000013 40506 40841 .
Class I glutamine amidotransferase-like; P-
Last step in pyrimidine biosynthesis loop containing nucleotide triphosphate
W Chro.50211 1997 AAEL01000013 41289 43301 pathway; Ura8p hydrolases; hypothetical protein T13J8.130 -
Arabidopsis thalianaπ gi|4455361 |emb|CAB36771.11
Chro.50212 1998 AAEL01000179 2 460 putative protein
Chro.50213 1999 AAELO 1000179 560 2206 unknown protein
Chro.50214 2000 AAEL01000179 2476 6318 ENSANGP00000021996 ARM repeat;
Chro.50215 2001 AAELO 1000179 6569 7042 .
Chro.50216 2002 AAEL01000179 7514 7786 .
Chro.50217 2003 AAELO 1000179 8478 9428 .
Drosophila melanogaster CG1349 gene
Chro.50218 2004 AAELO 1000179 9592 10149 product Class I glutamine amidotransferase-like;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Histone H3 K4-specific methyltransferase
Chro.50219 2005 AAEL01000179 10721 11650 MOKN repeat protein SET7/9 N-terminal domain;
Chro.50220 2006 AAEL01000179 11906 13552 .
Chro.50221 2007 AAEL01000550 2 2155 hypothetical protein
Chro.50222 2008 AAEL01000550 2226 3191 . eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa; eukaryotic translation initiation factor 2B, subunit 2
Chro.50223 (beta, 39kD)
Chro.50224 2009 AAEL01000353 6197 7333 .
Chro.50225 2010 AAEL01000353 5199 6116 ribosomal protein L3, putative Translation proteins;
Chro.50226 2011 AAEL01000353 4675 4899 ribosomal protein L3, putative Translation proteins;
Chro.50227 2012 AAEL01000353 3661 4302 terbinafϊne resistance locus protein YIPl
Chro.50228 2013 AAEL01000353 2903 3601.
Chro.50229 2014 AAEL01000353 2632 2838.
Chro.50230 2015 AAEL01000353 884 2275.
Chro.50231 2016 AAELO 1000353 70 801.
Chro.50232 2017 AAEL01000961 877 1212.
Chro.50233 2018 AAELO 1000054 127 1131.
Chro.50234 2019 AAEL01000054 1368 1775.
Chro.50235 2020 AAEL01000054 2354 10135.
Chro.50236 2021 AAEL01000054 10404 14105.
Chro.50237 2022 AAEL01000054 14460 15125 putative nucleoside-diphosphate kinase Nucleoside diphosphate kinases;
Chro.50238 2023 AAEL01000054 15193 17346 .
Chro.50239 2024 AAELO 1000054 17641 18789 ,
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.50240 2025 AAEL01000054 18868 23676 hypothetical protein hypothetical predicted protein, unknown
Chro.50241 2026 AAELO1000054 24667 26874 function Chro.50242 2027 AAELO1000434 4930 5562 Chro.50243 2028 AAEL01000434 3870 4886 Chro.50244 2029 AAEL01000434 3174 3860 hypothetical protein, conserved Chro.50245 2030 AAELO1000434 1578 2633 D13 Chro.50246 2031 AAEL01000434 979 1512 Chro.50247 2032 AAEL01000434 241 552 Chro.50248 2033 AAEL01000393 786 1976 similar to NC_001141 protein required for filamentous growth, cell polarity, and
-4 cellular elongation; DfglOp in
Chro.50250 2034 AAEL01000393 1973 2794 Saccharomyces cerevisiae Chro.50251 2035 AAEL01000393 2957 3721 hypothetical protein, conserved KNA-binding domain, KBD; Chro.50252 2036 AAEL01000393 3983 4924 actin-like protein Actin-like ATPase domain; Chro.50253 2037 AAEL01000393 5371 6186 hypothetical protein HSP20-like chaperones; Chro.50254 2038 AAEL01001213 0 693
Adenylyl and guanylyl cyclase catalytic
Chro.50255 2039 AAEL01000331 7684 8304 adenylate cyclase domain; Chro.50256 2040 AAEL01000331 4730 7531 hypothetical protein TPR-like; Chro.50257 2041 AAEL01000331 3599 4726 unknown protein
DHHC-type zinc finger domain-containing
Chro.50258 2042 AAEL01000331 2469 3365 protein Zn2/Cys6 DNA-binding domain; Chro.50259 2043 AAEL01000331 1 2367 P0695H10.17 Chro.50260 2044 AAEL01000606 103 2358 ENSANGP00000018078 Chro.50261 2045 AAELO1000606 2373 3125 .
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.50263 2046 AAELO 1000007 513 1160
RING finger domain, C3HC4; B-box zinc-
Chro.50264 2047 AAELO 1000007 1341 3302 binding domain;
Cnro.50265 2048 AAELO 1000007 3383 4534 2810480G15Rik protein RNA-binding domain, RBD; Prokaryotic type I DNA topoisomerase;
Chro.50266 2049 AAEL01000007 4654 5442 DNA topoisomerase iii Zn2/Cys6 DNA-binding domain;
Chro.50267 2050 AAEL01000007 5649 7145 DNA topoisomerase IH Prokaryotic type I DNA topoisomerase;
Chro.50268 2051 AAEL01000007 7226 9478 ENSANGPOOOOOO 13258 Metallo-hydrolase/oxidoreductase;
Chro.50269 2052 AAEL01000007 9587 10876 . POZ domain; TRAF domain-like;
Chro.50270 2053 AAEL01000007 11163 12323 unnamed protein product, putative cinnamyl-alcohol dehydrogenase (EC
1.1.1.195) - cider treeDgi|1143445|emb|CAA61275.1|
Chro.50271 2054 AAELO 1000007 12364 13698 cinnamyl alcohol dehydrogenase NAD(P)-binding Rossmann-fold domains;
WD-40 repeat protein family / small
Chro.50272 2055 AAELO 1000007 13943 15262 nuclear ribonucleoprotein Prp4p-rela WD40-repeat;
Chro.50273 2056 AAEL01000007 15282 17012 hypothetical protein Homeodomain-like;
Chro.50274 2057 AAEL01000007 17406 18161 . C2H2 and C2HC zinc fingers;
Chro.50275 2058 AAELO 1000007 18176 19666
Chro.50276 2059 AAEL01000007 19854 20939 .
Chro.50278 2060 AAEL01000007 21381 22712 Drosophila melanogaster GM01605p
Chro.50279 2061 AAEL01000007 22906 23667 hypothetical protein
Chro.50280 2061 AAELO 1000007 23873 24532 .
Chro.50281 2063 AAEL01000007 24680 25765 PH domain-like;
Pyk2-associated protein beta ARF-GAP
Chro.50282 2064 AAEL01000007 25803 26450 hypothetical protein domain;
Chro.50283 2065 AAEL01000007 26537 26779
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.50284 2066 AAELO 1000007 26748 27965 hypothetical protein
Chro.50285 2067 AAELO 1000007 28100 29620 hypothetical protein
Chro.50286 2068 AAEL01000007 29700 32015 hypothetical protein
Winged helix DNA-binding domain; C2H2
Chro.50288 2069 AAEL01000007 35441 41377 hypothetical protein and C2HC zinc fingers;
Chro.50289 2070 AAEL01000007 41477 42277
60S ribosomal protein
L13aDgi|7440817|pir||T07166 ribosomal protein Ll 3a - Cyanophora paradoxaDgi|l 743007|emb|CAA71090.11
Chro.50290 2071 AAEL01000007 42460 43068 ribosomal protein Ll 3 a Ribosomal protein L13;
Chro.50291 2072 AAEL01000007 43459 44193 hypothetical protein
-4 PINT domain protein (proteasomal subunit)
PFB0240w - malaria parasite (Plasmodium
Chro.50292 2073 AAELO 1000007 44219 45496 falciparum)
Chro.50293 2074 AAELO 1000007 46028 46486 histone H2A variant, putative Histone-fold;
Chro.50294 2075 AAEL01000007 47013 47270
Chro.50295 2076 AAEL01000007 48222 50993 putative pre-mRNA splicing factor TPR-like;
Chro.50296 2077 AAEL01000007 51220 52305
P-loop containing nucleotide triphosphate
Chro.50297 2078 AAELO 1000007 52336 53451 nucleotide-binding protein hydrolases;
Chro.50298 AAEL01000007 54307 55530
Chro.50299 2080 AAEL01000123 1045 1542 Nef associated protein 1
Chro.50300 2081 AAEL01000123 1979 2554 hypothetical protein t-snare proteins;
Chro.50301 2082 AAEL01000123 3198 3794
Chro.50302 2083 AAEL01000123 3926 4 4330033 Vacuolar ATP synthase subunit F, putative
Table 1
Ch Gene SEQ ID NO. Ch_Accession S Sttaarrtt End Description Superfamily
Protein serine/threonine phosphatase 2C,
Chro.50303 2084 AAEL01000123 4668 5303 serine-threonine phosophatase 2C catalytic domain;
Chro.50304 2085 AAEL01000123 8370 9227 hypothetical protein Integrin alpha N-terminal domain;
Chro.50305 2086 AAEL01000123 9847 11394 calmodulin-domain protein kinase 1 Protein kinase-like (PK-like); EF-hand;
Chro.50306 2087 AAELO 1000123 12053 17665 testis specific leucine rich repeat protein L domain-like;
Chro.50307 2088 AAEL01000301 7829 9109 .
Chro.50308 2089 AAEL01000301 5946 7559 hypothetical protein
Chro.50309 2090 AAEL01000301 4247 5893 Hypothetical protein CBG09285
Chro.50310 2091 AAEL01000301 2700 3527 hypothetical protein
Chro.50311 2092 AAEL01000332 40 903 .
Chro.50312 2093 AAEL01000332 1503 2141 .
Chro.50313 2094 AAEL01000332 2673 4151 .
Aminoacid dehydrogenase-like, N-terminal domain; NAD(P)-binding Rossmann-fold
Chro.50314 2095 AAEL01000332 4832 6520 malic enzyme domains;
Chro.50315 2096 AAEL01000332 7266 7538 .
Chro.50316 2097 AAEL01000452 855 2267 ENSANGPOOOOOO 14714 WD40-repeat;
RNA polymerase A/beta'/A" subunit, beta and beta-prime subunits of DNA
Chro.50317 2098 AAEL01000452 2373 3791 putative dependent RNA-polymerase;
DNA-directed RNA polymerase homolog • malaria parasite (Plasmodium beta and beta-prime subunits of DNA
Chro.50318 2099 AAEL01000452 4168 5064 falciparum) D gi|414322|gb| AAA72349.11 dependent RNA-polymerase;
Chro.50319 2100 AAEL01000087 15287 16621 Choline/ethanolamine kinase, putative Protein kinase-like (PK-like);
Chro.50320 2101 AAEL01000087 13125 14324 GM14490p probable ribonucleoprotein - Arabidopsis thalianaDgi|2244786|emb|CAB10209.1|
Chro.50321 2102 AAEL01000087 10421 11929 ribonucleoprotein like protein RNA-binding domain, RBD;
Table 1
Ch_Gene SEQ ED NO. Ch Accession Start End Description Superfamily
UDP-N-acetyl-D- galactosamine:polypeptide N- Nucleotide-diphospho-sugar transferases; Chro.50322 2103 AAEL01000087 6848 9046 acetylgalactosaminyltransferase T3 Ricin B-like lectins; eukaryotic translation initiation factor 3
Chro.50323 2104 AAEL01000087 5191 5976 37.28 kDa subunit, putative WLMO-repeat;
P-loop containing nucleotide triphosphate
Chro.50324 2105 AAEL01000087 3298 4737 Arabidopsis thaliana At5g67630/K9I9_20 hydrolases; Chro.50325 2106 AAELO 1000087 2594 3196 putative thioredoxin Thioredoxin-like; Chro.50326 2107 AAELO 1000087 211 2175 hypothetical protein Bet vl -like; Chro.50327 2108 AAEL01000369 772 1074 hypothetical protein Chro.50328 2109 AAEL01000369 2135 3442 hypothetical protein Ankyrin repeat; Bromodomain; Chro.50329 2110 AAEL01000369 3579 4295 conserved protein, putative PLP-binding barrel;
-4
Chro.50330 2111 AAELO 1000369 4614 5294 leucyl tRNA Synthetase (134.5 kD) (lrs-1) Nucleotidyl transferase;
Nucleotidylyl transferase;
Chro.50331 2112 AAEL01000369 5542 7416 KIAA1352 protein ValRS/ϋeRS/LeuRS editing domain; Chro.50332 2113 AAEL01001201 18 140 .
Involved in endocytosis and membrane
Chro.50334 2114 AAELO 1000517 3523 4377 growth and polarity; Arp2p Actin-like ATPase domain; Chro.50335 2115 AAEL01000517 2604 3230 hypothetical protein Chro.50336 2116 AAELO 1000517 565 2580 . Chro.50337 2117 AAELO 1000824 393 1433 hypothetical protein Chro.50338 2118 AAELO 1000984 74 220 . Chro.50339 2119 AAELO 1000984 208 981 .
Chro.50340 2120 AAEL01000585 2271 2909 vacuolar ATP synthase subunit D, putative
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Adenine nucleotide alpha hydrolases-like; cancer-associated gene protein like (41.3 Glucocorticoid receptor-like (DNA-binding
Chro.50341 2121 AAEL01000585 514 1434 fcD) (4A872) domain);
Chro.50342 2122 AAELO 1000746 107 1312 .
Chro.50343 2123 AAELO 1000746 1405 2145 expressed protein
Chro.50344 2124 AAEL01000712 1322 2161 MGC4171 protein
Chro.50345 2125 AAEL01000712 597 1319 .
Chro.50346 2126 AAEL01000712 3 86 .
Chro.50347 2127 AAEL01000596 22 660 . alpha/beta-Hydrolases;
Chro.50348 2128 AAEL01000596 1987 2898 RING zinc finger protein -related RING finger domain, C3HC4;
C-terminal domain of adenylylcyclase
Chro.50350 2129 AAELOlOOl 109 166 684 LD24380p associated protein;
O Chro.50351 2130 AAEL01000343 1238 4591 . Bacterial enterotoxins;
P-loop containing nucleotide triphosphate hydrolases; DNA repair protein Rad51, N-
Chro.50352 2131 AAELO 1000343 6021 7064 Rad51 homolog terminal domain;
Chro.50353 2132 AAEL01000343 7205 8020 . FYVE/PHD zinc finger;
Chro.50354 2133 AAEL01000884 910 1548 .
Chro.50355 2134 AAEL01001396 1 351 .
Chro.50356 2135 AAEL01001280 35 616 .
Chro.50357 2136 AAEL01000705 896 2098 hypothetical protein, conserved
Chro.50358 2137 AAEL01001417 0 313 .
Chro.50359 2138 AAEL01001336 216 479 .
Chro.50360 2139 AAEL01000991 498 644 .
Chro.50362 2140 AAEL01000797 175 1863 hypothetical protein
Chro.50363 2141 AAEL01001339 0 620 .
Chro.50364 2142 AAEL01001040 761 1033 .
Table 1
Ch_Gene SEQ ID NO. Ch_Accession art End Description Superfamily
Chro.50368 2143 AAELOlOOl 135 233 625 ARM repeat; Chro.50371 2144 AAELO 1000628 239 2182 serine/threonine kinase- 1 Protein kinase-like (PK-like); Chro.50372 2145 AAEL01000628 2763 3111 G-patch domain, putative Chro.50373 2146 AAEL01000741 491 802 . Chro.50374 2147 AAEL01000741 1375 2226 Chro.50378 2148 AAEL01000789 74 697 CG3887-PA Chro.50379 2149 AAEL01000789 1166 1816 Chro.50380 2150 AAELO 1000644 2314 2799
P-loop containing nucleotide triphosphate
Chro.50381 2151 AAELO 1000644 612 1829 DNA helicase hydrolases;
C2 domain (Calcium/lipid-binding domain,
CaLB); C2 domain (Calcium/lipid-binding
Chro.50382 2152 AAELO 1000699 1184 2440 hypothetical protein domain, CaLB);
C2 domain (Calcium/lipid-binding domain,
Chro.50383 2153 AAEL01000646 303 2906 hypothetical protein CaLB); Chro.50384 2154 AAEL01000420 3390 4421 hypothetical protein, conserved
Similar to CDC5 cell division cycle 5-like
Chro.50385 2155 AAELO 1000420 558 2951 (S. pombe) Homeodomain-like; similar to Homo sapiens (Human). PM-scl
Chro.50386 2156 AAELO 1000387 4159 6783 autoantigen Ribonuclease H-like; Chro.50387 2157 AAEL01000387 1776 3563 . Chro.50388 2158 AAEL01000710 74 664 Chro.50389 2159 AAEL01000354 104 3550 phosphoenolpyruvate carboxylase Phosphoenolpyruvate/pyruvate domain; Chro.50390 2160 AAEL01000354 3781 4317 centrin EF-hand; Chro.50391 2161 AAEL01000354 5006 6973 •
Quinoprotein alcohol dehydrogenase-like;
Chro.50392 2162 AAEL01000184 130 5898 Ankyrin repeat;
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.50394 2163 AAEL01000184 6994 9276 .
Chro.50395 2164 AAEL01000184 9873 11588 .
Chro.50397 2165 AAEL01000361 1 1584 .
Chro.50398 2166 AAEL01000361 1946 2533 thymidine kinase
Chro.50399 2167 AAELO 1000361 5606 5902 transducin / WD-40 repeat protein family WD40-repeat;
S-adenosyl-L-methionine-dependent
Chro.50400 2168 AAEL01000361 6170 7417 hypothetical protein, conserved methyltransferases; Chro.50401 2169 AAEL01000622 359 1075 .
Nucleotidylyl transferase; Anticodon-
Similar to RIKEN cDNA 261001 INl 9 binding domain of a subclass of class I
Chro.50402 2170 AAELO 1000622 1311 2828 gene aminoacyl-tRNA synthetases;
K) Chro.50403 2171 AAEL01000141 2 2134 kinase, putative Protein kuiase-like (PK-like); Chro.50404 2172 AAELO 1000141 3459 3944 . Chro.50405 2173 AAELO 1000141 4284 6716 acylamino acid-releasing enzyme alpha/beta-Hydrolases; Chro.50406 2174 AAEL01000141 7176 11270 . RING finger domain, C3HC4; Chro.50407 2175 AAEL01000141 11924 15091 . Chro.50408 2176 AAEL01000141 15338 15691 .
S-adenosyl-L-methionine-dependent
Chro.50409 2177 AAEL01000141 15803 16336 CG9643-PA methyltransferases; Chro.50410 2178 AAEL01000676 171 692 . Frataxin-like; Chro.50411 2179 AAELO 1000676 1340 2655 .
C2 domain (Calcium/lipid-binding domain,
Chro.50412 2180 AAELO 1000786 195 1631 . CaLB);
RAD26-LIKE DNA REPAIR AND P-loop containing nucleotide triphosphate
Chro.50413 2181 AAELO 1000381 4140 6608 RECOMBINATION PROTEIN hydrolases; Chro.50415 2182 AAEL01000381 2625 4109 .
Table 1
Ch Gene SEQ ID NO. Ch Accession art End Description Superfamily
Plasmodium falciparum asparagine-rich
Chro.50416 2183 AAEL01000381 836 2431 protein Chro.50417 2184 AAEL01000381 97 432 . Chro.50418 2185 AAELO 1000520 3302 4111 unnamed protein product WD40-repeat; Chro.50419 2186 AAEL01000520 467 3064 Chro.50420 2187 AAEL01000609 188 2455 Calponin-homology domain, CH-domain; Chro.50422 2188 AAEL01000570 410 3271 hypothetical protein EGF/Laminin; Chro.50423 2189 AAELO 1000548 672 2174 hypothetical protein Trimeric LpxA-like enzymes; HAD-like; N-terminal nucleophile aminohydrolases
Chro.50424 2190 AAEL01000548 2799 3671 unknown (Ntn hydrolases);
Chro.50427 2191 AAELO 1000595 2 391 hypothetical protein Secl/muncl8-like (SM) proteins; Protein serine/threonine phosphatase 2C,
OO Chro.50429 2192 AAEL01000325 18 1229 PP2C catalytic domain;
Chro.50430 2193 AAELO 1000325 2401 3363 .
Chro.50431 2194 AAELO 1000325 3752 6103 .
Chro.50432 2195 AAELO 1000325 6546 7283 .
Chro.50433 2196 AAEL01000325 8113 8508 .
Chro.50435 2197 AAELO 1000160 666 1256 .
Chro.50436 2198 AAEL01000160 2065 2613 . EF-hand;
Chro.50437 2199 AAEL01000160 3557 5218 hypothetical protein
P-loop containing nucleotide triphosphate
Chro.50438 2200 AAEL01000160 5642 9421 putative ATP dependent RNA helicase hydrolases;
Chro.50439 2201 AAEL01000160 10738 12093 membrane skeletal protein, putative
Chro.50440 2202 AAEL01000160 13646 14365 Unknown (protein for MGC:75638) Metallo-dependent phosphatases; protein phosphatase catalytic (36.3 kD)
Chro.50441 2203 AAEL01000160 14530 14733 (4M623) Metallo-dependent phosphatases;
Chro.50442 2204 AAEL01000160 14889 15227 .
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.50443 2205 AAELO 1000878 476 1192 . Chro.50444 2206 AAELOlOOl 143 288 938 . Chro.50445 2207 AAEL01000545 2220 3701 . Chro.50446 2208 AAEL01000545 340 1953 . Chro.50447 2209 AAELOlOOl 115 122 298 . Chro.50448 2210 AAEL01001115 539 907 . Chro.50450 2211 AAELO 1000602 1 1620 . Chro.50451 2212 AAEL01000578 340 843 . Chro.50453 2213 AAEL01000578 1234 3333 hypothetical protein RING finger domain, C3HC4;
Chro.50454 2214 AAEL01000428 1260 2360 hydrolase, alpha/beta hydrolase fold family alpha/beta-Hydrolases;
Chro.50456 2215 AAEL01000428 3115 3771 Ran-binding protein PH domain-like;
Chro.50457 2216 AAELO 1000428 4390 5469 erythrocyte membrane-associated antigen Acid proteases;
Chro.50458 2217 AAEL01001308 55 660 .
Chro.50459 2218 AAELO 1000759 1530 2054 .
Chro.50460 2219 AAELO 1000759 636 1298 calmodulin EF-hand;
Chro.50462 2220 AAELO 1000740 1132 2181 . PH domain-like;
Chro.50463 2221 AAEL01000740 I l l 764 . RING finger domain, C3HC4;
Chro.50464 2222 AAEL01000414 5539 5982 .
Chro.50465 2223 AAEL01000414 4278 5534 .
P-loop containing nucleotide triphosphate
Chro.50466 2224 AAEL01000414 2368 3468 probable DNA helicase hydrolases;
Chro.50467 2225 AAEL01000414 823 1197 .
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily adaptor-related protein complex 1, gamma 2 subunit; gamma2-adaptin; clathrin- associated/assembly/adaptor protein, large,
Chro.50468 2226 AAELO 1000289 6972 8948 gamma-2 ARM repeat;
Chro.50469 2227 AAEL01000289 4488 4868 hypothetical protein
Chro.50470 2228 AAEL01000289 3722 4264 .
Chro.50471 2229 AAELO 1000289 78 308 .
Chro.50472 2230 AAEL01001069 229 321 .
Chro.50473 2231 AAELO 1000707 3 413 .
Chro.50474 2232 AAELO 1000707 951 1568 .
Chro.50475 2233 AAELO 1000707 1644 2276 hypothetical protein
Chro.50477 2234 AAELO 1000400 5903 6343 hypothetical protein
" Chro.50478 2235 AAELO 1000400 4879 5544 similar to dynactin subunit p25 Trimeric LpxA-like enzymes;
Chro.50479 2236 AAELO 1000400 3472 3903 ribosomal protein S 12 L30e-like;
Chro.50480 2237 AAELO 1000400 1631 3043 ENSANGP00000013300 Ankyrin repeat;
40S ribosomal protein
S17Dgi|14132796|gb|AAK52315.1| 40S
Chro.50481 2238 AAEL01000400 1151 1546 ribosomal protein S 17
Chro.50482 2239 AAEL01000400 1 363 .
Chro.50483 2240 AAEL01000433 394 2394 Seel family Secl/muncl8-like (SM) prote
Chro.50484 2241 AAEL01000433 2981 3955 .
Chro.50485 2242 AAEL01000433 4702 5247 . WD40-repeat;
Chro.50486 2243 AAELO 1000738 441 521 .
Chro.50487 2244 AAELO 1000738 555 1103 hypothetical protein
Chro.50488 2245 AAEL01000738 1669 2244 .
Chro.50489 2246 AAEL01000482 3570 4346 .
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
P-loop containing nucleotide triphosphate
Chro.50490 2247 AAEL01000482 2551 3048 thymidylate kinase, putative hydrolases;
Chro.50491 2248 AAEL01000482 149 1750 . BRCT domain;
Chro.50492 2249 AAELO 1000648 2057 2911 .
MSP-domain protein like family member
Chro.50493 2250 AAELO 1000648 258 1577 (4G39)
Adenine nucleotide alpha hydrolases-like; GMP synthetase C-terminal dimerisation
Chro.50499 2251 AAEL01000910 558 1337 burgundy CG9242-PA domain; hypothetical predicted protein, unknown
Chro.50500 function
Chro.50501 2252 AAEL01001330 12 675 AsnA Class π aaRS and biotin synthetases; Tryptophan synthase beta subunit-like PLP-
Chro.50503 2253 AAELO 1000915 216 1445 PUTATIVE TRYPTOPHAN SYNTHASE dependent enzymes;
Chro.50504 2254 AAELO 1000865 118 870 .
Chro.50507 2255 AAELO 1000309 1259 1978 .
Chro.51000 2256 AAELO 1000292 7382 8614 alpha amylase
Chro.51001 2257 AAELOlOOl 116 728 892 .
Chro.51002 2258 AAELOlOOl 184 2 121 hypothetical protein cgd5_4000
Chro.51003 2259 AAELO 1000595 3266 3418 .
Chro.51004 2260 AAEL01000160 402 557 .
Chro.51005 2261 AAEL01001344 597 647 .
Chro.51006 2262 AAEL01000643 1 32 .
Chro.60010 2263 AAELO 1000251 7336 8304 . hypothetical predicted transmembrane
Chro.60011 2264 AAEL01000251 2934 3647 protein, unknown function
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Inosine monophosphate dehydrogenase
Chro.60012 2265 AAEL01000251 35 262 inosine-5-monophosphate dehydrogenase (IMPDH); hypothetical predicted protein, unknown
Chro.60013 2266 AAEL01000376 4407 5228 function
Chro.60014 2267 AAEL01000376 3163 3741 serine repeat antigen, probable hypothetical predicted protein, unknown
Chro.60015 2268 AAEL01000376 1548 1787 function
Chro.60016 2269 AAELO 1000052 21932 26641 protease, possible Single hybrid motif;
Chro.60017 2270 AAELO 1000052 20501 21799 CAAX prenyl protease, possible
Chro.60019 2271 AAEL01000052 18831 20165 histone deacetylase Arginase/deacetylase; conserved hypothetical multi-pass
Chro.60020 2272 AAEL01000052 15784 18123 transmembrane protein Sm-like ribonucleoproteins; EF-hand;
OO conserved hypothetical Leucine Rich
Chro.60021 2273 AAEL01000052 14276 15208 Repeat protein L domain-like; conserved hypothetical transmembrane
Chro.60022 2274 AAELO 1000052 13290 14159 protein
Chro.60023 2275 AAEL01000052 11048 12493 protein disulphide isomerase, probable Thioredoxin-like;
Chro.60024 2276 AAELO 1000052 8102 10717 Na+/H+ antiporter, possible
Chro.60025 2277 AAEL01000052 4314 7094 Na+/H+ antiporter, possible hypothetical predicted protein, unknown
Chro.60026 2278 AAELO 1000052 2703 3587 function hypothetical predicted protein, unknown
Chro.60027 2279 AAEL01000052 47 2125 function 4-helical cytokines;
Chro.60028 2280 AAELOlOOl 124 23 490 synaptobrevin-like protein, possible
DNA-directed RNA polymerase ii largest Transcription factor DA (TFHA), N-
Chro.60029 2281 AAEL01000800 926 1279 subunit, possible terminal domain;
Table 1
Ch Gene SEQ TD NO. Ch Accession Start End Description Superfamily hypothetical predicted PH-domain protein,
Chro.60030 2282 AAELO 1000940 110 616 unknown function . hypothetical predicted PH-domain protein,
Chro.60031 2283 AAEL01000415 151 948 unknown function PH domain-like;
Insect cysteine-rich antifreeze protein;
Chro.60033 2284 AAEL01000415 3146 5704 oocyst wall protein precursor, possible EGF/Laminin;
Chro.60035 2285 AAEL01000941 324 1304 beclinl-like protein, possible
P-loop containing nucleotide triphosphate
Chro.60036 2286 AAEL01000615 165 1547 DNA replication factor, possible hydrolases;
Chro.60037 2287 AAEL01000935 52 318 CG3358-PB Metallo-dependent hydrolases;
Chro.60038 2288 AAEL01001039 330 476 Unknown (protein for MGC:76066)
Chro.60039 2289 AAEL01001039 735 1007 . . 90 Chro.60040 2290 AAEL01000689 1775 2525 coatamer protein, beta subunit, putative ARM repeat;
Chro.60041 2291 AAEL01000689 64 1209 .
Chro.60042 2292 AAEL01001358 1 585 .
Chro.60043 2293 AAELO 1001068 0 892 .
Chro.60044 2294 AAEL01001081 627 878 .
Chro.60045 2295 AAEL01001081 540 626 .
Chro.60051 2296 AAEL01001084 4 156 .
Chro.60052 2297 AAEL01001003 129 557 .
Chro.60053 2298 AAELOlOOl 132 92 832 .
Chro.60055 2299 AAEL01000422 4807 5403 .
CCAAT-box DNA binding protein subunit
Chro.60056 2300 AAELO 1000422 2891 3874 B
Chro.60057 2301 AAEL01000422 847 1638 poly(A) binding protein II RNA-binding domain, RBD;
Chro.60058 2302 AAEL01001415 0 155 .
Chro.60062 2303 AAELO 1000662 2 937 transcription factor TFBl
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.60064 2304 AAELO 1000662 1754 1963 .
Chro.60065 2305 AAEL01001133 378 542 .
Chro.60066 2306 AAEL01000718 519 1055 .
Chro.60067 2307 AAELO 1000718 1282 2274 transporter protein, putative
Chro.60068 2308 AAEL01000872 500 1006 .
Chro.60069 2309 AAEL01000671 547 1221 hypothetical protein SNARE-like;
Chro.60070 2310 AAELO 1000515 350 1924 probable serine/threonine-protein kinase 2 Protein kinase-like (PK-like);
Chro.60071 2311 AAEL01000515 2221 4026 .
Thyroid receptor interacting protein 13 (TRIP-13)Dgi|703102|gb|AAC41732.1|
Chro.60073 2312 AAEL01001239 6 788 thyroid receptor interactor
QO
P-loop containing nucleotide triphosphate
Chro.60074 2313 AAEL01000342 7631 8080 protein -related binding protein hydrolases;
Class π aaRS and biotin synthetases;
Threonyl-tRNA synthetase (ThrRS),
Chro.60075 2314 AAEL01000342 4096 7065 cytosolic tRNA-Ala synthetase second 'additional' domain;
Chro.60076 2315 AAEL01000342 3177 3596 60S ribosomal protein L23 Ribosomal protein L14;
Chro.60077 2316 AAEL01000557 2421 3665
Chro.60078 2317 AAEL01000557 0 1275
Chro.60079 2318 AAEL01001210 265 774 Superantigen toxins, C-terminal domain;
Chro.60080 2319 AAEL01001210 781 858
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
ATP synthase alpha chainDgi|67815|pir||PWQFA H+- transporting two-sector ATPase (EC 3.6.3.14) alpha chain - Rhodospirillum P-loop containing nucleotide triphosphate rubrumDgi|46366|emb|CAA26338.1| hydrolases; N-terminal domain of alpha
Chro.60082 2320 AAEL01000992 52 1101 unnamed protein product and beta subunits of Fl ATP synthase;
Chro.60083 2321 AAEL01001014 415 1083 Protein kinase domain Protein kinase-like (PK-like);
Chro.60084 2322 AAELO 1000916 844 1104
Chro.60085 2323 AAEL01001211 60 856 hypothetical protein
Chro.60086 2324 AAEL01000581 54 2261 OSK4 Protein kinase-like (PK-like);
Chro.60089 2325 AAELO 1000774 1154 2059 hypothetical protein
Chro.60090 2326 AAEL01000774 54 944 ribonucleotide reductase R2 subunit Ferritin-like; ribonucleotide reductase small subunit,
O Chro.60091 2327 AAEL01000412 1020 2129 putative Ferritin-like;
Chro.60092 . 2328 AAEL01000412 2769 4154
Cliro.60093 2329 AAEL01000412 5274 5831
Chro.60095 2330 AAEL01000894 0 1089
A DNA-binding domain in eukaryotic
Chro.60096 2331 AAEL01000137 730 2073 . transcription factors; protein phosphatase- 1 regulatory subunit 7
Chro.60097 2332 AAEL01000137 2513 3532 alpha2 L domain-like;
Chro.60098 2333 AAEL01000137 3890 6847 Arabidopsis thaliana F6D8.20
Chro.60099 2334 AAELO 1000137 7979 8194 . hypothetical predicted protein, unknown
Chro.60100 2335 AAELO 1000137 8800 9576 function
Chro.60101 2336 AAEL01000137 10331 10945 sporozoite cysteine-rich protein TSP-I type 1 repeat; EGF/Laminin;
Chro.60102 21 AAEL01000137 11337 12380 sporozoite cysteine-rich protein
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
TSPl domain-containing protein TSP7
Chro.60103 11 AAEL01000308 12 1982 precursor TSP-I type 1 repeat; EGF/Laminin;
TSPl domain-containing protein TSP9
Chro.60104 2337 AAEL01000137 14012 14425 precursor EGF/Laminin; hypothetical predicted BRCAl domain
Chro.60105 2338 AAEL01000137 14790 16049 protein, unknown function SMAD/FHA domain; BRCT domain; hypothetical predicted protein, unknown
Chro.60106 2339 AAELO 1000498 288 1202 function
Chro.60107 2340 AAELO 1000498 1563 4610 41 Kd oocyst wall protein
Chro.60108 2341 AAELO 1000492 175 4548 41 Kd oocyst wall protein PH domain-like; conserved hypothetical multi-pass
Chro.60109 2342 AAELO 1000284 1039 2265 transmembrane protein hypothetical predicted transmembrane,
Chro.60110 2343 AAELO 1000284 2689 4248 thioredoxin domain protein Thioredoxin-like; hypothetical predicted protein, unknown
Chro.60111 2344 AAELO 1000284 4443 4787 function hypothetical predicted protein, unknown
Chro.60112 2345 AAEL01000284 6054 6761 function similar to glycogen debranching enzyme,
Chro.60114 2346 AAELO 1000631 1156 3018 possible E set domains; hypothetical predicted protein, unknown
Chro.60115 2347 AAELO 1000743 697 1212 function
Chro.60116 2348 AAEL01000743 125 658 CGl 6979 protein, possible
P-loop containing nucleotide triphosphate
Chro.60119 2349 AAEL01001029 635 1149 26s protease regulatory subunit 8, probable hydrolases;
Chro.60121 2350 AAEL01000025 388 2034 conserved BRCAl domain protein BRCT domain;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
C-terminal domain of phosphatidylinositol transfer protein secl4p; N-terminal domain
CRAL/TRIO cell signalling protein, of phosphatidylinositol transfer protein
Chro.60122 2351 AAEL01000025 2789 4111 possible secl4p;
Chro.60125 2352 AAEL01000025 5664 6941 cysteinyl-tRNA-synthetase, possible Nucleotidylyl transferase; putative cAMP-dependent protein kinase,
Chro.60126 2353 AAELO 1000025 8600 8812 probable Protein kinase-like (PK-like); hypothetical predicted protein, unknown
Chro.60128 2354 AAELO 1000025 8770 10173 function SET domain;
Ul small nuclear ribonucleoprotein,
Chro.60129 2355 AAELO 1000025 10688 11533 possible RNA-binding domain, RBD; retinitis pigmentosa GTPase regulator,
VO
Chro.60130 2356 AAELO 1000025 12044 12982 possible
Protein serine/threonine phosphatase 2C,
Chro.60131 2357 AAELO 1000025 13193 15340 PP2C-related protein phosphatase, possible catalytic domain;
Chro.60132 2358 AAEL01000025 16424 17146 putative initiation factor e4, probable Translation initiation factor eIF4e; dentin sialophosphoprotein precursor,
Chro.60133 2359 AAELO 1000025 17433 19127 possible hypothetical predicted protein, unknown
Chro.60134 2360 AAEL01000025 20314 20733 function
Chro.60135 2361 AAELO 1000025 21746 22198 IscU-like protein hypothetical predicted protein, unknown
Chro.60136 2362 AAELO 1000025 23008 24684 function
< conserved hypothetical multi-pass
Chro.60137 2363 AAELO 1000025 25831 26520 transmembrane protein
Chro.60138 2364 AAELO 1000025 26940 27974 sporozoite antigen gp40/15
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.60139 2365 AAELO 1000025 29651 29908 . Chro.60141 2366 AAELO 1000025 30362 31471 heat shock protein 40-like, probable Chaperone J-domain; conserved hypothetical transmembrane
Chro.60142 2367 AAEL01000025 32125 33744 protein hypothetical predicted protein, unknown Chro.60143 2368 AAEL01000025 33996 35372 function hypothetical predicted protein, unknown Chro.60144 2369 AAEL01000162 92 2335 function hypothetical predicted protein, unknown Chro.60146 2370 AAEL01000162 4932 7157 function hypothetical predicted protein, unknown Chro.60147 2371 AAEL01000162 8184 8873 function hypothetical predicted protein, unknown
VO Chro.60148 2372 AAEL01000162 9027 11153 function hypothetical predicted protein, unknown Chro.60150 2373 AAEL01000162 11822 12559 function hypothetical predicted transmembrane Chro.60151 2374 AAEL01000638 1825 2757 protein, unknown function hypothetical predicted transmembrane
Chro.60152 2375 AAEL01000767 1669 2022 protein, unknown function Chro.60153 2376 AAEL01000767 1 549 DNAJ protein-like, possible Chaperone J-domain;
Chro.60154 2377 AAEL01000553 2924 3739 tetrapyrrole methylases, probable Cobalt precorrin-4 methyltransferase CbiF;
S-adenosyl-L-methionine-dependent Chro.60155 2378 AAEL01000553 2169 2858 conserved hypothetical protein methyltransferases; hypothetical predicted transmembrane Chro.60156 2379 AAELO 1000553 1606 1992 protein, unknown function
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily hypothetical predicted protein, unknown P-loop containing nucleotide triphosphate
Chro.60157 2380 AAELO 1000553 1 948 function " hydrolases;
Chro.60159 2381 AAEL01001061 3 515 .
Chro.60160 2382 AAEL01000401 4958 6181 . glycerol-3 -phosphate acyltransferase,
Chro.60161 2383 AAEL01000401 3166 4926 probable hypothetical predicted transmembrane
Chro.60162 2384 AAELO 1000401 1112 2938 protein, unknown function hypothetical predicted zinc-finger protein,
Chro.60163 2385 AAEL01000241 1639 2265 unknown function RING finger domain, C3HC4;
TSPl domain-containing protein TSP5
Chro.60164 2386 AAELO 1000241 2386 3450 precursor TSP-I type 1 repeat; hypothetical predicted protein, unknown
Chro.60165 2387 AAELO 1000241 3901 5196 function hypothetical predicted transmembrane
Chro.60166 2388 AAEL01000241 5301 6059 protein, unknown function hypothetical predicted zinc-finger protein,
Chro.60167 2389 AAEL01000241 7277 7693 unknown function
hypothetical predicted multi-pass
Chro.60168 2390 AAEL01000241 8140 10977 transmembrane protein, unknown function Bet vl-like; hypothetical predicted transmembrane
Chro.60169 2391 AAEL01000691 1187 2515 protein, unknown function
Chro.60170 2392 AAELOlOOl 167 520 741 .
Chro.60172 2393 AAELO 1000021
Chro.60173 2394 A AAAEELL0011000000002211 35563 36861 putative histone deacetylase Arginase/deacetylase;
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily hypothetical predicted protein, unknown
Chro.60174 2395 AAEL01000021 33911 34357 function pre-mRNA splicing factor ATP-dependent P-loop containing nucleotide triphosphate
Chro.60176 2396 AAEL01000021 32412 33884 RNA helicase, probable hydrolases;
Chro.60177 2397 AAEL01000021 28392 30386 cdc2-related protein kinase, possible Protein kinase-like (PK-like);
Chro.60178 2398 AAEL01000021 25808 27802 E2F-related protein, possible Winged helix DNA-binding domain; hypothetical predicted protein, unknown
Chro.60179 2399 AAEL01000021 25092 25307 function
Chro.60180 2400 AAELO 1000021 24410 24634 .
Chro.60181 2401 AAEL01000021 21793 23907 interaptin, possible
Chro.60182 2402 AAELO 1000021 19065 21548 galactosyltransferase, possible
C-terminal domain of phosphatidylinositol transfer protein secl4p; N-terminal domain secl4-like CRAL/TRIO domain protein, of phosphatidylinositol transfer protein Chro.60183 2403 AAEL01000021 17943 18968 possible secl4p; hypothetical predicted SET domain protein, Chro.60184 2404 AAELO 1000021 17292 17603 unknown function SET domain; FYVE/PHD zinc finger; hypothetical predicted protein, unknown
Chro.60185 2405 AAEL01000021 12941 14560 function
Chro.60186 2406 AAEL01000021 12208 12795 dbj|baa86974.1, possible
hypothetical predicted multi-pass
Chro.60187 2407 AAELO 1000021 11197 12072 transmembrane protein, unknown function
hypothetical predicted multi-pass
Chro.60188 2408 AAELO 1000021 8229 10313 transmembrane protein, unknown function
Table 1
Ch Gene SEQ ED NO. Ch_Accession Start End Description Superfamily conserved hypothetical transmembrane
Chro.60189 2409 AAEL01000021 6370 8001 protein
Chro.60190 2410 AAEL01000021 4144 6351 Rad4-related protein, possible replication-associated histone mRNA stem
Chro.60191 2411 AAEL01000021 2740 3858 loop-bindingprotein, possible hypothetical predicted protein, unknown
Chro.60192 2412 AAEL01000021 1788 2369 function
Chro.60193 2413 AAELO 1000021 816 1625 2900016dO5rik protein, possible similar to riken cDNA 5830420c20 gene,
Chro.60194 13 AAEL01000133 15004 16041 probable
Resolvase-like; 5' to 3' exonuclease, C-
Chro.60195 2 2441144 AAEL01000133 13491 14939 XPG (rad-related) exonuclease, possible terminal subdomain;
Os Chro.60196 2415 AAEL01000133 9138 12779 conserved MIF4G domain protein ARM repeat; RNA-binding domain, RBD; Chro.60197 2416 AAEL01000133 8424 8732 . hypothetical predicted protein, unknown
Chro.60198 2417 AAEL01000133 5621 6973 function hypothetical predicted protein, unknown
Chro.60199 2418 AAEL01000133 4099 5151 function Chro.60200 2419 AAEL01000133 2106 2693 p23 co-chaperone, probable HSP20-like chaperones; hypothetical predicted protein, unknown
Chro.60202 2420 AAEL01000133 404 1507 function hypothetical predicted thrombospondin Chro.60203 2421 AAEL01000391 2346 3287 domain protein, unknown function TSP-I type 1 repeat;
P-loop containing nucleotide triphosphate
Chro.60204 2422 AAEL01000391 3302 4600 GTP-binding protein, probable hydrolases; Chro.60205 2423 AAELO 1000391 4754 6229 splicing factor, possible RNA-binding domain, RBD;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.60206 2424 AAEL01000391 6238 6537 kinesin-related protein, possible Chro.60207 2425 AAELO 1000225 8880 9521 nuclear cap-binding protein, possible RNA-binding domain, RBD; hypothetical predicted protein, unknown
Chro.60208 2426 AAELO 1000225 7095 8855 function TNF receptor-like; hypothetical predicted protein, unknown
Chro.60209 2427 AAEL01000225 5909 6742 function Chro.60210 2428 AAEL01000225 5290 5826 zf-CCCH zinc finger protein, possible phosphatidylinositol kinase-like protein,
Chro.60211 2429 AAELO 1000225 175 5202 possible Protein kinase-like (PK-like); Terpenoid cylases/Protein
Chro.60212 2430 AAELO 1000098 11582 12574 prenyltransferase subunit, probable prenyltransferases; phosphatidylinositol 3 -kinase, root isoform,
Chro.60213 2431 AAEL01000098 12654 15485 possible Protein kinase-like (PK-like);
-4 hypothetical predicted zf-C2H2 zinc finger
Chro.60214 2432 AAEL01000098 15650 17656 protein, unknown function RNA-binding domain, RBD;
P-loop containing nucleotide triphosphate
Chro.60215 2433 AAELO 1000098 18187 19605 ATP-dependent RNA helicase, possible hydrolases; hypothetical predicted protein, unknown
Chro.60216 2434 AAEL01000098 19659 19865 function hypothetical predicted protein, unknown
Chro.60217 2435 AAEL01000568 2913 3587 function Acyl-CoA N-acyltransferases (Nat); Chro.60219 2436 AAEL01000145 15904 16119 conserved hypothetical protein Chro.60220 2437 AAEL01000145 14034 15509 ht-1080 protein, possible conserved CBS domain multi-pass
Chro.60221 2438 AAEL01000145 12284 14002 transmembrane protein CBS-domain; Chro.60222 2439 AAELO 1000145 10137 10649 SRPl 9-domain protein SRP 19; Chro.60223 2440 AAEL01000145 9166 10020 conserved hypothetical protein
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily hypothetical predicted protein, unknown Chro.60224 2441 AAEL01000145 8561 8869 function
P-loop containing nucleotide triphosphate Chro.60225 2442 AAEL01000145 5950 8094 kinesin heavy chain, possible hydrolases; hypothetical predicted transmembrane Chro.60226 2443 AAEL01000145 5265 5801 protein, unknown function
P-loop containing nucleotide triphosphate
Chro.60227 2444 AAEL01000145 2400 5204 putative kinesin heavy chain, possible hydrolases;
Chro.60228 2445 AAEL01000145 349 2163 conserved hypothetical protein hypothetical predicted ATP cone domain
Chro.60229 2446 AAEL01000145 11 331 protein, unknown function
Ribonucleoside-diphosphate reductase
VO large chain (Ribonucleotide reductase Rl PFL-like glycyl radical enzymes; Rl subunit)ϋgi|8365757|gb|AAC12280.2| subunit of ribonucleotide reductase, N-
Chro.60230 2447 AAEL01000260 6117 7031 ribonucleotide reductase Rl subunit terminal domain;
Nucleotide-diphospho-sugar transferases;
Chro.60231 2448 AAEL01000260 2022 4451 glycosyl transferase, possible Ricin B-like lectins; Chro.60232 2449 AAEL01000260 116 1288 conserved hypothetical protein Chro.60233 2450 AAEL01001060 185 937 conserved hypothetical protein hypothetical predicted transmembrane
Chro.60234 2451 AAEL01000541 3250 3870 protein, unknown function hypothetical predicted protein, unknown Chro.60235 2452 AAELO 1000541 184 3216 function hypothetical predicted protein, unknown
Chro.60236 2453 AAEL01000072 1996 3870 function Chro.60237 2454 AAELO 1000072 5185 6231 conserved hypothetical protein
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.60238 2455 AAELO 1000072 7195 7896 BTl family protein oligosaccharyl transferase stt3 protein,
Chro.60239 2456 AAEL01000072 8042 10210 probable Chro.60240 2457 AAEL01000072 10360 11241 gal83 protein, possible E set domains; putative transcription regulatory protein,
Chro.60241 2458 AAELO 1000072 11586 19571 possible adapter-related protein complex 2 alpha 1 ARM repeat; Clathrin adaptor appendage
Chro.60242 2459 AAEL01000072 19595 22888 subunit, possible domain; Chro.60243 2460 AAELO 1000902 0 1293 exonuclease ii, possible
Growth factor receptor domain; Insect
Chro.60244 2461 AAELO 1000265 2586 7448 oocyst EB module wall protein cysteine-rich antifreeze protein; hypothetical predicted protein, unknown
Chro.60245 2462 AAELO 1000682 0 2494 function hypothetical predicted protein, unknown Chro.60246 2463 AAEL01000443 3710 5338 function hypothetical predicted transmembrane
Chro.60247 2464 AAEL01000443 3052 3696 protein, unknown function Chro.60249 2465 AAELO 1000443 2523 2756 conserved hypothetical protein conserved hypothetical multi-pass transmembrane protein, possible ion
Chro.60250 2466 AAEL01000443 970 1224 transporter conserved hypothetical multi-pass transmembrane protein, possible ion
Chro.60251 2467 AAELO 1000057 23725 25458 transporter hypothetical predicted transmembrane C2 domain (Calcium/lipid-binding domain,
Chro.60252 2468 AAEL01000057 22572 23360 protein, unknown function CaLB); Chro.60253 2469 AAELO 1000057 20459 21262 Ul snrnp, possible RNA-binding domain, RBD;
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily hypothetical predicted protein, unknown
Chro.60254 2470 AAEL01000057 19725 20381 function
Chro.60255 2471 AAEL01000057 19111 19629 ribosomal protein LIl, probable Ribosomal protein L5;
P-loop containing nucleotide triphosphate putative translation initiation factor if-2, hydrolases; Translation proteins; Initiation
Chro.60256 2472 AAELO 1000057 16122 18107 73082-68138, probable factor IF2/eIF5b, domain 3;
Chro.60257 2473 AAEL01000057 14662 15888 GTPase activator protein, possible Ypt/Rab-GAP domain of gyp Ip;
Chro.60258 2474 AAELO 1000057 12782 14647 F-box domain protein RNI-like; F-box domain;
hypothetical predicted multi-pass
Chro.60259 2475 AAEL01000057 11686 12549 transmembrane protein, unknown function
K)
O O hypothetical predicted multi-pass
Chro.60260 2476 AAELO 1000057 9654 10685 transmembrane protein, unknown function
Chro.60261 2477 AAELO 1000057 7821 9314 diphthamide synthesis protein, possible hypothetical predicted protein, unknown
Chro.60262 2478 AAEL01000057 3104 7531 function FYVE/PHD zinc finger; SET domain;
Chro.60263 2479 AAELO 1000057 1824 3020 myb proto-oncogene protein, possible Homeodomain-like;
Chro.60264 2480 AAEL01000947 470 1075 DEALVDEAH box helicase
hypothetical predicted multi-pass
Chro.60265 2481 AAELOIOOIOIO 1116 transmembrane protein, unknown function
hypothetical predicted multi-pass
Chro.60266 2482 AAELO 1000527 1051 1740 transmembrane protein, unknown function
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily endonuclease/exonuclease/phosphatase, Chro.60267 2483 AAEL01000527 1770 3293 possible DNase l-like; hypothetical predicted protein, unknown
Chro.60268 2484 AAEL01000527 3671 4189 function hypothetical predicted protein, unknown Chro.60269 2485 AAEL01000012 128 5026 function
TSPl domain-containing protein TSP6 Chro.60270 2486 AAEL01000012 5224 6300 precursor hypothetical predicted WD40-repeat
Chro.60271 2487 AAEL01000012 6400 11367 protein, unknown function WD40-repeat; Bromodomain;
Chro.60272 2488 AAEL01000012 11895 12803 Gal/GalNAc binding lectin
K> hypothetical predicted multi-pass
O
Chro.60273 2489 AAEL01000012 13230 15029 transmembrane protein, unknown function Chro.60274 2490 AAEL01000012 15105 15962 mitochondrial carrier protein, possible hypothetical predicted protein, unknown
Chro.60275 2491 AAELO 1000012 16448 16954 function Chro.60276 2492 AAELO 1000012 17311 19419 Sec 1 -family protein, possible Secl/muncl8-like (SM) proteins; DNA ligase/mRNA capping enzyme, mRNA capping enizyme alpha subunit, catalytic domain; Nucleic acid-binding
Chro.60277 2493 AAEL01000012 19797 20873 possible proteins;
Chro.60278 2494 AAEL01000012 22369 23454 DNA topoisomerase lllbeta-l, probable Prokaryotic type I DNA topoisomerase;
Chro.60280 2495 AAEL01000012 24050 24388 divalent cation tolerance protein, probable GlnB-like; hypothetical predicted protein, unknown Chro.60281 2496 AAEL01000012 24417 25226 function
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.60282 2497 AAELO 1000012 25905 26465 conserved NAC domain protein
hypothetical predicted multi-pass
Chro.60283 2498 AAEL01000012 26675 27466 transmembrane protein, unknown function
UDP-Glycosyltransferase/glycogen
Chro.60284 2499 AAEL01000012 27849 30554 glycogen phosphorylase 1, probable phosphorylase; Chro.60285 2500 AAEL01000012 30977 31456 ribosomal protein L21, probable Translation proteins SH3-like domain;
hypothetical predicted multi-pass
Chro.60286 2501 AAEL01000012 31656 33623 transmembrane protein, unknown function Thioredoxin-like; Thiol oxidase Erv2p;
Chro.60287 2502 AAEL01000012 33851 34837 £24b9.20, possible
K) Ubiquitin-protein ligase E3a, Hect catalytic
O κ> Chro.60288 2503 AAEL01000012 35117 37510 e3 ubiquitin-protein ligase, probable domain (E6ap);
Chro.60289 2504 AAEL01000012 38043 42497 rhoptry protein, possible
Chro.60290 2505 AAEL01000012 43364 44344 farnesyltransferase, possible Protein prenylyltransferase;
hypothetical predicted multi-pass
Chro.60291 2506 AAEL01000012 44686 44838 transmembrane protein, unknown function
tRNA delta(2)-isopentenylpyrophosphate
Chro.60293 2507 AAEL01001031 584 817 transferase, putative hypothetical predicted protein, unknown
Chro.60294 2508 AAEL01000094 19560 20687 function
Chro.60295 2509 AAEL01000094 16320 19037 spml protein, possible
Chro.60296 2510 AAEL01001389 123 434 .
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily
putative phosphatidylinositol-4-phosphate Histone H3 K4-specifϊc methyltransferase
Chro.60298 2511 AAEL01000094 14375 15472 5-kinase, 11335-7537, possible SET7/9 N-terminal domain; hypothetical predicted protein, unknown
Chro.60299 2512 AAELO 1000094 10811 13591 function
Acyl-CoA N-acyltransferases (Nat);
Chro.60300 2513 AAEL01000094 9045 10703 histone acetyltransferase, possible Chromo domain-like; hypothetical predicted protein, unknown
Chro.60301 2514 AAELO 1000094 5983 7854 function
excision repair cross-complementing rodent repair deficiency,complementation group 1,
M Chro.60302 2515 AAELO 1000094 4665 5339 possible RuvA domain 2-like;
O conserverd hypothetical MSP-domain
Chro.60303 2516 AAELO 1000094 3154 3906 transmembrane protein PapD-like; hypothetical predicted protein, unknown
Chro.60304 2517 AAEL01001099 279 770 function
hypothetical predicted multi-pass
Chro.60305 2518 AAEL01000037 16 969 transmembrane protein, unknown function . heat shock protein DNAJ homologue pfj4,
Chro.60306 2519 AAEL01000037 1452 2273 probable Chaperone J-domain;
P-loop containing nucleotide triphosphate
Chro.60307 2520 AAEL01000037 2438 5740 similar to helicase-like protein nhl, possible hydrolases; hypothetical predicted protein, unknown
Chro.60308 2521 AAEL01000037 5765 7234 function
Table 1 Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily hypothetical predicted AT hook motif
Chro.60309 2522 AAEL01000037 7624 10368 protein, unknown function peptidyl-prolyl isomerase/macrophage Chro.60310 2523 AAEL01000037 12030 13007 infectivity potentiator, possible FKBP-like; hypothetical predicted protein, unknown Nucleotidyltransferase; Zn2/Cys6 DNA- Chro.60311 2524 AAELO 1000037 13772 16345 function binding domain; hypothetical predicted protein, unknown Chro.60313 2525 AAEL01000037 16777 18327 function hypothetical predicted transmembrane Chro.60314 2526 AAEL01000037 18928 20190 protein, unknown function hypothetical predicted transmembrane
Chro.60315 2527 AAEL01000037 20961 21734 protein, unknown function Chro.60316 2528 AAEL01000037 22081 23073 splicing factor, possible RNA-binding domain, RBD;
©
4- Chro.60317 2529 AAEL01000037 24242 25441 cysteine protease, possible hypothetical predicted protein, unknown
Chro.60318 2530 AAEL01000037 25450 26535 function Chro.60319 2531 AAEL01000037 26619 28082 uvb-resistance protein uvr8, possible RCCl/BLIP-π; hypothetical predicted protein, unknown
Chro.60320 2532 AAEL01000037 28538 30650 function
P-loop containing nucleotide triphosphate
Chro.60321 2533 AAEL01000419 37 2310 kinesin heavy chain, possible hydrolases; Chro.60322 2534 AAEL01000419 2876 3121 . POZ domain;
P-loop containing nucleotide triphosphate
Chro.60323 2535 AAEL01000419 5045 5248 t24fl.l protein, probable hydrolases; hypothetical predicted protein, unknown Chro.60324 2536 AAEL01000419 5518 5913 function
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily hypothetical predicted protein, unknown Chro.60326 2537 AAELO 1000802 214 1803 function
S-adenosyl-L-methionine-dependent
Chro.60327 2538 AAEL01000193 242 2047 CG2614 protein, possible methyltransferases;
Chro.60328 2539 AAEL01000193 2067 2717 fl lalθ.2 protein, probable
Chro.60329 2540 AAELO 1000193 3469 4434 sucrose-phosphatase, possible HAD-like; hypothetical predicted protein, unknown
Chro.60330 2541 AAEL01000193 4846 5628 function
Chro.60331 2542 AAELO 1000193 6446 8539 repeat organellar protein, possible hypothetical predicted protein, unknown
Chro.60332 2543 AAEL01000193 8971 9723 function hypothetical predicted protein, unknown
Chro.60333 2544 AAEL01000193 9769 10791 function
O Ul hypothetical predicted protein, unknown
Chro.60334 2545 AAEL01000193 11269 12375 function hypothetical predicted transmembrane
Chro.60335 2546 AAEL01000193 12423 13079 protein, unknown function hypothetical predicted transmembrane
Chro.60336 2547 AAEL01000996 0 280 protein, unknown function hypothetical predicted transmembrane
Chro.60337 2548 AAEL01000041 360 1625 protein, unknown function
Lipovitellin-phosvitin complex,
Chro.60339 2549 AAEL01000041 1789 6000 related to nuclear protein sa-1, possible superhelical domain; hypothetical predicted protein, unknown
Chro.60340 2550 AAEL01000041 6235 10638 function Culin homology domain; aob567, aoflOOl, aoel 10, aoe264 and
Chro.60341 2551 AAEL01000041 11638 14454 aoel30 genes, possible
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.60342 2552 AAEL01000041 14820 15560 bax inhibitor- 1, possible
Chro.60344 2553 AAEL01000041 16218 17348 tyrosyl-tRNA synthetase, probable Nucleotidylyl transferase;
hypothetical predicted multi-pass
Chro.60345 2554 AAELO 1000041 18031 18918 transmembrane protein, unknown function . hypothetical predicted protein, unknown Chro.60346 2555 AAEL01000041 19568 20350 function putative poly(a)-binding protein fabm, PABC (PABP) domain; RNA-binding Chro.60347 2556 AAEL01000041 22088 24328 possible domain, RBD;
hypothetical predicted multi-pass
Chro.60348 2557 AAEL01000041 25294 26577 transmembrane protein, unknown function . Chro.60349 2558 AAEL01000041 26896 27624 uvb-resistance protein, possible Chro.60350 2559 AAEL01000390 79 942 uvb-resistance protein, possible RCCl/BLIP-II; hypothetical predicted protein, unknown
Chro.60351 2560 AAEL01000390 1148 2452 function TPR-like;
Chro.60352 2562 AAEL01000390 2912 5986 putative arabinogalactan protein, possible hypothetical predicted transmembrane Chro.60353 2561 AAEL01000949 301 723 protein, unknown function hypothetical predicted protein, unknown Chro.60354 2563 AAEL01000238 476 2275 function hypothetical predicted transmembrane Chro.60355 2564 AAELO 1000238 2850 4802 protein, unknown function hypothetical predicted protein, unknown
Chro.60357 2565 AAEL01000238 5474 9766 function Chro.60358 2566 AAELO 1000238 10144 10380 hypothetical protein, conserved
Table 1
Ch Gene SEQIDNO. Ch_Accession Start End Description Superfamily
Chro.60359 2567 AAEL01000238 10650 11066 ci-meta2, probable Chro.60360 2568 AAEL01000429 2961 4775 ci-meta2, probable Chro.60361 2569 AAEL01000429 1263 1 1550088 . Chro.60362 2570 AAEL01000429 5 355 asparagine-rich protein, possible Chro.60363 2571 AAELOlOOl 104 0 982 cytohesin-like protein, possible
Sec7 domain; Ypt/Rab-GAP domain of
Chro.60364 2572 AAELO 1000056 805 4677 cytohesin-like protein, possible gypip; hypothetical predicted protein, unknown Chro.60365 2573 AAEL01000056 5246 6703 function hypothetical predicted protein, unknown Chro.60366 2574 AAEL01000056 7591 10098 function
O -4 Cysteine rich protein B (HcpB); Cysteine rich protein B (HcpB); Cysteine rich protein B (HcpB); Cysteine rich protein B
Chro.60367 2575 AAEL01000056 10831 13308 sel-1 protein, possible (HcpB); Cysteine rich protein B (HcpB); Chro.60368 3 AAEL01000056 13760 14197 ribosomal protein S19 Ribosomal protein S 19; Chro.60369 2576 AAEL01000056 15563 15760 60S ribosomal protein-like, probable Ribosomal protein L4; Chro.60371 2577 AAEL01000056 17163 17801 60S ribosomal protein-like, probable Ribosomal protein L4; Chro.60372 2578 AAEL01000056 18260 19420 restin, possible
P-loop containing nucleotide triphosphate
Chro.60373 2579 AAEL01000056 20310 21752 dead box RNA helicase, possible hydrolases;
P-loop containing nucleotide triphosphate Chro.60374 2580 AAEL01000056 23126 23737 small GTP binding protein rabla, probable hydrolases;
S-adenosyl-L-methionine-dependent Chro.60375 2581 AAEL01000056 24263 25891 nucleolar protein-like, probable methyltransferases;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
hypothetical predicted multi-pass
Chro.60376 2582 AAEL01000518 3504 4371 transmembrane protein, unknown function hypothetical predicted protein, unknown
Chro.60377 2583 AAEL01000518 2559 3236 function hypothetical predicted protein, unknown
Chro.60378 2584 AAEL01000518 780 1553 function hypothetical predicted protein, unknown
Chro.60379 2585 AAEL01000092 19996 21006 function
Mov34/MPN/PAD-1 family proteasome
Chro.60380 2586 AAEL01000092 18688 19635 regulatory subunit, probable
1,4-alpha-glucan branching enzyme, (Trans)glycosidases; E set domains; alpha-
O OO Chro.60381 2587 AAEL01000092 14591 17683 probable Amylases, C-terminal beta-sheet domain;
DNA-directed RNA polymerase HTIII beta and beta-prime subunits of DNA
Chro.60382 2588 AAEL01000092 8559 14168 subunit, probable dependent RNA-polymerase; zf-C3HC4/zf-CCCH zinc finger protein,
Chro.60383 2589 AAEL01000092 7057 7581 possible hypothetical predicted protein, unknown
Chro.60384 2590 AAEL01000092 5925 6539 function
G-protein associated signal transduction
Chro.60386 2591 AAELO 1000092 2156 5266 protein
Chro.60387 2592 AAEL01000092 1271 1684 ribosomal protein L32, probable Ribosomal protein L32e; hypothetical predicted protein, unknown
Chro.60388 2593 AAEL01000357 123 527 function hypothetical predicted protein, unknown
Chro.60389 2594 AAEL01000357 1877 2149 function
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily microtubule-associated protein ytml, Chro.60390 2595 AAEL01000357 2742 4124 possible WD40-repeat;
Translational machinery components; N- terminal domain of eukaryotic peptide eukaiyotic peptide chain release factor, chain release factor subunit 1, ERFl; L30e-
Chro.60391 2596 AAEL01000357 4398 5687 probable like;
Chro.60392 2597 AAEL01000345 3835 7374 PI3_PI4_kinase, possible Protein kinase-like (PK-like);
Chro.60393 2598 AAEL01000345 973 3420 protein kinase Protein kinase-like (PK-like); hypothetical predicted protein, unknown
Chro.60394 2599 AAEL01000456 4495 5112 function
translation initiation factor eif-2b epsilon Trimeric LpxA-like enzymes; Nucleotide-
Chro.60395 2600 AAELO 1000456 1610 3790 subunit, possible diphospho-sugar transferases;
K>
O U4/U6 snRNA-assocaited splicing factor,
Chro.60396 2601 AAEL01000456 380 1171 possible RNA-binding domain, RBD;
Chro.60398 2602 AAEL01000371 6972 7378 nucleolar protein, possible
Chro.60399 2603 AAELO 1000371 3033 5336 conserved hypothetical protein hypothetical predicted protein, unknown
Chro.60400 2604 AAEL01000371 1665 2396 function hypothetical predicted protein, unknown
Chro.60401 2605 AAEL01000371 126 641 function hypothetical predicted protein, unknown
Chro.60403 2606 AAEL01000490 7 651 function
Chro.60404 2607 AAEL01000490 698 901 . hypothetical predicted protein, unknown
Chro.60405 2608 AAEL01000490 1585 2184 function
Chro.60406 2609 AAELO 1000490 2882 4702 conserved hypothetical protein
Table 1
Ch_Gene SEQ D) NO. Ch Accession Start End Description Superfamily
Chro.60407 2610 AAEL01000616 174 344 . hypothetical predicted protein, unknown
Chro.60408 2611 AAEL01000616 492 2381 function WD40-repeat; Chro.60409 2612 AAEL01000250 10230 10475 ribonuclease PH-like protein, possible Chro.60410 2613 AAEL01000250 8723 9301 endopeptidase, probable Actin-like ATPase domain; Chro.60411 2614 AAELO 1000250 6762 8381 conserved hypothetical protein Pseudouridine synthase; fyve domain-containing dual specificity
Chro.60412 2615 AAEL01000250 3179 5911 protein phosphatasefyve-dsp Ib, possible (Phosphotyrosine protein) phosphatases II; conserved hypothetical multi-pass Chro.60413 2616 AAELO 1000250 1895 2722 transmembrane protein
26s proteasome non-ATPase regulatory Chro.60414 2617 AAEL01000250 275 1543 subunit, probable TPR-like; hypothetical predicted protein, unknown
O Chro.60415 2618 AAEL01000096 1 750 function hypothetical predicted WD-40 repeat
Chro.60416 2619 AAEL01000096 1975 3153 protein, unknown function WD40-repeat; Chro.60417 2620 AAELO 1000096 3900 4409 sf-assemblin-like protein, possible hypothetical predicted transmembrane
Chro.60419 2621 AAEL01000096 6914 8926 protein, unknown function Ankyrin repeat; hypothetical predicted protein, unknown
Chro.60420 2622 AAEL01000096 10083 11810 function Thioredoxin-like; Chro.60421 2623 AAEL01000096 12038 19027 ankyrin-related protein, possible Ankyrin repeat; hypothetical predicted F-box protein,
Chro.60422 2624 AAELO1000096 19778 20572 unknown function hypothetical predicted protein, unknown Chro.60423 2625 AAEL01000113 1477 2109 function RNA polymerase sigma subunit;
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily similarity to rod-like tail of several Chro.60424 2626 AAEL01000113 2726 4459 myosins, possible Prefoldin; hypothetical predicted protein, unknown Chro.60425 2627 AAEL01000113 5016 6518 function Ubiquitin-like;
Chro.60426 2628 AAEL01000113 8094 8564 pyrroline-5-carboxylate reductase, possible .
Chro.60427 2629 AAEL01000113 9632 16387 PAN domain protein Subtilisin-like;
Chro.60428 2630 AAEL01000113 17237 17488 41 -2 protein antigen precursor
1,4-alpha-glucan branching enzyme,
Chro.60429 2631 AAEL01000113 17901 18155 possible hypothetical predicted protein, unknown
Chro.60430 2632 AAELO 1000531 555 2972 function GYF domain;
Chro.60431 2633 AAEL01000124 123 359 . predicted integral membrane protein,
Chro.60432 2634 AAEL01000124 390 1475 possible hypothetical predicted transmembrane
Chro.60433 2635 AAEL01000124 1590 2219 protein, unknown function
Glyceraldehyde-3 -phosphate glyceraldehyde-3 -phosphate dehydrogenase-like, C-terminal domain;
Chro.60434 2636 AAEL01000124 3050 4069 dehydrogenase, probable NAD(P)-binding Rossmann-fold domains;
Chro.60435 2637 AAEL01000124 4916 6469 hexokinase i, possible Actin-like ATPase domain; hypothetical predicted protein, unknown
Chro.60436 2638 AAEL01000124 6864 7697 function
Chro.60437 2629 AAEL01000124 7821 9221 aspartyl protease precursor, probable Acid proteases;
P-loop containing nucleotide triphosphate
Chro.60438 2640 AAEL01000124 10534 hydrolases;
Table 1
Ch_Gene SEQ TD NO. Ch_Accession Start End Description Superfamily hypothetical predicted protein, unknown
Chro.60439 2641 AAEL01000124 10941 13097 function SET domain;
Chro.60440 2642 AAEL01000124 13162 13566 ribosomal protein L7A L30e-like;
P-loop containing nucleotide triphosphate
Chro.60441 2643 AAEL01000124 14228 17535 SNF2 helicase, possible hydrolases; Homeodomain-like;
Chro.60442 2644 AAEL01000359 7237 7440 .
hypothetical predicted multi-pass
Chro.60443 2645 AAEL01000359 5233 6507 transmembrane protein, unknown function .
Chro.60444 2646 AAEL01000359 3504 4460 putative mitochondrial carrier, possible
Chro.60445 2647 AAEL01000359 3056 3385 . hypothetical predicted protein, unknown
Chro.60446 2648 AAELO 1000359 1362 2402 function hypothetical predicted PH-domain protein,
Chro.60447 2649 AAEL01000359 44 1234 unknown function PH domain-like;
Chro.60448 2650 AAEL01000237 7880 10249 hypothetical garp protein, possible hydroxyproline-rich glycoprotein dz-hrgp
Chro.60450 2651 AAEL01000237 4741 7176 precursor, probable
Chro.60451 2652 AAEL01000237 4491 4664 . hydroxyproline-rich glycoprotein dz-hrgp
Chro.60453 2653 AAEL01000237 2173 3159 precursor, probable
Chro.60454 2654 AAEL01000237 1932 2165 . hypothetical predicted protein, unknown
Chro.60455 2655 AAELO 1000908 706 1260 function
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
EF-G/eEF-2 domains IH and V; Ribosomal protein S5 domain 2-like; Translation
Chro.60456 2656 AAEL01000221 9316 11937 elongation factor-like protein proteins;
Chro.60457 2657 AAELO 1000221 8566 9225 thioredoxin-like protein, possible Thioredoxin-like; hypothetical predicted protein, unknown
Chro.60458 2658 AAEL01000221 7838 8311 function
ELONGATIONFACTOR 1 -ALPHA (EF-I P-loop containing nucleotide triphosphate
ALPHA) G gi| 1737177|gb|AAC47526.11 hydrolases; EF-Tu/eEF-lalpha/eIF2-
Chro.60459 2659 AAELO 1000221 5871 7178 elongation factor 1-alpha gamma C-terminal domain; hypothetical predicted transmembrane
Chro.60460 2660 AAEL01000221 2488 4425 protein, unknown function
K) hypothetical predicted protein, unknown w Chro.60461 2661 AAELO 1000221 1863 2345 function
Catalytic domain of cyclic nucleotide
Chro.60462 2662 AAEL01000169 661 1866 phosphdiesterase, possible phosphodiesterase 4b2b; hypothetical predicted protein, unknown
Chro.60463 2663 AAEL01000169 2391 5513 function hypothetical predicted protein, unknown
Chro.60464 2664 AAELOlOOl 159 444 890 function
hypothetical predicted multi-pass Culin homology domain; Culin repeat;
Chro.60465 2665 AAEL01000169 5570 9184 transmembrane protein, unknown function "Winged helix" DNA-binding domain; hypothetical predicted protein, unknown
Chro.60466 2666 AAELO 1000169 9852 12149 function
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
hypothetical predicted multi-pass
Chro.60467 2667 AAELO 1000169 12683 13072 transmembrane protein, unknown function hypothetical predicted protein, unknown
Chro.60468 2668 AAEL01000169 13345 14665 function hypothetical predicted protein, unknown
Chro.60469 2669 AAEL01000990 115 555 function alpha/beta-Hydrolases; hypothetical predicted protein, unknown
Chro.60470 2670 AAELO 1000082 20850 21572 function hypothetical predicted protein, unknown
Chro.60471 2671 AAELO 1000082 14575 19554 function hypothetical predicted protein, unknown
Chro.60472 2672 AAELO 1000082 13219 13692 function
S Chro.60473 2673 AAEL01000082 12030 12926 conserved hypothetical protein
Chro.60474 2674 AAEL01000082 9671 11761 HEC protein, possible Prefoldin;
Chro.60475 2675 AAELO 1000082 4137 9044 formin-related protein, possible TPR-like;
Chro.60476 2676 AAEL01000082 2427 2648
Chro.60477 2677 AAELO 1000082 786 1874 myosin light chain, possible EF-hand;
Chro.60478 2678 AAEL01000425 67 2271 conserved hypothetical protein putative ubiquitin-conjugating enzyme,
Chro.60479 2679 AAEL01000425 2284 2733 probable UBC-like;
Chro.60480 2680 AAELO 1000425 3590 4258 ribsomal protein LlO, probable Ribosomal protein LlOe;
Chro.60481 2681 AAEL01000272 113 1171 protein phosphatase 2b, probable Metallo-dependent phosphatases;
P-loop containing nucleotide triphosphate hydrolases; Homodimeric domain of signal
Chro.60483 2682 AAELO 1000272 1580 5134 kinesin-like boursin, possible transducing histidine kinase;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.60484 2683 AAELO 1000272 5735 6832 GTPase activator protein, possible Ypt/Rab-GAP domain of gyp Ip; hypothetical predicted protein, unknown
Chro.60485 2684 AAEL01000272 7425 8894 function Chro.60486 2685 AAEL01001231 0 251 MO25-family protein, possible ARM repeat; hypothetical predicted protein, unknown
Chro.60487 2686 AAELO 1000253 10205 10624 function hypothetical predicted Nuclearjtnove Chro.60488 2687 AAEL01000253 9383 10114 domain protein, unknown function HSP20-like chaperones; conserved hypothetical ATP binding P-loop containing nucleotide triphosphate Chro.60489 2688 AAEL01000253 8315 9118 protein hydrolases; hypothetical predicted protein, unknown Chro.60490 2689 AAELO 1000253 6440 7807 function
'Jl hypothetical predicted protein, unknown Chro.60491 2690 AAEL01000264 5303 9619 function hypothetical predicted protein, unknown Chro.60492 2691 AAEL01000264 2624 4795 function hypothetical predicted protein, unknown Chro.60493 2692 AAEL01000858 353 961 function hypothetical predicted protein, unknown
Chro.60494 2693 AAEL01000471 448 918 function Chro.60495 2694 AAEL01000471 1237 1827 ribosomal protein S5, probable Ribosomal protein S7;
Chro.60496 2695 AAEL01000471 2228 3181 phosphoglycerate mutase domain protein Phosphoglycerate mutase-like;
P-loop containing nucleotide triphosphate Chro.60497 2696 AAELO 1000296 6201 9263 myosin-related protein, possible hydrolases;
P-loop containing nucleotide triphosphate Chro.60498 2697 AAEL01000296 4129 5427 26s proteasome ATPase subunit, probable hydrolases;
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
hypothetical predicted multi-pass
Chro.60499 2698 AAEL01000296 3332 4039 transmembrane protein, unknown function
RNA-binding domain, RBD; Superantigen
Chro.60500 2699 AAELO 1000296 1035 2705 RNA-binding domain protein toxins, C-terminal domain; hypothetical predicted protein, unknown
Chro.60502 2700 AAEL01000847 452 1063 function EF-hand; Chro.60503 2701 AAEL01000847 4 243 . Chro.60505 2702 AAELO 1000732 220 609 aminoacyl-tRNA synthetase, probable C-terminal domain of ProRS;
DNA polymerase family B subunit,
Chro.60506 2703 AAEL01000732 782 2245 probable DNA/RNA polymerases;
P-loop containing nucleotide triphosphate
Chro.60507 2704 AAEL01000166 9958 12930 DEAD/DEAH box helicase hydrolases; hypothetical predicted protein, unknown Chro.60508 2705 AAELO 1000166 8674 9678 function hypothetical predicted transmembrane
Chro.60509 2706 AAEL01000166 6384 7634 protein, unknown function Chro.60510 2707 AAEL01000166 5884 6171 hypothetical protein, conserved hypothetical predicted Armadillo/beta- catenin-like repeat protein, unknown
Chro.60511 2708 AAELO 1000166 332 5605 function ARM repeat; PH domain-like; hypothetical predicted Armadillo/beta- catenin-like repeat protein, unknown
Chro.60512 2709 AAEL01000040 27443 28438 function hypothetical predicted protein, unknown
Chro.60513 2710 AAEL01000040 22758 24935 function Chro.60514 2711 AAEL01000040 20111 21601 ankyrin-repeat protein Ankyrin repeat;
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.60515 2712 AAEL01000040 18615 19256 splicing factor, probable RNA-binding domain, RBD;
hypothetical predicted multi-pass P-loop containing nucleotide triphosphate
Chro.60516 2713 AAEL01000040 15557 18436 transmembrane protein, unknown function hydrolases; Chro.60517 2714 AAEL01000040 13174 15120 putative telomeric DNA binding protein Homeodomain-like; hypothetical predicted protein, unknown
Chro.60518 2715 AAEL01000040 11367 12887 function hypothetical predicted transmembrane Chro.60519 2716 AAELO 1000040 7312 9711 protein, unknown function
DHHC zinc finger multi-pass
Chro.60520 2717 AAELO 1000040 6127 7098 transmembrane protein Zn2/Cys6 DNA-binding domain; Chro.60521 2718 AAELO 1000040 2424 5186 ubiquitin-specifϊc protease, probable Cysteine proteinases; Chro.60522 2719 AAELO 1000040 152 2140 WD40 repeat myosin-like protein WD40-repeat;
-4 P-loop containing nucleotide triphosphate hydrolases; Myosin Sl fragment, N-
Chro.60523 2720 AAELO 1000023 798 3404 WD40 repeat myosin-like protein terminal domain;
Glutamine synthase/guanido kinase;
Chro.60524 2721 AAELO 1000023 3760 5205 glutamine synthetase, probable Glutamine synthetase, N-terminal domain;
DNA-directed RNA polymerases iii 39 Kd
Chro.60525 2722 AAEL01000023 5521 6480 polypeptide, possible Chro.60526 2723 AAELO 1000023 6957 7931 ankyrin-related protein, possible Ankyrin repeat;
hypothetical predicted multi-pass
Chro.60527 2724 AAELO 1000023 8575 9123 transmembrane protein, unknown function Chro.60529 2725 AAEL01000023 9670 10605 mRNA export protein, probable WD40-repeat; Chro.60530 2726 AAELO 1000023 11207 11461 ribosomal protein L26, probable Translation proteins SH3-like domain;
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.60531 2727 AAEL01000023 11923 12549 ribosomal protein S8, probable hypothetical predicted protein, unknown Chro.60533 2728 AAEL01000023 14653 15030 function
N-utilization substance G protein NusG, N- spt5-like transcription initiation protein, terminal domain; Translation proteins SH3-
Chro.60534 2729 AAELO 1000023 15484 17949 possible like domain; hypothetical predicted protein, unknown
Chro.60535 2730 AAEL01000023 20571 22151 function Chro.60536 2731 AAELO 1000023 22451 23299 splicing factor 3a subunit 3, possible conserved hypothetical multi-pass
Chro.60537 2732 AAEL01000023 24446 26119 transmembrane protein Chro.60538 2733 AAELO 1000023 26170 28245 SAC3/GANP domain protein
P-loop containing nucleotide triphosphate
OO Chro.60539 2734 AAELO 1000023 28349 28552 ATP-binding cassette transporter hydrolases;
P-loop containing nucleotide triphosphate
Chro.60540 2735 AAEL01000023 28738 32589 ATP-binding cassette protein 3 hydrolases; Chro.60541 2736 AAELO 1000023 32828 35230 RNA-binding domain protein RNA-binding domain, RBD; hypothetical predicted protein, unknown
Chro.60542 2737 AAELO 1000023 35463 35960 function Chro.60543 2738 AAEL01000023 35997 36332 .
hypothetical predicted multi-pass
Chro.60544 2739 AAEL01000060 24949 25560 transmembrane protein, unknown function
hypothetical predicted multi-pass
Chro.60545 2740 AAEL01000060 23141 23974 transmembrane protein, unknown function
Chro.60546 2741 AAEL01000060 19822 22917 splicing factor, possible ARM repeat;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.60547 2742 AAEL01000060 19552 19788 .
Tubulin, C-terminal domain; Tubulin,
Chro.60548 2743 AAELO 1000060 GTPase domain; cell cycle control cwc2-related protein,
Chro.60549 2744 AAEL01000060 RNA-binding domain, RBD;
hypothetical predicted multi-pass
Chro.60550 2745 AAELO 1000060 13810 15030 transmembrane protein, unknown function . hypothetical predicted protein, unknown
Chro.60551 2746 AAEL01000060 9552 13022 function B-box zinc-binding domain; hypothetical predicted protein, unknown
Chro.60552 2747 AAELO 1000060 7860 9179 function hypothetical predicted protein, unknown κ>
Chro.60553 2748 AAEL01000060 6923 7249 function hypothetical predicted protein, unknown
Chro.60554 2749 AAELO 1000060 6162 6485 function
P-loop containing nucleotide triphosphate
Chro.60555 2750 AAEL01000060 3883 5514 DEALVDEAH box RNA helicase, possible hydrolases; hypothetical predicted protein, unknown
Chro.60556 2751 AAELO 1000060 3466 3591 function
Chro.60558 2752 AAEL01000060 1900 2166 subtilisin-like serine protease, probable putative guanine nucleotide-binding WD40-repeat; RING finger domain,
Chro.60560 2753 AAELO 1000168 2417 4075 protein, possible C3HC4;
P-loop containing nucleotide triphosphate
Chro.60561 2754 AAEL01000168 4270 6306 DEAD/DEAH box helicase, possible hydrolases; hypothetical predicted protein, unknown
Chro.60562 2755 AAELO 1000168 6613 8304 function
Table 1
Ch_Gene SEQ BD NO. Ch_Accession Start End Description Superfamily
Chro.60563 2756 AAEL01000168 8888 10093 cryptopain precursor Cysteine proteinases; Chro.60564 2757 AAELO 1000168 10427 11767 putative transporter Chro.60565 2758 AAEL01000168 13583 14809 zf-CCCH zinc finger protein
hypothetical predicted multi-pass
Chro.60566 2759 AAELO 1000445 678 2399 transmembrane protein, unknown function . Chro.60567 2760 AAELO 1000445 3578 5383 adaptin-like protein, possible ARM repeat;
hypothetical predicted multi-pass C2 domain (Calcium/lipid-binding domain,
Chro.60568 2761 AAEL01000050 25466 26824 transmembrane protein, unknown function CaLB); hypothetical predicted protein, unknown Chro.60569 2762 AAELO 1000050 23973 24761 function
Protein kinase-like (PK-like); Protein
O Chro.60570 2763 AAELO 1000050 22435 23487 serine/threonine-protein kinase, possible kinase-like (PK-like);
GroEL apical domain-like; GroEL equatorial domain-like chaperone
Chro.60573 2764 AAEL01000050 20023 21879 Hsp60 equatorial domain; Chro.60574 2765 AAELO 1000050 18302 19459 similar to CGI-67 protein, possible alpha/beta-Hydrolases; Chro.60575 2766 AAEL01000050 17670 17882 .
HEAT repeat-domain protein, unknown
Chro.60576 2767 AAELO 1000050 13519 17379 function ARM repeat; Chro.60577 2768 AAEL01000050 12423 12953 WD domain protein WD40-repeat; hypothetical predicted protein, unknown
Chro.60579 2769 AAEL01000050 10890 11417 function HSP20-like chaperones; Chro.60580 2770 AAEL01000050 9674 10213 transcription factor, possible
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
hypothetical predicted multi-pass Chro.60581 2771 AAEL01000050 8791 9564 transmembrane protein, unknown function
hypothetical predicted multi-pass
Chro.60582 2772 AAEL01000050 8341 8454 transmembrane protein, unknown function .
Chro.60584 2773 AAEL01000050 5768 7777 protein kinase Protein kinase-like (PK-like);
Chro.60585 2774 AAEL01000050 3679 5223 putative ribophorin i, possible
GroEL equatorial domain-like chaperone
Chro.60586 2775 AAEL01000050 1820 3415 TCP-l/cpn60 chaperonin-related protein equatorial domain;
Chro.60587 2776 AAELO 1000050 9 1379 sgt-related protein, possible
K) hypothetical predicted multi-pass
Chro.60588 2777 AAEL01000998 262 861 transmembrane protein, unknown function hypothetical predicted transmembrane
Chro.60589 2778 AAELOlOOl 170 304 678 protein, unknown function hypothetical predicted transmembrane
Chro.60590 2779 AAEL01001318 30 692 protein, unknown function
Chro.60592 2780 AAEL01001056 316 1081 Met-10 domain protein
Chro.60593 2781 AAELO 1000495 217 1146 lectin-domain protein
Chro.60594 2782 AAEL01000495 1236 2615 deltex-related RING finger protein RING finger domain, C3HC4; hypothetical predicted protein, unknown
Chro.60595 2783 AAELO 1000495 3298 4329 function hypothetical predicted protein, unknown
Chro.60596 2784 AAEL01000495 4336 4650 function Protein kinase-like (PK-like); hypothetical predicted transmembrane
Chro.60597 2785 AAELO 1000444 641 2848 protein, unknown function
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily conserved hypothetical transmembrane
Chro.60598 2786 AAELO 1000444 3704 5458 protein conserved hypothetical transmembrane
Chro.60599 2787 AAELO 1000687 920 1444 protein conserved hypothetical transmembrane
Chro.60600 2788 AAELOlOOl 145 137 817 protein conserved hypothetical transmembrane
Chro.60602 2789 AAEL01000109 25 993 protein putative serine/threonine-protein kinase a,
Chro.60603 2790 AAEL01000109 1670 3715 possible Protein kinase-like (PK-like); hypothetical predicted protein, unknown
Chro.60604 2791 AAEL01000109 4026 10733 function
K) KJ P-loop containing nucleotide triphosphate
Chro.60605 2792 AAEL01000109 11485 13737 ABC transporter-like protein, possible hydrolases; hypothetical predicted protein, unknown
Chro.60606 2793 AAEL01000109 14157 14639 function hypothetical predicted signal-peptide
Chro.60607 2794 AAELO 1000109 15040 18387 protein, unknown function hypothetical predicted protein, unknown
Chro.60608 2795 AAELO 1001087 892 1020 function hypothetical predicted protein, unknown
Chro.60609 2796 AAEL01001087 440 655 function hypothetical predicted protein, unknown
Chro.60610 2797 AAEL01000217 1 1068 function hypothetical predicted protein, unknown
Chro.60611 2798 AAEL01000217 1311 1562 function
Table 1
Ch_Gene SEQ H) NO. Ch_Accession Start End Description Superfamily hypothetical predicted protein, unknown
Chro.60612 2799 AAEL01000217 6314 9127 function hypothetical predicted protein, unknown
Chro.60614 2800 AAEL01000217 9921 11807 function hypothetical predicted protein, unknown
Chro.60615 2801 AAEL01000819 916 1833 function hypothetical predicted protein, unknown
Chro.60616 2802 AAEL01000383 5075 6772 function
P-loop containing nucleotide triphosphate
Chro.60617 2803 AAEL01000383 2504 4603 putative ABC transporter protein, possible hydrolases; hypothetical predicted protein, unknown
Chro.60618 2804 AAEL01000383 162 1622 function
K) hypothetical predicted protein, unknown
Chro.60619 2805 AAEL01000730 85 1122 function hypothetical predicted transmembrane
Chro.60620 2806 AAEL01000244 9824 10783 protein, unknown function hypothetical predicted protein, unknown
Chro.60621 2807 AAEL01000244 7397 9025 function hypothetical predicted protein, unknown
Chro.60622 2808 AAEL01000244 4857 7199 function hypothetical predicted protein, unknown
Chro.60623 2809 AAEL01000244 2434 4593 function hypothetical predicted protein, unknown
Chro.60624 2810 AAEL01000244 240 2114 function hypothetical predicted transmembrane
Chro.60625 2811 AAEL01000176 2199 3689 protein, unknown function
Table 1
Ch_Gene S SEEQQ IIDD NO. Ch Accession Start End Description Superfamily hypothetical predicted transmembrane
Chro.60626 2812 AAELO 1000176 4348 8157 protein, unknown function
P-loop containing nucleotide triphosphate
Chro.60627 2813 AAEL01000176 8851 10782 putative ABC transporter protein, possible hydrolases;
Chro.60628 2814 AAEL01000868 655 1425 .
Chro.60629 2815 AAEL01000804 1289 1486 .
Chro.60630 2816 AAEL01000176 11794 12012 . hypothetical predicted protein, unknown
Chro.60631 2817 AAEL01000385 2901 3536 function hypothetical predicted protein, unknown
Chro.60634 2818 AAEL01000309 2901 3536 function
Chro.61000 2819 AAEL01001061 825 1070 hypothetical protein cgd6_l 240
K) hypothetical predicted protein, unknown
Chro.61001 2820 AAELOlOOl 167 606 911 function
Chro.61002 2821 AAEL01000920 3 1238 Ser/Thr protein kinase
Chro.61003 2822 AAELO 1001029 129 335 26s protease regulatory subunit 8, probable hypothetical protein, possible G-patch
Chro.61004 2823 AAEL01000914 315 440 domain Chro.61005 2824 AAEL01000662 2 1525 hypothetical protein cgd6_450 Chro.61006 2825 AAEL01000296 493 630 . Chro.61007 2826 AAELO 1000050 8291 8452 . Chro.61008 2827 AAEL01000025 29655 29921 . Chro.61009 2828 AAELO 1000041 15954 16043 . Chro.61010 2829 AAEL01000456 1 55 . Chro.61011 2830 AAEL01001081 532 738 . Chro.61012 2831 AAEL01001081 1 58 .
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily hypothetical protein with signal peptide and 7 transmembrane domains and possible ER retention motif, conserved in
Chro.61013 2832 AAEL01001415 1 156 Plasmodium Chro.61014 2833 AAEL01000769 830 1038 . Chro.61015 2834 AAEL01001348 1 79 . Chro.61016 2835 AAEL01000498 4068 4103 . Chro.70010 2836 AAEL01000470 1533 3845 . Chro.70011 2837 AAELO 1000031 90 332 . Chro.70013 2838 AAEL01000031 331 1044 . Chro.70014 2839 AAELO 1000031 1199 1423 . Ankyrin repeat; Chro.70015 2840 AAEL01000031 5003 9850 . Chro.70016 2841 AAELO 1000031 9974 12415 calcium-dependent protein kinase Protein kmase-like (PK-like); EF-hand;
Ul Chro.70017 2842 AAEL01000031 12879 13259 . Chro.70018 2843 AAELO 1000031 13577 14848 hypothetical protein Acyl-CoA N-acyltransferases (Nat); Chro.70019 2844 AAELO 1000031 15596 16828 , RING finger domain, C3HC4;
P-loop containing nucleotide triphosphate
Chro.70020 2845 AAELO 1000031 17163 17957 expressed protein hydrolases;
Chro.70021 2846 AAEL01000031 18355 21093 high affinity sulphate transporter -related Anti-sigma factor antagonist SpoIIaa;
Chro.70022 2847 AAELO 1000031 21938 22939 Homo sapiens STRIN protein RING finger domain, C3HC4;
Sialidases (neuraminidases); Sialidases
Chro.70023 2848 AAEL01000031 23593 26613 sortilin, putative (neuraminidases); cAMP-dependent protein kinase regulatory
Chro.70024 2849 AAEL01000031 27023 27847 subunit cAMP-binding domain-like;
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
4OS RIBOSOMAL PROTEIN
S 14 D gi| 1076215|pir||A56064 ribosomal protein S 14 - Chlamydomonas reinhardtii D gi|463857|gb|AAB60274.11
Chro.70025 2850 AAELO 1000031 29052 29330 ribosomal protein S 14 Translational machinery components;
Chro.70026 2851 AAEL01000031 29798 30013 .
HMG-box; Glucocorticoid receptor-like
Chro.70027 2852 AAELO 1000031 31533 33329 conserved hypothetical protein (DNA-binding domain);
Chro.70028 2853 AAEL01000031 33351 33572 .
S-adenosyl-L-methionine-dependent
Chro.70029 2854 AAEL01000410 813 1280 methyltransferase, putative methyltransferases;
Chro.70030 2855 AAEL01000410 3533 3973 .
Chro.70031 2856 AAEL01000410 4786 4920 .
Chro.70032 2857 AAELO 1000410 5141 5698 .
Chro.70033 2858 AAELO 1000011 299 973 . putative immunophilin/FKBP-type peptidyl
Chro.70034 2859 AAELO 1000011 995 1933 prolyl cis-trans isomerase FKBP-like;
P-loop containing nucleotide triphosphate
Chro.70035 2860 AAELO 1000011 2374 3012 GTP-binding nuclear protein ran/tc4 hydrolases;
Exosome complex exonuclease RRP43 Ribosomal protein S5 domain 2-like; (Ribosomal RNA processing protein Polynucleotide phosphorylase/guanosine 43)Dgi|22208743|emb|CAD43467.1| CBP- pentaphosphate synthase (PNPase/GPSI),
Chro.70036 2861 AAELO 1000011 3334 4209 interacting protein 3 domain 3;
Chro.70037 2862 AAELO 1000011 4460 5371 .
Chro.70038 2863 AAEL01000011 5377 7635 expressed protein
Chro.70039 2864 AAELOlOOOOll 7819 8421 hypothetical protein, conserved Cyclin-like;
111
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
FAD/NAD(P)-binding domain; NAD(P)- binding Rossmann-fold domains; FYVE/PHD zinc finger; RING finger
Chro.70040 2865 AAELO 1000011 9601 13095 . domain, C3HC4;
Cell division control protein
28 D gi|2117789[pir|| JC4827 protein kinase
(EC 2.7.1.37) cdc28 - yeast (Candida albicans)Dgi|520628|emb|CAA56338.1|
Chro.70041 2866 AAEL01000011 13453 14631 Cdc 28 protein kinase Protein kinase-like (PK-like); Chro.70042 2867 AAEL01000011 15668 17605 .
LCCL domain; Galactose-binding domain- like; Fibrinogen C-terminal domain-like; Ricin B-like lectins; Concanavalin A-like
Chro.70043 2868 AAELO 1000011 18571 22926 hypothetical protein lectins/glucanases; Chro.70044 2869 AAELO 1000011 23051 24427 .
60S ribosomal protein
L18aDgi|13430184|gb|AAK25759.1|
Chro.70045 2870 AAEL01000011 25420 25977 ribosomal protein Ll 8a Chro.70046 2871 AAEL01000011 27290 29107 PhglB
golgi reassembly stacking protein 2,
Chro.70047 2872 AAEL01000011 2 299334499 31550 possibly N-myristoylated (53.7 kD) (41879) PDZ domain-like; Chro.70048 2873 AAELO 1000011 3311887799 33003 hypothetical protein
Heat shock protein 7OkD (HSP70), C- terminal substrate-binding fragment; Actin-
Chro.70049 2974 AAEL01000011 34858 36225 heat shock protein 70 precursor like ATPase domain;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
similar to Dictyostelium discoideum (Slime
Chro.70050 2875 AAELOlOOOOll 37268 39106 mold). Random slug cDNA-11 (Fragment) alphafaeta-Hydrolases; Chro.70051 2876 AAEL01000011 39510 41249 RNA-binding domain, RBD;
P-loop containing nucleotide triphosphate
Chro.70052 2877 AAELOlOOOOll 41333 42490 hypothetical protein L2954.08 hydrolases; Chro.70053 2878 AAELOlOOOOll 43335 44378 . Chro.70054 2879 AAELOlOOOOll 45161 45625 hypothetical protein
RING finger domain, C3HC4; P-loop
SNF2 domain/helicase domain/RING containing nucleotide triphosphate
Chro.70055 2880 AAEL01000344 411 5789 finger domain-containing protein hydrolases; Chro.70056 2881 AAELO 1000344 6586 7548 cyclin-dependent kinase-related kinase Protein kinase-like (PK-like);
M Chro.70057 2882 AAELO 1000344 7620 8114
% Chro.70058 2883 AAEL01000831 1522 1731 cytidine diphosphate-diacylglycerol
Chro.70059 2884 AAEL01000927 113 847 synthase Chro.70060 2885 AAEL01000986 452 808
HAD-like; Calcium ATPase, transduction domain A; Calcium ATPase, ATP-binding
Chro.70061 2886 AAEL01000175 11251 14253 P-type ATPase3 domain N;
Lactate & malate dehydrogenases, C- terminal domain; NAD(P)-binding
Chro.70062 2887 AAEL01000175 9686 10636 malate dehydrogenase Rossmann-fold domains;
Lactate & malate dehydrogenases, C- terminal domain; NAD(P)-binding
Chro.70063 2888 AAEL01000175 8305 9270 lactate dehydrogenase Rossmann-fold domains; Chro.70064 2889 AAELO 1000175 6764 7408
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.70065 2890 AAELO 1000175 4944 6710 . .
Chro.70066 2891 AAELO 1000175 4381 4731 . Zinc beta-ribbon;
Cyclophilin (peptidylprolyl isomerase);
Chro.70067 2892 AAEL01000175 1808 4132 putative protein-related WD40-repeat;
Chro.70068 2893 AAEL01000142 15908 16360 .
Chro.70069 2894 AAEL01000142 14441 15649 hypothetical protein
C-terminal (heme dl) domain of
Chro.70070 2895 AAEL01000142 12466 13227 hypothetical protein AN3785.2 cytochrome cdl -nitrite reductase;
Homo sapiens tetratricopeptide repeat
Chro.70071 2896 AAEL01000142 9516 10688 domain 4 TPR-like;
Chro.70072 2897 AAEL01000142 5901 9068 .
Chro.70073 2898 AAEL01000142 5524 5769 .
Chro.70074 2899 AAEL01000142 4721 5407 protein kinase, putative Protein kinase-like (PK-like);
K) Chro.70075 2900 AAEL01000142 4183 4557 .
Chro.70076 2901 AAEL01000142 1329 3209 hypothetical protein
C-terminal domain of phosphatidylinositol
Chro.70077 2902 AAEL01001254 104 703 . transfer protein secl4p;
S-adenosyl-L-methionine-dependent
Chro.70078 2903 AAELO 1000255 66 1010 hypothetical protein methyltransferases;
P-loop containing nucleotide triphosphate
Chro.70079 2904 AAELO 1000255 4250 4642 DEAH-box RNAhelicase hydrolases;
Chro.70080 2905 AAEL01000255 5614 6954 . Cyclin-like;
Chro.70081 2906 AAEL01000255 7807 8655 cyclin A Cyclin-like;
Chro.70082 2907 AAELO 1000255 9423 10358 probable syntaxin - Arabidopsis thaliana t-snare proteins;
Chro.70083 2908 AAEL01000282 392 1198 .
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
P-loop containing nucleotide triphosphate
Chro.70084 2909 AAELO 1000282 3228 6947 DNA polymerase theta hydrolases;
Eukaryotic type KH-domain (eKH- domain); Eukaryotic type KH-domain
Chro.70085 2910 AAEL01000282 7638 8732 hypothetical protein (eKH-domain);
Chro.70086 2911 AAEL01000282 9516 9578 .
Chro.70087 2912 AAEL01001043 84 557 .
Chro.70088 2913 AAEL01000913 369 1028 .
Chro.70090 2914 AAEL01000473 151 2118 .
Chro.70091 2915 AAELO 1000473 2888 3781 .
Chro.70092 2916 AAELO 1000473 3933 4217 .
Chro.70093 2917 AAEL01000898 834 1463 .
Chro.70094 2918 AAEL01000380 184 4251 .
W
O similar to Plasmodium falciparum (isolate C2 domain (Calcium/lipid-binding domain,
Chro.70095 2919 AAEL01000529 2679 4163 3D7). Hypothetical protein CaLB);
Chro.70096 2920 AAELO 1000529 1094 1426 .
Chro.70098 2921 AAELO 1000529 68 412 . EF-hand;
Chro.70100 2922 AAEL01000215 10234 11181 Unknown (protein for MGC:75638) Metallo-dependent phosphatases;
P-loop containing nucleotide triphosphate
Chro.70101 2923 AAELO 1000215 7211 9736 DNA repair protein -related hydrolases;
Chro.70102 2924 AAEL01000215 5711 7006 Unknown (protein for MGC:76136) tRNA-guanine transglycosylase;
Chro.70103 2925 AAEL01000215 4752 5156 . .
Multidrug efflux transporter AcrB
Chro.70104 2926 AAELO 1000215 2448 4511 patched family protein, putative transmembrane domain;
Multidrug efflux transporter AcrB
Chro.70105 2927 AAELO 1000215 783 1016 patched protein family transmembrane domain;
Table 1
Ch_Gene ! SEQ ID NO. Ch_Accession Start End Description Superfamily
Multidrug efflux transporter AcrB
Chro.70106 2928 AAELO 1000215 515 727 patched family member (ptc-1) transmembrane domain;
Chro.70107 2929 AAEL01000857 1024 1506 normocyte binding protein 2a
Chro.70108 2930 AAELO 1000172 223 1443 . ARM repeat;
Chro.70109 2931 AAEL01000172 1794 2573 .
Chro.70110 2932 AAELO 1000172 3013 4773 hypothetical protein WD40-repeat;
Chro.70111 2933 AAEL01000172 5724 7973 .
Chro.70112 2934 AAEL01000172 8122 9630 .
Chro.70113 2935 AAELO 1000172 10049 11230 phosphoglycerate kinase Phosphoglycerate kinase;
Chro.70114 2936 AAEL01000172 12273 13706 Hypothetical protein CBG15710
Chro.70115 2937 AAELOlOOl 151 83 412 hypothetical protein TPR-like;
Chro.70116 2938 AAELO 1000503 451 2187 .
Chro.70117 2939 AAELO 1000503 3235 4095 dentin phosphoryn RNA-binding domain, RBD;
Chro.70118 2940 AAELO 1000459 2018 3439 Pfsecόl
Chro.70119 2941 AAELO 1000459 149 1576 .
Chro.70121 2942 AAELO 1000928 142 1278 ENSANGP00000023353
Chro.70122 2943 AAELO 1000607 320 3339 hypothetical protein Ankyrin repeat; SET domain;
Chro.70123 2944 AAEL01000130 136 897 . .
2OG-Fe oxygenase superfamily (67.4 kD)
Chro.70124 2945 AAEL01000130 1114 2166 (3E801) RNA-binding domain, RBD;
3-carboxy-cis,cis-mucoante lactonizing
Chro.70125 2946 AAEL01000130 14969 16864 hypothetical protein enzyme;
Agouti-related protein; Superantigen
Chro.70126 2947 AAEL01000406 1613 2047 GlO protein toxins, C-terminal domain;
Chro.70128 2948 AAEL01000406 2300 2905 unnamed protein product Ribonuclease H-like;
Chro.70129 2949 AAELO 1000406 3712 4263 S4 domain, putative Alpha-L RNA-binding motif;
Chro.70130 2950 AAEL01000406 5328 5912 hypothetical protein •
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.70131 2951 AAELO 1000976 6 356 hypothetical protein
Chro.70132 2052 AAEL01000834 1045 1656 hypothetical protein, conserved
Chro.70133 2953 AAEL01000157 1685 2875 . NTF2-like;
Chro.70134 2954 AAEL01000157 2880 4889 .
Chro.70135 2955 AAEL01000157 5180 6409 Hypothetical protein CBG20922
Chro.70136 2956 AAELO 1000157 7401 9134 hypothetical protein
Chro.70137 2957 AAEL01000157 10149 14126 hypothetical protein Bromodomain;
Chro.70138 2958 AAEL01000157 14811 15537 K1AA0216
Chro.70139 2959 AAELOlOOl 186 89 892 .
Chro.70140 2960 AAEL01000999 48 548 ENSANGP00000022085
Chro.70141 2961 AAEL01000962 406 1221 . κ> Chro.70142 2962 AAELO 1000088 4106 7327 . RING finger domain, C3HC4; κ> Chro.70143 2963 AAEL01000088 7643 8326 hypothetical protein
Chro.70144 2964 AAEL01000088 8887 11490 putative protein kinase Protein kinase-like (PK-like);
Chro.70145 2965 AAELO 1000088 11629 14661 ppg3 Cyclin-like;
Chro.70146 2966 AAEL01000088 15582 16199 .
Chro.70147 2967 AAELO1OOOO88 16417 18216 .
Chro.70148 2968 AAELO 1000088 18464 19837 .
Chro.70149 2969 AAEL01000088 20104 21090 .
Chro.70150 2970 AAEL01000088 21210 21400 .
Plasmodium falciparum CDPK2 protein
Chro.70151 2971 AAEL01000024 335 3460 related Protein kinase-like (PK-like); EF-hand;
Chro.70152 2972 AAEL01000024 3840 16340 .
Chro.70153 2973 AAEL01000024 17336 17902 .
Chro.70155 2974 AAEL01000024 18706 20466 .
Chro.70156 2975 AAEL01000024 20927 21820 .
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
UDP-N-acetyl-D- galactosamine:polypeptide N- Nucleotide-diphospho-sugar transferases;
Chro.70157 2976 AAEL01000003 75080 76294 acetylgalactosaminyltransferase T4 Ricin B-like lectins;
Chro.70158 2977 AAELO 1000003 74710 75087 .
Chro.70159 2978 AAEL01000003 73158 74720 casein kinase π, alpha subunit, putative Protein kmase-like (PK-like); serine threonine protein kinase; possibly
Chro.70160 2979 AAEL01000003 70528 72978 sporulation specific Protein kinase-like (PK-like); hypothetical predicted transmembrane
Chro.70161 2980 AAEL01000003 66575 69823 protein, unknown function
Chro.70162 2981 AAELO 1000003 63920 65128 .
C-terminal domain of phosphatidylinositol
Chro.70163 2982 AAEL01000003 59346 62384 . transfer protein secl4p;
Chro.70164 2983 AAELO 1000003 58137 58715 .
Chro.70165 2984 AAEL01000003
Chro.70166 2985 AAEL01000003 55851 56852 hypothetical protein EBAC750-10A10.25 .
Chro.70167 2986 AAELO 1000003 53528 55720 .
P-loop containing nucleotide triphosphate
Chro.70168 2987 AAEL01000003 50576 52462 putative 26S proteosome regulatory subunit hydrolases;
Chro.70169 2988 AAEL01000003 49698 50075 .
Chro.70170 2989 AAEL01000003 48127 49518 Arabidopsis thaliana P42251 Metallo-dependent phosphatases;
Similar to CDC23 (cell division cycle 23,
Chro.70171 2990 AAELO 1000003 46036 47985 yeast, homolog) TPR-like;
Chro.70172 2991 AAELO 1000003 44633 45742 . Cyclin-like;
Chro.70173 2992 AAEL01000003 43972 44220 40S ribosomal protein S27, putative
Chro.70174 2993 AAELO 1000003 42693 43727 hypothetical protein Cytidine deaminase-like;
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.70175 2994 AAELO 1000003 41166
Nucleotidylyl transferase; Threonyl-tRNA synthetase (ThrRS), second 'additional'
Chro.70176 2995 AAEL01000003 39207 domain;
Phosphoglycerate mutase-like; Glutathione
Chro.70177 2996 AAEL01000003 35874 38918 expressed protein synthetase ATP-binding domain-like;
Chro.70178 2997 AAEL01000003 33009 35804 hypothetical protein
Chro.70179 2998 AAEL01000003 31217 31450 .
Drosophila melanogaster CG2972 gene
Chro.70180 2999 AAEL01000003 29723 30931 product
Class π aaRS and biotin synthetases;
Chro.70181 3000 AAELO 1000003 27698 29005 aspartate—tRNA ligase, putative Nucleic acid-binding proteins; aspartate-tRNA ligase homolog F10M23.210 - Arabidopsis thalianaDgii4455210|emb|CAB36533.1|
Chro.70182 3001 AAELO 1000003 26794 27042 putative aspartate-tRNA ligase Class π aaRS and biotin synthetases; Chro.70183 3002 AAEL01000003 23449 25971 hypothetical protein Chro.70184 3003 AAELO 1000003 21992 22771 unknown protein Zn2/Cys6 DNA-binding domain; Chro.70185 3004 AAEL01000003 21410 21796 . Chro.70186 3005 AAEL01000003 18116 20581 hypothetical protein Metallo-hydrolase/oxidoreductase; Chro.70187 3006 AAEL01000003 13535 16630. Chro.70188 3007 AAEL01000003 11843 12496 uracil-DNA glycosylase, putative DNA glycosylase; Chro.70189 3008 AAELO 1000003 10897 11565 unnamed protein product Chro.70190 3009 AAELO 1000003 7604 10612 mki67 (FHA domain) interacting nucleolar
Chro.70191 3010 AAEL01000003 6547 6996 phosphoprotein (human) - like RNA-binding domain, RBD;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
S-adenosyl-L-methionine-dependent
Chro.70192 3011 AAEL01000003 4180 6225 protein nucleolar (1B671) methyltransferases; Signal peptide-binding domain; P-loop containing nucleotide triphosphate
Chro.70193 3012 AAEL01000003 3207 4097 signal recognition particle protein SRP54 hydrolases;
Chro.70194 3013 AAELO 1000003 948 1982 .
Chro.70195 3014 AAEL01000003 262 534 .
Chro.70196 3015 A AAAEELL0011000000116633 13257 13673 similar to hypothetical protein MGC35182 .
Chro.70197 3016 AAEL01000163 8714 11986 unnamed protein product ARM repeat;
P-loop containing nucleotide triphosphate
Chro.70198 3017 AAELO 1000163 7533 7895 ras family GTP-ase, putative hydrolases;
P-loop containing nucleotide triphosphate meiotic recombination protein DMC 1 -like hydrolases; DNA repair protein Rad51 , N-
Chro.70199 3018 AAEL01000163 6393 7421 protein terminal domain;
Chro.70200 3019 AAEL01000163 4210 4605 histone H2B variant 1 Histone-fold;
Class H aaRS and biotin synthetases; Threonyl-tRNA synthetase (ThrRS), second 'additional' domain; Anticodon-
Chro.70201 3020 AAEL01000163 970 3261 threonyl-tRNA synthetase, putative binding domain of Class II aaRS; TGS-like;
Chro.70202 3021 AAEL01000143 15499 15741 endonuclease DI DNA-glycosylase;
LCCL domain; Fibrinogen C-terminal domain-like; Galactose-binding domain- like; Ricin B-like lectins;
Chro.70203 3022 AAEL01000143 10042 14712 al35 protein Tautomerase/MIF;
Chro.70204 3023 AAEL01000143 8278 9636 hypothetical protein FYVE/PHD zinc finger;
Table 1
Ch_Gene SEQID NO. Ch_Accession Start End Description Superfamily
Chro.70205 3024 AAEL01000143 6977 8194 step II splicing factor (74.5 kD) (5K834) Retrovirus zinc finger-like domains; adenosinetriphosphatase 2 - malaria parasite (Plasmodium falciparum)Dgi|1093478|prfl|2104205A HAD-like; Calcium ATPase,
Chro.70206 3025 AAEL01000143 3686 6829 ATPase:ISOTYPE=P transmembrane domain M;
Chro.70207 3026 AAEL01000143 2456 2776 . Ubiquitin-like;
Chro.70208 3027 AAEL01000143 37 2376 .
Chro.70209 3028 AAELO 1000407 1702 4446 . ARID-like; SAP domain; Growth factor receptor domain;
Chro.70210 3029 AAELO 1000006 55214 58904 oocyst wall protein 2 EGF/Laminin;
UDP-Glycosyltransferase/glycogen
Chro.70211 3030 AAELO 1000006 54056 54946 probable glycosyl transferase phosphorylase;
similar to transport protein particle component Bet3p-like protein; protein id:
Chro.70212 3031 AAELO 1000006 52107 52727 At5g54750.1, supported by cDNA: 122866. .
Chro.70213 3032 AAEL01000006 49676 51640 expressed protein Nucleotide-diphospho-sugar transferases;
Protein kinase-like (PK-like); EF-hand; Chro.70214 3033 AAELO 1000006 47394 49421 calmodulin-domain protein kinase 2 Starch-binding domain;
Stable Maintenance of Chromosomes; P-loop containing nucleotide triphosphate
Chro.70215 3034 AAEL01000006 43301 47251 Smc4p hydrolases; Chro.70216 3035 AAEL01000006 42439 43050 CG9308-PA
Table 1
Ch_Gene SEQ IDNO. Ch_Accession Start End Description Superfamily
Eukaryotic type KH-domain (eKH- domain); Eukaryotic type KH-domain (eKH-domain); Eukaryotic type KH-
Chro.70217 3036 AAEL01000006 38950 41406 KH domain, putative domain (eKH-domain);
Chro.70218 3037 AAELO 1000006 36450 38159 NADH dehydrogenase, putative FAD/NAD(P)-binding domain;
Chro.70219 3038 AAEL01000006 33504 36290 coatomer gamma subunit ARM repeat;
Chro.70220 3039 AAELO 1000006 32211 32543 .
Chro.70222 3040 AAEL01000006 29801 32131 DUF140-related Creatinase/aminopeptidase;
Chro.70223 3041 AAEL01000006 26765 28348 .
Chro.70224 3042 AAEL01000006 25485 26054 .
Chro.70226 3043 AAELO 1000006 24886 25296 .
Chro.70227 3044 AAELO 1000006 21440 22912 hypothetical protein, conserved Ubiquitin-like;
K>
W Tubulin, GTPase domain; Tubulin, C-
-4 Chro.70228 3045 AAELO 1000006 19466 20938 gamma-tubulin terminal domain;
Chro.70229 3046 AAELO 1000006 19085 19438 . probable mitotic checkpoint control protein kinase BUBl - mouse
(fragment)Dgi|2335138|gb|AAC53533.1| Protein kinase-like (PK-like); Snake toxin-
Chro.70230 3047 AAEL01000006 15809 18361 protein kinase like;
Chro.70231 3048 AAEL01000006 13996 15372 ARM repeat;
Chro.70232 3049 AAEL01000006 12823 13374
Chro.70234 3050 AAEL01000006 11605 12498 GLP_29_33086_34261 DHS-like NALVFAD-binding domain;
Chro.70235 3051 AAEL01000006 10383 10637 Sm protein F Sm-like ribonucleoproteins;
Chro.70236 3052 AAEL01000006 8983 10134 hypothetical protein
Chro.70237 3053 AAEL01000006 8336 8929 vacuolar protein sorting 29, putative Metallo-dependent phosphatases;
Chro.70238 3054 AAEL01000006 4711 7863
Table 1 Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily mitochondrial processing peptidase alpha
Chro.70239 3055 AAEL01000006 3015 4508 subunit LuxS/MPP-like metallohydrolase; P-loop containing nucleotide triphosphate Chro.70240 3056 AAEL01000006 1421 2794 Ruv DNA-helicase-related protein hydrolases; similar to Homo sapiens (Human). TGF- beta resistance-associated protein TRAG
Chro.70241 3057 AAELO 1000006 320 1315 (Fragment) WD40-repeat; Chro.70242 3058 AAEL01000115 738 3788 homeobox-containing protein WD40-repeat;
Translation proteins SH3-like domain;
Chro.70243 3059 AAEL01000115 4493 5278 60S ribosomal protein L8 Nucleic acid-binding proteins; Chro.70244 3060 AAEL01000115 6272 7183 •
Resolvase-like; 51 to 3' exonuclease, C-
Chro.70245 3061 AAEL01000115 7252 8616 flap endonuclease 1 terminal subdomain;
OO Chro.70246 3062 AAEL01000115 8978 9283 Chro.70247 3063 AAEL01000115 11458 12840 splicing factor, putative Chro.70248 3064 AAEL01000115 12864 15224 Chro.70249 3065 AAEL01000115 15663 16520
P-loop containing nucleotide triphosphate
Chro.70250 3066 AAEL01000115 17636 18230 guanylate kinase hydrolases; Chro.70251 3067 AAELO 1000077 21669 22262 . Chro.70252 3068 AAELO 1000077 20283 21032 . Chro.70253 3069 AAEL01000077 19716 20045 . Chro.70254 3070 AAELO 1000077 18987 19235 . Chro.70255 3071 AAELO 1000077 15825 18308 repeat organellar protein-related Spectrin repeat; Prefoldin; Chro.70256 3072 AAELO 1000077 13919 15553 .
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Ribosomal protein S3 C-terminal domain; Prokaryotic type KH domain (pKH-
Chro.70257 3073 AAEL01000077 12423 13088 putative ribosomal protein domain); Chro.70258 3074 AAELO 1000077 11178 12182 hypothetical protein Chro.70259 3075 AAELO 1000077 9931 11049 . ubiquitin / ribosomal protein CEP52
Chro.70260 3076 AAEL01000077 8871 9257 Eimeria bovis Ubiquitin-like; Chro.70261 3077 AAEL01000077 7346 7675 unnamed protein product
Translation proteins SH3-like domain;
Chro.70262 3078 AAEL01000077 6626 7108 putative translation initiation factor 5A2 Nucleic acid-binding proteins;
P-loop containing nucleotide triphosphate Chro.70263 3079 AAEL01000077 4824 6476 Hypothetical protein CBGl 8335 hydrolases;
COG3208: Predicted thioesterase involved
Chro.70264 3080 AAELO 1000077 3296 4315 in non-ribosomal peptide biosynthesis alpha/beta-Hydrolases;
P-loop containing nucleotide triphosphate
Chro.70265 30831 AAELO 1000077 2556 3137 small GTP-binding protein sari hydrolases; Chro.70266 3082 AAEL01000077 285 2168 . Chro.70267 3083 AAEL01000117 13764 17039 . Chro.70268 3084 AAEL01000117 13123 13422 . Chro.70269 3085 AAEL01000117 12669 12938 . Chro.70270 3086 AAEL01000117 10619 12016 hypothetical protein Chro.70271 3087 AAEL01000117 9477 10334 putative microtubule-associated protein Calponin-homology domain, CH-domain; Chro.70272 3088 AAEL01000117 8182 9408 polymyositis/scleroderma autoantigen 1 Ribosomal protein S5 domain 2-like; Chro.70273 3089 AAEL01000117 6523 8058 expressed protein Phospholipase D/nuclease; Chro.70274 3090 AAEL01000117 5911 6531 . Chro.70275 3091 AAEL01000117 5353 5583 . GroES-like;
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.70276 3092 AAEL01000117 4074 5312 . Chro.70277 3093 AAEL01000117 3341 3688 ribosomal protein L22
Zinc-binding domain of translation initiation factor 2 beta; Glucocorticoid
Chro.70278 3094 AAEL01000117 1336 2718 hypothetical protein receptor-like (DNA-binding domain); Chro.70279 3095 AAEL01000593 2258 2506 . Chro.70280 3096 AAELO 1000208 80 616 . Chro.70281 3097 AAEL01000208 1313 2011 hypothetical protein Chro.70282 3098 AAEL01000208 2313 3452 hypothetical protein Ypt/Rab-GAP domain of gyp Ip; Chro.70283 3099 AAEL01000208 3543 4241 . 14-3-3 protein; Chro.70284 3100 AAEL01000208 4619 5341 .
Cyclin-like; RNA polymerase sigma
4-
O Chro.70285 3101 AAEL01000208 6116 7276 cyclin family subunit; Chro.70287 3102 AAEL01000208 8308 9042 hypothetical protein Chro.70288 3103 AAELO 1000208 10511 11128 . Chro.70289 3104 AAEL01000208 11413 12186 . Chro.70290 3105 AAELO 1000348 2507 2869 60S ribosomal protein L35a (RPL35aC) Chro.70291 3105 AAELO 1000348 3335 3916 expressed protein alpha/beta-Hydrolases; Chro.70292 3107 AAELO 1000348 3927 6143 . Chro.70293 3108 AAELO 1000069 89 1930 hypothetical protein Chro.70294 3109 AAEL01000069 1938 3134 polysaccharide polymerization protein Chro.70295 3110 AAELO 1000069 3353 4978 .
C-terminal (heme dl) domain of
Chro.70296 3111 AAEL01000069 5183 9598 . cytochrome cdl -nitrite reductase; Galactose oxidase, central domain; POZ Chro.70297 3112 AAELO 1000069 9768 11507 unnamed protein product, putative domain;
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
P-loop containing nucleotide triphosphate
Chro.70298 3113 AAELO 1000069 11631 15422 clpB protein hydrolases;
Chro.70299 3114 AAELO 1000069 16035 17492 Atlg33270
- hypothetical protein SPBC 16Dl 0.0 Ic - fission yeast (Schizosaccharomyces
Chro.70300 3115 AAELO 1000069 17561 18520 pombe) TPR-like;
Chro.70301 3116 AAEL01000069 18630 19850 methionine adenosyltransferase S-adenosylmethionine synthetase;
P-loop containing nucleotide triphosphate
Chro.70302 3117 AAEL01000069 19991 22096 CG7825-PA hydrolases;
Chro.70303 3118 AAELO 1000069 22704 23666 Unknown (protein for MGC:55744) Metallo-dependent phosphatases;
Second domain of Mu2 adaptin subunit
Chro.70304 3119 AAEL01000392 4233 5594 clathrin-adaptor medium chain, putative (ap50) of ap2 adaptor; SNARE-like;
Chro.70305 3120 AAEL01000392 2460 3299 .
involved in sister chromatid cohesion; P-loop containing nucleotide triphosphate
Chro.70306 3121 AAEL01000392 474 2432 Smc3p hydrolases; Smc hinge domain;
Chro.70307 3122 AAEL01000286 1602 3557 hypothetical protein Nudix;
Chro.70308 3123 AAELO 1000286 3954 9218 FALZ protein Bromodomain;
P-loop containing nucleotide triphosphate
Chro.70309 19 AAEL01000377 5325 7046 ABC transporter ATP-binding protein hydrolases;
Chro.70310 3124 AAEL01000377 4198 4644 . WD40-repeat;
Chro.70311 3125 AAEL01000377 1063 3606 .
Chro.70312 3126 AAEL01001004 205 1176 .
Table 1
Ch_Gene SEQ m NO. Ch_Accession Start End Description Superfamily
Espl promotes sister chromatid separation by mediating dissociation from the chromatin of the cohesin Sccl. The anaphase-promoting complex promotes anaphase by mediating destruction of Pdsl which binds to Espl and inhibits its
Chro.70313 3127 AAEL01000372 1296 2972 activity; Esplp
Chro.70314 3128 AAEL01000524 74 586 .
Chro.70316 3129 AAEL01000524 689 3145 .
Chro.70317 3130 AAEL01000524 3496 3996 hypothetical protein
Chro.70318 3131 AAELO 1000431 1125 1916 hypothetical protein, conserved
Chro.70319 3132 AAEL01000431 2090 4741 .
4- Chro.70320 3133 AAEL01000431 4900 5532 .
Chro.70321 3134 AAEL01000356 6048 7331 .
Chro.70322 3135 AAEL01000356 3213 5234 thiolproteinase SmTPl Cysteine proteinases;
Chro.70323 3136 AAEL01000356 2025 3017 EXONUCLEASE SBCC
Chro.70324 3137 AAEL01000129 14319 16718 IMDaJ protein
Chro.70325 3138 AAEL01000129 12980 13426 . Histone-fold;
Chro.70326 3139 AAEL01000129 11881 12369 .
26S proteasome regulatory particle non-
Chro.70327 3140 AAEL01000129 10704 11645 ATPase subunitδ
S-adenosyl-L-methionine-dependent
Chro.70328 3141 AAEL01000129 8565 10571 hypothetical protein methyltransferases;
P-loop containing nucleotide triphosphate
DNA replication licensing factor mcm5, hydrolases; Glucocorticoid receptor-like
Chro.70329 3142 AAEL01000129 6032 8413 putative (DNA-binding domain);
Chro.70330 3143 AAEL01000129 5343 6005 .
Table 1
Ch_Gene SEQ EO NO. Ch_Accession Start End Description Superfamily
SNARE-like; Second domain of Mu2
Chro.70331 3144 AAEL01000129 3253 4860 delta-COP adaptin subunit (ap50) of ap2 adaptor;
Chro.70332 3145 AAEL01000129 1668 2870 CTP:ethanolamine cytidylyltransferase Nucleotidylyl transferase;
Chro.70333 3146 AAEL01000129 611 1648 . similar to Drosophila melanogaster
Chro.70334 3147 AAEL01000129 5 505 CG17347 Trimeric LpxA-like enzymes;
Chro.70335 3148 AAELO 1000653 1134 2465 .
Chro.70336 3149 AAELO 1000154 3 203 .
Chro.70337 3150 AAEL01000154 871 1527 hypothetical protein
Chro.70338 3151 AAELO 1000154 1917 2531 .
Chro.70339 3152 AAELO 1000154 2655 4049 Arabidopsis thaliana F6D8.20
Chro.70340 3153 AAELO 1000532 3492 3902 ENSANGPOOOOOO 13260 ARM repeat;
Chro.70341 3154 AAEL01000154 4456 7104 importin-beta2 ARM repeat;
Chro.70342 3155 AAELO 1000154 8108 13072 hypothetical protein dual-specificity tyrosine-(Y)-
Chro.70343 3156 AAEL01000154 13169 15124 phosphorylation regulated kinase TbPK4 Protein kinase-like (PK-like);
Chro.70344 3157 AAEL01000418 464 2749 Plasmodium vivax PVlH14095_P-related
Chro.70345 3158 AAEL01000418 3037 3816 .
Chro.70346 3159 AAEL01000418 3902 5869 hypothetical protein ANl 665.2 Protein kinase-like (PK-like);
Chro.70347 3160 AAEL01000919 81 1226 .
Chro.70348 3161 AAELO 1000016 40010 40261 .
Chro.70349 3162 AAEL01000016 38323 39981 hypothetical protein
Chro.70350 3163 AAEL01000016 36574 37824 Sl/Plnuclease, putative Phospholipase C/Pl nuclease;
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Thiamin diphosphate-binding fold (THDP- binding); DHS-like NAD/FAD-binding
TPP_enzymes_N, Thiamine pyrophosphate domain; Thiamin diphosphate-binding fold
Chro.70351 3164 AAEL01000016 34668 36398 enzyme, N-terminal TPP binding domain (THDP-binding);
Similar to serologically defined breast
Chro.70352 3165 AAEL01000016 33263 34456 cancer antigen 84 Chro.70353 3166 AAELO 1000016 32415 32978 . Chro.70354 3167 AAELO 1000016 3300225522 32165 Dkfzp434h2226-prov protein
Acid phosphatase/Vanadium-dependent
Chro.70355 3168 AAEL01000016 2 288667700 29824 hypothetical protein haloperoxidase;
ATP binding protein associated with cell Chro.70356 3169 AAELO 1000016 2277886633 28408 differentiation; protein 1-4 Thioredoxin-like;
GroEL equatorial domain-like chaperone
Chro.70357 3170 AAELO 1000016 25976 27589 CCTepsilon subunit equatorial domain; Chro.70358 3171 AAEL01000016 24553 25488 asparagine-rich protein, putative similar to Homo sapiens (Human).
Chro.70359 3172 AAELO 1000016 22115 23095 Hypothetical protein FLJ31812 Zn2/Cys6 DNA-binding domain; Chro.70360 3173 AAEL01000016 20693 21649 Chro.70361 3174 AAEL01000016 19747 20580
Drosophila melanogaster CG 15040 gene
Chro.70362 3175 AAEL01000016 18859 19569 product Chro.70363 3176 AAEL01000016 17261 18052. Chro.70364 3177 AAELO 1000016 16151 16942. Chro.70365 3178 AAEL01000016 12671 16054 karyopherin beta ARM repeat; Chro.70366 3179 AAEL01000016 11740 12312 . strong similarity to unknown protein-
Chro.70367 3180 AAEL01000016 9065 10930 related
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.70368 3181 AAELO 1000016 8117 8953 .
Chro.70369 3182 AAEL01000016 7711 8004 chromosome 9 open reading frame 74 MoaD/ThiS;
RING finger domain, C3HC4; SMAD/FHA
Chro.70370 3183 AAEL01000016 4821 7442 zinc finger protein domain;
Chro.70371 3184 AAEL01000016 3580 4731 similar to hypothetical protein MGC1008'
Chro.70372 3185 AAELO 1000016 2784 3329 .
Eukaryotic DNA topoisomerase I, N- terminal DNA-binding fragment; DNA
Chro.70373 3186 AAELO 1000016 522 2447 putative DNA topoisomerase I breaking-rejoining ersymes;
Chro.70374 3187 AAELO 1001027 24 809 .
Chro.70375 3188 AAEL01000047 797 1714 .
Chro.70376 3189 AAEL01000047 2454 3080 .
'Jl COG1752: Predicted esterase of the alpha
Chro.70377 3190 AAELO 1000047 3422 5806 beta hydrolase superfamily
Chro.70378 3191 AAEL01000047 6951 7388 . lambda repressor-like DNA-binding
Chro.70379 3192 AAEL01000047 7685 9463 . domains;
Chro.70380 3193 AAELO 1000047 9744 9923 .
Chro.70382 3194 AAEL01000047 10146 12059 Protein kinase domain, putative Protein kinase-like (PK-like);
Chro.70383 3195 AAELO 1000047 12872 13153 .
Chro.70384 3196 AAEL01000047 13242 15149 transporter, putative
Chro.70385 3197 AAELO 1000047 15279 16151 .
Chro.70386 3198 AAEL01000047 16600 20589 .
Chro.70387 3199 AAEL01000047 20578 21216 .
Chro.70388 3200 AAEL01000047 21525 22178 . Nucleotidylyl transferase;
Chro.70389 3201 AAEL01000047 22680 23432 At2g42650/F14N22.8 Ribosomal protein Ll;
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.70390 3202 AAELO 1000047 23542 24348 .
P-loop containing nucleotide triphosphate
Chro.70391 3203 AAEL01000047 26007 26759 putative helicase hydrolases;
Protein serine/threonine phosphatase 2C,
Chro.70393 3204 AAEL01000017 95 1201 protein phosphatase 2C catalytic domain; Chro.70394 3205 AAEL01000017 1380 2927 hypothetical protein Chro.70395 3206 AAELO 1000017 3274 4722 hypothetical protein Chro.70396 3207 AAEL01000017 4813 5409 . Chro.70397 3208 AAEL01000017 5430 7304 . Chro.70398 3209 AAELO 1000017 7416 7643 . EGF/Laminin; Chro.70399 3210 AAELO 1000017 7835 9796 Kelch repeats protein family Galactose oxidase, central domain;
K) Chro.70400 3211 AAEL01000017 9902 11557 Arabidopsis thaliana At5g66540/KlF13_21
S-adenosyl-L-methionine-dependent
Chro.70401 3212 AAEL01000017 12742 13533 protein methyltransferase-related methyltransferases; Chro.70402 3213 AAEL01000017 14447 15349 .
Protein serine/threonine phosphatase 2C,
Chro.70403 3214 AAEL01000017 15435 16793 homeobox-containing protein catalytic domain; Chro.70404 3215 AAEL01000017 16905 18347 hypothetical protein Nucleotidyltransferase; Chro.70405 3216 AAEL01000017 19586 20638 Chro.70406 3217 AAEL01000017 20792 22435 ENSANGP00000015295 Ribokmase-like; Chro.70407 3218 AAELO 1000017 22530 23369 Unknown (protein for MGC:73281) Winged helix DNA-binding domain;
Proteasome subunit alpha type 2 (20S proteasome alpha subunit B) (2OS proteasome subunit alpha- 2)Dgi|8671494|dbj|BAA96830.1| alpha 2 N-terminal nucleophile aminohydrolases
Chro.70408 3219 AAELO 1000017 23697 24407 subunit of 2OS proteasome (Ntn hydrolases);
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
ATPase domain of HSP90 chaperone/DNA topoisomerase π/histidine kinase; 4-helical
Chro.70410 3220 AAELO 1000017 24517 26991 heat shock protein 90 cytokines;
Human homologue of S. pombe nuc2+ and
Chro.70411 3221 AAEL01000017 27058 29433 A. nidulans bimA TPR-like;
Chro.70412 3222 AAEL01000017 29642 31852 hypothetical protein TPR-like;
Chro.70413 3223 AAELO 1000017 32064 32519 .
Chro.70414 3224 AAEL01000017 32647 34653 mKIAA0840 protein RNI-like;
DNA-directed RNA polymerase (EC 2.7.7.6) π second largest chain - malaria beta and beta-prime subunits of DNA
Chro.70415 3225 AAELO 1000017 3
K) 366332266 38527 parasite (Plasmodium falciparum) dependent RNA-polymerase; 4- -4 geranyl diphosphate synthase
Chro.70416 3226 AAEL01000017 3 388997744 40341 (GPPS)(dimethylallyltransferase), putative Terpenoid synthases; Chro.70417 3227 AAELO 1000846 633 1652 P36-like protein homologue, putative
Homo sapiens A_IG002N01.1 gene
Chro.70418 3228 AAEL01000228 10051 11484 product, putative
Serine/threomne-protein kinase Nekl (NimA-related protein kinase 1) (NY-REN-
Chro.70419 3229 AAEL01000228 9210 9581 55 antigen) Protein kinase-like (PK-like); Chro.70420 3230 AAEL01000228 8106 8387 . Chro.70421 3231 AAEL01000228 7685 8023 ENSANGP00000014808 Chro.70422 3232 AAELO 1000228 5265 7055 Cyclin, putative Cyclin-like; unconventional myosin-A - Toxoplasma gondii D gi|2209250|gb| AAC47724.11 P-loop containing nucleotide triphosphate
Chro.70423 3233 AAELO 1000228 2519 4969 myosin-A hydrolases;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
MurD-like peptide ligases, catalytic
Chro.70424 3234 AAELO 1000228 10 2202 . domain;
Chro.70425 3235 AAELO 1000165 5523 8153 .
Chro.70426 3236 AAELO 1000165 94 2781 .
Chro.70427 3237 AAEL01000028 362 949 .
Chro.70428 3238 AAELO 1000028 1466 3277 .
Chro.70429 3239 AAEL01000028 3421 5673 .
Chro.70430 3240 AAEL01000028 5924 6637 .
Chro.70431 3241 AAELO 1000028 6860 10639 . lambda integrase-like, N-terminal domain;
Chro.70432 3242 AAELO 1000028 10896 15893 putative
Chro.70433 3243 AAELO 1000028 16765 18648 DNAJ-like Sec63 homologue Chaperone J-domain;
Chro.70434 3244 AAEL01000028 19000 20373 . calcium-dependent protein kinase 7
Chro.70435 3245 AAEL01000028 20415 21488 (CDPK)(CPK7) Protein kinase-like (PK-like);
Chro.70436 3246 AAELO 1000028 22231 22890 .
Chro.70437 3247 AAEL01000028 23100 24797 .
Chro.70438 3248 AAELO 1000028 25126 25629 .
Chro.70439 3249 AAELO 1000028 26196 26822 .
Eukaryotic initiation factor 4A-3 (eIF4A-3) (eIF-4A-3)Dgi|100276[pir||S22579 translation initiation factor eIF-4A - curled- leaved tobacco D gi| 19699|emb|CAA43514.11 nicotiana eukaryotic translation initiation P-loop containing nucleotide triphosphate
Chro.70440 3250 AAEL01000028 26945 28132 factor 4A hydrolases;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Drosophila melanogaster CG3542 gene
Chro.70441 3251 AAELO 1000028 28181 29476 product FF domain;
Chro.70442 3252 AAEL01000028 29651 30913 pleiotropic regulator 1 WD40-repeat;
Chro.70443 3253 AAELO 1000028 32182 33960 Krox-like protein PX domain; WD40-repeat;
Chro.70444 3254 AAELO 1000028 34023 34274 autophagy 8i Ubiquitin-like;
Chro.70445 3255 AAEL01000323 7366 8478 rhoptry protein, putative
Chro.70446 3256 AAEL01000323 4439 7114 hypothetical protein RCCl/BLIP-π; mucin-like glycoprotein 900 -
Cryptosporidium parvum D gi|4063042|gb|AAC98153.1)
Chro.70447 5 AAEL01000323 2977 3963 GP900; mucin-like glycoprotein Plakin repeat;
Chro.70448 3257 AAELO 1000004 62100 63113 hypothetical protein
Chro.70449 3258 AAELO 1000004 60741 61061
4-
Chro.70450 3259 AAELO 1000004 60009 60248 hypothetical protein MG06952.4
Signal recognition particle 72 kDa protein (SRP72)Dgi|3243033|gb|AAC97490.1|
Chro.70451 3260 AAEL01000004 57594 59636 signal recognition particle 72 TPR-like;
P-loop containing nucleotide triphosphate
Chro.70452 3261 AAEL01000004 56604 57455 arsenical pump-driving ATPase, putative hydrolases; protein disulfide isomerase-related protein
Chro.70453 3262 AAELO 1000004 54714 56006 (provisional) Thioredoxin-like;
Chro.70454 3263 AAEL01000004 52590 54665 hypothetical protein ARM repeat;
Chro.70455 3264 AAEL01000004 48812 50992 seroreactive antigen BMNl -9B-related SMALVFHA domain;
conserved hypothetical protein; similar to
Chro.70456 3265 AAEL01000004 46759 48345 yeast YER082C; contains 1 WD-repeat WD40-repeat;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
UDP-N-acetyl-D- galactosamine:polypeptide N-
Chro.70457 17 AAELO 1000004 44914 46158 acetylgalactosaminyltransferase T4 Nucleotide-diphospho-sugar transferases;
S-adenosyl-L-methionine-dependent
Chro.70458 3266 AAEL01000004 43202 44719 Unknown (protein for MGC: 66176) methyltransferases; Chro.70459 3267 AAEL01000004 41723 42949 CG 1109-PA WD40-repeat;
Protein serine/threonine phosphatase 2C,
Chro.70460 3268 AAELO 1000004 39626 41512 F21B7.20 catalytic domain;
UDP-N-acetyl-D- galactosamine.-polypeptide N- Nucleotide-diphospho-sugar transferases;
Chro.70461 3269 AAELO 1000004 39169 39495 acetylgalactosaminyltransferase T 1 Ricin B-like lectins; Chro.70462 3270 AAEL01000004 36278 37384 hypothetical protein RING finger domain, C3HC4;
Ul Chro.70463 3271 AAELO 1000004 35378 35698 CG3948-PA SNARE-like;
O calcium-transporting ATPase 1, Calcium ATPase, transmembrane domain endoplasmic reticulum-type (calcium M; HAD-like; Calcium ATPase, ATP-
Chro.70464 3272 AAELO 1000004 31390 34779 pump) binding domain N; Chro.70465 3273 AAEL01000004 30360 30764 . HRDC-like;
GroEL equatorial domain-like chaperone
Chro.70466 3274 AAEL01000004 27214 28812 chaperonin, putative equatorial domain; Chro.70467 3275 AAEL01000004 25303 27129 . Chro.70468 . 376 AAEL01000004 24512 25069 prohibitin, putative Chro.70469 3277 AAEL01000004 22307 24094 NLI interacting factor, putative BRCT domain; HAD-like; Chro.70470 3278 AAELO 1000004 19965 21950 . Chro.70471 3279 AAEL01000004 18776 19525 phosphoglycerate mutase, putative Phosphoglycerate mutase-like; Chro.70472 3280 AAELO 1000004 14971 18303 . Chro.70473 3281 AAELO 1000004 12567 14132 hypothetical protein Chro.70474 3282 AAELO 1000004 11218 12171 .
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.70475 3283 AAELO 1000004 5811 10808 . PR-1-like;
Chro.70476 3284 AAEL01000004 4213 5244 .
Chro.70477 3285 AAELO 1000004 2225 4009 polythreonine protein
Chro.70478 3286 AAEL01000004 1767 1979 .
Chro.70479 3287 AAELO 1000004 469 1497 .
Chro.70480 3288 AAELO 1000890 62 1531 .
Chro.70481 3289 AAEL01000477 3510 4778 .
Chro.70482 3290 AAEL01000035 2083 2493 .
Chro.70483 3291 AAEL01000035 3741 7571 myosin B RCCl/BLIP-π;
Chro.70484 3292 AAEL01000035 8115 8549 hypothetical protein
P-loop containing nucleotide triphosphate
Chro.70485 3293 AAEL01000035 10202 10801 Rabllb hydrolases;
Chro.70486 3294 AAEL01000035 11162 12085 nuclear distribution gene C homolog HSP20-like chaperones;
2 Chro.70487 3295 AAEL01000035 12818 14209 Coronin WD40-repeat;
Chro.70488 3296 AAEL01000035 14377 15354 hypothetical protein, conserved
Chro.70489 3297 AAEL01000035 15422 17902 Unknown (protein for MGC:63825) Metallo-dependent phosphatases;
Chro.70490 3298 AAEL01000035
Chro.70491 3299 AAEL01000035 Nucleotide-diphospho-sugar transferases; Glutathione S-transferase (GST), C-
Chro.70492 3300 AAEL01000035 19932 21080 elongation factor 1 -gamma, putative terminal domain; Thioredoxin-like;
Chro.70493 3301 AAEL01000035 21763 22317 60S ribosomal protein L6 (YL 16 like)
Chro.70494 3302 AAEL01000035 23035 24396 CDC14 homolog A isoform 2 (Phosphotyrosine protein) phosphatases II;
Chro.70495 3303 AAEL01000035 24470 25621 UBPl interacting protein 2a RNA-binding domain, RBD;
Chro.70496 3304 AAEL01000035 29289 31181 .
Chro.70497 3305 AAEL01000375 1206 3629 . beta-sandwich domain of Sec23/24;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
ATP-binding cassette, sub-family C (CFTR/MRP), member 2; Canalicular multispecific organic anion transporter; P-loop containing nucleotide triphosphate
Chro.70498 3306 AAEL01000375 3811 7140 multidrug resistance associated protein 2 hydrolases;
SI:dZ52I16.4 (novel ABC transporter similar to human multidrug-resistance P-loop containing nucleotide triphosphate
Chro.70499 3307 AAEL01000131 2675 6850 proteins (MRP)) hydrolases;
Chro.70500 3308 AAEL01000131 7441 13116 .
Chro.70501 3309 AAEL01000131 13913 14359 CP15/60
Chro.70503 3310 AAEL01000131 15722 16852 .
Chro.70504 3311 AAELO 1000222 2833 3513 RK-EN cDNA 1500016L11 probable U6 SNRNA-ASSOCIATED SM-
Chro.70505 3312 AAELO 1000222 2280 2627 LIKE PROTEIN LSM5 Sm-like ribonucleoproteins;
K> hypothetical protein DKFZp566D 143.1 - human
(fragment)Dgi|5817110|emb|CAB53671.1|
Chro.70506 3313 AAEL01000222 1031 2239 hypothetical protein alpha/beta knot;
P-loop containing nucleotide triphosphate hydrolases; Retrovirus zinc finger-like
Chro.70507 3314 AAEL01000192 15 770 RNAhelicase-l domains;
Chro.70508 3315 AAELO 1000192 943 2010 . Cyclin-like;
Chro.70509 3316 AAEL01000192 2760 4820 replication protein A 7OkDa Nucleic acid-binding proteins;
Chro.70511 3317 AAELO 1000192 5008 5409 hypothetical protein Prefoldin;
Protein serine/threonine phosphatase 2C,
Chro.70512 3318 AAEL01000192 5729 6634 hypothetical protein catalytic domain;
Chro.70513 3319 AAEL01000192 6661 7146 . DNA-binding protein Sso 1 Ob (AIbA); .
Chro.70514 3320 AAEL01000192 8138 9541 .
Table 1
Ch_Gene SEQIDNO. Ch Accession Start End Description Superfamily
Chro.70515 3321 AAEL01000192 9797 10018 . Chro.70516 3322 AAEL01000192 10173 10292 . Chro.70517 3323 AAEL01000192 10291 10746 . Chro.70518 3324 AAELO 1000192 10867 12027 . Chro.70519 3325 AAEL01000192 12154 13149 . Chro.70520 3326 AAELO 1000048 25213 25863 hypothetical protein RING finger domain, C3HC4; Chro.70521 3327 AAEL01000048 24123 25118 . Bet vl -like; Chro.70522 3328 AAELO 1001242 418 642 . Chro.70523 3329 AAELO 1000048 21585 22304 . Chro.70524 3330 AAEL01000048 19638 20663 RAD 23B protein - channel catfish Ubiquitin-like; UBA-like;.
Rab proteins geranylgeranyltransferase component A (Rab escort protein)
Ul (REP) D gi|4062858|dbj |BAA36167.11 Rab geranylgeranyl transferase escort protein FAD/NAD(P)-binding domain;
Chro.70525 3331 AAELO 1000048 17539 19302 (REP) FAD/NAD(P)-binding domain; Chro.70526 3332 AAEL01000048 16755 17495
4OS ribosomal protein
S4Dgi|453574|dbj|BAA05485.1| ribosomal
Chro.70527 3333 AAEL01000048 15594 16052 protein S4 Alpha-L RNA-binding motif; similar to GenBank Accession Number
L24368 ribosomal protein S4 in Gallus
Chro.70528 3334 AAEL01000048 14953 15201 gallus Chro.70529 3335 AAEL01000048 14305 14694 DNA-directed RNA polymerase Ha RPB5-like RNA polymerase subunit; Glutathione S-transferase (GST), C-
Chro.70530 3336 AAEL01000048 13005 13490 termiαal domain; Thioredoxin-like; Protein serine/threonine phosphatase 2C, Chro.70531 3337 AAEL01000048 10801 12855 hypothetical protein catalytic domain;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.70533 3338 AAELO 1000048 8591 10396 hypothetical protein AN4477.2
Anthrax protective antigen; Kringle-like;
Chro.70534 3339 AAEL01000048 5453 7768 hypothetical protein Galactose-binding domain-like;
Chro.70535 3340 AAEL01000048 4032 5216 .
Sm-like ribonucleoproteins; conserved hypothetical multi-pass Mechanosensitive channel protein MscS
Chro.70536 3341 AAEL01000048 579 3443 transmembrane protein (YggB), transmembrane region;
Chro.70537 3342 AAEL01001034 530 829 .
Chro.70538 3343 AAELO 1001034 343 714 .
Chro.70540 3344 AAEL01001034 214 543 cyclin-dependent kinase 3 Protein kmase-like (PK-like);
Chro.70542 3345 AAELOIOOIOOI 0 1160 .
Chro.70543 3346 AAELOlOOl 123 508 756 .
M Chro.70544 3347 AAEL01000861 759 1610 .
2 Chro.70545 3348 AAEL01000861 8 451 . ubiquitin carboxyl-terminal hydrolase,
Chro.70546 3349 AAELO 1000405 370 1554 putative Cysteine proteinases;
Chro.70547 3350 AAELO 1000405 2357 3292 hypothetical protein RING finger domain, C3HC4;
Chro.70548 3351 AAEL01000405 5397 5756 hypothetical protein, conserved
Chro.70549 3352 AAELO 1000159 14609 15145 hypothetical protein MGC 19780
COG0014: Gamma-glutamyl phosphate
Chro.70551 3353 AAEL01000159 12723 14054 reductase ALDH-like;
Chro.70552 3354 AAELO 1000159 11395 12486 Unknown (protein for MGC:66285) putative protein potential transcriptional RNA-binding domain, RBD; RING finger
Chro.70553 3355 AAEL01000159 8115 10172 repressor Not4hp domain, C3HC4;
Chro.70554 3356 AAEL01000159 5406 6809 CG4733-PA EF-hand;
Chro.70555 3357 AAELO 1000159 4861 5073 .
Chro.70556 3358 AAEL01000656 354 1556 .
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.70557 3359 AAEL01000562 200 1999 .
Ubiquitin-protein ligase E3a, Hect catalytic
Chro.70558 3360 AAEL01000562 2118 3623 HECT-domain, putative domain (E6ap);
P-loop containing nucleotide triphosphate hydrolases; C-terminal domain of alpha and
Chro.70559 3361 AAEL01000580 2305 3546 vacuolar ATP synthase catalytic subunit a beta subunits of Fl ATP synthase;
Chro.70561 3362 AAEL01000580 9 1544 coatomer beta' subunit Protein prenylyltransferase;
Chro.70562 3363 AAEL01000366 2885 4498 suppressor of NosA Ubiquitin-like; UBA-like;
Chro.70563 3364 AAEL01000366 5015 6796
Chro.70564 3365 AAEL01000227 9179 11209 κ> Chro.70565 3366 AAELO 1000227 4407 8594 NIMA-related kinase 5 Protein kinase-like (PK-like); ui Chro.70566 3367 AAELO 1000227 3629 4012 ribosomal protein S20 Ribosomal protein SlO;
Chro.70567 3368 AAEL01000227 300 1991 similar to Plasmodium falciparum. SET domain; Glucocorticoid receptor-like
Chro.70568 3369 AAEL01000285 6747 8474 Transporter, putative (DNA-binding domain);
PROTEIN DISULFIDE ISOMERASE PRECURSOR
(PDI)Dgi|625437|pir|[JC2291 protein disuliϊde-isomerase (EC 5.3.4.1) precursor • Humicola insolensDgi|712823[gb|AAC60578.1|
Chro.70569 3370 AAEL01000285 4842 6512 protein disulfide isomerase; PDI Thioredoxin-like;
Chro.70570 3371 AAEL01000285 855 2225
Chro.70571 3372 AAEL01001050 1 1065
Chro.70572 3373 AAELO 1000939 92 1150
Chro.70573 3374 AAELO 1000658 380 772
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.70574 3375 AAELO 1000576 33 824 .
Growth factor receptor domain;
Chro.70575 3376 AAELO 1000576 1360 3246 oocyst wall protein 5 precursor EGF/Laminin;
Chro.70576 3377 AAELO 1000576 3414 3596 . RNA-binding domain, RBD; deoxyuridine 5 '-triphosphate Deoxyuridine 5'-triphosphate
Chro.70577 3378 AAEL01000178 13397 13927 nucleotidohydrolase, putative nucleotidohydrolase (dUTPase);
Chro.70578 3379 AAEL01000178 11658 13010 hypothetical protein AN1270.2
Chro.70579 3380 AAEL01000178 10083 11324
Chro.70580 3381 AAELO 1000178 9055 9927
Chro.70581 3382 AAEL01000178 6947 8488 bromodomain protein, putative Bromodomain;
Chro.70582 3383 AAEL01000178 5050 6741 putative splicing factor RNA-binding domain, RBD;
Chro.70583 3384 AAEL01000178 4130 4630 RNA helicase - like protein D-Tyr tRNAtyr deacylase;
Chro.70584 3385 AAEL01000178 2566 3792
'Jl
Ankyrin repeat; S-adenosyl-L-methionine-
Chro.70585 3386 AAEL01000178 842 2143 expressed protein dependent methyltransferases;
Chro.70586 3387 AAEL01000189 1 1275 . eukaryotic translation initiation factor 2
Chro.70587 3388 AAEL01000189 2221 3228 alpha subunit Nucleic acid-binding proteins; structure specific recognition protein,
Chro.70588 3389 AAEL01000189 3898 5442 putative
C. elegans QUA-I protein (corresponding
Chro.70589 3390 AAEL01000189 5868 6998 sequence T05C12.10) Hedgehog/intein (Hint) domain;
Rab geranylgeranyltransferase, alpha
Chro.70590 3391 AAEL01000189 7387 9090 subunit isoform a Protein prenylyltransferase;
60S ribosomal subunit protein L24, Glucocorticoid receptor-like (DNA-binding
Chro.70591 3392 AAEL01000189 9183 9776 putative domain);
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.70592 3393 AAELO 1000189 10238 10798 Hypothetical protein CBGl 7615
Chro.70593 3394 AAEL01000189 10946 12940
Chro.70594 3395 AAEL01000051 2 1582 u6 snRNA-associated sm-like protein,
Chro.70595 3396 AAEL01000051 2633 2929 putative Sm-like ribonucleoproteins;
Chro.70596 3397 AAELO 1000051 3555 5531
Chro.70597 3398 AAEL01000051 5579 6754
Chro.70598 3399 AAELO 1000051 7109 7909
Chro.70599 3400 AAELO 1000051 8000 8983
Chro.70600 3401 AAEL01000051 9363 9893
Chro.70601 3402 AAEL01000051 10238 12910 RIKEN cDNA 2610034K17 WD40-repeat;
Chro.70602 3403 AAEL01000051 13221 14792
Ul Chro.70603 3404 AAELO 1000051 14998 16743 -4
Chro.70604 3405 AAELO 1000051 17359 27045
Chro.70605 3406 AAEL01000249 10079 10817
Chro.70606 3407 AAELO 1000249 6785 9688 hypothetical protein
Chro.70607 3408 AAELO 1000249 5326 6534
Chro.70609 3409 AAELO 1000249 102 5162
Functional domain of the splicing factor
Chro.70610 3410 AAEL01000177 11563 12165 pre-mRNA splicing factor protein, putative Prpl8;
Chro.70611 3411 AAELO 1000177 6313 10764
Chro.70612 3412 AAEL01000177 5118 5837 cell surface protein that may regulate cell wall beta-glucan synthesis and bud site selection; Hansenula mrakii killer toxin-
Chro.70613 3413 AAEL01000177 1449 4448 resistance protein; Hkrlp
Chro.70614 3414 AAEL01000177 824 1114
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily phosphatidylinositol glycan, class L; N- acetylglucosaminyl-phosphatidylinositol de
Chro.71000 3415 AAEL01000282 2110 2977 N-acetylase hypothetical protein, transcripts identified
Chro.71001 3416 AAEL01000047 9844 10017 by EST
Chro.71002 3417 AAELO 1000282 9504 9580 . hypothetical predicted protein, unknown
Chro.80010 3418 AAEL01000333 6670 7203 function
Chro.80011 3419 AAEL01000333 . 1131 3881 .
Chro.80012 3420 AAEL01000692 614 1630 .
Chro.80013 3421 AAELO 1000034 1104 3758 .
Chro.80014 3422 AAELO 1000034 4166 5671 .
Chro.80015 3423 AAELO 1000034 6248 6796 .
Chro.80016 3424 AAEL01000034 7297 8571 acid phosphatase, putative Metallo-dependent phosphatases;
Chro.80017 3425 AAEL01000034 9034 10446 putative transmembrane transporter
Chro.80018 3426 AAEL01000034 10644 13493 .
Chro.80019 3427 AAEL01000034 13881 17630 .
Chro.80020 3428 AAELO 1000034 17896 18303 .
Chro.80022 3429 AAELO 1000034 18434 18802 .
Chro.80023 3430 AAEL01000034 19363 20709 hypothetical protein
Chro.80024 3431 AAELO 1000034 23404 24657 .
TSPl domain-containing protein TSP4
Chro.80025 3432 AAELO 1000034 26512 27372 precursor TSP-I type 1 repeat;
Chro.80026 3433 AAELO 1000034 28995 29264 . NAD(P)-binding Rossmann-fold domains;
DNA-directed RNA polymerase, beta beta and beta-prime subunits of DNA
Chro.80027 3434 AAEL01000988 88 1122 subunit, putative dependent RNA-polymerase;
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superf amity
Chro.80028 3435 AAEL01000686 216 2402 .
Chro.80029 3436 AAEL01000066 21913 23070 .
Similar to DEALVH (Asp-Glu-Ala- P-loop containing nucleotide triphosphate
Chro.80030 3437 AAELO 1000066 16901 19414 Asp/His) box polypeptide 24 hydrolases;
Chro.80031 3438 AAEL01000066 11923 15318 . EF-hand;
Chro.80032 3439 AAELO 1000066 9757 10245 ubiquitin-conjugating enzyme e2, putative UBC-like;
Chro.80033 3440 AAELO 1000066 8760 9437 .
Chro.80034 3441 AAELO 1000066 7157 8164 .
Chro.80035 3442 AAELO 1000066 5117 6829 MOZ/S AS family, putative Acyl-CoA N-acyltransferases (Nat);
Chro.80036 3443 AAELO 1000066 2296 4662 .
Chro.80037 3444 AAELO 1000066 1271 1492 .
Chro.80038 3445 AAELO 1000066 28 1179 Unknown (protein for MGC:66285) tRNA splicing endonuclease EdnA, N-
Chro.80039 3446 AAEL01000103 18589 19086 . terminal domain; EF-hand;
Chro.80040 3447 AAEL01000103 16350 17507 hypothetical protein Metallo-dependent phosphatases;
Chro.80041 3448 AAEL01000103 15592 15870 .
Chro.80042 3449 AAEL01000103 14260 15294 DNA-directed RNA polymerase I, putative RBPl 1-like subunits of RNA polymerase;
Chro.80043 3450 AAEL01000103 13405 14127 .
Chro.80044 3451 AAEL01000103 11216 12847 .
Chro.80045 3452 AAEL01000103 9537 9938 .
Chro.80046 3453 AAELO 1000103 8463 8696 . Ribosomal protein S5 domain 2-like; Class π aaRS and biotin synthetases;
Chro.80047 3454 AAELO 1000103 6337 7836 asparaginyl-tRNA synthetase Nucleic acid-binding proteins;
Chro.80048 3455 AAEL01000103 5008 5676 vacuolar ATP synthase subunit E, putative
Table 1
Ch_Gene SEQID NO. Ch Accession Start End Description Superfamily
DNA repair protein MutS, domain HI; P- loop containing nucleotide triphosphate
Chro.80049 3456 AAELO 1000103 853 4581 DNA repair protein, putative hydrolases;
Chro.80050 3457 AAEL01000467 4020 4961 malate:quinone oxidoreductase, putative
Chro.80051 4358 AAEL01000467 3426 3974 .
Chro.80052 3459 AAEL01000467 1776 2348 ribosomal protein homolog Ribosomal protein L6;
Chro.80053 3460 AAEL01000467 2 964 .
Chro.80054 3461 AAELO 1000280 6411 9618 hypothetical protein Fibrinogen C-terminal domain-like;
60S RIBOSOMAL PROTEIN
L7ADgi|542158|pir||S38360 ribosomal protein L7a, cytosolic -
ON riceDgi|303855|dbj|BAA02156.1| O Chro.80055 3462 AAEL01000280 5052 5831 ribosomal protein L7A L30e-like; similar to GenBank Accession Number
Chro.80056 3463 AAEL01000280 3216 4151 L78668 60S ribosomal protein L5A Translational machinery components;
Chro.80057 3464 AAEL01000280 1722 2600 DNAJ-like protein Chaperone J-domain; cleavage and polyadenylation specifity
Chro.80059 3465 AAELO 1000280 219 1673 factor protein, putative
Chro.80060 3466 AAEL01000139 988 1977 . Tudor/PWWP;
Arginase/deacetylase; Ankyrin repeat;
Chro.80061 3467 AAEL01000139 2840 5764 hypothetical protein Concanavalin A-like lectins/glucanases;
Chro.80062 3468 AAEL01000139 6496 9270 hypothetical protein Prefoldin;
Chro.80063 3469 AAEL01000139 9719 10162 caltractin EF-hand;
Chro.80064 3470 AAEL01000139 10622 10867 .
Chro.80065 3471 AAEL01000139 11704 13209 hypothetical protein Pseudouridine synthase;
Chro.80066 3472 AAEL01000139 13651 14775 .
Chro.80068 3473 AAEL01000543 398 1096 .
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
TSPl domain-containing protein TSP 12
Chro.80069 3474 AAEL01000543 1110 3566 precursor TSP-I type 1 repeat;
Chro.80070 3475 AAEL01000104 160 5328 .
CDP-diacylglycerol—inositol 3- phosphatidyltransferase isoform 1; phosphatidylinositol synthase; Ptdlns
Chro.80072 3476 AAEL01000104 7427 7891 synthase; PI synthase .
26S proteasome regulatory subunit S2
Chro.80073 3477 AAELO 1000104 8064 11180 (RPNl) ARM repeat;
Chro.80074 3478 AAELO 1000104 12575 13552 aminopeptidase, putative alpha/beta-Hydrolases;
κ> Chro.80075 3479 AAELO 1000104 14432 15688 hydrolase, alpha/beta fold family, putative alpha/beta-Hydrolases;
P-loop containing nucleotide triphosphate
Chro.80076 3480 AAEL01000104 16351 18915 replication factor C subunit 1, putative hydrolases; BRCT domain;
Chro.80078 3481 AAELO 1000497 1472 2989 . ARM repeat;
Chro.80079 3482 AAEL01000758 254 2143 hypothetical protein similar to GenBank Accession Number
Chro.80080 3483 AAEL01000212 10606 10818 BC016558 ribosomal protein L23a Ribosomal proteins L23 and L15e;
Chro.80081 3484 AAEL01000212 7478 9712 .
Chro.80082 3485 AAEL01000516 4016 4390 .
Chro.80087 3486 AAEL01000212 347 2671 .
Chro.80088 3487 AAEL01000778 1115 1906 .
P-loop containing nucleotide triphosphate
Chro.80089 3488 AAEL01000408 1367 4333 myosin D hydrolases;
Chro.80090 3489 AAEL01000408 5255 5599 .
Chro.80092 3490 AAEL01000655 235 651 .
Chro.80093 3491 AAEL01000655 1350 2096 OSJNBa0052O12.6 Prefoldin;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Protein kmase-like (PK-like); cAMP-
Chro.80094 3492 AAEL01000394 3857 6535 cGMP-dependent protein kinase binding domain-like; Chro.80095 3493 AAEL01000394 2376 3653 . Chro.80096 3494 AAEL01000351 6176 7762 Exonuclease SBCC Chro.80097 3495 AAEL01000351 4940 5938 zf-CCCH zinc finger protein
Nucleotidylyl transferase; Ribosomal
Chro.80098 3496 AAEL01000351 3156 4823 glutamate-tRNA ligase protein L25-like;
P-loop containing nucleotide triphosphate
Chro.80099 3497 AAEL01000351 31 2415 ATP-dependentRNA helicase, putative hydrolases; Chro.80100 3498 AAELO 1000194 6731 10753 . Chro.80101 3499 AAEL01000194 4247 5359 . Chro.80102 3500 AAEL01000194 3311 4111 .
26S proteasome regulatory subunit, P-loop containing nucleotide triphosphate
K> Chro.80103 3501 AAELO 1000194 1549 2724 putative hydrolases; Chro.80104 3502 AAEL01000194 109 1449 Chro.80105 3503 AAEL01000614 237 2867 coatomer protein complex subunit alpha TPR-like; Rubredoxin-like; Chro.80106 3504 AAEL01000148 821 2686 DNA polymerase alpha subunit, putative transcription initiation factor TFTTR3
Chro.80107 3505 AAEL01000148 3249 4058 putative Zinc beta-ribbon; Cyclin-like;
P-loop containing nucleotide triphosphate
Chro.80108 3506 AAEL01000148 4366 5598 putative cobW protein hydrolases; Chro.80109 3507 AAEL01000148 6025 8934 hypothetical protein TPR-like; Chro.80110 3508 AAEL01000148 9398 13147 .
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily
NAD(P)-binding Rossmann-fold domains; 6-phosphogluconate dehydrogenase C- terminal domain-like; UDP-glucose dehydrogenase (UDPGDH), C-terminal
Chro.80111 3509 AAEL01000148 13214 14842 sugarless CG10072-PA (UDP-binding) domain; ring-box 1; RING box protein 1; regulator of cullins 1; RING finger protein; ZYP
Chro.80112 3510 AAELO 1000148 15471 15845 protein RING finger domain, C3HC4;
Chro.80113 3511 AAEL01000708 530 1057 hypothetical protein
Second domain of Mu2 adaptin subunit
Chro.80114 3512 AAEL01000708 1113 2036 clathrin coat assembly like protein (ap50) of ap2 adaptor;
Chro.80115 3513 AAEL01000234 8702 10741 .
Chro.80116 3514 AAELO 1000234 1746 8063 .
Chro.80117 3515 AAELO 1000234 841 981 calmodulin mutant SYNCAM56 EF-hand;
Chro.80118 3516 AAELO 1000234 593 820 .
Chro.80119 3517 AAEL01000488 251 2392 .
Chro.80120 3518 AAEL01000488 2478 3647 .
Chro.80122 3519 AAEL01001347 184 546 .
Class π aaRS and biotin synthetases; Anticodon-binding domain of Class II
Chro.80123 3520 AAEL01000571 406 2187 glycyl-tRNA synthetase aaRS;
Chro.80124 3521 AAEL01000210 893 2977 . similar to Dictyostelium discoideum (Slime mold). Homeobox-containing protein
Chro.80125 3522 AAELO 1000210 3266 5320 (Fragment)
Chro.80126 3523 AAELO 1000210 5861 7030 unnamed protein product Actin-like ATPase domain;
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.80127 3524 AAEL01000210 7270 9261 syntaxin binding protein, putative Secl/muncl8-like (SM) proteins; Chro.80128 3525 AAEL01000210 9437 9628 . Chro.80129 3526 AAEL01000210 9642 10739 . Chro.80130 3527 AAELO1000513 351 2579 hypothetical protein MG03270.4
Chro.80131 3528 AAEL01000513 3275 3934 endoplasmic reticulum retention receptor
P-loop containing nucleotide triphosphate Chro.80132 3529 AAELO 1000749 897 1502 ENSANGP00000002945 hydrolases;
C-terminal domain of phosphatidylinositol
Chro.80134 3530 AAEL01001284 3 572 transfer protein secl4p;
K) Chro.80135 3531 AAEL01000509 3046 3822 cholinephosphate cytidylyltransferase Nucleotidylyl transferase;
Chro.80136 3532 AAEL01000509 724 2247
Chro.80137 3533 AAELO 1000921 3 836 .
Chro.80138 3534 AAELO 1000567 675 3155 coronin WD40-repeat;
Chro.80140 3535 AAEL01000918 0 1397 hypothetical protein
Chro.80141 3536 AAEL01001051 48 914 ADP/ATP carrier
Chro.80142 3537 AAEL01000896 189 818
Chro.80143 3538 AAEL01000815 286 1104 . alpha/beta-Hydrolases;
Chro.80144 3539 AAELOlOOl 119 316 945 ENSANGP00000017360 Protein kinase-like (PK-like);
Chro.80146 3540 AAEL01000043 26872 28224 .
DNA polymerase epsilon catalytic subunit ■ Ribonuclease H-like; DNA/RNA
Chro.80147 3541 AAEL01000043 23623 26415 related polymerases; Bacterial enterotoxins; beta-sandwich domain of Sec23/24; C: terminal, gelsolin-like domain of Sec23/24;
Chro.80148 3542 AAELO 1000043 14331 17825 SEC24 Helical domain of Sec23/24;
Chro.80149 3543 AAELO 1000043 11234 13387 .
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
ARM repeat; Clathrin heavy-chain terminal
Chro.80150 3544 AAEL01000043 4887 10907 clathrm, heavy polypeptide (Hc) domain; TPR-like;
Chro.80151 3545 AAEL01000043 3570 4067 centrin, putative EF-hand;
Chro.80152 3546 AAEL01000043 2157 3503 OSJNBa0038F22.20
Chro.80153 3547 AAEL01000841 98 1681 .
Chro.80155 3548 AAEL01000972 3 491 .
Chro.80156 3549 AAELO 1000426 134 643 .
Chro.80157 3550 AAEL01000426 876 1757 .
Chro.80158 3551 AAELO 1000426 2111 5830 . Proteasome activator reg(alpha);
Chro.80159 3552 AAELO 1000252 701 4879 CG2
Chro.80160 3553 AAELO 1000252 5366 6448 putative SPOI l protein DNA topoisomerase IV, alpha subunit;
Chro.80161 3554 AAEL01000252 7310 9184 . similar to Homo sapiens (Human). GDP-
Os 'Jl Chro.80162 3555 AAEL01000252 9784 10696 fUcose transporter 1
Chro.80163 3556 AAELO 1000399 5572 6336 unknown protein
Chro.80164 3557 AAEL01000399 3224 4135 .
Chro.80165 3558 AAEL01000399 1613 2512 hypothetical protein, conserved
Chro.80166 3559 AAEL01000399 0 890 DNA primase large subunit
Chro.80167 3560 AAEL01001037 431 1111 .
Protein serine/threonine phosphatase 2C,
Chro.80168 3561 AAELO 1000382 159 542 . catalytic domain;
Chro.80169 3562 AAEL01000382 967 1170 .
Chro.80170 3563 AAEL01000382 1348 1614 . similar to Homo sapiens (Human). GDP-
Chro.80171 3564 AAELO 1000382 1739 2992 fucose transporter 1
Chro.80172 3565 AAELO 1000382 4359 6218 WD repeat-containing protein 3 WD40-repeat;
Chro.80173 3566 AAEL01000468 1 2220 . •
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.80174 3567 AAELO 1000468 2655 3116 .
Chro.80175 3568 AAELO 1000468 3192 4166 hypothetical protein, conserved
Chro.80176 3569 AAEL01000365 461 1072 hypothetical protein
Chro.80177 3570 AAELO 1000365 1533 4439 formin-related protein, possible
Chro.80178 3571 AAEL01000229 449 979 . hypothetical protein T10G3.5 -
Chro.80179 3572 AAEL01000229 1518 5138 Caenorhabditis elegans
Chro.80180 3573 AAELO 1000873 620 1444 ubiquitin carboxyl-terminal hydrolase,
Chro.80181 3574 AAEL01000229 5652 10457 putative Cysteine proteinases; TRAF domain-like; similar to Plasmodium falciparum.
Chro.80182 3575 AAELO 1000229 10632 11285 Hypothetical protein
Chro.80183 3576 AAELO 1000479 600 1751 hypothetical protein C2H2 and C2HC zinc fingers;
Chro.80184 3577 AAELO 1000479 1766 2335 cyclophilin Cyclophilin (peptidylprolyl isomerase);
Chro.80185 3578 AAELO 1000479 2506 4188
Chro.80186 3579 AAEL01000640 1394 2368 expressed protein
Chro.80187 3580 AAEL01000640 81 1397
Chro.80188 3581 AAEL01000378 2646 5021 Hexosphosphate Transport Family A G protein-coupled receptor-like;
Chro.80189 3582 AAEL01000378 6049 6801
Chro.80190 3583 AAEL01000140 9742 11172 hypothetical protein
Chro.80191 3584 AAEL01000140 8010 8591
Chro.80192 3585 AAEL01000140 6872 7552 CG1418-PA
Eukaryotic type KH-domain (eKH-
Chro.80193 3586 AAEL01000140 6091 6729 YOR3513c domain);
Table 1 Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Putative protein kinase, related to and redundant with Elmlp and Paklp in
Chro.80194 3587 AAEL01000140 4321 5535 activating the SNFl complex; Tos3p Protein kinase-like (PK-like);
P-loop containing nucleotide triphosphate hydrolases; C-terminal domain of alpha and beta subunits of Fl ATP synthase; N- terminal domain of alpha and beta subunits
Chro.80195 3588 AAEL01000140 2387 3868 vacuolar ATP synthase subunitb of Fl ATP synthase;
Chro.80196 3589 AAEL01000140 168 1613 .
13 KDA DEFLAGELLATION-
K) INDUCIBLE
PROTEIND gi|4689324|gb| AAD27849.11
Chro.80197 3590 AAELO 1000026 34349 34678 DIP 13 protein
Chro.80198 3591 AAEL01000026 32591 34000 aldehyde-alcohol dehydrogenase Dehydroquinate synthase-like;
Chro.80199 3592 AAEL01000026 28773 31241 aldehyde-alcohol dehydrogenase E Dehydroquinate synthase-like; ALDH-like; Molybdenum cofactor biosynthesis protein
Chro.80201 3593 AAEL01000026 26808 27743 ubiquitin-activating enzyme MoeB;
Chro.80202 3594 AAEL01000026 22122 26642 .
Chro.80203 3595 AAELO 1000026 20430 21431 .
Chro.80205 3596 AAEL01000026 15479 19201 . Ubiquitin-like;
Chro.80206 3597 AAEL01000026 11116 14304 YLP motif containing protein (XM130)
Chro.80207 3598 AAEL01000026 8414 10519 .
Chro.80208 3599 AAELO 1000026 5841 7283 .
Chro.80209 3600 AAEL01000026 3927 5024 .
Chro.80210 3601 AAEL01000026 2593 3366 .
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
ATP-dependent RNA helicase, putative; P-loop containing nucleotide triphosphate
Chro.80211 3602 AAEL01000026 46 1131 putative ATP-dependent RNA Helicase hydrolases;
L30e-like; Translational machinery
Chro.80212 3603 AAELO 1000319 396 1778 pelota (PELl) components;
Chro.80213 3604 AAEL01000319 2189 2518 4OS ribosomal subunit protein S9, putative Alpha-L RNA-binding motif;
Chro.80214 3605 AAELO 1000319 5335 5577 DP transcription factor CG4654-PA Winged helix DNA-binding domain;
Chro.80215 3606 AAELO 1000319 6480 8594 hypothetical protein WD40-reρeat; zinc finger (C3HC4-type RING finger)
Chro.80216 3607 AAEL01000373 2 397 protein family RING finger domain, C3HC4;
Chro.80217 3608 AAEL01000373 1404 2795 expressed protein
Chro.80218 3609 AAEL01000373 3030 4580 MGC69076 protein
OO Chro.80219 3610 AAEL01000373 5583 6062 .
Chro.80221 3611 AAELO 1000373 5823 7245 .
Chro.80222 3612 AAEL01000787 930 1862 .
Chro.80224 3613 AAEL01000787 281 814 . RmlC-like cupins;
Chro.80225 3614 AAELO 1000798 113 709 . EF-hand;
LacOPZ-alpha peptide from pUC9;
Chro.80226 3615 AAEL01001286 114 500 putative
P-loop containing nucleotide triphosphate
Chro.80227 3616 AAELO 1000579 4 2253 helicase, putative hydrolases;
Chro.80228 3617 AAEL01000943 684 1328 .
Chro.80229 3618 AAEL01000108 14 1465 .
Chro.80230 3619 AAELOIOOOIIO 109 963 . putative inorganic polyphosphate/ATP-
Chro.80231 3620 AAEL01000108 1767 3479 NAD kinase
Table 1
Ch_Gene SEQ TD NO. Ch_Accession Start End Description Superfamily
Actin-related protein 2/3 complex subunit
IA (SOP2-like protein) D gi| 1654002|emb|CAA70203.11
Chro.80232 3621 AAEL01000108 3660 4091 Sop2p-like protein WD40-repeat;
P-loop containing nucleotide triphosphate
Chro.80233 3622 AAEL01000108 5235 8126 hypothetical protein hydrolases;
Chro.80234 3623 AAEL01000108 8398 11373 Unknown (protein for MGC:66119) Acyl-CoA N-acyltransferases (Nat);
GCN5-related N-acetyltransferase (GNAT)
Chro.80236 3624 AAEL01000108 12086 12958 family Acyl-CoAN-acyltransferases (Nat);
DNA-glycosylase; TATA-box binding
Chro.80237 3625 AAEL01000108 13374 14540 ENSANGP00000020191 protein-like;
Chro.80238 3626 AAEL01000108 15435 16184 TATA-binding protein TATA-box binding protein-like;
Chro.80239 3627 AAEL01000108 16300 17025 unnamed protein product POZ domain;
Chro.80240 3628 AAEL01000108 17955 18977 . Nucleic acid-binding proteins;
Chro.80241 3629 AAEL01000551 1734 3239 . Nucleic acid-binding proteins;
Chro.80242 3630 AAEL01000623 1858 3090 rrp5 protein homolog TPR-like;
Chro.80243 3631 AAELO 1000623 372 1673 .
Chro.80244 3632 AAEL01000320 225 1124 .
Chro.80245 3633 AAEL01000320 1223 3040 . .
HAD-like; Calcium ATPase, transduction domain A; Calcium ATPase,
Chro.80246 3634 AAELO 1000320 3950 8425 membrane atpase transmembrane domain M;
Chro.80247 3635 AAEL01000079 21219 21530 . PH domain-like;
Chro.80248 3636 AAEL01000079 19256 19477 . PX domain;
Chro.80249 3637 AAELO 1000079 18858 19103 . .
Chro.80250 3638 AAEL01000079 17742 18419 hypothetical protein
Chro.80251 3639 AAEL01000079 17290 17565 .
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.80252 3640 AAEL01000079 15580 17124 hypothetical protein TPR-like;
Chro.80253 3641 AAEL01000079 14372 14830 .
PROLIFERATING CELL NUCLEAR ANTIGEN (PCNA) (CYCLIN) Dgi[ 100169|pir||S 15434 proliferating cell nuclear antigen - Madagascar periwinkleDgi|18172|emb|CAA38893.1|
Chro.80254 3642 AAEL01000079 12917 13705 proliferating cell nuclear antigen DNA clamp;
Chro.80255 3643 AAELO 1000079 10835 12160 poly (ADP-ribose) glycohydrolase
Chro.80256 3644 AAEL01000079 9885 10298 histone h2a Histone-fold;
Serine/threonine-protein kinase Nekl (NimA-related protein kinase 1) (NY-REN-
° Chro.80257 3645 AAEL01000079 7139 8740 55 antigen) Protein kinase-like (PK-like);
Chro.80258 3646 AAELO 1000079 6573 7001
Chro.80259 3647 AAELO 1000079 4873 6144 BRGl/brm-associated factor 53A Actin-like ATPase domain;
Chro.80260 3648 AAEL01000079 3228 4484 ENSANGP00000014983 RCCl/BLIP-π;
Chro.80261 3649 AAELO 1000079 481 1665
Chro.80262 3650 AAEL01001399 168 542 Phosphoglycerate mutase-like;
Chro.80263 3651 AAEL01001117 23 241
Chro.80264 3652 AAEL01000887 750 1265 CG10354-PA Resolvase-like;
Chro.80265 3653 AAEL01000302 6765 8969 pacman protein RNA-binding domain, RBD;
Drosophila melanogaster CG12263 gene
Chro.80266 3654 AAEL01000302 3514 6630 product-related Alkaline phosphatase-like;
Chro.80267 3655 AAEL01000302 2 2680 purine NTPase Prefoldin;
Chro.80268 3656 AAEL01000922 129 992
Chro.80269 3657 AAEL01000439 4080 4871
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superf amity
Chro.80270 3658 AAEL01000592 226 1077 bromodomain protein Bromodomain;
Chro.80272 3659 AAEL01000592 1700 2158 .
Chro.80273 3660 AAEL01000204 9835 12024 .
transhydrogenase homolog 7B2 - Eimeria Formate/glycerate dehydrogenase catalytic tenellaD gi|305062|gb|AAA29077.11 domain-like; DHS-Kke NAD/FAD-binding
Chro.80274 3661 AAEL01000204 8649 9152 transhydrogenase domain;
Chro.80275 3662 AAELO 1000204 4562 4945 glycine-rich protein 2 (GRP2) Nucleic acid-binding proteins; cyclophilin-RNA interacting protein, Cyclophilin (peptidylprolyl isomerase);
Chro.80276 3663 AAEL01000204 2202 3110 putative RNA-binding domain, RBD;
Chro.80277 3664 AAEL01000204 4 195
Chro.80279 3665 AAELO 1000059 23222 25342
K) Chro.80280 3666 AAEL01000059 20771 22621 diacylglycerol kinase variant A
-4
FIFO ATP synthase subunitB, membrane
Chro.80281 3667 AAEL01000059 19507 20256 hypothetical protein domain;
P-loop containing nucleotide triphosphate
Chro.80282 3668 AAEL01000059 17000 19447 hypothetical protein, conserved hydrolases;
Chro.80283 3669 AAELO 1000059 14671 15231 . Winged helix DNA-binding domain;
Protein kinase-like (PK-like); Histone H3 K4-specifϊc methyltransferase SET7/9 N-
Chro.80284 3670 AAELO 1000059 terminal domain; SAM/Pointed domain;
Chro.80285 3671 AAELO 1000059 9459 12203 protein kinase, putative Protein kinase-like (PK-like); ARM repeat;
Chro.80286 3672 AAEL01000059 5652 8816 Formin Homology 2 Domain, putative
Chro.80287 3673 AAEL01000059 4004 5233 .
Chro.80288 3674 AAEL01000059 1685 3469 .
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro,80289 3675 AAEL01000059 751 1494 .
Chro.80290 3676 AAEL01000033 28 1767 .
Chro.80292 3677 AAEL01000033 2425 4092 .
Chro.80293 3678 AAEL01000033 4635 6185 .
ATP dependent RNA helicase, putative; P-loop containing nucleotide triphosphate
Chro.80294 3679 AAEL01000033 7228 11070 putative ATP dependent RNA helicase hydrolases;
Chro.80295 3680 AAEL01000033 11919 14837 Sushi domain, putative Complement control module/SCR domain;
Chro.80296 3681 AAEL01000033 15044 15841 hypothetical protein
Chro.80297 3682 AAEL01001393 326 529.
Chro.80298 3683 AAEL01000033 16445 20404 hypothetical protein
Chro.80299 3684 AAEL01000033 20679 20936 .
-J Chro.80300 3685 AAEL01000033 22038 23921 hypothetical protein RING finger domain, C3HC4; KJ
Chro.80301 3686 AAEL01000033 24016 25233 .
Homo sapiens serine hydroxymethyltransferase 2
Chro.80302 3687 AAEL01000033 25331 26647 (mitochondrial) PLP-dependent transferases;
Chro.80304 3688 AAEL01000033 26907 27737 .
Chro.80305 3689 AAEL01000033 28382 28801 .
Chro.80306 3690 AAEL01000033 28873 30210 serine hydroxymethyltransferase PLP-dependent transferases;
Chro.80307 3691 AAEL01000033 30620 32878 .
Chro.80308 3692 AAEL01000121 28 756 putative autophagocytosis protein
Chro.80309 3693 AAEL01000121 784 1398 .
Chro.80310 3694 AAEL01000121 1670 12142 . ARM repeat;
Chro.80311 3685 AAEL01000121 12849 14135 .
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
FAD/NAD(P)-binding domain; FAD-
(R)-mandelonitrile lyase ((r)-oxynitrilase), linked reductases, C-terminal domain;
Chro.80312 3696 AAEL01000121 14380 16494 putative FAD/NAD(P)-binding domain;
Chro.80313 3697 AAEL01000121 16724 17620 .
Chro.80314 3698 AAEL01000121 17628 17765 .
Chro.80315 3699 AAELO 1000186 11474 12922 unknown protein FAD/NAD(P)-binding domain; putative NADPH:ferredoxin
Chro.80316 3700 AAEL01000186 9233 10798 oxidoreductase Nucleotide-binding domain;
Chro.80317 3701 AAELO 1000186 5409 9014 Insulinase, putative LuxS/MPP-like metallohydrolase;
Chro.80318 3702 AAEL01000703 16 645 SET-domain protein, putative SET domain;
Chro.80319 3703 AAELO 1000703 692 1717 .
Chro.80320 3704 AAEL01000153 15307 15528 .
Chro.80321 3705 AAEL01000153 14202 15305 hypothetical protein
Chro.80322 3706 AAELO 1000153 13654 13899 . chromatin remodelling complex protein SNF2L - malaria parasite (Plasmodium falciparum) D gi|2213862|gb|AAC47719.11 P-loop containing nucleotide triphosphate
Chro.80323 3707 AAELO1OOO153 8970 12848 PΪSNF2L hydrolases;
Chro.80324 3708 AAEL01000153 8371 8763
Chro.80325 3709 AAEL01000153 8023 8331 hypothetical protein
Chro.80326 3710 AAEL01000030 189 5516 . WD40-repeat;
Chro.80327 3711 AAEL01000030 5673 7397 putative notch receptor protein uridine kinase/uracil PRTase-like; P-loop containing nucleotide
Chro.80328 3712 AAELO 1000030 7647 9020 phosphoribosyltransferase triphosphate hydrolases;
Chro.80329 3713 AAEL01000030 9428 10075 DNAJ Chaperone J-domain;
Chro.80330 3714 AAELO 1000030 10540 12075 RNI-like; Ubiquitin-like;
Chro.80331 3715 AAEL01000030 12420 14084
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.80332 3716 AAEL01000030 14804 16690 . Chro.80333 3717 AAEL01000030 17317 18297 hypothetical protein Chaperone J-domain; Chro.80334 3718 AAEL01000030 18955 19611 ribosomal protein Ll, putative Ribosomal protein Ll; Chro.80335 3719 AAEL01000030 20162 20638 hypothetical protein Chro.80336 3720 AAEL01000030 20666 21190 hypothetical protein elFl-like; serologically defined breast cancer antigen
Chro.80337 3721 AAEL01000030 21638 22804 84 like (42.9 KD) (XQ234)
C2 domain (Calcium/lipid-binding domain, CaLB); C2 domain (Calcium/lipid-binding domain, CaLB); C2 domain (Calcium/lipid- binding domain, CaLB); C2 domain (Calcium/lipid-binding domain, CaLB); C2
-4 domain (Calcium/lipid-binding domain,
Chro.80338 3722 AAEL01000030 22864 26973 hypothetical protein CaLB);
C2 domain (Calcium/lipid-binding domain,
Chro.80339 3723 AAELO 1001067 396 944 hypothetical protein CaLB); Chro.80340 3724 AAEL01000030 27125 28486 .
Ribosomal protein S5 domain 2-like; P-
Elongation factor 2 (EF- loop containing nucleotide triphosphate 2) D gi|706975|gb|AAC46607.1 [ elongation hydrolases; EF-G/eEF-2 domains HI and V;
Chro.80341 3725 AAEL01000030 28628 31126 factor-2 Translation proteins;
P-loop containing nucleotide triphosphate hydrolases; DNA polymerase HI clamp
Chro.80342 3726 AAEL01000030 32103 32735 replication factor C subunit loader subunits, C-terminal domain;
Chro.80343 3737 AAEL01000030 33438 33722 .
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.80344 3738 AAELO 1000817 1323 1766 .
Chro.80345 3729 AAEL01000817 17 919 Cell cycle control protein cwf22 ARM repeat;
Chro.80346 3730 AAEL01000116 17269 18123 unnamed protein product hypothetical predicted glutathione S- transferase domain protein, unknown
Chro.80347 3731 AAEL01000116 15855 17141 function Thioredoxin-like;
Chro.80348 3732 AAEL01000116 15258 15692 hypothetical protein
Chro.80349 3733 AAEL01000116 14695 14904 .
Chro.80350 3734 AAEL01000116 11792 13837 hypothetical protein, conserved
P-loop containing nucleotide triphosphate
Chro.80351 3735 AAEL01000116 7400 11206 Unknown (protein for MGC:68930) hydrolases;
Chro.80352 3736 AAEL01000116 6444 7346 .
Ul Chro.80353 3737 AAEL01000116 5427 6131 .
Chro.80354 3738 AAEL01000116 2235 4862 .
Glucocorticoid receptor-like (DNA-binding
Chro.80355 3739 AAEL01000119 16669 17550 . domain);
Chro.80356 3740 AAEL01000119 15911 16162 . Histone-fold;
Chro.80357 3741 AAEL01000119 12922 14745 ENSANGPOOOOOO 19991 Clathrin adaptor appendage domain; serine/threonine protein kinase KKIALRE
Chro.80358 3742 AAEL01000119 11152 12687 (EC 2.7.1.-) - human Protein kinase-like (PK-like);
P-loop containing nucleotide triphosphate
Chro.80359 3743 AAEL01000119 8345 10864 Hypothetical protein CBG00497 hydrolases; subunit of proteaseome activator complex,
Chro.80360 3744 AAEL01000119 5893 6597 putative Proteasome activator reg(alpha);
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Nucleotidylyl transferase; Anticodon- binding domain of a subclass of class I aminoacyl-tRNA synthetases; tRNA-
Chro.80361 3745 AAEL01000119 2466 5594 valyl tRNA synthetase binding arm;
Chro.80362 3746 AAEL01000119 1 2235 Unknown (protein for MGC:77199) WD40-repeat;
Chro.80363 3747 AAEL01000982 217 1188 .
Chro.80364 3748 AAEL01000278 168 1724 hypothetical protein
Chro.80365 3749 AAEL01000278 2018 2275 .
P-loop containing nucleotide triphosphate
Chro.80366 3750 AAELO 1000278 2604 3671 hypothetical protein AN2155.2 hydrolases;
Chro.80367 3751 AAEL01000278 4514 4882 .
Chro.80368 3752 AAELO 1000278 4876 5235 .
Chro.80369 3753 AAELO 1000278 4977 5285 unknown
Chro.80370 3754 AAEL01000278 6247 8742 hypothetical protein F13O11.26 ARM repeat; endoplasmic reticulum oxidoreductin,
Chro.80371 3755 AAELO 1000278 8871 9711 putative ubiquitin carboxy-terminal hydrolase Ll; gracile axonal dystrophy; protein gene
Chro.80372 3756 AAELO 1000005 187 954 product 9.5 Cysteine proteinases; helicase, belonging to UvrD family, P-loop containing nucleotide triphosphate
Chro.80373 3757 AAELO 1000005 953 3703 putative hydrolases;
Chro.80374 3738 AAEL01000005 3724 4959 putative RNA-binding protein
Chro.80375 3759 AAELO 1000005 5674 8130 hypothetical protein
Chro.80376 3760 AAEL01000005 8509 10758 hypothetical protein
Chro.80377 3761 AAELO 1000005 11074 12759 ABCl family, putative Protein kmase-like (PK-like);
Chro.80378 3762 AAELO 1000005 12885 14525 importin alpha ARM repeat;
Chro.80379 3763 AAEL01000005 14970 15212 .
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.80380 3764 AAELO 1000005 15384 17249 hypothetical protein Chaperone J-domain; phosphatidylinositol-4-phosρhate 5-kinase,
Chro.80381 3765 AAEL01000005 19612 20754 putative SAICAR synthase-like; EF-hand;
S-adenosyl-L-methionine-dependent Chro.80382 3766 AAEL01000005 21400 22188 methyltransferase methyltransferases;
P-loop containing nucleotide triphosphate
Chro.80383 3767 AAEL01000005 22810 24642 kinesin-like protein, putative hydrolases; Chro.80384 3768 AAEL01000005 25272 26393 expressed protein C2H2 and C2HC zinc fingers;
B3/B4 domain of PheRS, PheT; Putative phenylalanyl-tRNA synthetase beta- DNA-binding domain; Class II aaRS and
Chro.80385 3769 AAEL01000005 26852 28795 subunit; PheHB -related biotin synthetases;
Chro.80386 3770 AAEL01000005 29123 29554 translation initiation factor eIF-lA, putative Nucleic acid-binding proteins;
K) -4 -4 Chro.80387 3771 AAEL01000005 29862 30809 PWI domain, putative
EGF/Laminin; Growth factor receptor
Chro.80388 3772 AAEL01000005 31004 33667 oocyst wall protein 4 precursor domain;
Chro.80389 3773 AAEL01000005 33662 35458 .
Chro.80390 3774 AAEL01000005 36312 37301 ENSANGP00000021579 RNA-binding domain, RBD; hypothetical protein ( hypothetical protein Chro.80391 3775 AAEL01000005 38058 42077 B ID 1.160 ARM repeat;
872
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
RNA-binding protein; eukaryotic conserved protein; localization nucleolus (predicted) (PME) 11864607); involved in RNA processing (predicted) (PMID 11864607); involved in ribosome biogenesis and assembly (predicted) (PMID 11864607); Brix domain; similar to
Chro.80392 3776 AAEL01000005 42448 43539 S. cerevisiae YHR066W Chro.80393 3777 AAEL01000005 43604 44605 Unknown, putative
S-adenosyl-L-methionine-dependent
Chro.80394 3778 AAEL01000005 46076 47050 hypothetical protein methyltransferases; Metalloproteases ("zincins"), catalytic domain; Leukotriene A4 hydrolase N-
Chro.80395 3779 AAEL01000005 47539 50349 aminopeptidase N terminal domain; Chro.80396 3780 AAEL01000005 50634 53429 karyopherin (importin) beta 2 ARM repeat; Chro.80397 3781 AAEL01000005 54364 54927 similar to ribosomal protein Ll 7 Ribosomal protein L22; Nucleotidylyl transferase; Anticodon- binding domain of a subclass of class I
Chro.80398 3782 AAEL01000005 55308 56996 methionine ~ tRNA ligase, putative aminoacyl-tRNA synthetases; Chro.80399 3783 AAEL01000005 57183 58496 hypothetical protein RING finger domain, C3HC4; hypothetical protein ( (AF378548)
Chro.80400 3784 AAEL01000005 59376 59783 ribosomal protein L34-like protein Chro.80401 3785 AAELO 1000005 59857 60816 . Chro.80402 3786 AAEL01000005 60991 61563 . thioredoxin-like, 32kDa; thioredoxin- related 32 kDa protein; thioredoxin-like,
Chro.80403 3787 AAEL01000161 11310 11723 32kD
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.80404 3788 AAEL01000161 7435 10815 unknown
Chro.80405 3789 AAEL01000161 4230 5798 .
Chro.80406 3790 AAEL01000161 1806 3476 .
Chro.80409 3791 AAEL01000453 1690 3201 .
Chro.80410 3792 AAELO 1000453 4295 4594 .
Chro.80412 3793 AAELO 1000122 16536 17702 .
Chro.80413 3794 AAEL01000122 15295 16440 .
Chro.80414 3795 AAEL01000122 13517 15133 .
Chro.80415 3796 AAEL01000122 11772 12506 expressed protein
Chro.80416 3797 AAEL01000122 9581 10624 .
Chro.80417 3798 AAEL01000122 8718 8987 .
Chro.80418 3799 AAEL01000122 8423 8551 .
Chro.80420 3800 AAELO 1000122 7482 8234 .
-4
Multidrug efflux transporter AcrB
Chro.80421 3801 AAEL01000122 2068 6465 Hypothetical protein CBG02358 transmembrane domain; Transglutaminase, two C-terminal
Chro.80422 3802 AAEL01000122 949 1848 . domains;
RNA 3'-Terminal Phosphate Cyclase-like
Chro.80423 3803 AAEL01000036 50 1057 protein, putative EPT/RTPC-like;
Chro.80424 3804 AAEL01000036 1305 1889 .
Glutathione synthetase ATP-binding domain-like; PreATP-grasp domain; Rudiment single hybrid motif; Single
Chro.80425 3805 AAEL01000036 2208 10385 acetyl-CoA carboxylase 2 hybrid motif;
Chro.80426 3806 AAEL01000036 11240 12079
Chro.80427 3807 AAEL01000036 12398 12673
Chro.80428 3808 AAEL01000036 13029 14234
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily
RING finger domain, C3HC4; Retrovirus
Chro.80429 3809 AAEL01000036 14359 15789 development protein DGl 124 zinc finger-like domains;
Chro.80430 3810 AAEL01000036 16156 16968 .
Chro.80431 3811 AAEL01000036 17449 18822 putative transmembrane transporter
Chro.80432 3812 AAEL01000036 19187 20497 .
Chro.80433 3813 AAEL01000036 25871 28051 .
Chaperone J-domain; HSP40/DnaJ peptide-
Chro.80434 3814 AAEL01000036 28510 29784 DnaJ homolog binding domain;
Chro.80435 3815 AAEL01000036 30283 30726 .
C-terminal domain of phosphatidylinositol κ> Chro.80436 3816 AAEL01000036 30775 31311 hypothetical protein transfer protein secl4p;
OO O Chro.80437 3817 AAEL01000027 34889 35128 .
Chro.80438 3818 AAEL01000027 34202 34522 .
Chro.80439 3819 AAELO 1000027 32770 33618 .
Chro.80440 3820 AAELO 1000027 30821 32269 .
Chro.80441 3821 AAELO 1000027 30058 30462 .
Chro.80442 3822 AAEL01000027 29243 29863 .
Chro.80443 3823 AAEL01000027 27991 29001 Unknown (protein for MGG63554) UBC-like;
Chro.80444 3824 AAELO 1000027 25592 27682 .
Chro.80445 3825 AAEL01000027 23993 25441 hypothetical protein
Chro.80446 3826 AAEL01000027 21970 23811 .
Chro.80447 3837 AAEL01000027 19723 21567 .
P-loop containing nucleotide triphosphate
Chro.80448 3828 AAEL01000027 17931 19214 helicase, putative hydrolases;
Chro.80449 3829 AAEL01000027 15252 17081 expressed protein
Chro.80450 3830 AAELO 1000027 14376 15110 .
Table 1
Ch Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
P-loop containing nucleotide triphosphate
Chro.80451 3831 AAEL01000027 12553 13989 hypothetical protein hydrolases;
Chro.80452 3832 AAEL01000027 10290 1 111779922 hypothetical protein Nucleotide-diphospho-sugar transferases;
DNA repair protein MutS, domain IH; P- loop containing nucleotide triphosphate
Chro.80453 3833 AAEL01000027 7510 1 100005533 MutS homolog 2-related hydrolases;
YVTN repeat-like/Quinoprotein amine
Chro.80454 3834 AAELO 1000027 6445 6663 dehydrogenase;
Similar to RIKEN cDNA 9430077D24
Chro.80455 3835 AAELO 1000027 5821 6168 gene Tricorn protease N-terminal domain;
Chro.80456 3836 AAELO 1000027 5004 5576 nucleosome assembly protein
OO Chro.80457 3837 AAEL01000027 3586 4389
Chro.80458 3838 AAEL01000027 2624 3082
Chro.80459 3839 AAELO 1000027 51 2279 EF-hand; reticulocyte-binding protein 2 homolog A,
Chro.80460 3840 AAEL01000199 11318 12730 putative cAMP-binding domain-like; EF-hand; similar to Homo sapiens (Human). Histidyl- ■ Class H aaRS and biotin synthetases; tRNA synthetase (EC 6.1.1.21) (Histidine- Anticodon-binding domain of Class II
Chro.80461 3841 AAEL01000199 7219 8805 tRNA ligase) (HisRS) aaRS;
Chro.80462 3842 AAEL01000199 2790 5150
Chro.80463 3843 AAEL01001259 13 687
Chro.80464 3844 AAEL01000621 42 284
Chro.80465 3845 AAELO 1000621 294 842 clathrin assembly protein AP 19, putative SNARE-like;
Chro.80466 3846 AAEL01000556 2374 3651 PCI domain, putative TPR-like;
Chro.80467 3847 AAEL01000534 131 3013 hypothetical protein Homeodomain-like;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Diisopropylfluorophosphatase
Chro.80469 3848 AAEL01000534 3074 3943 . (phosphotriesterase, DFP);
Chro.80470 3849 AAEL01000677 1685 2521 .
P-loop containing nucleotide triphosphate
Chro.80471 3850 AAEL01000085 18903 21047 RNA helicase, putative hydrolases;
WD40-repeat; Insect cysteine-rich
Chro.80472 3851 AAEL01000085 17256 17879 Unknown (protein for MGC:63980) antifreeze protein;
Chro.80473 3852 AAEL01000085 14683 15375 centrosomal protein centrin 3 EF-hand;
Chro.80474 3853 AAEL01000085 13126 14499 .
Chro.80475 3854 AAEL01000085 12422 12844 .
Chro.80476 3855 AAELO 1000085 9996 11486 . RNA-binding domain, RBD;
Chro.80477 3856 AAELO 1000085 8812 9924 .
OC
KJ
Chro.80478 3857 AAEL01000085 4559 7831 CCAAT-box-binding transcription factor ARM repeat;
Chro.80481 3858 AAELO 1000085 2243 4441 similar to formin-2
Chro.80482 3859 AAEL01000085 766 1032 .
Chro.80483 3860 AAEL01001203 87 341 .
Chro.80484 3861 AAEL01000230 9664 10557 .
Structure-specific recognition protein 1 (SSRPl) (Recombination signal sequence recognition protein) (T160)Dgi|7446218|pir||S78050 high mobility group 1 protein homolog - chicken (fragment) D gi|211520|gb|AAA48685.11
Chro.80485 3862 AAEL01000230 8033 8725 HMG box (bp. 1499..1757) HMG-box;
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
FAD/NAD(P)-binding domain; Nucleotide-
Chro.80486 3863 AAEL01000230 5139 7787 . binding domain;
Drosophila melanogaster CG13900 gene Diisopropylfluorophosphatase
Chro.80487 3864 AAEL01000230 543 4499 product (phosphotriesterase, DFP);
Chro.80488 3864 AAEL01000611 6 302 putative hydroxysteroiddehydrogenase NAD(P)-binding Rossmann-fold domains;
Chro.80489 3866 AAEL01000611 847 1086
Chro.80490 3867 AAEL01000611 1552 1923 ubiquitin-like protein, putative Ubiquitin-like;
S-adenosyl-L-methionine-dependent
Chro.80491 3868 AAEL01000611 2347 3009 FLJ12760 protein methyltransferases;
Chro.80492 3869 AAEL01000537 323 2359 hypothetical protein
Chro.80493 3870 AAEL01000537 2913 3665 hypothetical protein PH domain-like;
Chro.80494 3871 AAEL01000384 11 487
Chro.80495 3872 AAEL01000384 612 818
Chro.80496 3873 AAEL01000384 1514 2140 •
S-adenosyl-L-methionine-dependent
Chro.80497 3874 AAEL01000384 3195 4100 fibrillarin, putative methyltransferases;
Chro.80498 3875 AAELO 1000384 4871 6884 Similar to KIAA1453 protein Cysteine proteinases;
Chro.80499 3876 AAEL01000329 173 862 60S ribosomal protein L7, putative Ribosomal protein L30p/L7e;
Chro.80500 3877 AAEL01000329 2096 2488 ribosomal protein S 8 Ribosomal protein S8;
Chro.80501 3878 AAEL01000329 3272 6262 .
Chro.80502 3879 AAEL01000329 6939 8234 Bx42 CG8264-PA
Chro.80503 3880 AAEL01001287 47 547
Elongation factor TFIIS domain 2; Zinc beta-ribbon; Conserved domain common to transcription elongation factor TFIIS .h, transcription factors TFIIS, elongin A,
Chro.80505 3881 AAELO 1000573 1669 2667 putative CRSP70;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.80506 3882 AAEL01000573 25 1458 .
Chro.80507 3883 AAEL01000112 175 522 SD02907p RING finger domain, C3HC4; eukaryotic translation initiation factor 2, Zinc-binding domain of translation
Chro.80508 3884 AAEL01000112 871 1515 beta, putative initiation factor 2 beta;
Chro.80509 3885 AAEL01000112 2681 4414 .
Chro.80510 3886 AAEL01000112 5149 7092 .
Chro.80511 3887 AAEL01000112 8680 9894 cell differentiation protein rcdl, putative ARM repeat; beta-sandwich domain of Sec23/24; C- terminal, gelsolin-like domain of Sec23/24;
Chro.80513 3888 AAEL01000112 11697 13160 hypothetical protein Helical domain of Sec23/24;
Chro.80514 3889 AAEL01000112 13895 15412 .
Chro.80517 3890 AAEL01000112 16094 18310 hypothetical protein g Chro.80518 3891 AAEL01000303 239 1657 phosphatidylinositol 4-kinase, putative Protein kmase-like (PK-like);
Chro.80519 3892 AAEL01000303 2048 5266 .
Chro.80520 3893 AAEL01000303 7828 8748 . Bromodomain;
Chro.80521 3894 AAEL01000635 932 2068 .
Chro.80522 3895 AAEL01000959 0 1250 SOFl protein-like protein WD40-repeat;
Chro.80523 3896 AAELO 1000973 0 1098 Plasmodium falciparum CG7
Chro.80525 3897 AAEL01001041 87 494 .
Chro.80527 3898 AAEL01000726 554 1981 .
Chro.80528 3899 AAEL01000929 687 1397 repeat organellar protein-related
Chro.80530 3900 AAEL01000683 3 1004 .
Chro.80531 3901 AAEL01000233 13 243 .
Chro.80532 3902 AAEL01000233 495 1118 . Nudix;
Table 1
Ch_Gene SEQ BD NO. Ch Accession Start End Description Superfamily
P-loop containing nucleotide triphosphate hydrolases; FYVE/PHD zinc finger; RING finger domain, C3HC4; Retrovirus zinc
Chro.80533 3903 AAEL01000233 1698 8126 SNF2 family N-terminal domain, putative finger-like domains; Chro.80534 3904 AAEL01000233 10016 10987 putative fatty-acyl elongase Chro.80535 3905 AAELO 1000565 3 1016 . WD40-repeat; Chro.80536 3906 AAEL01000565 1252 1638 Chro.80537 3907 AAEL01000565 2163 3356 Chro.80538 3908 AAEL01000760 496 1080 hypothetical protein Chro.80539 3909 AAELO 1000760 1180 1938 hypothetical protein Chro.80540 3910 AAEL01000636 3 1604 NSP3 homodimer;
OO Chro.80541 3911 AAEL01001333 2 301
Class II aaRS and biotin synthetases; tRNA-
Chro.80542 3912 AAEL01000180 10560 11924 hypothetical protein AN8867.2 binding arm; Chro.80543 3913 AAEL01000180 8706 10394 OSJNBa0084K11.19 Zn2/Cys6 DNA-binding domain; Chro.80544 3914 AAELO 1000180 7043 7627 proteinx0005 4'-phosphopantetheinyl transferase; Chro.80545 3915 AAEL01000180 6058 6345 .
P-loop containing nucleotide triphosphate
Chro.80546 3916 AAEL01000180 3727 5283 DEAD-box RNA helicase, putative hydrolases;
S-adenosyl-L-methionine-dependent
Chro.80547 3917 AAEL01000180 2155 3201 probable arginine N-methyltransferase methyltransferases; Chro.80548 3918 AAEL01000505 718 4245 . Chro.80549 3919 AAEL01000474 535 1866 . Chro.80550 3920 AAEL01000474 2516 2782 . Chro.80551 3921 AAEL01000474 3289 3834 V-ATPase subunit c" proteolipid FIFO ATP synthase subunit C;
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Sta arrtt E 1 Enndd Description Superfamily
ERYTHROCYTE MEMBRANE SMAD/FHA domain; RING finger domain,
Chro.80552 3922 AAELO 1000586 2752 3513 PROTEIN PFEMP3 C3HC4; Chro.80553 3923 AAEL01000583 1448 2080 hypothetical protein BRCT domain; HAD-like; Chro.80554 3924 AAELO 1000583 3124 3384 Chro.80555 3925 AAEL01000818 809 1847 Ovomucoid/PCI- 1 like inhibitors; Chro.80556 3926 AAEL01000352 388 6309 Myb-like DNA-binding domain, putative Homeodomain-like; Chro.80557 3927 AAEL01001350 3 632 . Chro.80558 3928 AAEL01000645 933 2474 hypothetical protein, conserved conserved protein; putative tRNA
Chro.80559 3929 AAEL01000901 535 1185 synthetase class H Chro.80560 3930 AAELO 1000955 206 1324 Chro.80561 3931 AAEL01000118 104 445
Ribonuclease H-like; WD40-repeat;
Chro.80562 3932 AAEL01000118 2305 8103 1200014O24Rik protein Cysteine proteinases; Chro.80563 3933 AAEL01000118 8674 9612 . WD40-repeat; Chro.80564 3934 AAEL01000118 11361 11861 hypothetical protein
UDP-Glycosyltransferase/glycogen
Chro.80565 3935 AAEL01000118 12567 16763 putative trehalose synthase phosphorylase; HAD-like; Chro.80566 3936 AAEL01000118 16854 17942 . Chro.80567 3937 AAEL01000306 2527 3168 . Chro.80568 3938 AAEL01000306 4744 5676 . Chro.80569 3939 AAEL01000395 56 2794 . TPR-like; Chro.80570 3940 AAEL01000395 3245 3622 .
P-loop containing nucleotide triphosphate
Chro.80571 3941 AAEL01000395 3771 4907 ENSANGP00000021537 hydrolases; Chro.80572 3942 AAEL01000395 5537 6421 . Chro.80573 3943 AAELO 1000790 1416 1670 .
Table 1
Ch Gene SEQ ID NO. Ch Accession Start End Description Superfamily glucan 1,4-alpha-glucosidase (EC 3.2.1.3)
Chro.80574 3944 AAEL01000790 522 998 precursor - Neurospora crassa Starch-binding domain; Chro.80575 3945 AAEL01000313 929 1906 Pfs77 protein, putative Chro.80576 3946 AAEL01000313 2195 2515 Chro.80577 3947 AAEL01000313 3921 4394 hypothetical protein Chro.80578 3948 AAEL01000313 4952 5410 Hypothetical protein CBG14319 Chro.80579 3949 AAEL01000313 7141 7479. Chro.80580 3950 AAEL01000313 7705 8625. Chro.80581 3951 AAELO1000313 8895 8978. Chro.80583 3952 AAEL01000170 476 967. protein kinase NPK2 (EC 2.7.1.-) -
OO common -4 tobacco D gi[862342|dbj |BAA06731.11
Chro.80584 3953 AAEL01000170 1427 2581 NPK2 Protein kinase-like (PK-like);
KNA recognition motif (RRM)-containing
Chro.80585 3954 AAEL01000170 2989 3756 p prrootteeimn RNA-binding domain, RBD; Chro.80586 3955 AAEL01000170 4021 4902 . Chro.80587 3956 AAEL01000170 6371 8341 e exxoorriibboonnuucclleeaassee,, V VaaccBB//RRnnbb f faami ily Nucleic acid-binding proteins; Chro.80588 3957 AAEL01000170 8617 9129 h hyyppootthheettiiccaall p prrootteeiinn RNA-binding domain, RBD; Chro.80589 3958 AAEL01000170 9882 10547 . Chro.80590 3959 AAELO 1000170 11125 12489 hypothetical protein AN4936.2 Protein kinase-like (PK-like); Chro.80591 3960 AAEL01000170 12490 14481 . Chro.80592 3961 AAEL01000330 7669 8292 . ARM repeat; Chro.80593 3962 AAEL01000330 6754 7299 conserved hypothetical protein Nucleic acid-binding proteins;
Acid_phosphatase/Vanadium-dependent
Chro.80594 3963 AAEL01000330 1493 2410 . haloperoxidase; Chro.80595 3964 AAEL01000330 196 1059 .
Table 1
Ch_Gene SEQ ID NO. Ch Accession Start End Description Superfamily
Chro.80596 3965 AAELO 1000015 38866 39897 . Thioredoxin-like;
Chro.80597 3966 AAELO 1000015 38250 38561 Histone H4 Histone-fold;
U2 snRNP auxiliary factor, small subunit,
Chro.80598 3967 AAEL01000015 36860 37603 putative RNA-binding domain, RBD;
Chro.80599 3968 AAEL01000015 35796 36503 . FYVE/PHD zinc finger; P-loop containing nucleotide triphosphate signal recognition particle receptor alpha hydrolases; Domain of the SRP/SRP
Chro.80600 3969 AAEL01000015 33923 35569 subunit, putative receptor G-proteins;
Chro.80601 3970 AAELO 1000015 32063 33565 .
Chro.80602 3971 AAEL01000015 30843 31475 unnamed protein product Pseudouridine synthase;
U4/U6-associated RNA splicing factor-
Chro.80603 3972 AAELO 1000015 23919 30431 related Quinoprotein alcohol dehydrogenase-like; retinitis pigmentosa GTPase regulator-like
Chro.80604 3973 AAELO 1000015 21258 23705 protein mature-parasite-infected erythrocyte
Chro.80605 3974 AAEL01000015 17727 20849 surface antigen
Chro.80606 3975 AAELO 1000015 17153 17389 .
Chro.80607 3976 AAEL01000015 15894 16931 . Protein kinase-like (PK-like);
Chro.80608 3977 AAELO 1000015 14542 15513 .
Chro.80609 3978 AAEL01000015 10540 13959 KIAA0866 protein
Chro.80610 3979 AAEL01000015 7357 9888 .
Chro.80611 3980 AAELO 1000015 6569 6916 CG4090-PA
Chro.80612 3981 AAEL01000015 4743 5216 .
Chro.80613 3982 AAELO 1000015 2831 3649 .
Chro.80614 3983 AAELO 1000015 1579 2124 . hypothetical predicted protein, unknown
Chro.80615 3984 AAEL01000015 5 472 function
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
METHYLATED-DNA-PROTEIN- CYSTEME METHYLTRANSFERASE (6- O-METHYLGUANINE-DNA METHYLTRANSFERASE) (0-6- METHYLGUANINE-DNA-
Chro.80616 3985 AAEL01000242 970 1611 ALKYLTRANSFERASE) DNA-glycosylase;
Chro.80617 3986 AAEL01000242 2989 3225
Chro.81000 3987 AAEL01001284 619 693
Chro.81001 3988 AAEL01000453 3 119
Chro.81002 3989 AAELO 1000170 3 185 hypothetical protein cgd8_5100
Chro.81003 3990 AAEL01000104 5588 5758
Chro.81004 3991 AAEL01000204 3 191 adenosine kinase like ribokinase
Chro.81005 3992 AAEL01000161 1 86
Chro.81006 3993 AAEL01001085 663 971
Chro.81007 3994 AAEL01000122 8340 8549
Chro.81008 3995 AAEL01001255 484 784
Chro.81009 3996 AAEL01000815 1 134
Chro.OOOOl hypothetical protein Rv2262c
Chro.00002 ribosomal protein S 17, putative Nucleic acid-binding proteins;
ATPase domain of HSP90 chaperone/DNA topoisomerase Η/histidine kinase; Homodimeric domain of signal transducing histidine kinase; PYP-like sensor domain
Chro.00003 3997 AAEL01000717 673 2319 sensor mstidine kinase (PAS domain);
Chro.00004 3998 AAEL01000308 2394 8906 hypothetical protein
Chro.00005 hypothetical protein
Table 1
Ch_Gene SEQ ID NO. Ch_Accession Start End Description Superfamily
Chro.00006 3999 AAEL01000657 2223 2543 putative senescence-associated protein Fibronectin type HI;
Chro.00007 4000 AAEL01000267 5101 6042 .
O
Table 2: C. hominis Genome Summary
Figure imgf000293_0001
Figure imgf000294_0001
Physical gaps are those which no existing clone closes; A, an additional 673 very short contigs do not assemble and probably include many as yet unidentified contaminant sequences; *, excluding introns; **, estimated intron content taken mostly from ESTs; ***, hits, or identified putative homologous protein in non redundant protein database. Ch, C. hominis; Cp, C. parvum; Pf P. falciparum; ND, not determined; hypothetical proteins are proteins without sufficient similarity to any other gene to permit functional assignment; transmembrane domains, TMHMM; signal peptide and signal anchor, SignalP-2.0. Both C. parvum and C. hominis genomes were annotated using identical strategies to permit comparison.
Table 3: Transporters
GenelD 1 Transporter Description ContiglD 2 Start End Strand
UDP-galactose transporter, putative [Plasmodium
Chro.10013 falciparum (isolate 3D7)] AAEL01000099 9428 10441 +
Chro.10029 Putative hydrogenase [Oryza sativa] AAEL01000336 1973 3655
Probable ADP-ribosylation factor At2g18390 Chro.10030 [Arabidopsis thaliana] AAEL01000336 1290 1745
Putative cell division control protein 48 homolog D Chro.10043 [Arabidopsis thaliana] AAEL01000091 16477 18921
Vacuolar ATPase subunit c [Avicennia marina Chro.10062 (Grey mangrove)] AAEL01000100 5460 5957 +
Vacuolar type H+-ATPase proteolipid subunit Chro.10063 [Acetabularia acetabulum (Mermaid's wine glass)] AAEL01000100 3644 4141 +
Sub-family C member 2 ATP-binding cassette Chro.10083 protein [Mus musculus] AAEL01000864 106 1209 +
Metal resistance protein YCF1 [Saccharomyces Chro.10084 cerevisiae] AAEL01000765 324 1769 +
Hypothetical ABC transporter ATP-binding protein Chro.10119 MJ0719 [Methanococcus jannaschii] AAEL01000274 4566 6422
Sec14 cytosolic factor [Schizosaccharomyces Chro.10145 pombe] AAEL01000008 23762 25147 +
Transporter ATM 1, mitochondrial precursor Chro.10157 [Saccharomyces cerevisiae] AAEL01000270 1941 4253 +
25.3 kDa vesicle transport protein [Arabidopsis Chro.10214 thaliana] AAEL01000191 9644 10150 +
Chro.10223 MOG1 protein [Saccharomyces cerevisiae] AAEL01000147 3567 4124 + Chro.10236 GTP-binding protein yptV4 [Volvox carterij AAEL01000218 6719 6937 +
Hypothetical protein [Oryza sativa (japonica
Chro.10248 cultivar-group)] AAEL01000532 373 1011
Chro.10250 TII0538 protein [Synechococcus elongatus] AAEL01000220 11242 11916
Mitochondrial folate transporter/carrier [Homo
Chro.10266 sapiens] AAEL01000022 11162 12133
Chro.10271 RAD50 [Homo sapiens] AAEL01000022 20080 20859
Mitochondrial import receptor subunit tom40 Chro.10287 [Plasmodium falciparum (isolate 3D7)] AAEL01000491 3595 4524
Probable ADP-ribosylation factor At2g18390 Chro.10289 [Arabidopsis thaliana] AAEL01000283 2498 3241
Chro.10296 Calcium/proton exchanger [Arabidopsis thaliana] AAEL01000010 45515 46936
Chro.10317 Syntaxin 5 [Homo sapiens] AAEL01000010 10158 11135
Chro.10325 27 kDa Golgi SNARE protein [Mus musculus] AAEL01000029 22657 23319
Chro.10338 Zinc transporter 2 [Rattus norvegicus] AAEL01000029 677 2053
Hypothetical protein MA1950 [Methanosarcina
Chro.20011 acetivorans] AAEL01000158 9504 11015
Bile pigment transporter 1 [Saccharomyces
Chro.20014 cerevisiae] AAEL01000158 150 4757
Putative ABC transporter [Plasmodium yoelii
Chro.20017 yoelii] AAEL01000120 2100 6962
Nucleoside transporter family protein
Chro.20039 [Trypanosoma brucei] AAEL01000374 1652 3001
Phosphate carrier protein, mitochondrial precursor
Chro.20060 [Mus musculus] AAEL01000151 3722 4648
UDP-N-acetylglucosamine transporter [Homo
Chro.20067 sapiens] AAEL01000203 10515 11795
Intracellular protein transport protein USO1
Chro.20077 [Saccharomyces cerevisiae] AAEL01000243 7994 10903 Table 3: Transporters
GenelD 1 Transporter Description ContiglD2 Start End Strand
Soluble NSF attachment protein [Drosophila Chro.20087 melanogaster] AAEL01000046 19349 20359 -
Putative sugar transporter protein [Arabidopsis Chro.20091 thaliana] AAELO1000046 8771 10585 -
Putative inner membrane solute transporter Chro.20115 MRS4 [Cryptococcus neoformans] AAEL01000009 17228 18172 + Chro.20116 Flavohemoprotein b5+b5R [Homo sapiens] AAEL01000009 16425 17000 + Chro.20126 Syntaxin 1A [Mus musculus] AAEL01000205 365 1333 Chro.20148 ATP synthase beta chain [Brucella melitensis] AAEL01000024 29834 30859 -
ATP synthase subunit beta [Moorella Chro.20149 thermoacetica] AAEL01000024 29093 29500 -
Transporter, putative [Plasmodium falciparum Chro.20159 (isolate 3D7)] AAELO1000065 5962 7686 -
Hypothetical protein [Plasmodium falciparum Chro.20166 (isolate 3D7)] AAEL01000268 4747 6525 +
Chro.20171 Vacuolar protein sorting 26 [Homo sapiens] AAEL01000071 23055 23462 - Chro.20193 PDI related protein A [Aspergillus niger] AAEL01000224 10578 11894 +
Chromosome partition protein [Clostridium Chro.20205 perfringens] AAELO1000073 17291 17998 +
Probable 26S proteasome regulatory subunit rpn7 Chro.20238 [Schizosaccharomyces pombe] AAEL01000535 3106 3321 -
Potential phospholipid-transporting ATPase NA Chro.20257 [Homo sapiens] AAEL01000311 4780 8658 -
Glutaredoxin [Aphelenchus avenae Chro.20270 (Mycophagous nematode)] AAEL01000334 4812 5117 + Chro.20284 UDP-galactose translocator [Mus musculus] AAEL01000188 9260 10504 -
Structural maintenance of chromosome 1-like 1 Chro.20291 protein [Bos taurus] AAEL01000126 10258 14307 -
ER lumen protein retaining receptor 1 [Homo Chro.20306 sapiens] AAEL01000102 9420 10346 -
DNA double-strand break repair rad50 ATPase Chro.20307 [Pyrococcus furiosus] AAEL01000102 7436 9220 +
Vesicular-fusion protein SEC18 homolog Chro.20314 [Schizosaccharomyces pombe] AAEL01000136 12536 14767 -
Heat shock protein DnaJ homologue Pfj2 Chro.20339 [Plasmodium falciparum (isolate 3D7)] AAEL01000093 3000 4814 -
ADP-ribosylation factor GTPase-activating. protein Chro.20341 GCS1 [Saccharomyces cerevisiae] AAELO1000093 840 2084 Chro.20360 ADP-ribosylation factor 1 [Homo sapiens] AAEL01000149 10827 11375 Chro.20361 CG3260 protein [Drosophila melanogaster] AAELO1000149 11799 12146 - Chro.20389 ABC transporter [Plasmodium yoelii yoelii] AAEL01000106 6749 8410 + Chro.20424 Not found Q960C9 AAEL01000574 1214 2695 -
Mitochondrial import inner membrane translocase Chro.20443 subunit TIM 17 B [Homo sapiens] AAEL01000055 16861 17352 +
Chro.20450 Putative organic solute transporter [Oryza sativa] AAEL01000055 4141 5460
Chromosome segregation protein, putative Chro.20451 [Plasmodium falciparum (isolate 3D7)] AAEL01000055 2267 3580
Thioredoxin reductase 2, mitochondrial precursor Chro.20464 [Homo sapiens] AAEL01000190 8361 9926
ATP-dependent bile acid permease Chro.30058 [Saccharomyces cerevisiae] AAEL01000014 3878 8824 Chro.30060 Vacuolar protein sorting 13A [Homo sapiens] AAEL01000014 12171 25412
Bile pigment transporter 1 [Saccharomyces Chro.30090 cerevisiae] AAEL01000081 10765 15525 I aoie 3: Transporters
GenelD 1 Transporter Description ContiglD 2 Start End Strand
Chro.30115 ADP-ribosylation factor [Dugesia japonica] AAEL01000144 3963 4514 + Chro.30141 Guanylyl cyclase [Plasmodium falciparum] AAEL01000277 2275 9726 lmportin alpha re-exporter [Saccharomyces Chro.30213 cerevisiae] AAEL01000086 11597 14971 + Chro.30223 Hypothetical protein [Homo sapiens] AAEL01000001 13920 16163
Hypothetical protein AII4633 [Anabaena sp. (strain Chro.30245 PCC 7120)] AAEL01000001 52358 57700
Strain Dd2 heat shock protein 86 (HSP86), 01
(o1 ), 03 (o3), O2 (o2), CG8 (cg8), CG4 (cg4),
CG3 (cg3), putative chloroquine resistance transporter (crt), CG9 (cg9), CG1 (cg1), CG6
(cg6), CG2 (cg2), and CG7 (cg7) genes Chro.30263 [Plasmodium falciparum (isolate Dd2)] AAEL01000076 7263 7901 +
Thioredoxin-like protein [Plasmodium falciparum Chro.30289 (isolate 3D7)] AAEL01000068 13495 14829 -
Potential phospholipid-transporting ATPase IB Chro.30311 [Mus musculus] AAEL01000197 6823 10359 +
Probable import inner membrane translocase subunit tim44, mitochondrial precursor Chro.30332 [Schizosaccharomyces pombe] AAEL01000150 11930 13204 Chro.30352 Putative transporter [Arabidopsis thaliana] AAEL01000318 3587 4837 + Chro.30357 Ras-related protein Rab-5C [Homo sapiens] AAEL01000114 1136 1792 -
Sodium/potassium/calcium exchanger 1 precursor Chro.30397 [Homo sapiens] AAEL01000201 4931 7753 +
Hypothetical protein [Plasmodium falciparum Chro.30401 (isolate 3D7)] AAEL01000891 346 582 +
DNA double-strand break repair rad50 ATPase Chro.30436 [Pyrococcus furiosus] AAELO1000322 3075 4520 +
High-affinity glucose transporter HXT2 Chro.30458 [Saccharomyces cerevisiae] AAELO1000287 8261 9106 -
Probable cation-transporting ATPase K07E3.7 in Chro.30465 chromosome X [Caenorhabditis elegans] AAEL01000174 5621 9913 -
Hypothetical 75.5 kDa protein in SDH1-
CIM5ATA3 intergenic region [Saccharomyces Chro.30489 cerevisiae] AAEL01000200 10172 11791 +
Intracellular protein transport protein USO1 Chro.40034 [Saccharomyces cerevisiae] AAEL01000271 829 5643 +
Membrane transporter, putative [Plasmodium Chro.40052 falciparum (isolate 3D7)] AAELO1000634 2513 3072 +
Intracellular protein transport protein USO1 Chro.40063 [Saccharomyces cerevisiae] AAEL01000173 7319 11350 +
Putative vacuolar ATP synthase subunit C [Oryza Chro.40070 sativa (japonica cultivar-group)] AAELO1000062 14285 15556 + Chro.40075 Not found P13662 AAELO1000402 5602 5991 -
NADPH-cytochrome P450 reductase Chro.40087 [Oryctolagus cuniculus] AAELO1000575 2751 3557 -
Protein disulphide isomerase [Cryptosporidium Chro.40127 parvum] AAEL01000720 66 467 +
Hypothetical protein [Plasmodium falciparum Chro.40156 (isolate 3D7)] AAEL01000105 5836 10308 -
Canalicular multispecific organic anion transporter Chro.40157 2 [Rattus norvegicus] AAEL01000105 10851 15260 -
AAEL01000105 16022 19129
Chro.40188 Thioredoxin I [Saccharomyces cerevisi AAELO1000363 2434 2646 + Table 3: Transporters
GenelD 1 Transporter Description ContiglD2 Start End ! 5tra
Structural maintenance of chromosome 2-like 1 Chro.40250 protein [Homo sapiens] AAEL01000337 2149 5859 Chro.40270 Vacuolar protein sorting 35 [Homo sapiens] AAEL01000018 5417 7846 -
NADPH-cytochrome P450 reductase [Mus Chro.40304 musculus] AAELO1000078 2719 4674 + Chro.40306 ATPase [Plasmodium falciparum] AAEL01000078 5341 9927 +
Intracellular protein transport protein USO1 Chro.40307 [Saccharomyces cerevisiae] AAEL01000078 10278 13238 +
Putative transmembrane transporter Chro.40312 [Schizosaccharomyces pombe] AAEL01000078 16260 17933 +
Mitochondrial protein import protein MAS5 Chro.40313 [Saccharomyces cerevisiae] AAEL01000078 17940 19022 Chro.40323 Not found Q8I756 AAELO1000368 3525 5042 +
DNA double-strand break repair rad50 ATPase Chro.40324 [Methanococcus jannaschii] AAEL01000368 5055 6365 Chro.40354 GDP-fucose transporter 1 [Homo sapiens] AAEL01000002 52413 54626 + Chro.40458 Vacuolar protein sorting 11 [Homo sapiens] AAEL01000447 3014 5407
Chro.40463 Transporter, putative [Porphyromonas gingivalis] AAEL01000481 756 1715 -
Adapter-related protein complex 1 beta 1 subunit Chro.40489 [Homo sapiens] AAELO1000675 115 1911 +
ATP-binding cassette protein 2 [Cryptosporidium Chro.40503 parvum] AAELO1000855 344 1483 +
Cystic fibrosis transmembrane conductance Chro.40504 regulator [Xenopus laevis] AAELO1000355 50 940 +
Putative amino acid transporter protein Chro.40505 [Arabidopsis thaliana] AAELO1000355 1282 2964 +
Putative ABC superfamily transporter [Salmonella Chro.50014 typhimurium] AAEL01000042 27175 28197 -
Mitochondrial processing peptidase beta subunit, Chro.50031 mitochondrial precursor [Neurospora crassa] AAEL01000155 13753 14880 + Chro.50123 Polyubiquitin [Homo sapiens] AAEL01000070 2085 2774 Chro.50138 ABC transporter [Baciilus halodurans] AAELO1000275 7603 8571
Thioredoxin-related protein, putative. [Plasmodium Chro.50157 falciparum (isolate 3D7)] AAELO1000074 3568 4668 Chro.50176 Thioredoxin-like protein 1 [Homo sapiens] AAEL01000019 17336 17941 +
Cell division control protein 48 homolog E Chro.50178 [Arabidopsis thaliana] AAELO1000019 13357 15429 + Chro.50206 GAR1 protein [Homo sapiens] AAEL01000013 35893 36441 +
Intracellular protein transport protein USO1 Chro.50240 [Saccharomyces cerevisiae] AAEL01000054 18868 23676 -
Chro.50257 TRANSLOCATIONAL protein-1 [Homo sapiens] AAEL01000331 3599 4726 +
ADP-ribosylation factor GTPase-activating protein Chro.50282 GLO3 [Saccharomyces cerevisiae] AAEL01000007 25803 26450 +
Vacuolar ATP synthase subunit F1 putative Chro.50302 [Plasmodium falciparum (isolate 3D7)] AAEL01000123 3926 4303 Chro.50325 Thioredoxin [Borrelia burgdorferi] AAEL01000087 2594 3196 +
Ran-specific GTPase-activating protein 1 Chro.50456 [Saccharomyces cerevisiae] AAEL01000428 3115 3771 -
Adapter-related protein complex 1 gamma 1 Chro.50468 subunit [Homo sapiens] AAELO1000289 6972 8948 + Chro.50483 R-sly1 [Rattus norvegicus] AAEL01000433 394 2394 + Table 3: Transporters
GenelD 1 Transporter Description ContiglD 2 Start End Strand
Protein disulphide isomerase [Cryptosporidium Chro.60023 parvum] AAELO 1000052 11048 12493
Na+/H+ antiporter, possible [Cryptosporidium Chro.60024 parvum] AAEL01000052 8102 10717 + Chro.60025 Putative Na/H antiporter [Cymodocea nodosa] AAEL01000052 4314 7094
Vesicle-associated membrane protein 714 Chro.60028 [Arabidopsis thaliana] AAEL01001124 23 490 Chro.60067 Zinc transporter ZIP1 [Brachydanio rerio] AAEL01000718 1282 2274
Chro.60069 VAMP-like protein YKT61 [Arabidopsis thaliana] AAEL01000671 547 1221
ATP synthase alpha chain [Bradyrhizobium Chro.60082 japonicum] AAEL01000992 52 1101 +
Chro.60110 Protein disulfide isomerase ER-60 [Fugu rubripes] AAEL01000284 2689 4248 + Chro.60122 Hypothetical protein [Arabidopsis thaliana] AAEL01000025 2789 4111 +
Chro.60161 Choline transporter [Plasmodium falciparum] AAEL01000401 3166 4926 +
Putative phosphatidylinositol/phophatidylcholine Chro.60183 transfer protein [Arabidopsis thaliana] AAEL01000021 17943 18968 Chro.60188 Hypothetical protein [Cryptosporidium parvum] AAEL01000021 8229 10313
Conserved hypothetical multi-pass transmembrane protein, possible ion transporter Chro.60250 [Cryptosporidium parvum] AAEL01000443 970 1224
Conserved hypothetical multi-pass transmembrane protein, possible ion transporter Chro.60251 [Cryptosporidium parvum] AAEL01000057 23725 25458 -
Vacuolar protein-sorting protein 33 homolog Chro.60276 [Arabidopsis thaliana] AAEL01000012 17311 19419 + Chro.60286 Hypothetical protein [Cryptosporidium parvum] AAEL01000012 31656 33623 -
Intracellular protein transport protein USO1 Chro.60331 [Saccharomyces cerevisiae] AAEL01000193 6446 8539 + Chro.60374 Ras-related protein Rab-1A [Rattus norvegicus] AAEL01000056 23126 23737 -
Vacuolar transporter chaperone 1 Chro.60386 [Saccharomyces cerevisiae] AAEL01000092 2156 5266 + Chro.60420 Hypothetical protein [Cryptosporidium parvum] AAEL01000096 10083 11810 +
DNA double-strand break repair rad50 ATPase Chro.60424 [Pyrococcus furiosus] AAEL01000113 2726 4459 + Chro.60437 Cathepsin E1 precursor [Xenopus laevis] AAEL01000124 7821 9221 - Chro.60457 Hypothetical protein [Caenorhabditis elegans] AAEL01000221 8566 9225 +
Intracellular protein transport protein USO1 Chro.60474 [Saccharomyces cerevisiae] AAEL01000082 9671 11761 +
Nuclear division RFT1 protein [Saccharomyces Chro.60537 cerevisiae] AAELO1000023 24446 26119 +
ATP-binding cassette protein 3 [Cryptosporidium Chro.60539 parvum] AAEL01000023 28349 28552
Chro.60540 Multidrug resistance protein 1 [Homo sapiens] AAEL01000023 28738 32589 Chro.60564 Putative transporter [Cryptosporidium parvum] AAEL01000168 10427 11767 -
Adapter-related protein complex 4 beta 1 subunit Chro.60567 [Homo sapiens] AAEL01000445 3578 5383 +
ABC transporter protein, putative [Arabidopsis Chro.60605 thaliana] AAEL01000109 11485 13737 +
ATP-binding cassette, sub-family G, member 1 Chro.60617 [Mus musculus] AAEL01000383 2504 4603 +
Chro.60627 Membrane transporter [Bactrocera tryoni] AAEL01000176 8851 10782 + Chro.70021 Sulfate transporter 1.3 [Arabidopsis th ' ι] AAEL01000031 18355 21093 Table 3: Transporters
GenelD 1 Transporter Description ContiglD 2 Start End Strand
Chro.70023 Sortilin-related receptor precursor [Homo sapiens] AAEL01000031 23593 26613 +
GTP-binding nuclear protein ran-1 Chro.70035 [Caenorhabditis elegans] AAEL01000011 2374 3012 -
Putative phagocytic receptor 1 b precursor Chro.70046 [Dictyostelium discoideum] AAEL01000011 27290 29107 +
Probable cation-transporting ATPase W08D2.5 in Chro.70061 chromosome IV [Caenorhabditis elegans] AAEL01000175 11251 14253 Chro.70082 Not found Q921T9 AAEL01000255 9423 10358 + Chro.70118 PfSec61 [Plasmodium falciparum] AAELO1000459 2018 3439 + Chro.70168 Hypothetical protein [Arabidopsis thaliana] AAEL01000003 50576 52462 +
Sodium/hydrogen exchanger, putative Chro.70178 [Plasmodium falciparum (isolate 3D7)] AAEL01000003 33009 35804 + Chro.70197 Ran-binding protein 17 [Homo sapiens] AAEL01000163 8714 11986 Chro.70198 Ras-related protein Rab-7 [Homo sapiens] AAEL01000163 7533 7895 -
Potential phospholipid-transporting ATPase VD Chro.70206 [Homo sapiens] AAEL01000143 3686 6829 +
Structural maintenance of chromosomes 4-like 1 Chro.70215 protein [Mus musculus] AAEL01000006 43301 47251 +
Cop-coated vesicle membrane protein p24 Chro.70216 precursor [Homo sapiens] AAELO1000006 42439 43050 +
NADH dehydrogenase, putative [Plasmodium Chro.70218 falciparum (isolate 3D7)] AAEL01000006 36450 38159 Chro.70219 Coatomer gamma-2 subunit [Homo sapiens] AAEL01000006 33504 36290 + Chro.70237 Vacuolar protein sorting 29 [Homo sapiens] AAEL01000006 8336 8929 +
GTP-binding protein SAR1 B [Arabidopsis Chro.70265 thaliana] AAEL01000077 2556 3137 +
Conserved protein, putative [Plasmodium Chro.70297 falciparum (isolate 3D7)] AAEL01000069 9768 11507 -
Adaptor-related protein complex 1 , mu 2 subunit Chro.70304 [Homo sapiens] AAEL01000392 4233 5594 +
Structural maintenance of chromosome 3 [Bos Chro.70306 taurus] AAEL01000392 474 2432 +
Chro.70307 Putative ABC transporter [Oryza sativa] AAELO1000286 1602 3557 - Chro.70309 ABC transporter [Planktothrix agardhii] AAEL01000377 5325 7046 - Chro.70331 Coatomer delta subunit [Homo sapiens] AAEL01000129 3253 4860 +
Small hydrophobic molecule transporter protein, Chro.70339 putative [Enterococcus faecalis] AAEL01000154 2655 4049 Chro.70340 lmportin beta-1 subunit [Homo sapiens] AAEL01000532 3492 3902 + Chro.70341 lmportin beta-1 subunit [Homo sapiens] AAEL01000154 4456 7104 -
UPF0071 protein At2g18990 [Arabidopsis Chro.70356 thaliana] AAEL01000016 27863 28408 Chro.70365 lmportin beta-3 [Homo sapiens] AAEL01000016 12671 16054 +
Transporter, putative [Plasmodium falciparum Chro.70384 (isolate 3D7)] AAEL01000047 13242 15149 -
Conserved oligomeric Golgi complex component Chro.70418 4 [Mus musculus] AAEL01000228 10051 11484 -
Translocation protein SEC63 homolog [Mus Chro.70433 musculus] AAELO1000028 16765 18648 -
Exonuclease SBCC [Fusobacterium nucleatum Chro.70446 (subsp. nucleatum)] AAELO1000323 4439 7114 -
Arsenical pump-driving ATPase, putative Chro.70452 [Plasmodium falciparum (isolate 3D7)] AAEL01000004 56604 57455 +
Chro.70453 BG:DS09218.4 protein [Drosophila melanogaster] AAEL01000004 54714 56006 Table 3: Transporters
GenelD 1 Transporter Description ContiglO2 Start End Strand
Chro.70463 Coatomer zeta-2 subunit [Mus musculus] AAELO1000004 35378 35698
Calcium-transporting ATPase 4, endoplasmic Chro.70464 reticulum-type [Arabidopsis thaliana] AAELO1000004 31390 34779 +
Putative sugar transporter protein [Arabidopsis Chro.70473 thaliana] AAELO1000004 12567 14132 Chro.70485 Ras-related protein Rab-11 B [Homo sapiens] AAELO1000035 10202 10801
Sub-family C member 2 ATP-binding cassette Chro.70498 protein [Mus musculus] AAELO1000375 3811 7140 -
ATP-binding cassette transporter C4 [Homo Chro.70499 sapiens] AAEL01000131 2675 6850 -
Putative secretory pathway GDP dissociation Chro.70525 inhibitor [Schizosaccharomyces pombe] AAEL01000048 17539 19302 -
Lysosomal amino acid transporter 1 [Rattus Chro.70533 norvegicus] AAEL01000048 8591 10396 +
Mechanosensitive ion channel, putative Chro.70536 [Plasmodium yoelii yoelii] AAELO1000048 579 3443 Chro.70553 CG31716-PG [Drosophila melanogaster] AAEL01000159 8115 10172 + Chro.70554 CG4733 protein [Drosophila melanogaster] AAEL01000159 5406 6809
Vacuolar H+-ATPase A subunit [Dictyostelium Chro.70559 discoideum] AAEL01000580 2305 3546 -
Chro.70561 Coatomer beta' subunit [Drosophila melanogaster] AAEL01000580 9 1544 + Chro.70569 Disulfide isomerase [Ostertagia ostertagi] AAEL01000285 4842 6512 +
Probable vacuolar protein sorting 16 Chro.70606 [Schizosaccharomyces pombe] AAELO1000249 6785 9688 +
Putative potassium channel regulatory factor Chro.70610 [Oryza sativa (japonica cultivar-group)] AAEL01000177 11563 12165 +
Putative transmembrane transporter Chro.80017 [Schizosaccharomyces pombe] AAEL01000034 9034 10446 +
Putative YLP [Oryza sativa (japonica cultivar- Chro.80048 group)] AAEL01000103 5008 5676 -
Intracellular protein transport protein USO1 Chro.80062 [Saccharomyces cerevisiae] AAEL01000139 6496 9270 + Chro.80105 Coatomer alpha subunit [Homo sapiens] AAEL01000614 237 2867 + Chro.80127 Syntaxin binding protein 3 [Mus musculus] AAEL01000210 7270 9261 +
ER lumen protein-retaining receptor-like protein Chro.80131 [Arabidopsis thaliana] AAEL01000513 3275 3934 +
ADP1ATP carrier protein, liver isoform T2 [Homo Chro.80141 sapiens] AAEL01001051 48 914 -
Chro.80148 Protein transport protein Sec24D [Homo sapiens] AAELO1000043 14331 17825 + Probable GDP-fucose transporter [Drosophila
Chro.80171 melanogaster] AAELO1000382 1739 2992 -
Intracellular protein transport protein USO1
Chro.80179 [Saccharomyces cerevisiae] AAELO1000229 1518 5138 +
Probable hexose phosphate transport protein
Chro.80188 [Chlamydia trachomatis] AAELO1000378 2646 5021
Chro.80195 B subunit V-ATPase [Culex quinquefasciatus] AAEL01000140 2387 3868 +
Chro.80239 Hypothetical protein [Mus musculus] AAEL01000108 16300 17025
Probable cation-transporting ATPase 2
Chro.80246 [Saccharomyces cerevisiae] AAEL01000320 3950 8425 -
NADPH:adrenodoxin oxidoreductase, mitochondrial precursor [Drosophila
Chro.80316 melanogaster] AAEL01000186 9233 10798 + Table 3: Transporters
GenelD 1 Transporter Description ContiglD2 Start End Strand
Putative phosphate transporter 1 [Arabidopsis Chro.80350 thaliana] AAEL01000116 11792 13837 + Chro.80351 SMC-like protein [Arabidopsis thaliana] AAEL01000116 7400 11206
Adapter-related protein complex 2 alpha 1 subunit Chro.80357 [Mus musculus] AAEL01000119 12922 14745
Abe transporter, putative [Plasmodium falciparum Chro.80377 (isolate 3D7)] AAEL01000005 11074 12759 + Chro.80378 lmportin alpha 2 subunit [Oryza sativa] AAEL01000005 12885 14525 Chro.80396 Transportin 1 (lmportin beta-)2 [Homo sapiens] AAELO1000005 50634 53429 Chro.80403 Thioredoxin-like protein 1 [Homo sapiens] AAEL01000161 11310 11723
Hypothetical 48.8 kDa protein in SSU81-SCS2 Chro.80431 intergenic region [Saccharomyces cerevisiae] AAELO1000036 17449 18822
Putative Na+-dependent inorganic phosphate Chro.80449 cotransporter [Arabidopsis thaliana] AAEL01000027 15252 17081
Clathrin-associated adaptor complex AP-1 small Chro.80465 chain sigmal [Drosophila melanogaster] AAELO1000621 294 842
DNA double-strand break repair rad50 ATPase Chro.80528 [Sulfolobus tokodaii] AAEL01000929 687 1397
Chro.80551 Putative H+-transporting ATPase [Oryza sativa] AAEL01000474 3289 3834
Mitogen-activated protein kinase kinase [Suaeda Chro.80584 maritima subsp. salsa] AAEL01000170 1427 2581
Genomic DNA, chromosome 3, BAC clone: Chro.80601 T31J18 [Arabidopsis thaliana] AAEL01000015 32063 33565
Intracellular protein transport protein USO1 Chro.80609 [Saccharomyces cerevisiae] AAEL01000015 10540 13959
1 GenelD: gene identification
2 ContiglD: contig identification
Table 4: Receptors
GenelD 1 Receptor Description ContiglD 2 Start End Strand
Peroxisomal proliferator-activated receptor A interacting complex 285 kDa protein [Homo Chro.10103 sapiens] AAEL01000298 794 3778
Steroid receptor-interacting SNF2 domain protein Chro.10140 [Mus musculus] AAEL01000008 35552 38185 +
Peroxisomal targeting signal-1 receptor Chro.10151 [Leishmania donovani] AAEL01000008 6775 8739 +
Probable mitochondrial import receptor subunit Chro.10287 tom40 homolog [Plasmodium yoelii yoelii] AAEL01000491 3595 4524
SEC22 vesicle trafficking protein-like 1 [Mus Chro.10325 musculus] AAEL01000029 22657 23319 +
ER lumen protein retaining receptor-like protein, Chro.10334 putative [Plasmodium yoelii yoelii] AAEL01000029 10002 10856
Seven transmembrane helix receptor [Homo Chro.10390 sapiens] AAEL01000209 4021 6078
F-box-like/WD-repeat protein TBLR1 [Homo Chro.20040 sapiens] AAEL01000374 3929 5536 +
Nuclear receptor coactivator GT198 [Rattus Chro.20059 norvegicus] AAEL01000151 2342 3247
Multidomain scavenger receptor protein PbSR Chro.20090 precursor [Plasmodium yoelii yoelii] AAEL01000046 11382 15125
G-protein-coupled receptor induced protein GIG2 Chro.20118 [Rattus norvegicus] AAEL01000009 12665 14821 +
Neurotrophin receptor interacting factor [Mus Chro.20127 musculus] AAEL01000205 2639 3646 +
Epidermal growth factor receptor substrate 15
Chro.20136 [Plasmodium yoelii yoelii] AAEL01000317 1799 3076 +
Chro.20173 Ci-METAI [Ciona intestinalis] AAEL01000071 20025 21869 lnositol(1 ,3,4,5)tetrakisphosphate receptor [Sus Chro.20191 scrofa] AAEL01000224 8025 9032 +
Mitochondrial import receptor subunit TOM34 Chro.20201 [Mus musculus] AAEL01000073 9038 10018
Activated protein kinase C receptor [Plasmodium Chro.20203 falciparum] AAEL01000073 14254 15195
ER lumen protein retaining receptor-like protein, Chro.20306 putative [Plasmodium yoelii yoelii] AAEL01000102 9420 10346
Similar to steroid receptor-interacting SNF2
Chro.20395 domain protein [Xenopus laevis] AAEL01000152 9524 12058 +
Chro.20466 Hypothetical protein [Caenorhabditis elegans] AAEL01000190 856 4701 Chro.30029 Ci-METAI [Ciona intestinalis] AAEL01000506 318 1610 +
TGF beta receptor associated protein-1 [Homo Chro.30136 sapiens] AAEL01000455 3432 5165
Thyroid receptor interacting protein 12 [Homo Chro.30149 sapiens] AAEL01000232 9854 11353
Chro.30161 FUSICOCCIN receptor 30 kDa protein [Zea mays] AAEL01000067 5736 6500 +
Probable mportin-alpha export receptor Chro.30213 [Neurospora crassa] AAEL01000086 11597 14971 +
Putative notch receptor protein [Branchiostoma Chro.30220 floridae] AAEL01000001 7512 9221 +
Chro.30246 Similar to laminin receptor 1 [Brachydanio rerio] AAEL01000001 58201 58971
Nuclear receptor binding factor-like protein Chro.30258 [Arabidopsis thaliana] AAEL01000076 13023 22868 Table 4: Receptors
GenelD 1 Receptor Description ContiglD 2 Start End Strand
Receptor-like protein kinase 5 precursor Chro.30329 [Arabidopsis thaliana] AAEL01000150 8137 10035 +
Chro.30344 G protein-coupled receptor kinase 5 [Bos taurus] AAEL01000245 4472 5650
Putative receptor-like protein kinase [Oryza sativa Chro.30357 Oaponica cultivar-group)] AAEL01000114 1136 1792
Similar to Dictyostelium discoideum (Slime mold).
TNF receptor associated protein 1 [Dictyostelium Chro.30427 discoideum] AAEL01000398 635 2734
NMDA receptor glutamate-binding subunit [Rattus Chro.30454 sp] AAEL01000125 7641 8390
Thyroid receptor interacting protein 11 [Homo Chro.40034 sapiens] AAEL01000271 829 5643 +
Hyaluronan mediated motility receptor-like protein Chro.40063 [Arabidopsis thaliana] AAEL01000173 7319 11350 +
Similar to thyroid hormone receptor coactivating Chro.40082 protein [Mus musculus] AAEL01000083 2374 8274 +
NMDA receptor glutamate-binding subunit [Rattus Chro.40302 sp] AAEL01000295 6872 7621
Nuclear receptor binding factor-1 [Rattus Chro.40326 norvegicus] . AAEL01000379 1661 7048
Egg receptor for sperm [Strongylocentrotus Chro.40370 purpuratus] AAEL01000002 26341 28761
Epidermal growth factor receptor substrate 15
Chro.40492 [Homo sapiens] AAEL01000135 237 1979 +
Chro.50026 CLV1 receptor kinase [Clostridium tetani] AAEL01000042 4364 6496 +
Chro.50147 B-cell receptor associated protein [Homo sapiens] AAEL01000134 5008 5850 + Chro.50162 Nuclear receptor corepressor 2 [Homo sapiens] AAEL01000074 12287 17053 +
Chro.50257 TRANSLOCATIONAL protein-1 [Homo sapiens] AAEL01000331 3599 4726 +
Peroxisomal targeting signal 2 receptor [Mus Chro.50272 musculus] AAEL01000007 13943 15262 +
140 kDa estrogen receptor associated protein Chro.50291 [Homo sapiens] AAEL01000007 43459 44193 +
TGF-beta receptor-interacting protein 1 Chro.50323 [Phaseoius vulgaris] AAEL01000087 5191 5976
Chro.60073 HPV16 E1 protein binding protein [Homo sapiens] AAEL01001239 6 788 + Chro.60074 HPV16 E1 protein binding protein [Homo sapiens] AAEL01000342 7631 8080
Hypothetical tyrosine protein kinase/serine/threonine protein kinase/eukaryotic protein kinase/TonB-dependent receptor protein
Chro.60086 containing protein [Mus musculus] AAEL01000581 54 2261 +
Chro.60097 Toll-like receptor [Carassius auratus] AAEL01000137 2513 3532 +
Vacuolar sorting receptor-like protein [Oryza Chro.60109 sativa Oaponica cultivar-group)] AAEL01000284 1039 2265 +
Glucocorticoid receptor AF-1 specific elongation Chro.60459 factor [Homo sapiens] AAEL01000221 5871 7178 + Table 4: Receptors
GenelD 1 Receptor Description ContiglD 2 Start End Strand
Adult retina cDNA, RIKEN full-length enriched library, clone:A930009G18 product:phosphodiesterase 6B, cGMP, rod receptor, beta polypeptide, full insert sequence Chro.60462 [Mus musculus] AAEL01000169 661 1866 +
FEM-1-like death receptor binding protein [Homo Chro.60526 sapiens] AAEL01000023 6957 7931
Chro.70023 Sortilin-related receptor precursor [Homo sapiens] AAEL01000031 23593 26613 +
Putative phagocytic receptor 1b precursor Chro.70046 [Dictyostelium discoideum] AAEL01000011 27290 29107 +
Phosphatidate cytidylyltransferase, photoreceptor- Chro.70059 specific [Drosophila melanogaster] AAEL01000927 113 847 +
Patched protein homolog 1 [Caenorhabditis Chro.70106 elegans] AAEL01000215 515 727
Similar to NMDA receptor-regulated gene 1
Chro.70114 [Brachydanio rerio] AAEL01000172 12273 13706
Chro.70197 Exportin 7 [Homo sapiens] AAEL01000163 8714 11986
Chro.70215 AT2 receptor-interacting protein 1 [Homo sapiens] AAEL01000006 43301 47251 +
Epidermal growth factor receptor-related protein Chro.70339 homolog [Mus musculus] AAEL01000154 2655 4049
Hypothetical B-box zinc finger domain/SPIa and Chro.70370 the RYanodine receptor [Mus musculus] AAEL01000016 4821 7442 Chro.70422 Not found Q86JB9 ϋ deleted AAELO1000228 5265 7055 Chro.70498 Sulfonylurea receptor-1 [Mus musculus] AAEL01000375 3811 7140
Sulphonylurea receptor 2B [Oryctolagus Chro.70499 cuniculus] AAEL01000131 2675 6850 Chro.70565 Insulin-like receptor [Tetrahymena thermophila] AAELO1000227 4407 8594
26S proteasome regulatory subunit RPN1 Chro.80073 [Saccharomyces cerevisiae] AAEL01000104 8064 11180
G protein-coupled receptor kinase 1 [Drosophila Chro.80094 melanogaster] AAEL01000394 3857 6535
ER lumen protein-retaining receptor-like protein Chro.80131 [Arabidopsis thaliana] AAEL01000513 3275 3934
Chro.80179 Hyaluronan receptor RHAMM [Rattus norvegicus] AAEL01000229 1518 5138
Similar to ACHLYA AMBISEXUALIS
ANTHERIDIOL steroid receptor [Pyrococcus
Chro.80234 abyssi] AAEL01000108 8398 11373
Chro.80284 EPH receptor tyrosine kinase [Ciona savignyi] AAEL01000059 12292 14268
Chro.80300 Autocrine motility factor receptor [Mus musculus] AAEL01000033 22038 23921
Nuclear receptor binding SET domain containing Chro.80318 protein 1 [Homo sapiens] AAEL01000703 16 645
Neurogenic locus Notch protein precursor Chro.80327 [Drosophila melanogaster] AAEL01000030 5673 7397
Xenotropic and polytropic murine retrovirus Chro.80350 receptor [Homo sapiens] AAEL01000116 11792 13837
Type 1 tumor necrosis factor receptor shedding Chro.80395 aminopeptidase regulator [Mus musculus] AAEL01000005 47539 50349
Chro.80421 Niemann-Pick C1 protein precursor [S Ofa] AAEL01000122 2068 6465 Table 4: Receptors
GenelD 1 Receptor Description ContiglD 2 Start End Strand
Multidomain scavenger receptor protein PbSR Chro.80497 precursor [Plasmodium yoelii yoelii] AAEL01000384 3195 4100
11 days embryo whole body cDNA, RIKEN full- length enriched library, clone:2700046D12 product:nuclear protein SKIP (SKI-interacting protein) (SNW 1 protein) (Nuclear receptor
Chro.80502 coactivator NCOA-62) homolog [Mus musculus] AAELO1000329 6939 8234 +
Chro.80511 Hypothetical protein [Arabidopsis thaliana] AAEL01000112 8680 9894 +
Similar to nuclear receptor co-repressor 1 [Homo
Chro.80556 sapiens] AAELO1000352 388 6309 +
Signal recognition particle receptor alpha subunit
Chro.80600 [Homo sapiens] AAEL01000015 33923 35569
1 GenelD: gene identification
2 ContiglD: contig identification
Table 5: Surface and Secreted Proteins
GenelD 1 Description: Surface and Secreted Proteins ContiglD 2 Start End Strand
Chro.00003 sensor histidine kinase AAEL01000717 673 2319
Chro.00007 Signal peptide AAELO 1000267 5101 6042
Chro.10010 Transmembrane protein AAELO 1000099 17573 18886 +
Chro.10011 Transmembrane protein AAEL01000099 16058 17374 +
Chro.10012 Transmembrane protein AAEL01000099 10634 15586
Chro.10013 solute carrier family 35, member 2, putative AAEL01000099 9428 10441 +
Chro.10017 Signal peptide AAELO 1000099 3836 4279 +
Chro.10021 Signal peptide AAELO 1000305 7602 8906
Chro.10022 Signal peptide AAEL01000305 5265 7157
Chro.10031 Transmembrane protein AAEL01000336 1 306
Chro.10032 GPI-anchor transamidase (U32517) -related AAEL01000091 147 1427
Chro.10033 ENSANGP00000013950 AAEL01000091 1678 3069 +
Chro.10036 Signal peptide AAEL01000091 6235 7617 dehydrogenase/reductase (SDR family) member
7; CGI-86 protein; retinal short-chain
Chro.10039 dehydrogenase/reductase 4; 2310016E22Rik AAEL01000091 8833 9936
Chro.10047 similar to Carboxypeptidase A2 precursor AAELO 1000727 687 2298 +
Chro.10051 protein kinase, putative AAEL01000257 5656 7851
Chro.10057 Signal peptide AAEL01000100 13988 16888
Chro.10062 vacuolar ATP synthetase, putative AAEL01000100 5460 5957 +
Vacuolar ATP synthase 16 kDa proteolipid subunit (V-ATPase 16 kDa proteolipid subunit)Ogi|1208770|gb|AAB67833.1| V-type
ATPase 16 kDa proteolipid subunitDgil2149129|gb|AAB58498.1 | vacuolar-
Chro.10063 type H(+)-ATPase AAEL01000100 3644 4141 +
Chro.10068 Signal anchor AAEL01000049 5146 5850
Chro.10070 Signal peptide AAEL01000049 10971 18911
Chro.10074 Signal peptide AAEL01000049 22159 23475 +
Chro.10077 Transmembrane protein AAEL01000440 2930 3181 +
Chro.10079 Signal peptide AAELO 1000462 2012 3028
Chro.10080 Transmembrane protein AAELO 1000489 3668 4555
Chro.10083 ATP-binding cassette protein AAEL01000864 106 1209 +
Chro.10084 ATP-binding cassette protein AAEL01000765 324 1769 +
Chro.10089 hypothetical protein AAELO 1000860 89 1126
Chro.10097 Transmembrane protein AAEL01000269 7920 8567
Chro.10099 Protein disulfide isomerase CG6988-PA AAEL01000269 1 1860
Chro.10101 binding protein, putative AAELO 1000298 4130 6424
Chro.10107 cyclophilin homolog Ta cyp AAELO 1000084 3586 4218
Chro.10109 Protein kinase domain, putative AAEL01000084 6992 10981
Chro.10114 Transmembrane protein AAEL01000084 17866 18405 hypothetical predicted transmembrane protein,
Chro.10115 unknown function AAELO 1000084 19423 20868 +
Chro.10120 NAD(P) transhydrogenase beta subunit, putative AAEL01000274 7200 9845
Chro.10131 hypothetical protein Rv1835c AAEL01000008 48278 51118
Chro.10133 Hypothetical protein CBG01950 AAELO 1000008 46405 47769
Chro.10138 Signal peptide AAEL01000008 39676 40569
Chro.10144 Signal peptide AAEL01000008 25758 27788 +
Chro.10146 Signal peptide AAEL01000008 15896 23227
Chro.10150 hypothetical protein AAELO 1000008 10395 11195
Chro.10153 Signal peptide AAEL01000008 4818 4976
Chro.10157 abc transporter (1 D44) AAEL01000270 1941 4253 +
Chro.10160 putative AAELO 1000270 6370 7410
Chro.10165 Signal peptide AAEL01000061 4290 4643 +
Chro.10167 ORF MSV156 hypothetical protein AAEL01000061 5765 8119 Table 5: Surface and secreieα i-roteiris
GenelD 1 Description: Surface and Secreted Proteins ContiglD 2 Start End Strand
Chro.10170 Transmembrane protein AAEL01000061 11962 13959 +
Chro.10171 Signal anchor AAEL01000061 14113 14796
Chro.10174 Signal anchor AAEL01000061 18233 19153
Chro.10196 phosphoglycerate mutase family, putative AAEL01000338 4284 5096
Chro.10197 Transmembrane protein AAEL01000338 6203 8224 +
Chro.10199 conserved hypothetical protein AAEL01000164 11141 12385 +
Chro.10200 ENSANGP00000010471 AAEL01000164 10222 11007 +
Chro.10201 Signal anchor AAEL01000164 8519 10057
Chro.10202 hypothetical protein AAEL01000164 7493 8518 + zinc finger (C3HC4-type RING finger) protein
Chro.10204 family AAEL01000164 2607 4589 +
Chro.10207 Transmembrane protein AAEL01001320 207 362
Chro.10208 conserved protein, putative AAEL01000191 1188 1805 +
Chro.10212 hypothetical protein AAEL01000191 7128 8591 +
Chro.10214 vesicle transport protein, putative AAEL01000191 9644 10150 +
Chro.10215 hypothetical protein AAEL01000191 10171 10377 +
Chro.10226 Signal anchor AAEL01000147 6755 7324
Chro.10232 Signal peptide AAEL01000147 15140 15760
Chro.10233 Signal peptide AAEL01000218 10532 12088 +
Chro.10238 Signal anchor AAEL01000218 3470 4162 +
Chro.10240 hypothetical protein AN7301.2 AAEL01000218 726 1775 +
Chro.10241 hypothetical protein AN0576.2 AAEL01000555 1970 3619
Chro.10250 putative potassium/proton antiporter AAEL01000220 11242 11916
Chro.10255 aspartyl protease-like AAEL01000220 5706 6653
Chro.10260 Transmembrane protein AAEL01000022 225 2324 +
Chro.10266 ENSANGP00000009305 AAELO 1000022 11162 12133
Chro.10268 Signal peptide AAEL01000022 14913 15572 +
Chro.10269 Signal peptide AAEL01000022 16060 17070 +
Chro.10274 hypothetical protein AAELO 1000022 24107 25492 +
Chro.10275 hypothetical protein AAEL01000022 25519 28266
Chro.10281 Transmembrane protein AAEL01000022 36120 36998
Chro.10286 hypothetical protein AAELO 1000598 1 520
Chro.10292 Transmembrane protein AAEL01000283 6723 7247 +
Chro.10296 calcium antiporter, putative AAEL01000010 45515 46936 +
Chro.10313 Transmembrane protein AAEL01000010 15342 16208
Chro.10317 syntaxin 5, putative AAEL01000010 10158 11135
Chro.10321 cg1 protein AAELO 1000029 31536 33614
Chro.10325 Golgi SNARE protein, putative AAEL01000029 22657 23319 +
Chro.10330 DNAJ-like molecular chaperone protein, putative AAEL01000029 14292 15461
ER lumen protein retaining receptor-like protein,
Chro.10334 putative AAELO 1000029 10002 10856
Chro.10338 zinc transporter AAEL01000029 677 2053
Chro.10339 Signal peptide AAELO 1000029 30 569 +
Chro.10359 Transmembrane protein AAEL01000312 8327 8950 +
Chro.10365 Signal peptide AAELO 1000504 2084 2791 +
Chro.10371 carboxylesterase AAEL01000514 2738 3319 +
Chro.10380 phosphatidylinositol-glycan-class c AAEL01000411 405 1229
Chro.10389 Transmembrane protein AAELO 1000209 2553 2966
Chro.10390 thrombospondin related adhesive protein AAEL01000209 4021 6078
Chro.10391 TSP 1 domain-containing protein TSP3 precursor AAELO 1000209 6853 8376 +
Chro.10402 Signal peptide AAEL01000547 2951 3385
Chro.10403 Transmembrane protein AAELO 1000547 561 2045
Chro.10406 Signal anchor AAEL01000777 271 2037 +
Chro.10410 Signal peptide AAEL01000128 4392 5966 +
Chro.10411 Signal peptide AAEL01000128 6724 7779 Table S't Suϊfa'tte-ϊifrtd SeύretedWbteϊils
GenelD 1 Description: Surface and Secreted Proteins ContiglD 2 Start End Strand
Chro.10416 aspartyl (acid) protease, putative AAEL01000346 5498 7882 +
Chro.10419 mannosyltransferase-related AAEL01000111 16877 17908
Chro.10421 hypothetical protein AN8767.2 AAEL01000111 9595 13818 -
Chro.10424 retinitis pigmentosa GTPase regulator-like protein AAEL01000111 1268 3706 + hypothetical predicted transmembrane protein, Chro.10427 unknown function AAEL01000183 6656 9385 Chro.10429 Transmembrane protein AAEL01000183 2963 5953 - Chro.10430 Signal peptide AAEL01000183 2294 2605 - Chro.10432 Signal anchor AAELO1000340 633 3404 + deoxyuridine 5'-triphosphate nucleotidohydrolase, Chro.10434 putative AAELO1000340 5921 6481
Chro.20011 molybdenum cofactor sulfurase AAEL01000158 9504 11015 Chro.20014 ATP-binding cassette protein 2 AAEL01000158 150 4757 + Chro.20017 ATP-binding cassette protein 2 AAEL01000120 2100 6962 + Chro.20020 acidic ribosomal protein P2 AAEL01000487 2013 2351 + Chro.20025 CGI-141 protein AAEL01000202 963 1328 +
Chro.20028 glycerol-3-phosphate dehydrogenase, putative AAELO1000202 3123 4373 - Chro.20039 CG31911-PA AAELO1000374 1652 3001 + Chro.20046 Signal peptide AAEL01000097 9899 10363 - Chro.20047 Signal peptide AAEL01000097 8061 8630 - Chro.20048 Signal peptide AAEL01000097 6598 7383 - Chro.20049 Signal peptide AAEL01000097 4750 5328 - Chro.20050 Signal peptide AAEL01000097 3340 3936 - Chro.20051 Signal peptide AAEL01000097 2492 2896 - Chro.20052 Signal peptide AAEL01000097 1530 2090 Chro.20060 PfMPC AAEL01000151 3722 4648 - Chro.20062 Transmembrane protein AAEL01000151 7358 9010 - Chro.20063 MPUI p AAEL01000151 10080 10781 + Chro.20064 Transmembrane protein AAEL01000300 118 1392 + Chro.20067 nucleotide-sugar transporter (2A681) AAEL01000203 10515 11795 Chro.20070 Transmembrane protein AAELO1000203 2674 3855 - Chro.20071 acid phosphatase, putative AAELO1000203 858 1778 + Chro.20074 Signal anchor AAEL01000549 1751 3079 - Chro.20075 Signal peptide AAEL01000792 1217 1978 - Chro.20084 Transmembrane protein AAEL01001202 149 493 + Chro.20090 scavenger receptor protein TgSRI precursor AAELO1000046 11382 15125 - Chro.20091 hypothetical protein AAEL01000046 8771 10585
Hypothetical FAM18-like protein Dgi|28829725|gb|AAO52232.11 similar to Chro.20094 Mus musculus (Mouse). 1810036l24Rik protein AAEL01000046 4801 5481 + Chro.20095 similar to Homo sapiens (Human). NPD010 AAEL01000046 3703 4323 - Chro.20096 Signal anchor AAEL01000046 2669 3607 + Chro.20100 Signal anchor AAEL01000525 3089 4105 Chro.20105 Signal peptide AAELO1000009 35949 39137 - Chro.20115 putative mitochondrial carrier protein AAEL01000009 17228 18172 + Chro.20117 Signal anchor AAEL01000009 14953 15996 - acyl-CoA:diacylglycerol acyltransferase 1 -related Chro.20121 enzyme AAEL01000009 7660 9177 + Chro.20124 ENSANGP00000008492 AAELO1000009 1389 2333 _ Chro.20126 syntaxin, putative AAEL01000205 365 1333 Chro.20132 Hypothetical protein CBG11196 AAEL01000205 10049 10978 - Chro.20139 adenylyl cyclase AAEL01000240 8833 11033 + Chro.20141 Signal peptide AAEL01000240 5065 6330 + Chro.20143 hypothetical protein AAEL01000240 879 2327 + Table 5: Surface and Secreted Proteins
GenelD 1 Description: Surface and Secreted Proteins ContiglD2 Start End Strand
Chro.20156 Signal peptide AAEL01000065 10075 10869
Chro.20159 transporter, putative AAEL01000065 5962 7686 -
Chro.20163 Transmembrane protein AAEL01000065 1023 2024 +
Chro.20166 hypothetical protein AAEL01000268 4747 6525 + transmembrane protein 15; cDNA sequence
Chro.20170 BC026973 AAEL01000268 317 1081 +
Chro.20173 fibrillin 2; syndatyly ems AAEL01000071 20025 21869 - dolichyl-di-phosphooligosaccharide-protein glycotransferase (oligosaccharyltransferase)-
Chro.20179 related AAEL01000071 8135 9541 +
Chro.20183 hypothetical protein AAELO1000071 4972 5271
Chro.20185 hypothetical protein AAEL01000071 1858 3513 -
Chro.20193 hypothetical protein AAEL01000224 10578 11894 +
Chro.20200 Signal peptide AAELO1000073 7328 8878 -
Chro.20216 Transmembrane protein AAEL01000248 8583 9284 +
Chro.20217 hypothetical protein AAEL01000248 7755 8315 +
Chro.20218 hypothetical protein AAEL01000248 6221 7024 +
Chro.20228 Signal peptide AAEL01000258 3216 3752 -
Chro.20229 Transmembrane protein AAEL01000258 4074 4832 -
Chro.20232 Signal anchor AAEL01000560 1 3655
Chro.20233 Transmembrane protein AAELO1000772 377 2068 -
Chro.20235 Signal anchor AAEL01000535 195 665 -
DHHC1 protein; Golgi apparatus-specific protein
Chro.20236 with DHHC zinc finger domain AAEL01000535 731 1933
Chro.20242 zuotin related factor-1 AAEL01000075 14202 16223 -
Chro.20243 Signal anchor AAEL01000075 13130 14167 + similar to Plasmodium berghei heat shock related protein, encoded by GenBank Accession Number L04508, and Trypanosoma cruzi heat shock protein 70, Swiss-Prot Accession Number
Chro.20248 P05456-related AAEL01000075 1175 6235 -
Chro.20256 Transmembrane protein AAEL01001153 106 807 -
ATPas, class II, type 9B; ATPase, class 2, member b; ATPase 9B, p type; ATPase 9B, class
Chro.20257 Il AAEL01000311 4780 8658
Chro.20258 seroreactive antigen BMN1-9B-related AAEL01000311 4231 4698 +
Chro.20260 Signal peptide AAEL01000311 284 787 -
Chro.20262 Signal anchor AAEL01000321 7661 8365 +
Chro.20264 Transmembrane protein AAEL01000321 3689 4573 +
Chro.20268 Signal peptide AAELO1000334 2766 3794 +
Chro.20271 Signal peptide AAEL01000334 5511 6419 +
Chro.20273 Signal peptide AAEL01000310 3796 5790 -
Chro.20274 Signal peptide AAELO1000310 6232 6774 -
Chro.20278 Signal peptide AAEL01000095 6020 13858 +
Chro.20280 Signal peptide AAEL01000095 1523 3457 -
Chro.20282 Transmembrane protein AAEL01000188 12564 13394 solute carrier family 35 (UDP-N- acetylglucosamine (UDP-GIcNAc) transporter), member A3; solute carrier family 35 (UDP-N- acetylglucosamine (UDP-GIcNAc) transporter),
Chro.20283 member 3 AAEL01000188 11038 12012 solute carrier family 35 (UDP-N- acetylglucosamine (UDP-GIcNAc) transporter),
Chro.20284 member 3 AAEL01000188 9260 10504
Chro.20285 Hypothetical protein CBG24344 AAEL01000188 4737 8558 + Table S: Surface arifl Sliiόreted'TOteMs GenelD 1 Description: Surface and Secreted Proteins ContiglD2 Start End Strand similar to yeast nuclear segregation protein Bfr1 Chro.20287 involved in Mitosis and Vesicular transport AAEL01000188 1499 2986 Chro.20288 unnamed protein product AAEL01000188 295 1359 + Chro.20300 Signal peptide AAEL01000102 19132 19482 +
Chro.20306 er lumen protein retaining receptor 1 , putative AAEL01000102 9420 10346 - Chro.20316 Signal peptide AAEL01000136 16027 16461 + Chro.20319 Signal peptide AAEL01000101 3334 3540 +
TSP1 domain-containing protein TSP10 Chro.20323 precursor AAEL01000101 7312 8487 + Chro.20324 Signal peptide AAEL01000101 9168 10595 + Chro.20325 Transmembrane protein AAEL01000101 12133 13206 + Chro.20326 Signal peptide AAEL01000101 14170 17292 - Chro.20327 Transmembrane protein AAEL01000101 18131 19542 + Chro.20329 Signal anchor AAEL01000389 1235 6175 +
Chro.20339 heat shock protein DnaJ homologue Pfj2 AAEL01000093 3000 4814 - Chro.20345 Signal peptide AAEL01000038 8990 10708 + Chro.20348 Homo sapiens P3ECSL-related AAELO1000038 17061 19535 - Chro.20349 putative HSP protein AAELO1000038 20657 23437 - Chro.20353 Signal peptide AAELO1000149 1397 2401 - Chro.20354 Transmembrane protein AAEL01000149 3430 3921 - Chro.20358 dynamin-related protein AAEL01000149 10097 10333 - Chro.20363 Severe Depolymerization of Actin; Sdaip AAEL01000149 13473 15953 + Chro.20364 Transmembrane protein AAELO1000045 27131 27577 + Chro.20368 Signal peptide AAELO1000045 16850 17911 + Chro.20369 Signal anchor AAEL01000045 14518 16497 - Chro.20371 Signal anchor AAELO1000045 7256 9373 + Chro.20373 Signal peptide AAELO1000045 3551 4462 + Chro.20375 Signal peptide AAEL01000045 1206 2624 + Chro.20380 Signal anchor AAEL01000370 5 142 + Chro.20389 ABC transporter AAEL01000106 6749 8410 + Chro.20398 Signal peptide AAEL01000152 4782 5588 + Chro.20399 Signal peptide AAEL01000152 2953 4341 + Chro.20400 Transmembrane protein AAEL01000152 67 1479 - Chro.20402 Transmembrane protein AAELO1000409 1214 2344 + Chro.20404 PC20A AAELO1000409 5712 6026 - Chro.20413 Signal anchor AAELO1001138 138 905 - Chro.20418 Signal peptide AAEL01000239 8341 8601 -
Chro.20427 membrane-associated calcum-binding protein AAEL01000397 1554 2903 - Chro.20429 Signal anchor AAEL01000639 1014 1745 + Chro.20432 hypothetical protein MG05933.4 AAEL01000591 37 2502 + Chro.20433 Transmembrane protein AAELO1000494 76 660 + Chro.20437 Signal anchor AAELO1000055 24515 24862 + mitochondrial import inner membrane translocase Chro.20443 subunit tim17 AAELO1000055 16861 17352 + Chro.20446 Signal anchor AAEL01000055 11547 11906 + Chro.20450 unnamed protein product AAEL01000055 4141 5460 Chro.20456 P-type ATPase3 AAEL01000442 1 4450 - Chro.20459 ENSANGP00000016000 AAEL01000341 1078 4818 - Chro.20464 putative thioredoxin reductase AAEL01000190 8361 9926 + hypothetical protein F55F8.1 - Caenorhabditis Chro.20466 elegans AAEL01000190 856 4701 Chro.20468 Signal peptide AAELO1000327 6218 7354 - Chro.30010 Signal peptide AAEL01000507 558 3725 + Chro.30011 Signal peptide AAEL01000396 793 1923 + Table 5: Surface and Secreted'P'rbtiiris
GenelD 1 Description: Surface and Secreted Proteins ContiglD2 Start End Strand
Chro.30012 Transmembrane protein AAEL01000396 2262 3590
Chro.30014 ZW18 protein AAELO1000207 8474 12100 -
Chro.30018 erythrocyte membrane-associated antigen AAEL01000207 2119 4338 -
Chro.30019 Signal anchor AAELO1000207 778 1971
Chro.30020 putative asparagine synthase AAEL01000465 3710 5065 -
Chro.30027 Transmembrane protein AAELO1000506 2633 3145 +
Chro.30030 Signal peptide AAEL01000519 1 410 _
Chro.30049 Signal anchor AAELO1000063 13390 14514 +
Chro.30050 Transmembrane protein AAEL01000063 14430 14639 -
Chro.30058 ATP-binding cassette protein 2 AAEL01000014 3878 8824 +
Chro.30061 Transmembrane protein AAEL01000014 26198 27544 -
Transmembrane amino acid transporter protein, Chro.30064 putative AAEL01000014 31807 33411 Chro.30065 Signal anchor AAEL01000014 34041 35141 + similar to Homo sapiens (Human). GDP-fucose Chro.30069 transporter 1 AAEL01000014 36497 37795 + Chro.30070 Signal peptide AAEL01000014 41968 44019 - Chro.30072 hypothetical protein AAEL01000053 22747 24222 + Chro.30073 Transmembrane protein AAELO1000053 20747 22228 - Chro.30074 Signal peptide AAEL01000053 18682 20334 + Chro.30075 Signal peptide AAELO1000053 16412 17755 - Chro.30076 Signal peptide AAEL01000053 13988 16054 - Chro.30077 hypothetical protein AAEL01000053 9837 13355 - Chro.30078 Signal peptide AAELO1000053 4999 9288 Chro.30079 Transmembrane protein AAEL01000053 2587 3675 - Chro.30086 Signal peptide AAEL01000081 113 1645 Chro.30087 Signal peptide AAEL01000081 2101 4761 - Chro.30088 Signal peptide AAEL01000081 6403 8151 + Chro.30090 ATP-binding cassette protein 2 AAELO1000081 10765 15525 + Chro.30091 Signal peptide AAEL01000081 15926 18916 + Chro.30092 Transmembrane protein AAELO1001248 411 764 + Chro.30096 Signal peptide AAEL01000185 868 7656 + Chro.30101 RIKEN cDNA 1110065L07 AAELO1000362 402 1661 + Chro.30102 Transmembrane protein AAEL01000362 1908 2963 - Chro.30111 Signal peptide AAEL01000339 2057 2485 + Chro.30127 Transmembrane protein AAEL01000291 2766 3326 - Chro.30128 Transmembrane protein AAEL01000291 3930 4403 + Chro.30129 Transmembrane protein AAELO1000291 4637 4888 - Chro.30130 Signal anchor AAEL01000291 5327 5554 Chro.30131 Transmembrane protein AAEL01000291 7320 7847 - Chro.30132 Transmembrane protein AAEL01000291 8050 8805 + Chro.30141 guanylyl cyclase-related AAEL01000277 2275 9726 - Chro.30142 Transmembrane protein AAEL01000430 1636 1962 Chro.30144 Transmembrane protein AAELO1000232 357 1046 Chro.30147 Signal peptide AAEL01000232 5993 7474 - Chro.30153 hypothetical protein AAELO1000067 17503 18897 - Chro.30169 Transmembrane protein AAELO1000044 1161 2627 + Chro.30178 hypothetical protein AAEL01000044 21517 23343 Chro.30183 Transmembrane protein AAELO1000044 27802 28245 - Chro.30185 Signal peptide AAEL01000584 2447 3310 + Chro.30194 Transmembrane protein AAEL01000146 2127 3401 + Chro.30198 Transmembrane protein AAELO1000146 10737 11732 + Chro.30200 Transmembrane protein AAEL01000146 15081 15911 + Chro.30204 Signal peptide AAELO1000247 8583 10688 - Chro.30205 Signal peptide AAELO1000247 7348 8250 Table S: Surface and Secreted Proteins
GenelD 1 Description: Surface and Secreted Proteins ContiglD2 Start End Strand
Chro.30206 Signal anchor AAEL01000247 6098 6910
Chro.30207 Signal peptide AAEL01000247 3127 4023
Chro.30208 Signal anchor AAEL01000247 1581 2708 -
Chro.30209 Signal peptide AAEL01000247 438 1286
Chro.30210 Signal anchor AAEL01000086 20512 21390
Chro.30211 Signal peptide AAELO1000086 17763 19355
Chro.30212 Signal peptide AAEL01000086 15328 17031 -
Chro.30214 Transmembrane protein AAELO1000086 9499 11184 +
Chro.30216 transport protein AAEL01000086 3857 6130
Chro.30217 Signal peptide AAEL01000086 507 3806 +
Chro.30220 ENSANGP00000004359 AAEL01000001 7512 9221 + transmembrane phosphatase with tensin
Chro.30223 homology isoform C AAEL01000001 13920 16163
Chro.30224 hypothetical protein AAEL01000001 17018 17893 +
Chro.30227 Signal anchor AAEL01000001 20849 21835 +
Chro.30237 hypothetical protein AAELO1000001 36864 39458
Chro.30245 Ion transport protein, putative AAEL01000001 52358 57700 -
Chro.30250 Signal peptide AAEL01000001 70031 71005 +
Chro.30252 similar to NM_072339 T15B7 AAEL01000001 72764 73507 -
Chro.30269 cGMP phosphodiesterase A4, putative AAEL01000256 2214 5207 +
Chro.30271 Signal anchor AAELO1000256 5219 5893
Chro.30289 Signal anchor AAEL01000068 13495 14829 -
Chro.30302 diacylglycerol kinase, putative AAEL01000273 1730 3271 + probable microsomal signal peptidase 22 kDa
Chro.30306 subunit, putative AAEL01001198 363 883 +
Chro.30307 hypothetical protein AAEL01000197 1 1605
ATPase, aminophospholipid transporter-like, class I, type 8A, member 2; ATPase, class 1 , member a; ATPase 8A2, p type; ATPase 8A2,
Chro.30311 class I AAEL01000197 6823 10359 +
Chro.30316 hypothetical protein AAEL01000501 352 3639
Chro.30326 Transmembrane protein AAEL01001092 88 303 +
Chro.30338 ENSANGP00000011856 AAEL01000219 504 1769 +
Chro.30339 Signal peptide AAEL01000219 1843 5055 -
Chro.30352 hypothetical protein, conserved AAEL01000318 3587 4837 +
Chro.30354 alternative oxidase AAEL01000318 265 1272 +
Chro.30358 Transmembrane protein AAEL01000114 2292 3227 -
Chro.30375 Signal peptide AAEL01000020 2757 3260 -
Chro.30383 Signal peptide AAELO1000020 24003 28526 -
Chro.30385 synthetic antigen of P.falciparum, putative AAELO1000020 31869 35585 -
Chro.30387 Transmembrane protein AAEL01000132 14305 15507 +
Chro.30388 amiloride binding protein 1 AAEL01000132 8422 13737 +
Chro.30397 cation exchanger, putative (CAX11 ) AAELO1000201 4931 7753 +
Chro.30401 hypothetical protein AAEL01000891 346 582 +
Chro.30406 hypothetical protein AAEL01000246 6042 7922 +
Chro.30409 hypothetical protein AAEL01000512 1295 4252 _
Chro.30412 Signal peptide AAEL01001016 1 1116 -
Chro.30418 Transmembrane protein AAEL01000706 2134 2343 +
Chro.30424 P-type ATPase 2 AAEL01000836 1013 1681 -
Chro.30434 isoleucine-tRNA synthetase AAELO1000627 129 2504 +
Chro.30444 Transmembrane protein AAELO1000254 9238 10557 +
Chro.30447 Transmembrane protein AAEL01000674 751 1188 +
Chro.30454 Grina-prov protein AAEL01000125 7641 8390 -
Chro.30458 hexose transporter AAEL01000287 8261 9106
Chro.30465 Hypothetical ORF; Yor291wp AAEL01000174 5621 9913 Table 5: Surface and Secreted Profefri's
GenelD 1 Description: Surface and Secreted Proteins ContiglD 2 Start End Strand
Chro.30468 insulin degrading enzyme AAEL01000226 1377 2387
Chro.30470 Signal peptide AAEL01000226 7139 10396
Chro.30474 peptidase, M16 family AAEL01000304 4920 8684 +
Chro.30475 peptidase, insulinase family AAEL01000304 429 4256 +
Chro.30476 Signal peptide AAEL01000788 64 1632
Chro.30483 ENSANGP00000016000 AAEL01000521 2520 3305 +
Chro.30485 hypothetical protein AAEL01000200 2406 3074
Chro.30489 hypothetical protein AN4477.2 AAEL01000200 10172 11791 +
Chro.40010 Signal peptide AAEL01000613 1730 2209 +
Chro.40012 Signal peptide AAEL01000127 427 651
Chro.40019 hypothetical protein AAEL01000127 9256 10548
Chro.40021 hypothetical protein, conserved AAEL01000127 14385 16898 +
Chro.40023 Signal anchor AAEL01000416 5802 6017
Chro.40030 Transmembrane protein AAEL01000577 1897 2778 +
Chro.40040 hypothetical protein, conserved AAEL01000293 436 4509 +
Chro.40042 unnamed protein product AAEL01000293 6026 7813 +
Chro.40049 Signal anchor AAELO 1000276 5444 6289 +
Chro.40052 hypothetical protein AAEL01000634 2513 3072 +
Chro.40053 hypothetical protein MG03690.4 AAEL01000299 7607 8680
Chro.40056 CG4196-PC AAELO 1000299 2444 3229
Nuclear transport factor 2 (NTF-
2)Dgi|5360221 |dbj|BAA81910.11 nuclear transport
Chro.40075 factor 2 (NTF2) AAEL01000402 5602 5991
Chro.40081 Transmembrane protein AAEL01000083 102 2120 +
Chro.40094 serine proteinase inhibitor AAEL01000451 1 1838
Chro.40099 CG12404-PA AAEL01000500 76 639 +
Chro.40106 Signal anchor AAEL01000211 7638 10712 +
Chro.40110 Signal peptide AAEL01000659 166 1176 +
Chro.40118 Signal anchor AAEL01000263 8418 9617
Chro.40132 hypothetical protein AAELO 1000559 3064 3744
Chro.40137 expressed protein AAEL01000424 3542 5344 +
Chro.40139 Transmembrane protein AAEL01000424 605 937 +
Chro.40149 Signal peptide AAELO 1000288 5728 7170 +
Chro.40150 Transmembrane protein AAEL01000288 3130 4923 +
Chro.40151 hypothetical protein AAELO 1000288 319 2724 + hypothetical protein C0740c - malaria parasite
Chro.40155 (Plasmodium falciparum) AAEL01000105 3197 5251
Chro.40156 ATP-binding cassette protein 2 AAEL01000105 5836 10308
Chro.40157 ABC multidrug or ion efflux transporter AAELO 1000105 10851 15260
Chro.40158 ATP-binding cassette protein 1 AAEL01000105 16022 19129
Chro.40165 Transmembrane protein AAEL01000235 2296 5058 +
Chro.40166 Transmembrane protein AAEL01000235 5120 5545 vacuolar proton translocating ATPase 116 kDa
Chro.40167 subunit a isoform 1 AAELO 1000235 6740 9466 +
Chro.40178 Transmembrane protein AAEL01000457 3401 3652
Chro.40189 Signal peptide AAEL01000363 3865 4488
Chro.40190 hypothetical protein AN7182.2 AAEL01000363 5051 6064
Chro.40200 hypothetical protein AAEL01000552 526 1875
Chro.40203 hypothetical protein AAELO 1000432 1496 2209
Chro.40209 Transmembrane protein AAEL01000261 2222 4213 +
Chro.40216 expressed protein AAELO 1000039 24730 26175 +
Chro.40222 Transmembrane protein AAEL01000039 15788 16474
Chro.40225 CP15/60 AAELO 1000039 10793 12259
Chro.40229 Signal peptide AAEL01000039 3937 4173 +
Chro.40233 unnamed protein product AAELO 1000090 1942 2967 Table 5: Surface and Secreted Proteins
GenelD 1 Description: Surface and Secreted Proteins ContiglD2 Start End Strand
Chro.40239 preprocathepsin c precursor, putative AAEL01000090 8859 10766 - Chro.40248 hypothetical protein AAEL01000785 121 1965 Chro.40249 aspartyl protease-like AAELO1000337 273 1925 Chro.40251 Transmembrane protein AAEL01000337 6037 6354 Chro.40258 ENSANGP00000010899 AAEL01000018 27871 29013 - Chro.40263 Signal anchor AAEL01000018 18401 18715 + Chro.40264 Signal peptide AAEL01000018 17820 18269 + Chro.40265 Signal anchor AAEL01000018 16302 17339 -
Chain A, 4ank: A Designed Ankyrin Repeat Chro.40272 Protein With Four Identical Consensus Repeats AAEL01000018 531 2330 + Chro.40273 Transmembrane protein AAEL01000849 695 1618 - Chro.40274 Signal peptide AAEL01000533 2619 3206 + Chro.40276 Signal peptide AAEL01000533 1113 2012 + Chro.40278 Signal peptide AAEL01000617 1227 1829 + Chro.40279 Signal peptide AAEL01000617 154 867 - Chro.40280 Signal peptide AAEL01001193 473 889 + Chro.40281 Signal peptide AAELO1000058 25053 25874 + Chro.40282 Signal peptide AAELO1000058 23694 24515 + Chro.40283 Transmembrane protein AAEL01000058 22629 23321 -
N-methyl-D-aspartate receptor-associated protein Chro.40302 CG3798-PC AAELO1000295 6872 7621 -
ATPase homolog - Cryptosporidium
Chro.40306 parvumDgi|1513210|gb|AAC47833.1| P-ATPase AAEL01000078 5341 9927 + Chro.40312 Signal anchor AAELO1000078 16260 17933 + Chro.40313 DNAJ domain protein, putative AAEL01000078 17940 19022 - Chro.40314 ethanolaminephosphotransferase, putative AAEL01000078 19280 20566 + Chro.40315 hypothetical protein AAELO1000078 20815 21951 - Chro.40316 Signal peptide AAEL01000360 4288 7599 + Chro.40321 Signal anchor AAEL01000368 1086 1817 + Chro.40323 facilitative hexose transporter AAEL01000368 3525 5042 + Chro.40325 hypothetical protein AAEL01000281 8629 9546 + Chro.40344 Signal peptide AAEL01000002 68967 70121 + Chro.40345 Signal peptide AAELO1000002 67678 68670 + Chro.40348 Signal anchor AAELO1000002 64174 64389 - Chro.40349 Signal anchor AAEL01000002 63720 64148 - Chro.40351 oocyst wall protein 6 precursor AAELO1000002 60468 62084 - similar to GDP-fucose transporter 1 ; multispan Chro.40354 transmembrane protein fucti AAELO1000002 52413 54626 + Chro.40356 glucosyltransferase AAEL01000002 50219 51808 - Chro.40367 Signal peptide AAELO1000002 34509 36587 + Chro.40390 Signal peptide AAEL01000107 17505 18863 + Chro.40392 Signal anchor AAEL01000315 2181 4568 + Chro.40395 Signal peptide AAEL01000198 8727 10967 + Chro.40396 Signal peptide AAEL01000198 11526 12845 + Chro.40397 Signal peptide AAEL01000812 400 1503 - Chro.40400 Signal peptide AAEL01000089 591 1007 + Chro.40404 hypothetical protein AAELO1000089 12985 13707 + hypothetical protein T13C2.5 - Caenorhabditis Chro.40405 elegans AAELO1000089 14447 18346 + Chro.40409 Signal peptide AAEL01000476 561 3224 + Chro.40410 Transmembrane protein AAELO1000604 30 2531 + Chro.40412 Signal anchor AAEL01000216 3004 4749 + Chro.40415 Signal peptide AAEL01000216 6883 10011 + Tabie 5: Surface and Secreted Proteins
GenelD 1 Description: Surface and Secreted Proteins ContiglD2 Start End Strand
Chro.40417 Signal peptide AAEL01000697 1481 1981 -
Chro.40419 Signal anchor AAEL01000436 2313 3044 +
Chro.40436 ankyrin-related protein, possible AAEL01000349 38 2635 +
Chro.40437 Transmembrane protein AAEL01000784 1526 1909 -
Chro.40438 Transmembrane protein AAEL01001053 537 1043 -
Chro.40441 Signal anchor AAELO1000966 113 1054 -
Chro.40448 Signal anchor AAEL01000702 709 1722 +
Chro.40454 Signal peptide AAELO1000324 5339 7909 -
Chro.40463 RIKEN cDNA 1200003006 AAEL01000481 756 1715 -
Chro.40468 hypothetical protein, conserved AAELO1000722 664 1629 -
Chro.40480 Signal peptide AAEL01000480 1588 3939 +
Chro.40483 Transmembrane protein AAEL01000757 354 1928 +
Chro.40486 Signal peptide AAEL01001141 425 940 +
Chro.40497 Signal peptide AAEL01000135 13468 14160 +
Chro.40503 ATP-binding cassette protein 2 AAEL01000855 344 1483 +
Chro.40504 putative ABC transporter AAEL01000355 50 940 +
Chro.40505 hypothetical protein AN4477.2 AAEL01000355 1282 2964 +
Chain A, Crystal Structure Of Dhfr-Ts From
Cryptosporidium
HominisDgi|39654757|pdb|1QZF|B Chain B,
Crystal Structure Of Dhfr-Ts From
Cryptosporidium
HominisDgi|39654758|pdb|1QZF|C Chain C1
Crystal Structure Of Dhfr-Ts From
Cryptosporidium
HominisDgi|39654759|pdb|1QZF|D Chain D,
Crystal Structure Of Dhfr-Ts From
Cryptosporidium
HominisDgi|39654760|pdb|1QZF|E Chain E,
Crystal Structure Of Dhfr-Ts From
Cryptosporidium
HominisDgi|1480451|gb|AAC47230.1| bifunctional dihydrofolate reductase-thymidylate Chro.40506 synthase AAELO1000355 3431 4996 + Chro.40507 Signal anchor AAEL01000355 6292 7356 + Chro.40508 Transmembrane protein AAEL01000196 315 1346 + Chro.50010 Signal peptide AAEL01000267 1661 3742 + Chro.50011 Signal peptide AAEL01000413 1798 3267 + Chro.50012 Signal peptide AAEL01000670 1 1166 - Chro.50013 sbmA AAEL01000670 1822 2664 - sensitivity to microcin B17, possibly envelop Chro.50014 protein AAELO1000042 27175 28197 Chro.50015 Signal peptide AAEL01000042 22152 26624 + Chro.50020 chaperone, putative AAEL01000042 13877 14218 + Chro.50022 hypothetical protein MG01634.4 AAELO1000042 10988 12430 - Chro.50023 Signal peptide AAELO1000042 9808 10701 + Chro.50028 CG3061-PA AAEL01000042 984 2255 -
AAEL01000042 317 682 +
Chro.50030 hypothetical protein AAEL01000155 11378 12865 Chro.50034 Signal peptide AAELO1000564 1732 3609 + similar to XM_028438 CGI-101 protein in Homo Chro.50040 sapiens AAELO1000328 5909 6541 + Chro.50058 Transmembrane protein AAEL01000156 5154 7406 - Chro.50066 Signal peptide AAELO1000538 3438 3950 _ Table 1Si SVrface arid Secreted Proteins
GenelD 1 Description: Surface and Secreted Proteins ContiglD 2 Start End Strand similar to Protein required for cell viability;
Chro.50074 YjlOIOcp AAEL01000661 7 1602 +
Chro.50093 Signal peptide AAEL01000464 3475 3993 +
Chro.50101 Signal peptide AAEL01000213 1213 3771 +
Chro.50102 Signal anchor AAEL01000780 1 1113
Chro.50104 Signal peptide AAEL01001360 144 359 +
Chro.50107 Signal peptide AAEL01000032 31184 32182 +
Chro.50108 Signal peptide AAEL01000032 28518 30455 +
Chro.50109 Signal peptide AAEL01000032 26148 27947 +
Chro.50118 dolichyl phosphate glucosyltransferase AAEL01000032 3902 4990 +
Chro.50120 Transmembrane protein AAEL01000032 2255 2656
Chro.50125 hypothetical protein AAELO 1000070 8112 10811
Chro.50126 Transmembrane protein AAEL01000070 11538 11747
Chro.50129 expressed protein AAELO 1000070 19512 20474
Chro.50137 hypothetical protein AAEL01000275 5392 7242
Chro.50147 SPFH domain / Band 7 family, putative AAEL01000134 5008 5850 +
Chro.50149 defender against cell death protein AAEL01000539 122 520
Chro.50150 Signal peptide AAELO 1000539 898 2802 +
N-acetyIgIucosamine-1 -phosphate transferase,
Chro.50156 putative AAEL01000074 1948 3222 +
Chro.50157 transmembrane protein 17 AAEL01000074 3568 4668
Chro.50161 endonuclease G-like 1 AAEL01000074 10183 11601
Chro.50164 hypothetical protein AAEL01000074 20594 21655
Chro.50173 Signal peptide AAEL01000019 21940 23790
Chro.50181 Transmembrane protein AAEL01000019 7428 8015
Chro.50185 Signal anchor AAEL01000019 1402 2280 +
Chro.50194 hypothetical protein AAEL01000013 14734 15645 +
Chro.50196 hypothetical protein MG00894.4 AAEL01000013 18069 20081 +
Chro.50217 Signal peptide AAEL01000179 8478 9428
Chro.50220 Signal anchor AAEL01000179 11906 13552
Chro.50227 terbinafine resistance locus protein YIP1 AAEL01000353 3661 4302 +
Chro.50228 Transmembrane protein AAELO 1000353 2903 3601
Chro.50230 Signal peptide AAEL01000353 884 2275
Chro.50231 Signal peptide AAELO 1000353 70 801
Chro.50234 Signal anchor AAEL01000054 1368 1775
Chro.50235 Signal peptide AAEL01000054 2354 10135
Chro.50236 Signal peptide AAEL01000054 10404 14105
Chro.50237 putative nucleoside-diphosphate kinase AAELO 1000054 14460 15125 +
Chro.50238 Signal peptide AAEL01000054 15193 17346
Chro.50239 Signal peptide AAEL01000054 17641 18789 +
Chro.50240 hypothetical protein AAEL01000054 18868 23676
Chro.50247 Transmembrane protein AAEL01000434 241 552 +
Chro.50248 Transmembrane protein AAEL01000393 786 1976 + similar to NC_001141 protein required for filamentous growth, cell polarity, and cellular
Chro.50250 elongation; Dfg1 Op in Saccharomyces cerevisiae AAEL01000393 1973 2794
Chro.50253 hypothetical protein AAEL01000393 5371 6186
Chro.50254 Transmembrane protein AAEL01001213 1 694
Chro.50257 unknown protein AAEL01000331 3599 4726
Chro.50258 DHHC-type zinc finger domain-containing protein AAEL01000331 2469 3365
Chro.50259 P0695H10.17 AAEL01000331 1 2367
Chro.50278 Drosophila melanogaster GM01605p AAEL01000007 21381 22712
Chro.50285 hypothetical protein AAEL01000007 28100 29620 Table 5: S'uWaϊϊe a'nltf Sδόrefed'Pi'όt^iris
GenelD 1 Description: Surface and Secreted Proteins ContiglD2 Start End Strand
Chro.50304 hypothetical protein AAEL01000123 6518 8356 +
Chro.50308 hypothetical protein AAEL01000301 5946 7559
Chro.50309 Hypothetical protein CBG09285 AAEL01000301 4247 5893 +
Chro.50320 GM14490p AAEL01000087 13125 14324 -
UDP-N-acetyl-D-galactosamineipolypeptide N-
Chro.50322 acetylgalactosaminyltransferase T3 AAEL01000087 6848 9046
Chro.50325 putative thioredoxin AAEL01000087 2594 3196 +
Chro.50335 hypothetical protein AAEL01000517 2604 3230 -
Chro.50357 hypothetical protein, conserved AAELO1000705 896 2098 +
Chro.50362 hypothetical protein AAEL01000797 175 1863 +
Chro.50378 CG3887-PA AAEL01000789 74 697 -
Chro.50380 Transmembrane protein AAEL01000644 2314 2799 -
Chro.50382 hypothetical protein AAELO1000699 1184 2440 -
Chro.50391 Signal peptide AAEL01000354 5006 6973 +
Chro.50392 Signal peptide AAEL01000184 130 5898 +
Chro.50394 Signal peptide AAEL01000184 6994 9276 +
Chro.50395 Signal peptide AAEL01000184 9873 11588 +
Chro.50411 Transmembrane protein AAEL01000676 1341 2656 +
Chro.50412 Transmembrane protein AAEL01000786 195 1631 -
Chro.50415 Signal peptide AAEL01000381 2625 4109 +
Chro.50416 Plasmodium falciparum asparagine-rich protein AAEL01000381 836 2431
Chro.50422 hypothetical protein AAEL01000570 410 3271 +
Chro.50430 Signal anchor AAEL01000325 2401 3363 +
Chro.50432 Transmembrane protein AAELO1000325 6546 7283 -
Chro.50433 Transmembrane protein AAEL01000325 8113 8508 -
Chro.50443 Transmembrane protein AAEL01000878 476 1192 +
Chro.50450 Signal anchor AAELO1000602 1 1620 -
Chro.50453 hypothetical protein AAELO1000578 1234 3333
Chro.50454 hydrolase, alpha/beta hydrolase fold family AAEL01000428 1260 2360 +
Chro.50457 erythrocyte membrane-associated antigen AAEL01000428 4390 5469 -
Chro.50458 Signal peptide AAEL01001308 55 660 +
Chro.50459 Signal peptide AAELO1000759 1530 2054 -
Chro.50471 Signal anchor AAELO1000289 78 308 +
Chro.50480 ENSANGP00000013300 AAEL01000400 1631 3043
Chro.50484 Signal anchor AAELO1000433 2981 3955 +
Chro.50507 Signal anchor AAEL01000309 1259 1978 +
Chro.60010 Signal peptide AAEL01000251 7336 8304 - hypothetical predicted transmembrane protein, Chro.60011 unknown function AAEL01000251 2934 3647 +
Chro.60013 hypothetical predicted protein, unknown function AAELO1000376 4407 5228 + Chro.60014 serine repeat antigen, probable AAELO1000376 3163 3741 +
Chro.60015 hypothetical predicted protein, unknown function AAEL01000376 648 1445 + Chro.60016 protease, possible AAELO1000052 21932 26641 - Chro.60017 CAAX prenyl protease, possible AAEL01000052 20501 21799 + conserved hypothetical multi-pass Chro.60020 transmembrane protein AAELO1000052 15784 18123 +
Chro.60022 conserved hypothetical transmembrane protein AAEL01000052 13290 14159 + Chro.60023 protein disulphide isomerase, probable AAEL01000052 11048 12493 - Chro.60024 Na+/H+ antiporter, possible AAEL01000052 8102 10717 + Chro.60025 Na+/H+ antiporter, possible AAEL01000052 4314 7094 _ Chro.60028 synaptobrevin-like protein, possible AAEL01001124 23 490 Table '5: Surface and Secreted Proteins
GenelD 1 Description: Surface and Secreted Proteins ContiglD2 Start End Strand
Chro.60033 oocyst wall protein precursor, possible AAEL01000415 3146 5704 Chro.60065 Signal anchor AAEL01001133 379 543 + Chro.60067 transporter protein, putative AAEL01000718 1282 2274 Chro.60070 probable serine/threonine-protein kinase 2 AAEL01000515 350 1924 + Chro.60079 Transmembrane protein AAEL01001210 265 774 +
ATP synthase alpha chain Dgi|67815|pir||PWQFA
H+-transporting two-sector ATPase (EC 3.6.3.14) alpha chain - Rhodospirillum rubrumDgi|46366|emb|CAA26338.1| unnamed Chro.60082 protein product AAEL01000992 52 1101 + Chro.60084 Signal anchor AAEL01000916 844 1104 + Chro.60090 ribonucleotide reductase R2 subunit AAEL01000774 54 944 + Chro.60092 Signal peptide AAEL01000412 2769 4154 - Chro.60093 Signal anchor AAEL01000412 5274 5831 + Chro.60098 Arabidopsis thaliana F6D8.20 AAEL01000137 3890 6847
Chro.60101 sporozoite cysteine-rich protein AAEL01000137 10331 10945
Chro.60102 sporozoite cysteine-rich protein AAEL01000137 11337 12380
Chro.60103 TSP1 domain-containing protein TSP7 precursor AAEL01000308 12 1982 Chro.60104 TSP1 domain-containing protein TSP9 precursor AAEL01000137 14012 14425
Chro.60106 hypothetical predicted protein, unknown function AAEL01000498 288 1202 conserved hypothetical multi-pass Chro.60109 transmembrane protein AAEL01000284 1039 2265 hypothetical predicted transmembrane, Chro.60110 thioredoxin domain protein AAEL01000284 2689 4248
Chro.60114 similar to glycogen debranching enzyme, possible AAEL01000631 1156 3018
Chro.60130 retinitis pigmentosa GTPase regulator, possible AAEL01000025 12044 12982
Chro.60133 dentin sialophosphoprotein precursor, possible AAEL01000025 17433 19127 conserved hypothetical multi-pass
Chro.60137 transmembrane protein AAEL01000025 25831 26520
Chro.60138 sporozoite antigen gp40/15 AAEL01000025 26940 27974
Chro.60139 Signal anchor AAEL01000025 29651 29908
Chro.60142 conserved hypothetical transmembrane protein AAEL01000025 32125 33744 Chro.60143 hypothetical predicted protein, unknown function AAEL01000025 33996 35372
Chro.60146 hypothetical predicted protein, unknown function AAEL01000162 4932 7157 hypothetical predicted transmembrane protein, Chro.60156 unknown function AAEL01000553 1606 1992
Chro.60161 glycerol-3-phosphate acyltransferase, probable AAEL01000401 3166 4926 hypothetical predicted zinc-finger protein, Chro.60163 unknown function AAEL01000241 1639 2265
Chro.60164 TSP1 domain-containing protein TSP5 precursor AAEL01000241 2386 3450 hypothetical predicted transmembrane protein, Chro.60166 unknown function AAEL01000241 5301 6059 hypothetical predicted multi-pass transmembrane Chro.60168 protein, unknown function AAEL01000241 8140 10977 Taole'5: Surface ana1 Secreted Wbteihs
GenelD 1 Description: Surface and Secreted Proteins ContiglD 2 Start End Strand hypothetical predicted transmembrane protein,
Chro.60169 unknown function AAEL01000691 1188 2516 +
Chro.60170 Signal anchor AAEL01001167 521 742
Chro.60180 Transmembrane protein AAEL01000021 24410 24634 +
Chro.60182 galactosyltransferase, possible AAEL01000021 19065 21548
Chro.60186 dbj|baa86974.1 , possible AAEL01000021 12208 12795 hypothetical predicted multi-pass transmembrane
Chro.60187 protein, unknown function AAEL01000021 11197 12072 + hypothetical predicted multi-pass transmembrane
Chro.60188 protein, unknown function AAEL01000021 8229 10313
Chro.60189 conserved hypothetical transmembrane protein AAEL01000021 6370 8001 similar to riken cDNA 5830420c20 gene, Chro.60194 probable AAEL01000133 15004 16041 conserved CBS domain multi-pass Chro.60221 transmembrane protein AAEL01000145 12284 14002 + hypothetical predicted transmembrane protein,
Chro.60226 unknown function AAEL01000145 5265 5801 +
Chro.60231 glycosyl transferase, possible AAEL01000260 2022 4451 hypothetical predicted transmembrane protein, Chro.60234 unknown function AAEL01000541 3250 3870
Chro.60235 hypothetical predicted protein, unknown function AAEL01000541 184 3216 + Chro.60238 BT1 family protein AAEL01000072 7195 7896 +
Chro.60239 oligosaccharyl transferase stt3 protein, probable AAEL01000072 8042 10210
Chro.60244 oocyst EB module wall protein AAEL01000265 2586 7448 + hypothetical predicted transmembrane protein,
Chro.60247 unknown function AAEL01000443 3052 3696 + conserved hypothetical multi-pass Chro.60250 transmembrane protein, possible ion transporter AAEL01000443 970 1224 conserved hypothetical multi-pass Chro.60251 transmembrane protein, possible ion transporter AAEL01000057 23725 25458 hypothetical predicted transmembrane protein, Chro.60252 unknown function AAEL01000057 22572 23360 hypothetical predicted multi-pass transmembrane Chro.60259 protein, unknown function AAEL01000057 11686 12549 + hypothetical predicted multi-pass transmembrane Chro.60260 protein, unknown function AAEL01000057 9654 10685 hypothetical predicted multi-pass transmembrane Chro.60265 protein, unknown function AAEL01001010 1 1117 hypothetical predicted multi-pass transmembrane Chro.60266 protein, unknown function AAEL01000527 1051 1740 +
Chro.60270 TSP1 domain-containing protein TSP6 precursor AAEL01000012 5224 6300 +
Chro.60272 Gal/GalNAc binding lectin AAEL01000012 11895 12803 hypothetical predicted multi-pass transmembrane
Chro.60273 protein, unknown function AAEL01000012 13230 15029 +
Chro.60274 mitochondrial carrier protein, possible AAEL01000012 15105 15962 + hypothetical predicted multi-pass transmembrane
Chro.60283 protein, unknown function AAEL01000012 26675 27466 hypothetical predicted multi-pass transmembrane
Chro.60286 protein, unknown function AAEL01000012 31656 33623 Table 5: Surface and Secreted Proteins
GenelD 1 Description: Surface and Secreted Proteins ContiglD2 Start End Strand
Chro.60289 rhoptry protein, possible AAEL01000012 38043 42497 + hypothetical predicted multi-pass transmembrane Chro.60291 protein, unknown function AAEL01000012 44687 44839 - conserverd hypothetical MSP-domain Chro.60303 transmembrane protein AAEL01000094 3154 3906 - hypothetical predicted multi-pass transmembrane Chro.60305 protein, unknown function AAEL01000037 16 969 - peptidyl-prolyl isomerase/macrophage infectivity Chro.60310 potentiator, possible AAEL01000037 12030 13007 - hypothetical predicted transmembrane protein, Chro.60314 unknown function AAEL01000037 18928 20190 - hypothetical predicted transmembrane protein, Chro.60315 unknown function AAEL01000037 20961 21734 + hypothetical predicted transmembrane protein, Chro.60337 unknown function AAEL01000041 360 1625 + Chro.60342 bax inhibitor-1 , possible AAEL01000041 14820 15560 hypothetical predicted multi-pass transmembrane Chro.60345 protein, unknown function AAEL01000041 18031 18918 + hypothetical predicted multi-pass transmembrane Chro.60348 protein, unknown function AAEL01000041 25294 26577 + Chro.60352 putative arabinogalactan protein, possible AAEL01000390 2912 5986 + hypothetical predicted transmembrane protein, Chro.60353 unknown function AAEL01000949 301 723
Chro.60354 hypothetical predicted protein, unknown function AAEL01000238 476 2275 hypothetical predicted transmembrane protein, Chro.60355 unknown function AAEL01000238 2850 4802
Chro.60357 hypothetical predicted protein, unknown function AAEL01000238 5474 9766 - Chro.60361 Transmembrane protein AAEL01000429 1263 1508 + Chro.60367 sel-1 protein, possible AAEL01000056 10831 13308 + hypothetical predicted multi-pass transmembrane Chro.60376 protein, unknown function AAEL01000518 3505 4372 +
Chro.60386 G-protein associated signal transduction protein A AAAEELL0011000000009922 2156 5266 + Chro.60410 endopeptidase, probable AAEL01000250 8723 9301 - conserved hypothetical multi-pass Chro.60413 transmembrane protein AAEL01000250 1895 2722 - hypothetical predicted transmembrane protein, Chro.60419 unknown function AAEL01000096 6914 8926 -
Chro.60420 hypothetical predicted protein, unknown function AAELO1000096 10083 11810 + Chro.60421 ankyrin-related protein, possible AAEL01000096 12038 19027 - Chro.60427 PAN domain protein AAEL01000113 9632 16387 + Chro.60432 predicted integral membrane protein, possible AAEL01000124 390 1475 + hypothetical predicted transmembrane protein, Chro.60433 unknown function AAEL01000124 1590 2219 + Chro.60435 hexokinase i, possible AAEL01000124 4916 6469 + Chro.60437 aspartyl protease precursor, probable AAEL01000124 7821 9221 - hypothetical predicted multi-pass transmembrane Chro.60443 protein, unknown function AAEL01000359 5233 6507 Chro.60444 putative mitochondrial carrier, possible AAELO1000359 3504 4460 - Chro.60448 hypothetical garp protein, possible AAEL01000237 7880 10249 + hypothetical predicted transmembrane protein, Chro.60460 unknown function AAEL01000221 2488 4425 Table 5: Surface and Secreted Proteins GenelD 1 Description: Surface and Secreted Proteins ContiglD 2 Start End Strand
Chro.60461 hypothetical predicted protein, unknown function AAEL01000221 1863 2345 +
Chro.60466 hypothetical predicted protein, unknown function AAEL01000169 9852 12149 + hypothetical predicted multi-pass transmembrane Chro.60467 protein, unknown function AAEL01000169 12683 13072
Chro.60485 hypothetical predicted protein, unknown function AAEL01000272 7425 8894 +
Chro.60490 hypothetical predicted protein, unknown function AAEL01000253 6440 7807 hypothetical predicted multi-pass transmembrane
Chro.60499 protein, unknown function AAEL01000296 3332 4039 +
Chro.60503 Transmembrane protein AAEL01000847 4 249 + hypothetical predicted transmembrane protein, Chro.60509 unknown function AAEL01000166 6384 7634 hypothetical predicted Armadillo/beta-catenin-like Chro.60511 repeat protein, unknown function AAEL01000166 332 5605 +
Chro.60513 hypothetical predicted protein, unknown function AAEL01000040 22758 24935 + hypothetical predicted multi-pass transmembrane Chro.60516 protein, unknown function AAEL01000040 15557 18436 + hypothetical predicted transmembrane protein, Chro.60519 unknown function AAEL01000040 7312 9711
DHHC zinc finger multi-pass transmembrane Chro.60520 protein AAEL01000040 6127 7098 + hypothetical predicted multi-pass transmembrane Chro.60527 protein, unknown function AAEL01000023 8575 9123 conserved hypothetical multi-pass
Chro.60537 transmembrane protein AAEL01000023 24446 26119 +
Chro.60539 ATP-binding cassette transporter AAEL01000023 28349 28552
Chro.60540 ATP-binding cassette protein 3 AAEL01000023 28738 32589 hypothetical predicted multi-pass transmembrane Chro.60544 protein, unknown function AAEL01000060 24949 25560 hypothetical predicted multi-pass transmembrane
Chro.60545 protein, unknown function AAEL01000060 23141 23974
Chro.60547 Signal peptide AAEL01000060 19552 19788 + hypothetical predicted multi-pass transmembrane Chro.60550 protein, unknown function AAEL01000060 13810 15030
Chro.60553 hypothetical predicted protein, unknown function AAEL01000060 6923 7249
Chro.60563 cryptopain precursor AAEL01000168 8888 10093
Chro.60564 putative transporter AAEL01000168 10427 11767 hypothetical predicted multi-pass transmembrane
Chro.60566 protein, unknown function AAEL01000445 678 2399 + hypothetical predicted multi-pass transmembrane
Chro.60568 protein, unknown function AAEL01000050 25466 26824
Chro.60585 putative ribophorin i, possible AAEL01000050 3679 5223 + hypothetical predicted multi-pass transmembrane
Chro.60588 protein, unknown function AAEL01000998 262 861
Chro.60593 lectin-domain protein AAEL01000495 217 1146 +
Chro.60596 hypothetical predicted protein, unknown function AAEL01000495 4336 4650 hypothetical predicted transmembrane protein, Chro.60597 unknown function AAEL01000444 641 2848 Table 5: Surface and Secreted Proteins GenelD 1 Description: Surface and Secreted Proteins ContiglD 2 Start End Strand
Chro.60598 conserved hypothetical transmembrane protein AAEL01000444 3705 5459 +
Chro.60605 ABC transporter-like protein, possible AAEL01000109 11485 13737 +
Chro.60606 hypothetical predicted protein, unknown function AAEL01000109 14157 14639 + hypothetical predicted signal-peptide protein,
Chro.60607 unknown function AAEL01000109 15040 18387 +
Chro.60610 hypothetical predicted protein, unknown function AAEL01000217 1 1068 - Chro.60611 hypothetical predicted protein, unknown function AAEL01000217 1311 1562 - Chro.60612 hypothetical predicted protein, unknown function AAEL01000217 2075 5983 -
Chro.60616 hypothetical predicted protein, unknown function AAELO1000383 5075 6772 Chro.60617 putative ABC transporter protein, possible AAEL01000383 2504 4603 +
Chro.60618 hypothetical predicted protein, unknown function AAELO1000383 162 1622 - Chro.60621 hypothetical predicted protein, unknown function AAEL01000244 7397 9025 + Chro.60622 hypothetical predicted protein, unknown function AAELO1000244 4857 7199 +
Chro.60623 hypothetical predicted protein, unknown function AAEL01000244 2434 4593 + hypothetical predicted transmembrane protein,
Chro.60625 unknown function AAELO1000176 2199 3689 + hypothetical predicted transmembrane protein,
Chro.60626 unknown function AAEL01000176 4348 8157 +
Chro.60627 putative ABC transporter protein, possible AAEL01000176 8851 10782 +
Chro.70010 Signal peptide AAEL01000470 1533 3845 +
Chro.70017 Transmembrane protein AAEL01000031 12879 13259 +
Chro.70019 Signal peptide AAEL01000031 15596 16828 +
Chro.70021 high affinity sulphate transporter -related AAEL01000031 18355 21093 -
Chro.70023 sortilin, putative AAEL01000031 23593 26613 +
Chro.70028 Transmembrane protein AAEL01000031 33352 33573 -
Chro.70030 Signal peptide AAEL01000410 3533 3973 -
Chro.70039 hypothetical protein, conserved AAEL01000011 7819 8421 -
Chro.70043 hypothetical protein AAEL01000011 18571 22926 +
Chro.70044 Transmembrane protein AAEL01000011 23051 24427 -
Chro.70046 Phg1B AAEL01000011 27290 29107 +
Chro.70049 heat shock protein 70 precursor AAEL01000011 34858 36225 +
Chro.70053 Signal peptide AAEL01000011 43335 44378 +
Chro.70059 cytidine diphosphate-diacylglycerol synthase AAELO1000927 113 847 +
Chro.70060 Transmembrane protein AAELO1000986 452 808 +
Chro.70061 P-type ATPase3 AAEL01000175 11251 14253
Chro.70066 Transmembrane protein AAEL01000175 4381 4731 -
Chro.70068 Signal anchor AAEL01000142 15908 16360 -
Chro.70069 hypothetical protein AAEL01000142 14441 15649 +
Chro.70082 probable syntaxin - Arabidopsis thaliana AAEL01000255 9423 10358 +
Chro.70085 hypothetical protein AAELO1000282 7638 8732 -
Chro.70091 Transmembrane protein AAELO1000473 2888 3781 -
Chro.70103 Transmembrane protein AAEL01000215 4752 5156 -
Chro.70104 patched family protein, putative AAEL01000215 2448 4511 -
Chro.70105 patched protein family AAEL01000215 783 1016 _
Chro.70106 patched family member (ptc-1) AAEL01000215 515 727 _ Table 5: Surface and Secreted Proteins
GenelD 1 Description: Surface and Secreted Proteins ContiglD2 Start End Strand
Chro.70108 Transmembrane protein AAEL01000172 223 1443 +
Chro.70112 Transmembrane protein AAEL01000172 8122 9630 -
Chro.70116 Signal anchor AAEL01000503 451 2187 +
Chro.70118 Pfsec61 AAEL01000459 2018 3439 +
Chro.70131 hypothetical protein AAEL01000976 6 356 -
Chro.70146 Signal peptide AAEL01000088 15582 16199 -
Chro.70147 Signal peptide AAELO1000088 16417 18216 -
Chro.70149 Signal anchor AAELO1000088 20104 21090 +
Chro.70152 Signal anchor AAEL01000024 3840 16340 -
Chro.70153 Signal peptide AAEL01000024 17336 17902 +
Chro.70155 Signal peptide AAELO1000024 18706 20466 +
Chro.70158 Transmembrane protein AAELO1000003 74710 75087 +
Chro.70159 casein kinase II, alpha subunit, putative AAEL01000003 73158 74720 + serine threonine protein kinase; possibly Chro.70160 sporulation specific AAEL01000003 70528 72978 + hypothetical predicted transmembrane protein, Chro.70161 unknown function AAELO1000003 66575 69823 + Chro.70162 Signal anchor AAEL01000003 63920 65128 - Chro.70163 Signal peptide AAEL01000003 59346 62384 - Chro.70164 Signal peptide AAELO1000003 58137 58715 + Chro.70165 SbmA protein AAELO1000003 57001 58017 +
Chro.70166 hypothetical protein EBAC750-10A10.25 AAEL01000003 55851 56852 - Chro.70167 Signal peptide AAEL01000003 53528 55720 + Chro.70170 Arabidopsis thaliana P42251 AAEL01000003 48127 49518 + Chro.70176 IFP53 AAELO1000003 39207 40988 Chro.70179 Transmembrane protein AAEL01000003 31217 31450 + Chro.70184 unknown protein AAEL01000003 21992 22771 - Chro.70194 Signal peptide AAEL01000003 948 1982 + Chro.70197 unnamed protein product AAEL01000163 8714 11986 - Chro.70203 a135 protein AAEL01000143 10042 14712 + adenosinetriphosphatase 2 - malaria parasite
(Plasmodium falciparum)πgi|1093478|prf||2104205A Chro.70206 ATPase:ISOTYPE=P AAELO1000143 3686 6829 + Chro.70210 oocyst wall protein 2 AAEL01000006 55215 58905 + Chro.70211 probable glycosyl transferase AAEL01000006 52903 54135 - similar to transport protein particle component
Bet3p-like protein; protein id: At5g54750.1, Chro.70212 supported by cDNA: 122866. AAELO1000006 52107 52727 + Chro.70213 expressed protein AAELO1000006 49676 51640 - Chro.70216 CG9308-PA AAEL01000006 42439 43050 + Chro.70220 Transmembrane protein AAEL01000006 32211 32543 - Chro.70226 Signal peptide AAEL01000006 23610 24878 + Chro.70232 Signal anchor AAELO1000006 12823 13374 + Chro.70238 Signal peptide AAELO1000006 4711 7863 - similar to Homo sapiens (Human). TGF-beta Chro.70241 resistance-associated protein TRAG (Fragment) AAEL01000006 320 1315 + Chro.70246 Transmembrane protein AAEL01000115 8978 9283 - Chro.70251 Signal peptide AAELO1000077 21669 22262 - Chro.70256 Signal peptide AAELO1000077 13919 15553 + Chro.70258 hypothetical protein AAEL01000077 11178 12182 Chro.70267 Signal anchor AAEL01000117 13764 17039 + Chro.70268 Transmembrane protein AAEL01000117 13123 13422 - Chro.70270 hypothetical protein AAEL01000117 10619 12016 _ Taβϊe'5: Surface and Secretedf Proteins
GenelD 1 Description: Surface and Secreted Proteins ContiglD 2 Start End Strand
Chro.70276 Signal peptide AAEL01000117 4074 5312 +
Chro.70280 Signal peptide AAEL01000208 80 616 +
Chro.70281 hypothetical protein AAEL01000208 1313 2011
Chro.70282 hypothetical protein AAEL01000208 2313 3452 +
Chro.70284 Transmembrane protein AAEL01000208 4619 5341 +
Chro.70287 hypothetical protein AAEL01000208 8308 9042
Chro.70288 Transmembrane protein AAEL01000208 10511 11128 +
Chro.70289 Transmembrane protein AAEL01000208 11413 12186
Chro.70295 Transmembrane protein AAEL01000069 3353 4978
Chro.70298 clpB protein AAELO 1000069 11631 15422
Chro.70305 Signal anchor AAEL01000392 2460 3299
Chro.70309 ABC transporter ATP-binding protein AAEL01000377 5325 7046 " -
Chro.70310 Transmembrane protein AAEL01000377 4198 4644
Esp1 promotes sister chromatid separation by mediating dissociation from the chromatin of the cohesin Scc1. The anaphase-promoting complex promotes anaphase by mediating destruction of
Pds1 which binds to Esp1 and inhibits its activity;
Chro.70313 Espi p AAEL01000372 1296 2972 +
Chro.70322 thiolproteinase SmTPI AAEL01000356 3213 5234 +
Chro.70339 Arabidopsis thaliana F6D8.20 AAEL01000154 2655 4049
Chro.70345 Signal peptide AAEL01000418 3037 3816 +
Chro.70347 Transmembrane protein AAEL01000919 81 1226
Chro.70350 S1/P1 nuclease, putative AAEL01000016 36574 37824
TPP_enzymes_N, Thiamine pyrophosphate
Chro.70351 enzyme, N-terminal TPP binding domain AAEL01000016 34668 36398 +
Similar to serologically defined breast cancer
Chro.70352 antigen 84 AAEL01000016 33263 34456 +
Chro.70354 Dkfzp434h2226-prov protein AAEL01000016 30252 32165 +
Chro.70355 hypothetical protein AAEL01000016 28670 29824 similar to Homo sapiens (Human). Hypothetical
Chro.70359 protein FLJ31812 AAEL01000016 22115 23095 +
Chro.70361 Transmembrane protein AAEL01000016 19747 20580 +
Chro.70363 Signal anchor AAEL01000016 17261 18052
Chro.70367 strong similarity to unknown protein-related AAEL01000016 9065 10930
Chro.70368 Transmembrane protein AAEL01000016 8117 8953
Chro.70372 Transmembrane protein AAEL01000016 2784 3329 +
Chro.70375 Signal peptide AAELO 1000047 797 1714 +
Chro.70376 Transmembrane protein AAEL01000047 2454 3080 +
COG1752: Predicted esterase of the alpha-beta
Chro.70377 hydrolase superfamily AAELO 1000047 3422 5806 +
Chro.70378 Signal peptide AAEL01000047 6951 7388
Chro.70380 Signal anchor AAELO 1000047 9745 9924 +
Chro.70383 Transmembrane protein AAEL01000047 12872 13153 +
Chro.70384 transporter, putative AAEL01000047 13242 15149
Chro.70396 Signal peptide AAEL01000017 4813 5409 +
Chro.70398 Signal peptide AAEL01000017 7417 7644 +
Chro.70410 heat shock protein 90 AAEL01000017 24517 26991 +
Chro.70424 Signal anchor AAELO 1000228 10 2202 +
Chro.70426 Signal peptide AAEL01000165 94 2781
Chro.70428 Signal peptide AAEL01000028 1466 3277 +
Chro.70429 Signal anchor AAEL01000028 3421 5673
Chro.70431 Signal peptide AAEL01000028 6860 10639
Chro.70432 putative AAEL01000028 10896 15893 +
Chro.70433 DNAJ-like Sec63 homoiogue AAEL01000028 16765 18648 Table'S: Siirfade arid Secreted Prøteins
GenelD 1 Description: Surface and Secreted Proteins ContiglD2 Start End Strand
Chro.70434 Signal peptide AAEL01000028 19000 20373 + Chro.70437 Transmembrane protein AAEL01000028 23100 24797 + mucin-like glycoprotein 900 - Cryptosporidium parvumDgi|4063042|gb|AAC98153.1| GP900; Chro.70447 mucin-like glycoprotein AAELO1000323 855 3050 + Chro.70449 Signal anchor AAEL01000004 60741 61061 + protein disulfide isomerase-related protein Chro.70453 (provisional) AAEL01000004 54714 56006 -
UDP-N-acetyl-D-galactosamine:polypeptide N- Chro.70457 acetylgalactosaminyltransferase T4 AAEL01000004 44914 46158 +
UDP-N-acetyl-D-galactosamine:polypeptide N- Chro.70461 acetylgalactosaminyltransferase T1 AAEL01000004 37577 38947 + Chro.70462 hypothetical protein AAEL01000004 36278 37384 + calcium-transporting ATPase 1 , endoplasmic Chro.70464 reticulum-type (calcium pump) AAEL01000004 31390 34779 + Chro.70468 prohibitin, putative AAEL01000004 24512 25069 + Chro.70470 Signal anchor AAEL01000004 19965 21950 + Chro.70472 Signal peptide AAEL01000004 14971 18303 + Chro.70473 hypothetical protein AAELO1000004 12567 14132 - Chro.70475 Signal peptide AAEL01000004 5811 10808 - Chro.70476 Signal anchor AAELO1000004 4213 5244 - Chro.70478 Signal anchor AAEL01000004 1767 1979 - Chro.70483 myosin B AAEL01000035 3741 7571 -
Chro.70489 Unknown (protein for MGC:63825) AAEL01000035 15422 17902 - Chro.70490 Signal peptide AAEL01000035 18484 18810 + Chro.70497 Signal peptide AAEL01000375 1206 3629 +
ATP-binding cassette, sub-family C (CFTR/MRP), member 2; Canalicular multispecific organic anion transporter; multidrug resistance Chro.70498 associated protein 2 AAEL01000375 3811 7140 -
SI:dZ52l16.4 (novel ABC transporter similar to Chro.70499 human multidrug-resistance proteins (MRP)) AAEL01000131 2675 6850 _ Chro.70500 Signal peptide AAEL01000131 7441 13116 + Chro.70503 Transmembrane protein AAEL01000131 15722 16852 - Chro.70513 Transmembrane protein AAEL01000192 6661 7146 - Chro.70514 Signal peptide AAEL01000192 8138 9541 + Chro.70518 Signal peptide AAEL01000192 10867 12027 Chro.70520 hypothetical protein AAELO1000048 25213 25863 - Chro.70533 hypothetical protein AN4477.2 AAELO1000048 8591 10396 + Chro.70535 Signal peptide AAEL01000048 4032 5216 + conserved hypothetical multi-pass Chro.70536 transmembrane protein AAEL01000048 579 3443 Chro.70538 Signal anchor AAEL01001034 343 714 - Chro.70544 Transmembrane protein AAEL01000861 759 1610 - Chro.70547 hypothetical protein AAEL01000405 2357 3292 + Chro.70548 hypothetical protein, conserved AAELO1000405 4084 5412 - Chro.70549 hypothetical protein MGC19780 AAEL01000159 14609 15145 - Chro.70555 Signal peptide AAEL01000159 4861 5073 + Chro.70567 Transmembrane protein AAELO1000227 300 1991 + similar to Plasmodium falciparum. Transporter, Chro.70568 putative AAEL01000285 6747 8474 + Table "5: Sϋrfa'de Md Secreted Proteins
GenelD 1 Description: Surface and Secreted Proteins ContiglD 2 Start End Strand
PROTEIN DISULFIDE ISOMERASE
PRECURSOR (PDI)Ggi|625437|pir||JC2291 protein disulfide-isomerase (EC 5.3.4.1) precursor - Humicola insolensDgi|712823|gb|AAC60578.11 protein Chro.70569 disulfide isomerase; PDI AAEL01000285 4842 6512 + Chro.70573 Transmembrane protein AAEL01000658 380 772 - Chro.70574 Signal peptide AAEL01000576 33 824 Chro.70575 oocyst wall protein 5 precursor AAEL01000576 1360 3246 + Chro.70593 Signal peptide AAEL01000189 10946 12940 - Chro.70600 Signal peptide AAEL01000051 9363 9893 Chro.70605 Transmembrane protein AAELO1000249 10080 10818 + Chro.70611 Signal peptide AAEL01000177 6313 10764 - Chro.70612 Transmembrane protein AAEL01000177 5118 5837 - Chro.80011 Signal peptide AAELO1000333 1131 3881 + Chro.80012 Signal peptide AAEL01000692 614 1630 - Chro.80013 Signal peptide AAELO1000034 1104 3758 - Chro.80014 Signal peptide AAELO1000034 4166 5671 - Chro.80015 Signal peptide AAELO1000034 6248 6796 - Chro.80016 acid phosphatase, putative AAEL01000034 7297 8571 - Chro.80017 putative transmembrane transporter AAEL01000034 9034 10446 + Chro.80020 Transmembrane protein AAELO1000034 17896 18303 + Chro.80034 Signal anchor AAELO1000066 7157 8164 - Chro.80037 Transmembrane protein AAEL01000066 1271 1492 + Chro.80040 hypothetical protein AAEL01000103 16350 17507 + Chro.80066 Signal peptide AAEL01000139 13651 14775 - Chro.80068 Signal anchor AAELO1000543 398 1096 +
TSP1 domain-containing protein TSP12 Chro.80069 precursor AAEL01000543 1110 3566
CDP-diacylglyceroI-inositol 3- phosphatidyltransferase isoform 1 ; phosphatidylinositol synthase; Ptdlns synthase; Chro.80072 Pl synthase AAEL01000104 7427 7891 +
Chro.80075 hydrolase, alpha/beta fold family, putative AAELO1000104 14432 15688 + Chro.80081 Signal peptide AAEL01000212 3696 6731 + Chro.80088 Signal peptide AAEL01000778 1115 1906 + Chro.80092 Transmembrane protein AAEL01000655 235 651 + Chro.80095 Signal anchor AAELO1000394 2376 3653 + Chro.80104 Transmembrane protein AAEL01000194 109 1449 + Chro.80115 Signal peptide AAEL01000234 8702 10741 -
Chro.80131 endoplasmic reticulum retention receptor AAEL01000513 3275 3934 + Chro.80136 Signal peptide AAELO1000509 724 2247 - Chro.80137 Signal anchor AAEL01000921 1 836 Chro.80141 ADP/ATP carrier AAEL01001051 48 914 - Chro.80143 Transmembrane protein AAEL01000815 286 1104 + Chro.80152 OSJNBa0038F22.20 AAEL01000043 2157 3503 + Chro.80157 Transmembrane protein AAELO1000426 876 1757 - similar to Homo sapiens (Human). GDP-fucose Chro.80162 transporter 1 AAEL01000252 9785 10697 + Chro.80164 Transmembrane protein AAEL01000399 3224 4135 + Chro.80165 hypothetical protein, conserved AAELO1000399 1613 2512 + similar to Homo sapiens (Human). GDP-fucose Chro.80171 transporter 1 AAELO1000382 1739 2992 Chro.80178 Signal peptide AAELO1000229 449 979 + Chro.80188 Hexosphosphate Transport AAEL01000378 2646 5021 Table'S: Surface and Secretea Prbteihs
GenelD 1 Description: Surface and Secreted Proteins ContiglD2 Start End Strand
Chro.80192 CG1418-PA AAEL01000140 6872 7552
Chro.80201 ubiquitin-activating enzyme AAEL01000026 26808 27743
Chro.80202 Signal peptide AAEL01000026 22122 26642 +
Chro.80203 Signal peptide AAELO1000026 20430 21431
Chro.80205 Signal peptide AAELO1000026 15479 19201
Chro.80206 YLP motif containing protein (XM130) AAEL01000026 11116 14304 -
Chro.80207 Signal peptide AAEL01000026 8414 10519 +
Chro.80209 Signal peptide AAEL01000026 3927 5024
Chro.80219 Signal anchor AAEL01000373 5583 6062 -
Chro.80221 Signal anchor AAEL01000373 5824 7246 +
Chro.80243 Transmembrane protein AAELO1000623 372 1673 +
Chro.80244 Transmembrane protein AAEL01000320 225 1124 +
Chro.80246 membrane atpase AAEL01000320 3950 8425 -
Chro.80249 Signal peptide AAEL01000079 18858 19103 -
Chro.80250 hypothetical protein AAEL01000079 17742 18419 +
Chro.80255 poly (ADP-ribose) glycohydrolase AAELO1000079 10835 12160 -
Drosophila melanogaster CG12263 gene product-
Chro.80266 related AAEL01000302 3514 6630 +
Chro.80268 Signal anchor AAEL01000922 129 992 -
Chro.80272 Signal peptide AAELO1000592 1700 2158 + transhydrogenase homolog 7B2 - Eimeria tenellaDgi|305062|gb|AAA29077.1|
Chro.80274 transhydrogenase AAEL01000204 5720 8599
Chro.80282 hypothetical protein, conserved AAEL01000059 17000 19447 +
Chro.80289 Signal anchor AAELO1000059 751 1494 +
Chro.80290 Signal peptide AAELO1000033 28 1767 -
Chro.80292 Signal peptide AAEL01000033 2425 4092 -
Chro.80293 Signal peptide AAEL01000033 4635 6185 -
Chro.80295 Sushi domain, putative AAEL01000033 11919 14837 +
Chro.80298 hypothetical protein AAELO1000033 16445 20404 +
Chro.80299 Signal anchor AAEL01000033 20676 20936 -
Chro.80300 hypothetical protein AAEL01000033 22038 23921 +
Chro.80304 Transmembrane protein AAEL01000033 26907 27737 -
Chro.80312 R-mandelonitrile lyase ((r)-oxynitrilase), putative AAEL01000121 14380 16494 +
Chro.80313 Signal peptide AAEL01000121 16724 17620 +
Chro.80324 Signal anchor AAEL01000153 8371 8763 -
Chro.80325 hypothetical protein AAEL01000153 8023 8331
Chro.80327 putative notch receptor protein AAEL01000030 5673 7397 -
Chro.80329 DNAJ AAEL01000030 9428 10075 + serologically defined breast cancer antigen 84 Chro.80337 like (42.9 kD) (XQ234) AAEL01000030 21638 22804 + Chro.80338 hypothetical protein AAEL01000030 22864 26973 - Chro.80343 Transmembrane protein AAEL01000030 33438 33722 - Chro.80344 Transmembrane protein AAEL01000817 1323 1766 + Chro.80350 hypothetical protein, conserved AAEL01000116 11792 13837 + Chro.80353 Signal peptide AAEL01000116 5427 6131 - Chro.80354 Signal anchor AAEL01000116 2235 4862 + Chro.80363 Signal peptide AAEL01000982 217 1188 + Chro.80366 hypothetical protein AN2155.2 AAELO1000278 2604 3671 - Chro.80371 endoplasmic reticulum oxidoreductin, putative AAELO1000278 8872 9712 + Chro.80388 oocyst wall protein 4 precursor AAEL01000005 31004 33667 + Chro.80399 hypothetical protein AAEL01000005 57183 58496 - Chro.80404 unknown AAEL01000161 7435 10815 + Chro.80406 Signal peptide AAEL01000161 1806 3476 + Table 5: Surface and Secreted Proteins
GenelD 1 Description: Surface and Secreted Proteins ContiglD 2 Start End Strand
Chro.80409 Signal peptide AAEL01000453 1690 3201
Chro.80410 Signal peptide AAELO 1000453 4295 4594 +
Chro.80413 Signal anchor AAEL01000122 15295 16440 +
Chro.80414 Signal peptide AAEL01000122 13517 15133 +
Chro.80417 Signal peptide AAEL01000122 8718 8987 +
Chro.80420 Transmembrane protein AAEL01000122 7482 8234
Chro.80421 Hypothetical protein CBG02358 AAEL01000122 2068 6465
Chro.80431 putative transmembrane transporter AAEL01000036 17449 18822
Chro.80433 Transmembrane protein AAELO 1000036 21667 24744
Chro.80435 Transmembrane protein AAEL01000036 30283 30726 +
Chro.80441 Signal peptide AAEL01000027 30058 30462
Chro.80443 Unknown (protein for MGC:63554) AAEL01000027 27991 29001
Chro.80445 hypothetical protein AAEL01000027 23993 25441 +
Chro.80446 Signal peptide AAEL01000027 21970 23811
Chro.80447 Signal anchor AAEL01000027 19723 21567
Chro.80449 expressed protein AAEL01000027 15252 17081
Chro.80450 Signal peptide AAELO 1000027 14376 15110 +
Chro.80451 hypothetical protein AAELO 1000027 12553 13989 +
Chro.80470 Signal anchor AAELO 1000677 1685 2521 +
Chro.80474 Signal peptide AAELO 1000085 13126 14499 +
Chro.80477 Transmembrane protein AAEL01000085 8812 9924 +
Structure-specific recognition protein 1 (SSRP1 ) (Recombination signal sequence recognition protein) (T160)Dgi|7446218|pir||S78050 high mobility group 1 protein homolog - chicken (fragment)Dgi|211520|gb|AAA48685.1| HMG box
Chro.80485 (bp. 1499..1757) AAEL01000230 8033 8725 -
Chro.80486 Signal peptide AAEL01000230 5139 7787 +
Chro.80489 Transmembrane protein AAEL01000611 847 1086 +
Chro.80493 hypothetical protein AAEL01000537 2913 3665
Chro.80503 Transmembrane protein AAEL01001287 47 547 _
Chro.80509 Signal anchor AAEL01000112 2681 4414
Chro.80510 Transmembrane protein AAEL01000112 5149 7092 -
Chro.80521 Transmembrane protein AAEL01000635 932 2068
Chro.80527 Transmembrane protein AAEL01000726 554 1981 -
Chro.80531 Transmembrane protein AAELO 1000233 13 243 +
Chro.80534 putative fatty-acyl elongase AAELO 1000233 10016 10987 +
Chro.80537 Signal peptide AAELO 1000565 2163 3356 -
Chro.80540 Signal anchor AAELO 1000636 1 1604 -
Chro.80543 OSJNBa0084K11.19 AAEL01000180 8706 10394 +
Chro.80550 Signal peptide AAELO 1000474 2516 2782 +
Chro.80551 V-ATPase subunit c" proteolipid AAEL01000474 3289 3834 -
Chro.80555 Signal peptide AAEL01000818 810 1848 +
Chro.80557 Signal anchor AAEL01001350 1 632 -
Chro.80558 hypothetical protein, conserved AAEL01000645 933 2474 -
Chro.80560 Transmembrane protein AAEL01000955 207 1325 +
Chro.80568 Signal peptide AAEL01000306 4744 5676 -
Chro.80573 Signal anchor AAEL01000790 1416 1670 -
Chro.80577 hypothetical protein AAEL01000313 3921 4394 +
Chro.80579 Signal peptide AAEL01000313 7141 7479 -
Chro.80580 Signal anchor AAEL01000313 7705 8625 +
Chro.80586 Transmembrane protein AAEL01000170 4021 4902 +
Chro.80594 Transmembrane protein AAEL01000330 1493 2410 +
Chro.80596 Signal peptide AAEL01000015 38866 39897 Table 5: Surface and Secreted Proteins
GenelD 1 Description: Surface and Secreted Proteins ContiglD 2 Start End Strand
Chro.80601 Transmembrane protein AAEL01000015 32063 33565
Chro.80603 U4/U6-associated RNA splicing factor-related AAEL01000015 23919 30431
Chro.80604 retinitis pigmentosa GTPase regulator-like protein AAEL01000015 21258 23705 mature-parasite-infected erythrocyte surface Chro.80605 antigen AAEL01000015 17727 20849 Chro.80609 KIAA0866 protein AAEL01000015 10540 13959 Chro.80610 Signal anchor AAEL01000015 7357 9888 Chro.80612 Signal anchor AAEL01000015 4743 5216 Chro.80613 Signal peptide AAEL01000015 2831 3649 Chro.80614 Signal peptide AAEL01000015 1579 2124 Chro.80617 Signal anchor AAEL01000242 2989 3225 Chro.00001 hypothetical protein Rv2262c 200 1612 Chro.00005 hypothetical protein 118 1275
1 GenelD: gene identification
2 ContiglD: contig identification
Table 6: Organellar Proteins
GenelD 1 Description: Organellar Proteins ContiglD 2 Start End Strand
Pyruvate:ferredoxin oxidoreductase/NADPH-
Chro.40087 cytochrome P450 reductase PNO AAEL01000575 2751 3557 _
Chro.80316 NADPH:ferredoxin-NADP+ reductase AAEL01000186 9233 10798 +
Chro.10029 Putative Fe-hydrogenase AAEL01000336 1973 3655 -
Chro.60135 IscU-like NifU protein, iron-sulfur protein AAEL01000025 21746 22198 +
Chro.80057 DNAJ-like protein AAEL01000280 1722 2600
Chro.80333 DNAJ protein AAEL01000030 17317 18297 -
Chro.50019 DnaJ domain protein AAEL01000042 14510 15040 +
Chro.40313 DNAJ domain protein AAEL01000078 17940 19022 -
Chro.50028 DNAJ protein AAEL01000042 984 2255 -
Chro.50078 DNAJ domain protein AAEL01000795 340 666 +
Chro.10330 DNAJ like chaperone AAELO 1000029 14292 15461 -
Chro.20144 DNAJ protein AAEL01000240 304 606
Chro.20145 DNAJ protein AAELO 1000024 35551 36102 _
Chro.30319 DNAJ domain containing protein AAEL01000590 1722 2456 +
Chro.30307 DNAJ domain AAEL01000197 1 1605
Chro.30124 DnaJ domain AAEL01000144 15070 15564 +
Chro.80434 DNAJ like chaperone AAELO 1000036 28510 29784 +
Chro.80564 DNAJ protein AAEL01000118 9997 11124 _
Chro.60141 DnaJ (hsp40) AAEL01000025 30362 31471
Chro.70433 DNAJ domain protein AAELO 1000028 16765 18648 _
Chro.10217 Predicted DNAJ protein AAEL01000191 11454 12449 +
Chro.80329 Membrane associated DNAJ AAELO 1000030 9428 10075 +
Chro.50410 Frataxin like protein AAELO 1000676 171 692 -
Chro.10157 ATM1-like AAEL01000270 1941 4253 +
Chro.20349 APG-1 like HSP70 domain containing protein AAEL01000038 20657 23437
Chro.60457 Glutaredoxin-like protein AAEL01000221 8566 9225 +
Chro.60524 Glutamate synthetase AAELO 1000023 3760 5205 +
Chro.70049 Heat shock protein, Hsp70 AAEL01000011 34858 36225 +
Chro.20010 Heat shock 70 (HSP70) protein AAEL01000158 12080 14113
Chro.30389 Heat shock protein HSP70, mitochondrial AAEL01000132 5696 7747 +
Chro.10287 Tom40p like translocase AAEL01000491 3595 4524
Mitochondrial import inner membrane translocase
Chro.20443 subunit tim17 AAEL01000055 16861 17352 +
Chro.30333 Probable cardiolipin AAEL01000150 13389 14786 +
Chro.30354 Alternative oxidase AAEL01000318 265 1272 +
Chro.70447 gp900 AAELO 1000323 855 3050 +
Chro.10388 TRAP-C1 AAELO 1000209 295 1659
Chro.70203 Cpa135 protein AAEL01000143 10042 14712 +
Chro.10390 MIC2 AAEL01000209 4021 6078
Chro.20173 microneme protein 5 AAEL01000071 20025 21869 _
Chro.70417 p36 AAEL01000846 633 1652 +
Chro.70445 rhoptry protein, putative AAEL01000323 7366 8478 -
Chro.40307 p235 rhoptry protein E5 AAEL01000078 10278 13238 +
Chro.60562 p235 rhoptry protein E5 AAEL01000168 6613 8304 -
Chro.40034 p235 rhoptry protein E5 AAEL01000271 829 5643 +
Chro.70139 p235 rhoptry protein E5 AAEL01001186 89 892 +
Chro.40063 p235 rhoptry protein E5 AAEL01000173 7319 11350 +
Chro.70446 p235 rhoptry protein E5 AAEL01000323 4439 7114 -
Chro.60227 p235 rhoptry protein E5 AAEL01000145 2400 5204 +
Chro.40092 p235 rhoptry protein E5 AAEL01000451 3973 4998
Chro.70306 p235 rhoptry protein E5 AAELO 1000392 474 2432 +
Chro.80179 p235 rhoptry protein E5 AAEL01000229 1518 5138 +
Chro.30436 p235 rhoptry protein E5 AAELO 1000322 3075 4520 +
Chro.40250 p235 rhoptry protein E5 AAEL01000337 2149 5859 Table 6: Organellar Proteins
GenelD 1 Description: Organellar Proteins ContiglD 2 Start End Strand
Chro.60181 p235 rhoptry protein E5 AAEL01000021 21793 23907
Chro.50326 p235 rhoptry protein E5 AAEL01000087 211 2175 +
Chro.70215 p235 rhoptry protein E5 AAEL01000006 43301 47251 +
Chro.20392 p235 rhoptry protein E5 AAEL01000106 12825 14900
Chro.30478 p235 rhoptry protein E5 AAEL01000610 1005 3080
Chro.20099 p235 rhoptry protein E5 AAEL01000525 98 1990
Chro.80351 p235 rhoptry protein E5 AAEL01000116 7400 11206
Chro.60492 p235 rhoptry protein E2 ' AAEL01000264 2624 4795
Chro.80179 p235 rhoptry protein E2 AAEL01000229 1518 5138 +
Chro.60181 p235 rhoptry protein E2 AAELO 1000021 21793 23907
Chro.60227 p235 rhoptry protein E2 AAEL01000145 2400 5204 +
Chro.10056 p235 rhoptry protein E2 AAEL01000100 17958 19724 +
Chro.40307 p235 rhoptry protein E2 AAEL01000078 10278 13238 +
Chro.40230 p235 rhoptry protein E2 AAEL01000039 893 3712 +
Chro.30377 p235 rhoptry protein E2 AAELO 1000020 4567 6699
Chro.70446 p235 rhoptry protein E2 AAEL01000323 4439 7114
Chro.40063 p235 rhoptry protein E2 AAELO 1000173 7319 11350 +
Chro.40034 p235 rhoptry protein E2 AAEL01000271 829 5643 +
Chro.20417 p235 rhoptry protein E2 AAEL01000906 124 1380
Chro.20291 p235 rhoptry protein E2 AAEL01000126 10258 14307
Chro.20239 p235 rhoptry protein E2 AAEL01000075 21629 22483
Chro.10270 p235 rhoptry protein E2 AAEL01000022 17969 19726 +
Chro.80540 p235 rhoptry protein E2 AAEL01000636 1 1604
Chro.60424 p235 rhoptry protein E2 AAEL01000113 2726 4459 +
Chro.70306 p235 rhoptry protein E2 AAEL01000392 474 2432 +
Chro.20379 p235 rhoptry protein E2 AAELO 1000423 1185 2510 +
Chro.80096 p235 rhoptry protein E2 AAEL01000351 6176 7762
Chro.40092 p235 rhoptry protein E2 AAEL01000451 3973 4998
Chro.70139 p235 rhoptry protein E2 AAEL01001186 89 892 +
Chro.60289 p235 rhoptry protein E2 AAEL01000012 38043 42497 +
Chro.40250 p235 rhoptry protein E2 AAEL01000337 2149 5859
Chro.80351 p235 rhoptry protein E2 AAEL01000116 7400 11206
Chro.20205 p235 rhoptry protein E2 AAEL01000073 17291 17998 +
Chro.80603 p235 rhoptry protein E2 AAEL01000015 23919 30431
Chro.70065 p235 rhoptry protein E2 AAEL01000175 4944 6710 +
Chro.70215 p235 rhoptry protein E2 AAEL01000006 43301 47251 +
Chro.30043 p235 rhoptry protein E2 AAEL01000279 11 1315 +
Chro.80359 p235 rhoptry protein E2 AAEL01000119 8345 10864
Chro.50233 p235 rhoptry protein E2 AAEL01000054 127 1131 +
Chro.30436 p235 rhoptry protein E2 AAELO 1000322 3075 4520 +
Chro.40332 p235 rhoptry protein E2 AAEL01000182 12685 13770
Chro.60070 p235 rhoptry protein E2 AAEL01000515 350 1924 +
Chro.60196 p235 rhoptry protein E2 AAEL01000133 9138 12779
Chro.80584 protein 2 precursor AAEL01000170 1427 2581 +
Chro.60327 ROPE AAEL01000193 242 2047 +
Chro.70304 Tgmui AAEL01000392 4233 5594 +
Chro.60563 cys proteinase AAEL01000168 8888 10093
Chro.20087 SNAP putative AAEL01000046 19349 20359
Chro.60069 SNARE AAEL01000671 547 1221
Chro.60374 Rab1 AAEL01000056 23126 23737
Chro.60374 Rab2 AAEL01000056 23126 23737
Chro.30357 Rab5 AAEL01000114 1136 1792
Chro.30357 Rabδb AAEL01000114 1136 1792
Chro.30357 Rab5c AAEL01000114 1136 1792
Chro.30357 Rab6 AAEL01000114 1136 1792 Table 6: Organellar Proteins
GenelD 1 Description: Organellar Proteins ContiglD 2 Start End Strand
Chro.60374 Rab6 AAELO 1000056 23126 23737
Chro.70198 Rab7 AAEL01000163 7533 7895
Chro.70485 Rab11 AAEL01000035 10202 10801
Chro.60374 Rab18 AAEL01000056 23126 23737
Chro.70049 GRP78 chaperone IgJ-ICBP AAEL01000011 34858 36225 +
Chro.80371 ER oxidoreductin AAEL01000278 8872 9712 +
Chro.20427 ER calcium binding AAEL01000397 1554 2903
Chro.80131 ERD2 AAEL01000513 3275 3934 +
Chro.30216 COPII subunit Sec23 AAEL01000086 3857 6130
Chro.70118 PfSec61 translocation AAEL01000459 2018 3439 +
Chro.60039 Beta-COP AAEL01001039 735 1007
Chro.70464 sarco/endoplasmic reticulum Ca2+ -ATPase AAEL01000004 31390 34779 +
Chro.40306 sarco/endoplasmic reticulum Ca2+ -ATPase AAEL01000078 5341 9927 +
Chro.80425 acetyl-CoA carboxylase 1 AAEL01000036 2208 10385 +
Chro.20139 adenylyl cyclase 1 AAELO 1000240 8833 11033 +
1 GenelD: gene identification
2 ContiglD: contig identification
Table 7: Signal Transduction ana Kinases
GenelD 1 Description: Signal Transduction and Kinase ContiglD2 Start End Strand
Chro.50460 Calmodulin-like protein AAEL01000759 636 1298 +
Chro.50340 Vacuolar H+ -ATPase subunit D AAEL01000585 2271 2909
Plasma membrane calcium-transporting ATPase 2 Chro.40306 (PMCA2) AAEL01000078 5341 9927 +
Plasma membrane calcium-transporting ATPase 2 Chro.70061 (PMCA2) AAEL01000175 11251 14253 -
Plasma membrane calcium-transporting ATPase 2 Chro.70206 (PMCA2) AAEL01000143 3686 6829 +
Plasma membrane calcium-transporting ATPase 2 Chro.70464 (PMCA2) AAEL01000004 31390 34779 +
Plasma membrane calcium-transporting ATPase 2 Chro.30311 (PMCA2) AAEL01000197 6823 10359 + Chro.60024 Na+/H+ exchanger AAEL01000052 8102 10717 + Chro.10296 Ca2+/H+ exchanger AAEL01000010 45515 46936 +
Sarcoplasmic-endoplasmic reticulum calcium Chro.70464 ATPase (SERCA) AAEL01000004 31390 34779 +
Sarcoplasmic-endoplasmic reticulum calcium Chro.40306 ATPase (SERCA) AAEL01000078 5341 9927 +
Rho-associated, coiled-coil containing protein Chro.60497 kinase p160ROCK [Homo sapiens] AAEL01000296 6201 9263 -
Rho-associated, coiled-coil containing protein Chro.80267 kinase p160ROCK [Homo sapiens] AAEL01000302 1 2680 Chro.10270 Rho-associated kinase. [Bos taurus] AAELO1000022 17969 19726 +
Serine/threonine protein kinase [Plasmodium Chro.50186 falciparum] AAEL01000013 2373 5756 +
Rho-associated, coiled-coil containing protein Chro.70215 kinase p160ROCK [Homo sapiens] AAELO1000006 43301 47251 +
Rho-associated, coiled-coil containing protein Chro.40307 kinase p160ROCK [Homo sapiens] AAELO1000078 10278 13238 +
Rho-associated, coiled-coil containing protein Chro.80609 kinase p160ROCK [Homo sapiens] AAEL01000015 10540 13959 - Chro.70446 Rho-associated kinase. [Bos taurus] AAEL01000323 4439 7114
Rho-associated, coiled-coil containing protein Chro.30436 kinase p160ROCK [Homo sapiens] AAEL01000322 3075 4520 +
Serine/threonine protein kinase [Plasmodium Chro.40145 falciparum] AAEL01000926 724 1412 + Chro.10136 protein kinase [Homo sapiens]. AAEL01000008 41695 42501 Chro.70585 putative protein [Arabidopsis thaliana]. AAEL01000178 842 2143 +
CDC42-binding protein kinase beta [Homo Chro.20099 sapiens]. AAELO1000525 98 1990 - similar to Pfam families PF00069 [Arabidopsis Chro.80063 thaliana]. AAEL01000139 9719 10162
Chro.70540 cyclin-dependent kinase 3 [Homo sapiens]. AAEL01001034 215 544 + Chro.20162 KIS [Rattus norvegicus]. AAEL01000065 2073 3389 Chro.50480 protein kinase [Homo sapiens]. AAELO1000400 1631 3043 Chro.80460 . AAEL01000199 9211 11205
Chro.70122 PKC-regulated kinase PKK [Mus musculus]. AAEL01000607 321 3340 + Chro.10302 PKC-regulated kinase PKK [Mus musculus]. AAEL01000010 37112 38623 + interferon-inducible RNA-dependent protein kinase Chro.61002 [Homo sapiens] AAEL01000920 3 1238 Chro.60474 Rho-associated kinase. [Bos taurus] AAELO1000082 9671 11761 +
Rho-associated, coiled-coil containing protein Chro.20077 kinase p160ROCK [Homo sapiens] AAELO1000243 7994 10903 Chro.50328 protein kinase [Homo sapiens]. AAELO1000369 2135 3442 + Chro.40034 ROK-alpha. [Rattus norvegicus] AAEL01000271 829 5643 + Table 7: Signal Transduction and Kinases
GenelD 1 Description: Signal Transduction and Kinase ContiglD2 Start End Strand calcium-dependent protein kinase [Solanum Chro.50460 tuberosum]. AAEL01000759 636 1298 +
Rho-associated, coiled-coil containing protein Chro.80179 kinase p160ROCK [Homo sapiens] AAEL01000229 1518 5138 + Chro.40063 Rho-associated kinase. [Bos taurus] AAEL01000173 7319 11350 + Chro.30249 myosin heavy chain FM3A [Morone saxatilis]. AAELO1000001 63525 69767 Chro.40272 protein kinase [Homo sapiens]. AAEL01000018 531 2330 + serine/threonine-protein kinase [Plasmodium Chro.60570 falciparum]. AAEL01000050 22435 23487 _
Chro.30141 guanylyl cyclase [Heterodera glycines]. AAELO1000277 2275 9726 - Chro.60526 PKC-regulated kinase PKK [Mus musculus]. AAEL01000023 6957 7931 - calcium-dependent protein kinase. [Arabidopsis Chro.80151 thaliana] AAELO1000043 3570 4067 Chro.80461 hypothetical protein [Homo sapiens]. AAEL01000199 7219 8805 + calcium-dependent protein kinase. [Arabidopsis Chro.30159 thaliana] AAELO1000067 9891 10481 + Chro.10100 serine/threonine kinase 33 [Homo sapiens]. AAEL01000298 7616 9231 + calcium-dependent protein kinase. [Arabidopsis Chro.50390 thaliana] AAELO1000354 3781 4317
Chro.20092 F1504.8 [Arabidopsis thaliana]. AAEL01000046 7455 7904 + Chro.70423 F22O13.20 [Arabidopsis thaliana]. AAELO1000228 2519 4969 + myosin light chain kinase.[Dictyostelium Chro.60393 discoideum] AAELO1000345 973 3420 -
PROBABLE SERINE/THREONINE-PROTEIN Chro.60070 KINASE [Plasmodium falciparum] AAEL01000515 350 1924 + Chro.60523 F22O13.20 [Arabidopsis thaliana]. AAELO1000023 798 3404 - Chro.80089 F22O13.20 [Arabidopsis thaliana]. AAEL01000408 1367 4333 - Chro.70483 class III myosin [Homo sapiens]. AAELO1000035 3741 7571 - Chro.40038 protein kinase 3 [Toxoplasma gondii]. AAEL01000663 1 1029 - Chro.703242MDa_2 protein [Caenorhabditis elegans] AAEL01000129 14319 16718 -
6-phosphofructokinase, putative [Plasmodium Chro.20231 falciparum (isolate 3D7)] AAEL01000258 5515 9795 -
6-phosphofructokinase, putative [Plasmodium Chro.30172 falciparum (isolate 3D7)] AAEL01000044 9168 13154 +
Activated protein kinase C receptor [Plasmodium Chro.20203 falciparum] AAELO1000073 14254 15195 Chro.50037 Adenylate kinase B [Oryza sativa] AAEL01000328 1713 2375 +
AMPKBI (δ'-AMP-activated protein kinase, beta subunit, complex-interacting region) domain family Chro.60240 [Arabidopsis thaliana] AAELO1000072 10360 11241 + Chro.20250 At1g10760/F20B24.26 [Arabidopsis thaliana] AAEL01000075 88 453 + Chro.70160 BnMAP4K alpha2 [Brassica napus] AAELO1000003 70528 72978 +
Ca2+/calmodulin-dependent kinase kinase [Homo Chro.80194 sapiens] AAEL01000140 4321 5535 -
Calcium/calmodulin-dependent protein kinase I Chro.70435 gamma [Mus musculus] AAELO1000028 20415 21488 -
Calcium-dependent protein kinase [Plasmodium Chro.40377 falciparum (isolate 3D7)] AAEL01000002 10284 12152 +
Calcium-dependent protein kinase [Plasmodium Chro.70214 falciparum (isolate 3D7)] AAEL01000006 47394 49421 -
Calcium-dependent protein kinase-3 (Calcium- dependent protein kinase, putative) [Plasmodium Chro.30039 falciparum (isolate 3D7)] AAEL01000236 903 4445 + Table 7: Signal Transduction and Kinases
GenelD 1 Description: Signal Transduction and Kinase ContiglD2 Start End £ Hra
Calcium-dependent protein kinase-3 (Calcium- dependent protein kinase, putative) [Plasmodium Chro.70016 falciparum (isolate 3D7)] AAEL01000031 9974 12415 Chro.20184 Calmodulin 2 [Homo sapiens] AAELO1000071 3671 4174 _
Calmodulin-domain protein kinase 1 [Toxoplasma Chro.20118 gondii] AAEL01000009 12665 14821 +
Calmodulin-domain protein kinase 1 [Toxoplasma Chro.20142 gondii] AAEL01000240 2761 4794 +
Calmodulin-domain protein kinase, putative Chro.30121 [Plasmodium falciparum (isolate 3D7)] AAEL01000144 11972 13588 +
Calmodulin-domain protein kinase, putative Chro.50305 [Plasmodium falciparum (isolate 3D7)] AAEL01000123 9847 11394 - cAMP-dependent protein kinase A, regulatory Chro.70024 subunit [Rhizomucor racemosus] AAEL01000031 27023 27847 - cAMP-dependent protein kinase, alpha-catalytic Chro.30344 subunit [Mus musculus] AAELO1000245 4472 5650 Chro.30013 Casein kinase I1 alpha isoform [Homo sapiens] AAEL01000396 4363 5844 Chro.30215 Casein kinase I, delta isoform [Homo sapiens] AAELO1000086 7058 8353 Chro.30219 Casein kinase Il beta chain [Brachydanio rerio] AAEL01000001 6231 7247
Casein kinase II, alpha chain (CK II) [Theileria Chro.70159 parva] AAEL01000003 73158 74720 +
Chro.60083 Casein kinase II, alpha chain (CK II) [Zea mays] AAEL01001014 415 1083 Chro.50127 Cdc2-related kinase 2 [Plasmodium knowlesi] AAEL01000070 12578 13462 +
CDK-activating kinase assembly factor, putative Chro.10372 [Plasmodium falciparum (isolate 3D7)] AAEL01000514 358 1248 +
Chro.10015 Cell division protein kinase 2 [Rattus norvegicus] AAELO1000099 5065 5964 Chro.70041 Cell division protein kinase 2 [Xenopus laevis] AAEL01000011 13453 14631 Chro.30182 Cell division protein kinase 3 [Homo sapiens] AAELO1000044 25911 26906 Chro.70056 Cell division protein kinase 7 [Homo sapiens] AAEL01000344 6586 7548 Chro.80333 CG1107 protein [Drosophila melanogaster] AAEL01000030 17317 18297 Chro.60331 CG18255-PA [Drosophila melanogaster] AAEL01000193 6446 8539 Chro.80415 CG18255-PA [Drosophila melanogaster] AAEL01000122 11772 12506
Chro.80094 cGMP-dependent protein kinase [Eimeria tenella] AAEL01000394 3857 6535 - Chro.30240 Choline kinase alpha [Mus musculus] AAEL01000001 43038 44240 + + + +1 I I 11 I I
Cyclic GMP-binding protein C [Dictyostelium Chro.30329 discoideum] AAEL01000150 8137 10035 +
Dephospho-CoA kinase [Synechocystis sp. (strain Chro.20045 PCC 6803)] AAEL01000097 12649 13005 +
Diacylglycerol kinase, putative [Plasmodium Chro.80280 falciparum (isolate 3D7)] AAEL01000059 20771 22621 Chro.20170 Dolichol kinase [Saccharomyces cerevisiae] AAEL01000268 317 1081 +
Dual specificity mitogen-activated protein kinase Chro.80584 kinase dSOR1 [Drosophila melanogaster] AAEL01000170 1427 2581 +
Chro.40423 Dual specificity protein kinase TTK [Homo sapiens] AAEL01000206 6993 10229 Chro.50319 Ethanolamine kinase [Drosophila melanogaster] AAELO1000087 15287 16621 +
Exported serine/threonine protein kinase Chro.60228 [Plasmodium falciparum (isolate 3D7)] AAEL01000145 349 2163 -
Extracellular signal-regulated kinase 1 Chro.20465 [Dictyostelium discoideum] AAEL01000190 5314 7014 Chro.30277 F12A21.14 [Arabidopsis thaliana] AAEL01000171 8140 8454 + Chro.20251 F20B24.19 [Arabidopsis thaliana] AAEL01000625 193 3147 + Table 7: Signal Transduction arid Kinases
GenelD 1 Description: Signal Transduction and Kinase ContiglD2 Start End Strand
Glucokinase-associated dual specificity Chro.20172 phosphatase [Rattus norvegicus] AAEL01000071 22218 22583 + Chro.60435 Hexokinase [Toxoplasma gondii] AAELO1000124 4916 6469 + Chro.20322 High mobility group protein 1 [Mus musculus] AAEL01000101 5758 6306 -
Hypothetical 46.9 kDa protein in SLT2-PUT2 Chro.20246 intergenic region [Saccharomyces cerevisiae] AAEL01000075 8284 9600 _ Chro.10319 Hypothetical protein [Arabidopsis thaliana] AAEL01000010 1627 5094 + Chro.40084 Hypothetical protein [Dictyostelium discoideum] AAEL01000083 8726 9268 - Chro.70052 Hypothetical protein [Leishmania major] AAEL01000011 41333 42490 Chro.30373 Hypothetical protein [Oryctolagus sp] AAEL01000020 630 1169 +
Hypothetical protein [Plasmodium falciparum Chro.50054 (isolate 3D7)] AAEL01000266 6966 8300 -
Hypothetical protein [Plasmodium falciparum Chro.70151 (isolate 3D7)j AAEL01000024 335 3460 +
Hypothetical protein [Plasmodium falciparum Chro.80144 (isolate 3D7)] AAEL01001119 316 945 Chro.20198 Hypothetical protein [Xenopus laevis] AAELO1000073 6079 7008 +
Hypothetical protein OSJNBa0094J08.29 [Oryza Chro.20247 sativa (japonica cultivar-group)] AAEL01000075 6395 8026 -
Interferon-induced, double-stranded RNA-activated Chro.10109 protein kinase [Homo sapiens] AAEL01000084 6992 10981 -
Mannose-1 -phosphate guanyltransferase Chro.20192 [Trichoderma reesei] AAEL01000224 9088 10365 +
MAP kinase phosphatase [Lycopersicon Chro.10095 esculentum] AAELO1000290 1528 3735 +
Mitogen-activated protein kinase homolog D5 Chro.30343 [Pisum sativum] AAELO1000245 6224 7924 +
Mitotic checkpoint serine/threonine-protein kinase Chro.70230 BUB1 [Homo sapiens] AAELO1000006 15809 18361 Chro.60086 Not found Q852Q0 AAEL01000581 54 2261 + Chro.70422 Not found Q86JB9 AAELO1000228 5265 7055 Chro.50115 Not found Q9PWA7 AAEL01000032 8305 9399 + Chro.80285 N-terminal kinase-like [Mus musculus] AAEL01000059 9459 12203 +
Nucleoside diphosphate kinase [Archaeoglobus Chro.50237 fulgidus] AAELO1000054 14460 15125 +
Nucleoside diphosphate kinase B [Rattus Chro.40219 norvegicus] AAELO1000039 18990 19442
Chro.70346 OJ990528_30.6 protein [Oryza sativa] AAEL01000418 3902 5869 - Chro.40119 OSJNBa0006B20.14 protein [Oryza sativa] AAEL01000633 28 1041 + Chro.80038 Pantothenate kinase 4 [Rattus norvegicus] AAEL01000066 28 1179 - Chro.60213 Phosphatidylinositol 3-kinase [Homo sapiens] AAEL01000098 12654 15485 - Chro.60392 Phosphatidylinositol 4-kinase [Oryza sativa] AAEL01000345 3835 7374 -
Phosphatidylinositol 4-kinase, putative Chro.80518 [Plasmodium falciparum (isolate 3D7)] AAEL01000303 239 1657 +
Chro.50389 Phosphoenolpyruvate carboxylase [Glycine max] AAEL01000354 104 3550 Chro.70113 Phosphoglycerate kinase 1 [Homo sapiens] AAEL01000172 10049 11230
Predicted unusual protein kinase Chro.50138 [Thermoanaerobacter tengcongensis] AAEL01000275 7603 8571
Probable pantothenate kinase 1 [Arabidopsis Chro.70552 thaliana] AAEL01000159 11395 12486
Probable serine/threonine-protein kinase Chro.50152 YKL101 W [Saccharomyces cerevisiae] AAEL01000539 2869 3852
Probable serine/threonine-protein kinase Chro.10297 YOL100W [Saccharomyces cerevisiae AAEL01000010 43578 44315 Table 7: Signal Transduction and Kinases
GenelD 1 Description: Signal Transduction and Kinase ContiglD 2 Start End Strand
Chro.80284 Protein kinase [Arabidopsis thaliana] AAEL01000059 12292 14268
Protein kinase domain, putative [Plasmodium yoelii
Chro.50422 yoelii] AAEL01000570 410 3271 +
Chro.10051 Protein kinase ELM1 [Saccharomyces cerevisiae] AAEL01000257 5656 7851
Protein kinase, putative [Plasmodium falciparum Chro.20204 (isolate 3D7)] AAEL01000073 15885 16232 +
Protein kinase, putative [Plasmodium falciparum Chro.70074 (isolate 3D7)] AAEL01000142 4721 5407 +
Protein phosphatase 2c-like protein, putative Chro.50429 [Plasmodium falciparum (isolate 3D7)] AAEL01000325 18 1229 +
Putative amino acid starvation response, yeast gen protein kinase activator homolog, non-transporter Chro.60605 (ABC) superfamily [Schizosaccharomyces pombe] AAEL01000109 11485 13737 +
Putative cell division protein kinase 9 homolog Chro.60177 [Caenorhabditis elegans] AAEL01000021 28392 30386
Putative inorganic polyphosphate/ATP-NAD kinase Chro.80231 [Homo sapiens] AAEL01000108 1767 3479 +
Putative phosphatidylinositol kinase, similarity to Chro.60211 yeast tra1 [Schizosaccharomyces pombe] AAEL01000225 175 5202 +
Putative phosphatidylinositol-4-phosphate 5-kinase Chro.20207 [Bacteroides thetaiotaomicron] AAEL01000073 19366 20967 +
Putative phosphatidylinositol-4-phosphate 5-kinase Chro.50219 [Bacteroides thetaiotaomicron] AAEL01000179 10721 11650 +
Putative phosphatidylinositol-4-phosphate 5- kinase, 11335-7537, possible [Cryptosporidium Chro.60298 parvum] AAEL01000094 14375 15472 +
Putative poly(A) ribonuclease component Chro.20350 [Schizosaccharomyces pombe] AAEL01000038 24255 26546 +
Putative RIO kinase 1 isoform 1 [Oryza sativa Chro.50179 (japonica cultivar-group)] AAEL01000019 11125 13131
Putative serine/threonine-protein kinase C05D10.2 Chro.20213 in chromosome III [Caenorhabditis elegans] AAEL01000364 2136 4268 +
Putative serine/threonine-protein kinase Ctrl [Oryza Chro.70382 sativa (japonica cultivar-group)] AAEL01000047 10146 12059
Pyrroline-5-carboxylate reductase [Bacillus cereus Chro.60426 (strain ATCC 14579 / DSM 31)] AAEL01000113 8094 8564
Pyrroline-5-carboxylate synthetase 1 [Medicago
Chro.70551 truncatula] AAEL01000159 12723 14054
Chro.10234 Pyruvate kinase [Arabidopsis thaliana] AAEL01000218 8703 10283 +
Related to serine/threonine-protein kinase Chro.20175 [Neurospora crassa] AAEL01000071 15443 16993 +
Sensory transduction histidine kinase Chro.00003 [Methanosarcina acetivorans] AAEL01000717 673 2319
Ser/Thr protein kinase [Plasmodium falciparum Chro.10168 (isolate 3D7)] AAEL01000061 8676 11828 +
Ser/Thr protein kinase [Plasmodium falciparum Chro.30110 (isolate 3D7)] AAEL01000339 3316 6267 +
Ser/Thr protein kinase [Plasmodium falciparum Chro.40102 (isolate 3D7)] AAEL01000437 4209 5186 +
Serine protein kinase-like protein [Arabidopsis Chro.10329 thaliana] AAEL01000029 16075 18330 + Table 7: Signal Transduction and Kinases
GenelD 1 Description: Signal Transduction and Kinase ContiglD 2 Start End Strand
Serine/threonine kinase-1 [Plasmodium falciparum Chro.50371 (isolate 3D7)] AAEL01000628 239 2182 +
Serine/threonine-protein kinase 22C [Mus Chro.70144 musculus] AAEL01000088 8887 11490 +
Chro.60603 Serine/threonine-protein kinase 6 [Homo sapiens] AAEL01000109 1670 3715 +
Serine/threonine-protein kinase ark1 Chro.20335 [Schizosaccharomyces pombe] AAEL01000093 12355 13413 +
Serine/threonine-protein kinase CBK1 Chro.10143 [Saccharomyces cerevisiae] AAEL01000008 29162 31438
Serine/threonine-protein kinase cds1 Chro.60584 [Schizosaccharomyces pombe] AAEL01000050 5768 7777 +
Serine/threonine-protein kinase Chk2 [Mus Chro.20102 musculus] AAEL01000009 46558 47688
Serine/threonine-protein kinase KKIALRE [Homo Chro.80358 sapiens] AAEL01000119 11152 12687
Serine/threonine-protein kinase Nek1 [Homo Chro.70419 sapiens] AAEL01000228 9210 9581
Serine/threonine-protein kinase Nek1 [Homo Chro.70565 sapiens] AAEL01000227 4407 8594
Serine/threonine-protein kinase Nek1 [Mus Chro.80257 musculus] AAEL01000079 7139 8740
Serine/threonine-protein kinase Nek2 [Homo Chro.10172 sapiens] AAEL01000061 15290 16957
Serine/threonine-protein kinase prp4 Chro.80590 [Schizosaccharomyces pombe] AAEL01000170 11125 12489 +
Similar to Dictyostelium discoideum (Slime mold). phosphatidylinositol 3-kinase 3 [Dictyostelium Chro.80217 discoideum] AAEL01000373 1404 2795 +
Similar to dual-specificity tyrosine-phosphorylation
Chro.70343 regulated kinase 4 [Mus musculus] AAEL01000154 13169 15124 +
Chro.30486 Similar to mRNA [Mus musculus] AAEL01000200 3154 5436
Similar to Plasmodium falciparum, protein kinase,
Chro.80125 putative [Dictyostelium discoideum] AAEL01000210 3266 5320
Similarity to myosin heavy chain kinase
Chro.30031 [Arabidopsis thaliana] AAEL01000519 962 2170
Chro.80351 SMC-like protein [Arabidopsis thaliana] AAEL01000116 7400 11206
Chro.50398 Thymidine kinase [Escherichia coli] AAEL01000361 1946 2533 +
Chro.50490 Thymidylate kinase [Homo sapiens] AAEL01000482 2551 3048 +
Transcription initiation factor TFIID subunit 1
Chro.40082 [Homo sapiens] AAEL01000083 2374 8274 +
Chro.10216 Uridine kinase-like protein [Arabidopsis thaliana] AAEL01000191 10573 11286 +
Chro.80328 Uridine kinase-like protein [Arabidopsis thaliana] AAEL01000030 7647 9020 Chro.60514 X-kinase [Homo sapiens] AAEL01000040 20111 21601
Chro.40275 XRP2 protein [Homo sapiens] AAEL01000533 2052 2561
1 GenelD: gene identification
2 ContiglD: contig identification Table 8: Critical Metabolic Enzymes
GenelD 1 Description: Critical Metabolic Enzymes ContiglD2 Start End Strand
Chro.10062 H(+)-transporting two-sector ATPase. 3.6.3.14 AAEL01000100 5460 5957 + Chro.10063 H(+)-transporting two-sector ATPase. 3.6.3.14 AAEL01000100 3644 4141 + Chro.10095 Protein-tyrosine-phosphatase. 3.1.3.48 AAEL01000290 1528 3735 +
NAD(P)(+) transhydrogenase (AB-specific). Chro.10120 1.6.1.2 AAELO1000274 7200 9845 -
CDP-diacylglycerol-serine O- Chro.10133 phosphatidyltransferase. 2.7.8.8 AAELO1000008 46405 47769 Chro.10196 Phosphoglycerate mutase. 5.4.2.1 AAELO1000338 4284 5096 - Chro.10216 Uracil phosphoribosyltransferase. 2.4.2.9 AAEL01000191 10573 11286 + Chro.10216 Uridine kinase. 2.7.1.48 AAEL01000191 10573 11286 + Chro.10225 DNA-directed RNA polymerase. 2.7.7.6 AAEL01000147 5527 6129 -
Farnesyl-diphosphate famesyltransferase. Chro.10227 2.5.1.21 AAEL01000147 7899 9392 + Chro.10234 Pyruvate kinase. 2.7.1.40 AAEL01000218 8703 10283 + Chro.10244 Glutamate-tRNA ligase. 6.1.1.17 AAEL01000367 2627 4549 + Chro.10244 Glutamine-tRNA ligase. 6.1.1.18 AAELO1000367 2627 4549 + Chro.10257 DNA-directed RNA polymerase. 2.7.7.6 AAEL01000220 4386 4820 - Chro.10306 DNA-directed RNA polymerase. 2.7.7.6 AAEL01000010 32700 33767 Chro.10312 DNA-directed RNA polymerase. 2.7.7.6 AAEL01000010 16656 20501 + Chro.10335 Fructose-bisphosphate aldolase. 4.1.2.13 AAEL01000029 8244 9320 -
Glyceraldehyde 3-phosphate dehydrogenase Chro.10337 (phosphorylating). 1.2.1.12 AAEL01000029 2935 3687 + Chro.10337 Triosephosphate isomerase. 5.3.1.1 AAELO1000029 2935 3687 + Chro.10371 Lysophospholipase. 3.1.1.5 AAEL01000514 2738 3319 + Chro.10418 Acetate-CoA ligase. 6.2.1.1 AAEL01000346 468 2555 +
Glutamine-fructose-6-phosphate transaminase Chro.10420 (isomerizing). 2.6.1.16 AAEL01000111 14520 16313 + Chro.10422 Lysophospholipase. 3.1.1.5 AAEL01000111 8614 9348 +
Chro.10434 Nucleoside-triphosphate diphosphatase. 3.6.1.19 AAEL01000340 5921 6481 Chro.11000 Triacylglycerol lipase. 3.1.1.3 AAEL01000489 1888 2358 +
Glycerol-3-phosphate dehydrogenase (NAD+). Chro.20028 1.1.1.8 AAEL01000202 3123 4373
Chro.20030 Phosphoinositide 5-phosphatase. 3.1.3.36 AAEL01000202 7083 11870 + Chro.20045 Dephospho-CoA kinase. 2.7.1.24 AAEL01000097 12649 13005 + Chro.20045 Uridine kinase. 2.7.1.48 AAELO1000097 12649 13005 + Chro.20071 Acid phosphatase. 3.1.3.2 AAEL01000203 858 1778 + Chro.20109 DNA-directed RNA polymerase. 2.7.7.6 AAELO1000009 28511 29128 - Chro.20121 Diacyiglycerol O-acyltransferase. 2.3.1.20 AAEL01000009 7660 9177 + Chro.20148 H(+)-transporting two-sector ATPase. 3.6.3.14 AAELO1000024 29834 30859 Chro.20148 Proton-exporting ATPase. 3.6.3.6 AAEL01000024 29834 30859 - Chro.20149 H(+)-transporting two-sector ATPase. 3.6.3.14 AAELO1000024 29093 29500 Chro.20149 Proton-exporting ATPase. 3.6.3.6 AAEL01000024 29093 29500 - Chro.20165 L-fucose isomerase. 5.3.1.25 AAEL01000268 6561 8978 - Chro.20165 Pseudouridylate synthase. 4.2.1.70 AAEL01000268 6561 8978 - Chro.20166 Ribulose-bisphosphate carboxylase. 4.1.1.39 AAELO1000268 4747 6525 + Chro.20170 Dolichol kinase. 2.7.1.108 AAEL01000268 ' 317 1081 + Chro.20170 Phosphatidate cytidylyltransferase. 2.7.7.41 AAELO1000268 317 1081 + Chro.20172 Protein-tyrosine-phosphatase. 3.1.3.48 AAEL01000071 22218 22583 +
Dolichyl-diphosphooligosaccharide-protein Chro.20179 glycosyltransferase. 2.4.1.119 AAEL01000071 8135 9541 +
Mannose-1 -phosphate guanylyltransferase. Chro.20192 2.7.7.13 AAELO 1000224 9088 10365 Chro.20201 Phospholipase C. 3.1.4.3 AAEL01000073 9038 10018 Chro.20206 dTDP-glucose 4,6-dehydratase. 4.2.1. AAEL01000073 18006 19013 Table 8: Critical Metabolic Enzymes
GenelD 1 Description: Critical Metabolic Enzymes ContiglD2 Start End Strand
1 -phosphatidylinositol-4-phosphate 5-kinase. Chro.20207 2.7.1.68 AAEL01000073 19366 20967 + Chro.20231 6-phosphofructokinase. 2.7 '.1.11 AAEL01000258 5515 9795 -
Diphosphate--fructose-6-phosphate 1 - Chro.20231 phosphotransferase. 2.7.1.90 AAELO1000258 5515 9795 _ Chro.20246 Glutamate 5-kinase. 2.7.2.11 AAEL01000075 8284 9600 Chro.20259 Pseudouridylate synthase. 4.2.1.70 AAEL01000311 2559 4004 + Chro.20265 DNA-directed DNA polymerase. 2.7.7.7 AAEL01000321 1772 3055 - Chro.20294 Deoxycytidine deaminase. 3.5.4.14 AAEL01000138 6500 7621 + Chro.20294 dCMP deaminase. 3.5.4.12 AAEL01000138 6500 7621 +
3-demethylubiquinone-9 3-O-methyltransferase. Chro.20298 2.1.1.64 AAEL01000138 11706 12626 -
Chro.20303 Biotin-[acetyl-CoA-carboxylase] ligase. 6.3.4.15 AAEL01000102 15251 16147 Chro.20310 Phospholipase C. 3.1.4.3 AAEL01000136 4245 5822 + Chro.20322 Adenosine kinase. 2.7.1.20 AAEL01000101 5758 6306 - Chro.20333 DNA-directed DNA polymerase. 2.7.7.7 AAEL01000093 14320 14925 + Chro.20334 DNA-directed DNA polymerase. 2.7.7.7 AAEL01000093 13974 14261 + Chro.20336 Glucose-6-phosphate isomerase. 5.3.1.9 AAEL01000093 9740 11443 - Chro.20343 Phosphoglucomutase. 5.4.2.2 AAEL01000038 3580 5286 + Chro.20424 H(+)-transporting two-sector ATPase. 3.6.3.14 AAEL01000574 1214 2695 - Chro.20424 Proton-exporting ATPase. 3.6.3.6 AAEL01000574 1214 2695 - Chro.20448 DNA-directed DNA polymerase. 2.7.7.7 AAEL01000055 6231 9692 + Chro.20464 Thioredoxin-disulfide reductase. 1.8.1.9 AAEL01000190 8361 9926 + Chro.21000 Amine oxidase (flavin-containing). 1.4.3.4 AAEL01000334 3 509 - Chro.21000 Mandelonitrile lyase. 4.1.2.10 AAEL01000334 3 509 Chro.30017 Adenosylhomocysteinase. 3.3.1.1 AAELO1000207 5266 6747 +
Asparagine synthase (glutamine-hydrolyzing). Chro.30020 6.3.5.4 AAEL01000465 3710 5065 Chro.30048 3-hydroxyacyl-CoA dehydrogenase. 1.1.1.35 AAELO1000063 11969 12823 +
3-oxoacyl-[acyl-carrier protein] reductase. Chro.30048 1.1.1.100 AAEL01000063 11969 12823 +
Chro.30063 Cinnamyl-alcohol dehydrogenase. 1.1.1.195 AAEL01000014 31058 31660 + Chro.30063 Glutathione peroxidase. 1.11.1.9 AAEL01000014 31058 31660 + Chro.30063 Peroxidase. 1.11.1.7 AAEL01000014 31058 31660 + Chro.30084 Long-chain-fatty-acid-CoA ligase. 6.2.1.3 AAELO1000523 1803 3860 - Chro.30116 Thymidylate synthase. 2.1.1.45 AAEL01000144 5288 5626 + Chro.30141 Guanylate cyclase. 4.6.1.2 AAEL01000277 2275 9726 - Chro.30172 6-phosphofructokinase. 2.7.1.11 AAELO1000044 9168 13154 +
Diphosphate-fructose-6-phosphate 1 - Chro.30172 phosphotransferase. 2.7.1.90 AAEL01000044 9168 13154 + Chro.30190 Alpha-glucosidase. 3.2.1.20 AAELO1000764 99 2012 Chro.30221 DNA-directed RNA polymerase. 2.7.7.6 AAEL01000001 9293 9796 - Chro.30223 Protein-tyrosine-phosphatase. 3.1.3.48 AAEL01000001 13920 16163 - Chro.30240 Choline kinase. 2.7.1.32 AAEL01000001 43038 44240 - Chro.30247 Phosphatidylserine decarboxylase. 4.1.1.65 AAEL01000001 60686 61195 +
[Acyl-carrier protein] S-malonyltransferase. Chro.30258 2.3.1.39 AAEL01000076 13023 22868 Chro.30261 Phospholipase C. 3.1.4.3 AAEL01000076 8834 10255 -
3',5'-cyclic-nucleotide phosphodiesterase. Chro.30269 3.1.4.17 AAEL01000256 2214 5207 +
Chro.30301 DNA-directed RNA polymerase. 2.7.7.6 AAEL01000273 3309 8996 - Chro.30329 Guanylate cyclase. 4.6.1.2 AAEL01000150 8137 10035 + Chro.30373 Shikimate kinase. 2.7.1.71 AAELO1000020 630 1169 + Chro.30378 Phenylalanine-tRNA ligase. 6.1.1.20 AAEL01000020 7195 8724 Table 8: Critical Metabolic EhzynTeS
GenelD 1 Description: Critical Metabolic Enzymes ContiglD2 Start End Strand
Chro.30388 Amine oxidase (copper-containing). 1.4.3.6 AAEL01000132 8422 13737 + Chro.30434 Isoleucine-tRNA ligase. 6.1.1.5 AAEL01000627 129 2504 + Chro.30435 Pseudouridylate synthase. 4.2.1.70 AAEL01000322 631 2187 +
Procollagen-proline,2-oxoglutarate-4- Chro.30441 dioxygenase. 1.14.11.2 AAEL01000254 2415 4571 _ Chro.30484 DNA-directed DNA polymerase. 2.7.7.7 AAEL01000200 552 2222 + Chro.40051 Histone-lysine N-methyltransferase. 2.1.1.43 AAEL01000634 295 1233 + Chro.40064 Carbonate dehydratase. 4.2.1.1 AAEL01000173 1550 5110 Chro.40070 H(+)-transporting two-sector ATPase. 3.6.3.14 AAEL01000062 14285 15556 + Chro.40070 Proton-exporting ATPase. 3.6.3.6 AAEL01000062 14285 15556 + Chro.40087 Pyruvate dehydrogenase (NADP+). 1.2.1.51 AAELO1000575 2751 3557 Chro.40087 Sulfite reductase (NADPH). 1.8.1.2 AAEL01000575 2751 3557 -
Chro.40088 Glucose-6-phosphate 1 -dehydrogenase. 1.1.1.49 AAEL01000575 982 2265 + Chro.40093 Cinnamyl-alcohol dehydrogenase. 1.1.1.195 AAEL01000451 3184 3774 + Chro.40093 Peroxidase. 1.11.1.7 AAEL01000451 3184 3774 +
UDP-N-acetylglucosamine diphosphorylase. Chro.40100 2.7.7.23 AAELO1000475 1722 3506
Chro.40115 Phosphomannomutase. 5.4.2.8 AAELO1000263 4757 4969 - Chro.40170 DNA-directed DNA polymerase. 2.7.7.7 AAEL01000881 154 732 + Chro.40170 DNA-directed RNA polymerase. 2.7.7.6 AAEL01000881 154 732 + Chro.40171 DNA-directed DNA polymerase. 2.7.7.7 AAEL01000917 101 340 - Chro.40171 DNA-directed RNA polymerase. 2.7.7.6 AAEL01000917 101 340 - Chro.40214 AMP deaminase. 3.5.4.6 AAEL01000039 27959 29275 - Chro.40219 Nucleoside-diphosphate kinase. 2.7.4.6 AAELO1000039 18990 19442 - Chro.40258 Retinol dehydrogenase. 1.1.1.105 AAEL01000018 27871 29013 - Chro.40267 Aspartate-tRNA ligase. 6.1.1.12 AAEL01000018 12806 14404 + Chro.40267 Lysine-tRNA ligase. 6.1.1.6 AAEL01000018 12806 14404 + Chro.40275 Nucleoside-diphosphate kinase. 2.7.4.6 AAELO1000533 2052 2561 - Chro.40285 Dimethylallyltransferase. 2.5.1.1 AAEL01000058 19643 20704 + Chro.40285 Geranyltranstransferase. 2.5.1.10 AAEL01000058 19643 20704 + Chro.40288 Phosphoinositide phospholipase C. 3.1.4.11 AAEL01000058 15344 17992 + Chro.40288 Phospholipase C. 3.1.4.3 AAEL01000058 15344 17992 +
Glycerophosphodiester phosphodiesterase. Chro.40291 3.1.4.46 AAEL01000058 9555 10601 +
Chro.40292 UDP-glucose 4-epimerase. 5.1.3.2 AAEL01000058 8335 9372 + Chro.40304 Nitric-oxide synthase. 1.14.13.39 AAEL01000078 2719 4674 + Chro.40314 Ethanolaminephosphotransferase. 2.7.8.1 AAEL01000078 19280 20566 +
[Acyl-carrier protein] S-malonyltransferase. Chro.40326 2.3.1.39 AAEL01000379 1661 7048 -
Aminoadipate-semialdehyde dehydrogenase. Chro.40330 1.2.1.31 AAEL01000182 329 7237 + Chro.40352 Adenylate cyclase. 4.6.1.1 AAEL01000002 55123 60018 + Chro.40352 Guanylate cyclase. 4.6.1.2 AAEL01000002 55123 60018 + Chro.40374 Phosphoacetylglucosamine mutase. 5.4.2.3 AAEL01000002 16193 18124 + Chro.40444 Tyrosine-tRNA ligase. 6.1.1.1 AAEL01000825 474 1673 -
Chro.40472 Nucleoside-triphosphate diphosphatase. 3.6.1.19 AAEL01000932 44 256 Chro.40506 Dihydrofolate reductase. 1.5.1.3 AAEL01000355 3431 4996 + Chro.40506 Thymidylate synthase. 2.1.1.45 AAELO1000355 3431 4996 + Chro.41000 Acyl-CoA dehydrogenase. 1.3.99.3 AAELO1000281 2 8212 Chro.50026 5'-nucleotidase. 3.1.3.5 AAEL01000042 4364 6496 +
Chro.50026 Inositol-polyphosphate 5-phosphatase. 3.1.3.56 AAELO 1000042 4364 6496 + Chro.50031 Ubiquinol-cytochrome c reductase. 1. AAEL01000155 13753 14880 + Table 8: Critical Metabolic Enzyriϊes
GenelD 1 Description: Critical Metabolic Enzymes ContiglD 2 Start End Strand
Chro.50037 Adenylate kinase. 2.7.4.3 AAEL01000328 1713 2375 +
Chro.50039 H(+)-transporting two-sector ATPase. 3.6.3.14 AAEL01000328 4265 5452 +
Chro.50052 Long-chain-fatty-acid-CoA ligase. 6.2.1.3 AAEL01000701 288 2339
Chro.50082 Alpha-amylase. 3.2.1.1 AAEL01000292 7232 7882
Chro.50115 θ-phosphofructo^-kinase. 2.7.1.105 AAEL01000032 8305 9399 +
Dolichyl-phosphate beta-glucosyltransferase. Chro.50118 2.4.1.117 AAEL01000032 3902 4990
UDP-N-acetylglucosamine--dolichyl-phosphate N- Chro.50156 acetylglucosaminephosphotransferase. 2.7.8.15 AAEL01000074 1948 3222 + Chro.50169 DNA (cytosine-5-)-methyltransferase. 2.1.1.37 AAEL01000316 8151 8768 +
Dolichyl-phosphate beta-D-mannosyltransferase. Chro.50175 2.4.1.83 AAEL01000019 18276 18500
Chro.50184 Phosphopyruvate hydratase. 4.2.1.11 AAEL01000019 3124 3696 - Chro.50211 CTP synthase. 6.3.4.2 AAEL01000013 41289 43301 - Chro.50237 Nucleoside-diphosphate kinase. 2.7.4.6 AAEL01000054 14460 15125 + Chro.50255 Adenylate cyclase. 4.6.1.1 AAEL01000331 7684 8304 - Chro.50255 Guanylate cyclase. 4.6.1.2 AAEL01000331 7684 8304 - Chro.50271 Cinnamoyl-CoA reductase. 1.2.1.44 AAELO1000007 12364 13698 - Chro.50302 H(+)-transporting two-sector ATPase. 3.6.3.14 AAEL01000123 3926 4303 - Chro.50302 Proton-exporting ATPase. 3.6.3.6 AAEL01000123 3926 4303 -
Malate dehydrogenase (oxaloacetate Chro.50314 decarboxylating) (NADP+). 1.1.1.40 AAEL01000332 4832 6520 -
Malate dehydrogenase (oxaloacetate Chro.50314 decarboxylating). 1.1.1.38 AAEL01000332 4832 6520 Chro.50317 DNA-directed RNA polymerase. 2.7.7.6 AAEL01000452 2373 3791 - Chro.50318 DNA-directed RNA polymerase. 2.7.7.6 AAEL01000452 4168 5064 - Chro.50319 Ethanolamine kinase. 2.7.1.82 AAEL01000087 15287 16621 +
Polypeptide N-acetylgalactosaminyltransferase. Chro.50322 2.4.1.41 AAEL01000087 6848 9046 Chro.50329 Alanine racemase. 5.1.1.1 AAELO1000369 3579 4295 - Chro.50330 Leucine-tRNA ligase. 6.1.1.4 AAELO1000369 4614 5294 + Chro.50331 Leucine-tRNA ligase. 6.1.1.4 AAELO1000369 5542 7416 + Chro.50340 H(+)-transporting two-sector ATPase. 3.6.3.14 AAEL01000585 2271 2909 -
Glycerophosphodiester phosphodiesterase. Chro.50344 3.1.4.46 AAEL01000712 1322 2161 _
Chro.50389 Phosphoenolpyruvate carboxylase. 4.1.1.31 AAEL01000354 104 3550 + Chro.50398 Thymidine kinase. 2.7.1.21 AAEL01000361 1946 2533 + Chro.50402 Arginine-tRNA ligase. 6.1.1.19 AAEL01000622 1311 2828 - Chro.50490 Thymidylate kinase. 2.7.4.9 AAELO1000482 2551 3048 +
Chro.50499 GMP synthase (glutamine-hydrolyzing). 6.3.5.2 AAELO1000910 558 1337 Chro.50501 Aspartate-ammonia ligase. 6.3.1.1 AAEL01001330 13 676 + Chro.50503 Tryptophan synthase. 4.2.1.20 AAEL01000915 216 1445 + Chro.51000 Cyclomaltodextrinase. 3.2.1.54 AAEL01000292 7385 8614 - Chro.60012 IMP dehydrogenase. 1.1.1.205 AAEL01000251 35 262 + Chro.60075 Alanine-tRNA ligase. 6.1.1.7 AAEL01000342 4096 7065 - Chro.60075 Aspartate-ammonia ligase. 6.3.1.1 AAELO1000342 4096 7065 - Chro.60082 H(+)-transporting two-sector ATPase. 3.6.3.14 AAELO1000992 52 1101 +
Chro.60090 Ribonucleoside-diphosphate reductase. 1.17.4.1 AAEL01000774 54 944 +
Chro.60091 Ribonucleoside-diphosphate reductase. 1.17.4.1 AAEL01000412 1020 2129 + Chro.60114 Amylo-alpha-1 ,6-glucosidase. 3.2.1.33 AAEL01000631 1156 3018 - Chro.60114 4-alpha-glucanotransferase. 2.4.1.25 AAEL01000631 1156 3018 _ Table 8: Critical Metabolic Enzymes
GenelD 1 Description: Critical Metabolic Enzymes ContiglD2 Start End £ 5tra
Chro.60125 Cysteine-tRNA ligase. 6.1.1.16 AAEL01000025 5664 6941 -
Chro.60161 Glycerol-3-phosphate O-acyltransferase. 2.3.1.15 AAELO1000401 3166 4926 + Chro.60194 Apyrase. 3.6.1.5 AAEL01000133 15004 16041 - Chro.60194 Nucleoside-diphosphatase. 3.6.1.6 AAEL01000133 15004 16041 - Chro.60213 Phosphatidylinositol 3-kinase. 2.7.1.137 AAEL01000098 12654 15485 -
Polypeptide N-acetylgalactosaminyltransferase. Chro.60231 2.4.1.41 AAEL01000260 2022 4451 Chro.60284 Phosphorylase. 2.4.1.1 AAEL01000012 27849 30554 - Chro.60344 Tyrosine-tRNA ligase. 6.1.1.1 AAEL01000041 16218 17348 Chro.60381 1 ,4-alpha-glucan branching enzyme. 2.4.1.18 AAEL01000092 14591 17683 - Chro.60381 Alpha-amylase. 3.2.1.1 AAELO1000092 14591 17683 - Chro.60382 DNA-directed RNA polymerase. 2.7.7.6 AAEL01000092 8559 14168 + Chro.60392 1 -phosphatidylinositol 4-kinase. 2.7.1.67 AAEL01000345 3835 7374 - Chro.60412 Protein-tyrosine-phosphatase. 3.1.3.48 AAEL01000250 3179 5911 +
Chro.60425 Glucose-6-phosphate 1 -dehydrogenase. 1.1.1.49 AAEL01000113 5016 6518 Chro.60426 Homoserine kinase. 2.7.1.39 AAEL01000113 8094 8564 - Chro.60426 Pyrroline-5-carboxylate reductase. 1.5.1.2 AAEL01000113 8094 8564 - Chro.60429 Alpha-amylase. 3.2.1.1 AAEL01000113 17901 18155 -
Glyceraldehyde 3-phosphate dehydrogenase Chro.60434 (phosphorylating). 1.2.1.12 AAEL01000124 3050 4069 + Chro.60435 Hexokinase. 2.7.1.1 AAEL01000124 4916 6469 +
3',5'-cyclic-nucleotide phosphodiesterase. Chro.60462 3.1.4.17 AAEL01000169 661 1866 + Chro.60497 Myosin ATPase. 3.6.4.1 AAEL01000296 6201 9263 - Chro.60505 Glutamate-tRNA ligase. 6.1.1.17 AAEL01000732 220 609 + Chro.60505 Proline--tRNA ligase. 6.1.1.15 AAEL01000732 220 609 + Chro.60506 DNA-directed DNA polymerase. 2.7.7.7 AAEL01000732 782 2245 - Chro.60524 Glutamate-ammonia ligase. 6.3.1.2 AAEL01000023 3760 5205 + Chro.60525 DNA-directed RNA polymerase. 2.7.7.6 AAELO1000023 5521 6480 +
Dolichyl-diphosphooligosaccharide-protein Chro.60585 glycosyltransferase. 2.4.1.119 AAELO1000050 3679 5223 + Chro.70052 Thymidine kinase. 2.7.1.21 AAEL01000011 41333 42490 - Chro.70059 Phosphatidate cytidylyltransferase. 2.7.7.41 AAEL01000927 113 847 + Chro.70062 L-lactate dehydrogenase. 1.1.1.27 AAEL01000175 9686 10636 + Chro.70062 Malate dehydrogenase. 1.1.1.37 AAEL01000175 9686 10636 + Chro.70063 L-lactate dehydrogenase. 1.1.1.27 AAEL01000175 8305 9270 + Chro.70063 Malate dehydrogenase. 1.1.1.37 AAEL01000175 8305 9270 + Chro.70084 DNA-directed DNA polymerase. 2.7.7.7 AAEL01000282 3228 6947 - Chro.70113 Phosphoglycerate kinase. 2.7.2.3 AAEL01000172 10049 11230 -
Polypeptide N-acetylgalactosaminyltransferase. Chro.70157 2.4.1.41 AAEL01000003 75080 76294 _
Chro.70168 Cytochrome-c oxidase. 1.9.3.1 AAELO1000003 50576 52462 + Chro.70170 Alkaline phosphatase. 3.1.3.1 AAEL01000003 48127 49518 + Chro.70176 Tryptophan-tRNA ligase. 6.1.1.2 AAELO1000003 39207 40988 - Chro.70177 Acid phosphatase. 3.1.3.2 AAELO1000003 35874 38918 - Chro.70181 Aspartate-tRNA ligase. 6.1.1.12 AAEL01000003 27698 29005 Chro.70182 Aspartate-tRNA ligase. 6.1.1.12 AAELO1000003 26794 27042 - Chro.70188 Uridine nucleosidase. 3.2.2.3 AAELO1000003 11843 12496 + Chro.70201 Threonine-tRNA ligase. 6.1.1.3 AAEL01000163 970 3261 -
UDP-N-acetylglucosamine diphosphorylase. Chro.70213 2.7.7.23 AAEL01000006 49676 51640 _
Chro.70218 NADH dehydrogenase (ubiquinone). 1.6.5.3 AAELO1000006 36450 38159 - Chro.70218 NADH dehydrogenase. 1.6.99.3 AAEL01000006 36450 38159 Table 8: Critical Metabolic Enzymes
GenelD 1 Description: Critical Metabolic Enzymes ContiglD2 Start End Strand
Chro.70250 Guanylate kinase. 2.7.4.8 AAEL01000115 17637 18231 +
Chro.70301 Methionine adenosyltransferase. 2.5.1.6 AAELO1000069 18630 19850 -
Ethanolamine-phosphate cytidylyltransferase. Chro.70332 2.7.7.14 AAELO1000129 1668 2870
Chro.70351 Pyruvate decarboxylase. 4.1.1.1 AAEL01000016 34668 36398 + Chro.70433 Citrate (Si)-synthase. 2.3.3.1 AAEL01000028 16765 18648 - Chro.70469 Phosphoserine phosphatase. 3.1.3.3 AAEL01000004 22307 24094 + Chro.70471 Phosphoglycerate mutase. 5.4.2.1 AAEL01000004 18776 19525 Chro.70488 Acylphosphatase. 3.6.1.7 AAELO1000035 14377 15354 - Chro.70489 Acid phosphatase. 3.1.3.2 AAEL01000035 15422 17902 Chro.70494 Protein-tyrosine-phosphatase. 3.1.3.48 AAEL01000035 23035 24396 + Chro.70498 Homoaconitate hydratase. 4.2.1.36 AAEL01000375 3811 7140 - Chro.70499 Adenosinetriphosphatase. 3.6.1.3 AAEL01000131 2675 6850 - Chro.70529 DNA-directed RNA polymerase. 2.7.7.6 AAEL01000048 14305 14694 +
1 -pyrroline-5-carboxylate dehydrogenase. Chro.70551 1.5.1.12 AAEL01000159 12723 14054 Chro.70551 Giutamate 5-kinase. 2.7.2.11 AAEL01000159 12723 14054 -
Glutamate-5-semialdehyde dehydrogenase. Chro.70551 1.2.1.41 AAEL01000159 12723 14054
Chro.70552 Pantothenate kinase. 2.7.1.33 AAEL01000159 11395 12486 + Chro.70559 H(+)-transporting two-sector ATPase. 3.6.3.14 AAEL01000580 2305 3546 Chro.70559 Proton-exporting ATPase. 3.6.3.6 AAEL01000580 2305 3546 -
Chro.70577 Nucleoside-triphosphate diphosphatase. 3.6.1.19 AAEL01000178 13397 13927 + Chro.70577 dUTP diphosphatase. 3.6.1.23 AAEL01000178 13397 13927 + Chro.70613 Glucan 1 ,4-alpha-glucosidase. 3.2.1.3 AAELO1000177 1449 4448 + Chro.80016 Acid phosphatase. 3.1.3.2 AAEL01000034 7297 8571 - Chro.80027 DNA-directed RNA polymerase. 2.7.7.6 AAELO1000988 88 1122 + Chro.80038 Pantothenate kinase. 2.7.1.33 AAEL01000066 28 1179 Chro.80042 DNA-directed RNA polymerase. 2.7.7.6 AAEL01000103 14260 15294 - Chro.80047 Asparagine-tRNA ligase. 6.1.1.22 AAEL01000103 6337 7836 - Chro.80047 Aspartate-tRNA ligase. 6.1.1.12 AAEL01000103 6337 7836 Chro.80048 H(+)-transporting two-sector ATPase. 3.6.3.14 AAEL01000103 5008 5676 - Chro.80048 Proton-exporting ATPase. 3.6.3.6 AAEL01000103 5008 5676 - Chro.80050 Glycerol-3-phosphate dehydrogenase. 1.1.99.5 AAEL01000467 4020 4961 - Chro.80050 Malate dehydrogenase (acceptor). 1.1.99.16 AAEL01000467 4020 4961 Chro.80065 Pseudouridylate synthase. 4.2.1.70 AAEL01000139 11704 13209 -
CDP-diacylglycerol-inositol 3- Chro.80072 phosphatidyltransferase. 2.7.8.11 AAEL01000104 7427 7891 + Chro.80075 Cinnamyl-alcohol dehydrogenase. 1.1.1.195 AAEL01000104 14432 15688 + Chro.80075 Peroxidase. 1.11.1.7 AAEL01000104 14432 15688 + Chro.80098 Glutamate-tRNA ligase. 6.1.1.17 AAEL01000351 3156 4823 + Chro.80098 Proline-tRNA ligase. 6.1.1.15 AAEL01000351 3156 4823 + Chro.80106 DNA-directed DNA polymerase. 2.7.7.7 AAELO1000148 821 2686 + Chro.80106 Riboflavin synthase. 2.5.1.9 AAEL01000148 821 2686 + Chro.80111 UDP-glucose 6-dehydrogenase. 1.1.1.22 AAEL01000148 13214 14842 - Chro.80123 Glycine-tRNA ligase. 6.1.1.14 AAEL01000571 406 2187 +
Chro.80135 Cholinephosphate cytidylyltransferase. 2.7.7.15 AAEL01000509 3046 3822 - 1 -acyIglycerol-3-phosphate O-acyltransferase. Chro.80165 2.3.1.51 AAEL01000399 1613 2512 +
Chro.80190 DNA-directed DNA polymerase. 2.7.7.7 AAEL01000140 9742 11172 + Chro.80195 H(+)-transporting two-sector ATPase. 3.6.3.14 AAEL01000140 2387 3868 + Chro.80195 Proton-exporting ATPase. 3.6.3.6 AAELO1000140 2387 3868 + Chro.80198 1 ,3-propanediol dehydrogenase. 1.1.1 AAEL01000026 32591 34000 + Table 8: Critical Metabolic Enzymes
GenelD 1 Description: Critical Metabolic Enzymes ContiglD2 Start End Strand
Acetaldehyde dehydrogenase (acetylating). Chro.80198 1.2.1.10 AAEL01000026 32591 34000 +
Chro.80198 Alcohol dehydrogenase. 1.1.1.1 AAEL01000026 32591 34000 + Chro.80199 Alcohol dehydrogenase. 1.1.1.1 AAELO1000026 28773 31241 + Chro.80206 Glucan 1 ,4-alpha-glucosidase. 3.2.1.3 AAELO1000026 11116 14304 - Chro.80217 Phosphatidylinositol 3-kinase. 2.7.1.137 AAELO1000373 1404 2795 + Chro.80224 Mannose-6-phosphate isomerase. 5.3.1.8 AAEL01000787 281 814 + Chro.80231 NAD(+) kinase. 2.7.1.23 AAEL01000108 1767 3479 +
Chro.80274 NAD(P)(+) transhydrogenase (B-specific). 1.6.1.1 AAELO1000204 5720 8599 Chro.80280 Diacylglycerol kinase. 2.7.1.107 AAEL01000059 20771 22621 - Chro.80302 Glycine hydroxymethyltransferase. 2.1.2.1 AAEL01000033 25331 26647 - Chro.80306 Glycine hydroxymethyltransferase. 2.1.2.1 AAELO1000033 28873 30210 - Chro.80312 Amine oxidase (flavin-containing). 1.4.3.4 AAEL01000121 14380 16494 + Chro.80312 Mandelonitrile lyase. 4.1.2.10 AAEL01000121 14380 16494 +
Chro.80315 2,4-dichlorophenol 6-monooxygenase. 1.14.13.20 AAEL01000186 11474 12922 Chro.80328 Uridine kinase. 2.7.1.48 AAEL01000030 7647 9020 Chro.80360 Amine oxidase (copper-containing). 1.4.3.6 AAEL01000119 5893 6597 Chro.80361 Valine-tRNA ligase. 6.1.1.9 AAEL01000119 2466 5594 - Chro.80373 RNA-directed RNA polymerase. 2.7.7.48 AAELO1000005 953 3703 + Chro.80385 Phenylalanine-tRNA ligase. 6.1.1.20 AAELO1000005 26852 28795 - Chro.80395 Membrane alanine aminopeptidase. 3.4.11.2 AAELO1000005 47539 50349 + Chro.80398 Methionine-tRNA ligase. 6.1.1.10 AAELO1000005 55308 56996 + Chro.80424 Biotin carboxylase. 6.3.4.14 AAEL01000036 1305 1889 + Chro.80425 Acetyl-CoA carboxylase. 6.4.1.2 AAELO1000036 2208 10385 +
Glucose-1 -phosphate thymidylyltransferase. Chro.80452 2.7.7.24 AAELO1000027 10290 11792 _ Chro.80452 Phospholipase C. 3.1.4.3 AAEL01000027 10290 11792 - Chro.80461 Histidine-tRNA ligase. 6.1.1.21 AAEL01000199 7219 8805 + Chro.80518 1 -phosphatidylinositol 4-kinase. 2.7.1.67 AAEL01000303 239 1657 + Chro.80542 Serine-tRNA ligase. 6.1.1.11 AAEL01000180 10560 11924 _ Chro.80551 H(+)-transporting two-sector ATPase. 3.6.3.14 AAEL01000474 3289 3834 -
Alpha.alpha-trehalose-phosphate synthase (UDP- Chro.80565 forming). 2.4.1.15 AAEL01000118 12567 16763 + Chro.80574 Glucan 1 ,4-alpha-glucosidase. 3.2.1.3 AAEL01000790 522 998 + Chro.80574 Alpha-amylase. 3.2.1.1 AAEL01000790 522 998 + Chro.80602 Pseudouridylate synthase. 4.2.1.70 AAEL01000015 30843 31475 - Chro.80609 3-dehydroquinate dehydratase. 4.2.1.10 AAEL01000015 10540 13959
1 GenelD: gene identification
2 ContiglD: contig identification Table 9: Species Specific Sequence Differences
GenelD 1 Description ContiglD2 Start End Strand
Chro.10022 deletion AAEL01000305 5265 7157 -
Chro.10026 deletion AAEL01000721 148 2314 +
Chro.10057 deletion/insertion AAEL01000100 13988 16888
Chro.10181 deletion AAEL01000064 9566 11278 +
Chro.10343 deletion AAEL01000469 104 4066 +
Chro.10363 insertion AAEL01000735 628 1815 -
Chro.20054 deletion AAELO1000572 164 2932 +
Chro.20062 deletion AAEL01000151 7358 9010 -
Chro.20077 insertion AAELO1000243 7994 10903 -
Chro.20079 deletion/insertion AAEL01000243 3219 6659 +
Chro.20329 insertion AAELO1000389 1235 6175 +
Chro.20350 deletion AAEL01000038 24255 26546 +
Chro.20375 deletion AAELO1000045 1206 2624 +
Chro.20378 deletion AAEL01000423 2734 4398 -
Chro.20381 insertion AAEL01000370 325 1920 -
Chro.20395 deletion AAEL01000152 9524 12058 +
Chro.30029 insertion AAEL01000506 318 1610 +
Chro.30042 deletion/insertion AAEL01000279 2120 6385
Chro.30134 deletion AAEL01000461 681 2024 -
Chro.30165 deletion AAELO1000297 7890 8507 -
Chro.30212 insertion AAEL01000086 15328 17031 -
Chro.30449 deletion AAEL01000125 14076 16436 -
Chro.30466 deletion/insertion AAEL01000174 10552 11979 -
Chro.30467 insertion AAEL01000174 13259 14293 +
Chro.30469 insertion AAEL01000226 2739 6119 -
Chro.30478 deletion AAEL01000610 1005 3080 -
Chro.40034 deletion AAEL01000271 829 5643 +
Chro.40076 insertion AAEL01000402 3155 5113 +
Chro.40122 deletion/insertion AAEL01000821 19 1830 +
Chro.40149 deletion AAEL01000288 5728 7170 +
Chro.40154 deletion/insertion AAEL01000105 523 2859 +
Chro.40165 insertion AAEL01000235 2296 5058 +
Chro.40187 insertion AAEL01000363 95 1720 +
Chro.40265 insertion AAEL01000018 16302 17339 -
Chro.40415 insertion AAEL01000216 6883 10011 +
Chro.40421 insertion AAEL01000206 1625 4414 +
Chro.40510 deletion AAEL01000196 3780 5174 +
Chro.40511 insertion AAEL01000196 6250 7356 +
Chro.60041 insertion AAELO1000689 64 1209 +
Chro.60102 deletion AAEL01000137 11337 12380 -
Chro.60107 deletion/insertion AAEL01000498 1563 4610 -
Chro.60177 insertion AAEL01000021 28392 30386 -
Chro.60352 insertion AAEL01000390 2912 5986 +
Chro.60360 deletion AAELO1000429 2961 4775 +
Chro.60427 deletion AAEL01000113 9632 16387 +
Chro.60453 insertion AAEL01000237 2173 3159 +
Chro.60471 deletion AAEL01000082 14575 19554 -
Chro.60491 deletion AAELO1000264 5303 9619 -
Chro.60561 deletion AAEL01000168 4270 6306 -
Chro'.60622 insertion AAEL01000244 4857 7199 +
Chro.60625 deletion AAEL01000176 2199 3689 +
Chro.70055 insertion AAEL01000344 411 5789 -
Chro.70065 insertion AAEL01000175 4944 6710 +
Chro.70076 insertion AAEL01000142 1329 3209 -
Chro.70079 insertion AAELO1000255 1465 3906 _ Table 9: Species Specific Sequence Differences
GenelD 1 Description ContiglD2 Start End Strand
Chro.70137 deletion AAEL01000157 10149 14126 + Chro.70226 deletion AAEL01000006 23610 24878 + Chro.70497 deletion AAEL01000375 1206 3629 + Chro.80107 deletion AAEL01000148 3249 4058 Chro.80147 deletion/insertion AAEL01000043 18168 23150 Chro.80148 insertion AAEL01000043 14331 17825 + Chro.80158 deletion AAEL01000426 2111 5830 Chro.80163 deletion AAEL01000399 4258 5343 Chro.80265 deletion AAEL01000302 6765 8969 Chro.80323 deletion AAEL01000153 8970 12848 Chro.80481 deletion AAEL01000085 2243 4441 + Chro.80489 deletion AAEL01000611 847 1086 + Chro.80511 insertion AAEL01000112 8680 9894 + Chro.80530 insertion AAEL01000683 1 1316 Chro.80555 deletion AAEL01000818 810 1848 + Chro.80556 deletion AAEL01000352 388 6309 + Chro.80613 insertion AAEL01000015 2831 3649
1 GenelD: gene identification
2 ContiglD: contig identification
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch_Gene Contig Accession Signal anchor peptide TMHMM GO EC Mito gene Gpi anchor cleavage coil
Chro.60102 AAEL01000137 0.795 1 3 yes 309
Chro.30014 AAEL01000207 0.62 . yes yes
Chro.30070 AAEL01000014 0.868 yes 659
Chro.70434 AAELOl 000028 0.967 3 yes 424
Chro.30217 AAEL01000086 0.979 yes 1077
Chro.50034 AAELOl 000564 0.989 yes
Chro.50023 AAEL01000042 0.997 yes 268
Chro.60244 AAEL01000265 0.997 3 yes 1593
Chro.50235 AAEL01000054 0.997 yes
Chxo.20326 AAELOIOOOIOI 0.998 m yes 1008
§ Chro.20418 AAEL01000239 0.999 3 yes 71
Chro.20398 AAEL01000152 0.999 yes 235
Chro.70600 AAEL01000051 1 yes yes 149
Chro.10079 AAELOl 000462 1 yes 313
Chro.70424 AAEL01000228 0.9 1 700
Chro.70149 AAELOl 000088 0.902 1
Chro.60252 AAEL01000057 0.904 m 1 m
Chro.30302 AAEL01000273 0.91 1 678
Chro.70305 AAEL01000392 0.921 1 244
Chro.20429 AAEL01000639 0.922 1
Chro.60016 AAEL01000052 0.923 1 1547
Chro.70538 AAEL01001034 0.925 1 93
Chro.70538 AAEL01001034 0.925 1 93
Chro.60133 AAELOl 000025 0.932 1
Chro.10215 AAEL01000191 0.934 1 33
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch_Gene Contig Accession Signal anchor peptide TMHMM GO EC M Miito gene Gpi anchor cleavage coil
Chro.70461 AAEL01000004 0.944 1
Chro.50322 AAEL01000087 0.952 1 3 1 yes 693
Chro.30130 AAEL01000291 0.953 1 .
Chro.30178 AAELOl 000044 0.954 1 yes 571
Chro.80418 AAEL01000122 0.963 1 .
Chro.70213 AAEL01000006 0.966 1 1 ι
Chro.50118 AAEL01000032 0.967 1 1
Chro.10371 AAEL01000514 0.967 1 1 164
Chro.40349 AAEL01000002 0.971 1 3 m 115
Chro.20262 AAELOl 000321 0.972 1
£ Chro.70258 AAEL01000077 0.976 1 3 300
Chro.80221 AAEL01000373 0.994 1 # 357
Chro.80580 AAEL01000313 0.995 1 m
Chro.50029 AAEL01000042 0.999 1 m 97
Chro.20380 AAEL01000370 0.999 1 t
Chro.30101 AAEL01000362 0.999 1 .
Chro.80165 AAEL01000399 1 1 1 264
Chro.80095 AAEL01000394 1 1
Chro.60065 AAELOlOOl 133 0.456 2
Chro.80354 AAEL01000116 0.473 2 m
Chro.30401 AAEL01000891 0.526 2 . yes 42
Chro.50234 AAELOl 000054 0.529 2 106
Chro.10202 AAEL01000164 0.57 2
Chro.20371 AAEL01000045 0.578 2
Chro.70106 AAEL01000215 0.653 2
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch_Gene Contig Accession Signal anchor peptide TMHMM GO EC Mito gene Gpi anchor cleavage coil
Chro.70380 AAELOl 000047 0.703 2
Chro.70380 AAEL01000047 0.703 2
Chro.70449 AAEL01000004 0.715 2 73
Chro.70449 AAELOl 000004 0.715 2 73
Chro.20183 AAEL01000071 0.751 2
Chro.50416 AAEL01000381 0.844 2
Chro.70131 AAEL01000976 0.906 2 77
Chro.60093 AAELOl 000412 0.933 2 156
Chro.80573 AAEL01000790 0.937 2 53
Chro.20437 AAEL01000055 0.937 2 t 83
Chro.60139 AAEL01000025 0.949 2 52
Chro.60139 AAELOl 000025 0.949 2 52
Chro.60585 AAEL01000050 0.968 2 2 482
Chro.80337 AAEL01000030 0.975 2 2 359
Chro.20243 AAELOl 000075 0.977 2 313
Chro.60084 AAEL01000916 0.995 2 68
Chro.20446 AAEL01000055 0.997 2
Chro.80299 AAELOl 000033 0.998 2 49
Chro.60286 AAEL01000012 0.999 2 3 yes
Chro.70116 AAEL01000503 1 2 558
Chro.80072 AAEL01000104 0.396 3
Chro.60291 AAEL01000012 0.501 3
Chro.60186 AAEL01000021 0.558 3 157
Chro.80577 AAEL01000313 0.662 3 3
Chro.30208 AAEL01000247 0.678 3
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch_Gene Contig Accession Signal anchor peptide TMHMM GO EC Mito gene Gpi anchor cleavage coil
Chro.60221 AAELOl 000145 0.804 3 3
Chro.40265 AAEL01000018 0.855 3 329
Chro.60170 AAELOlOOl 167 0.878 3
Chro.30271 AAEL01000256 0.888 3 yes
Chro.60413 AAEL01000250 0.895 3 258
Chro.20432 AAEL01000591 0.923 3 2
Chro.40056 AAELOl 000299 0.974 3 2 244
Chro.30252 AAELOl 000001 0.974 3 .
Chro.20025 AAELOl 000202 0.995 3 2
Chro.60231 AAEL01000260 0.996 m 3 3 792
Ul
O Chro.80178 AAEL01000229 0.9 2
Chro.20124 AAELOl 000009 2 452
Chro.40397 AAEL01000812 0.816 2 329
Chro.20278 AAELOl 000095 0.496 2 2590
Chro.30128 AAEL01000291 2
Chro.30129 AAEL01000291 2 55
Chro.10083 AAEL01000864 2 3
Chro.30375 AAEL01000020 0.604 2
Chro.60361 AAELOl 000429 2 yes 48
Chro.10359 AAELOl 000312 2
Chro.20095 AAEL01000046 2 3
Chro.10115 AAELOl 000084 0.875 2 . 451
Chro.20323 AAELOIOOOIOI 0.98 2 3 yes
Chro.70573 AAEL01000658 2 98
Chro.80304 AAEL01000033 2
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch_Gene Contig Accession Signal anchor peptide TMHMM GO EC Mito gene Gpi anchor cleavage coil
Chro.20115 AAELOl 000009 2 287 Chro.70555 AAEL01000159 0.501 2 33 Chro.70573 AAEL01000658 2 98 Chro.20185 AAEL01000071 2 yes Chro.80550 AAEL01000474 0.806 2 49 Chro.70270 AAEL01000117 2 450 Chro.80451 AAEL01000027 2 462 1 Chro.80433 AAEL01000036 2 Chro.60345 AAELOl 000041 0.976 2 3 Chro.20258 AAEL01000311 2 140
Ul Chro.20354 AAEL01000149 2 Chro.20141 AAEL01000240 0.371 2 Chro.70549 AAEL01000159 0.967 2 3 Chro.80304 AAEL01000033 2 Chro.30076 AAELOl 000053 0.979 2 656 Chro.70216 AAEL01000006 0.637 2 yes 166 Chro.10031 AAEL01000336 2 Chro.40190 AAEL01000363 2 312 Chro.80290 AAEL01000033 0.991 2 556 Chro.40264 AAEL01000018 0.777 2 Chro.50228 AAEL01000353 2 Chro.50181 AAEL01000019 2 Chro.60527 AAEL01000023 2 Chro.70520 AAELOl 000048 2 Chro.50304 AAEL01000123 0.876 2
Table 10: Vaccine Candidates
Signal Gpi Coiled
Ch_Gene Contig Accession Signal anchor peptide TMHMM GO EC Mito gene Gpi anchor cleavage coil
Chro.30354 AAEL01000318 2 3 yes 1
Chro.70060 AAEL01000986 2 103
Chro.40454 AAELOl 000324 0.792 2 yes
Chro.40437 AAEL01000784 2
Chro.60550 AAELOl 000060 2 371 3
Chro.80450 AAEL01000027 0.53 2 215
Chro.70017 AAEL01000031 2 108
Chro.50380 AAEL01000644 2 131
Chro.60138 AAEL01000025 0.999 2 1 yes 321
Chro.50357 AAEL01000705 2 3 367
Ul K> Chro.60367 AAELOl 000056 2 • > •
Chro.30127 AAEL01000291 2 . . . 1
Chro.70345 AAELOl 000418 0.996 2 236 1
Chro.70352 AAEL01000016 2 .
Chro.40272 AAEL01000018 0.898 2 575
Chro.80441 AAEL01000027 0.999 2 m
Chro.70282 AAEL01000208 2 358 m
Chro.60166 AAEL01000241 2 236 r
Chro.10097 AAEL01000269 2 • . > 9
Chro.40165 AAEL01000235 2 > 4
Chro.70468 AAEL01000004 2 225
Chro.70375 AAELOl 000047 0.881 2
Chro.70437 AAELOl 000028 2 yes
Chro.10250 AAELOl 000220 0.467 2 199
Chro.40315 AAEL01000078 2 3
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch_Gene Contig Accession Signal anchor peptide TMHMM GO EC Mito gene Gpi anchor cleavage coil
Chro.40274 AAEL01000533 0.674 2 166 Chro.10207 AAELOl 001320 2 102 Chro.70108 AAEL01000172 2 Chro.40251 AAEL01000337 2 Chro.80325 AAEL01000153 2 Chro.40229 AAEL01000039 0.947 2 Chro.10268 AAEL01000022 0.967 2 183 Chro.30224 AAELOIOOOOOI 2 3 271 Chro.40258 AAEL01000018 0.637 2 358 Chro.70241 AAEL01000006 0.75 2 Chro.40251 AAEL01000337 2 Chro.10429 AAEL01000183 2 965 Chro.20064 AAEL01000300 2 1 Chro.20166 AAEL01000268 2 555 3 Chro.30424 AAEL01000836 3 Chro.10084 AAEL01000765 3 3 Chro.50362 AAEL01000797 3 3 540 Chro.10286 AAEL01000598 3 Chro.70547 AAELOl 000405 3 290 • Chro.40021 AAEL01000127 3 Chro.10120 AAEL01000274 3 yes • Chro.40151 AAEL01000288 3 1 768 Chro.70396 AAEL01000017 0.967 3 164 Chro.20368 AAEL01000045 0.774 3 Chro.20070 AAELOl 000203 3 359
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch_Gene Contig Accession Signal anchor peptide TMHMM GO EC Mito gene Gpi anchor cleavage coil
Chro.20218 AAEL01000248 3 241 .
Chro.20229 AAEL01000258 3 m
Chro.70059 AAEL01000927 0.904 3 3 2 211 m
Chro.80560 AAEL01000955 3 306
Chro.80192 AAEL01000140 3 189
Chro.30132 AAEL01000291 3 . 1
Chro.10208 AAEL01000191 3 3 184
Chro.50257 AAELOl 000331 3 3 360 #
Chro.80131 AAEL01000513 3 3 186
Chro.60386 AAEL01000092 3 3 m • •
'Jl Chro.60265 AAELOIOOIOIO 3 m 363
Chro.50378 AAEL01000789 0.524 3 # 178
Chro.50149 AAELOl 000539 3 3 106
Chro.60161 AAEL01000401 3 3 1
Chro.60114 AAEL01000631 3 3 2
Chro.60137 AAEL01000025 3 .
Chro.40189 AAEL01000363 0.595 3 yes 170
Chro.20443 AAEL01000055 3 127
Chro.70567 AAEL01000227 3 9 < .
Chro.10114 AAEL01000084 φ m 3 3 141
Chro.70158 AAEL01000003 . ψ 3 2 96
Chro.30223 AAELOIOOOOOI . . 3 1
Chro.40279 AAEL01000617 0.975 3 .
Chro.20217 AAEL01000248 0.516 3 160
Chro.60467 AAEL01000169 3
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch_Gene Contig Accession Signal anchor peptide TMHMM GO EC Mito gene Gpi anchor cleavage coil
Chro.50254 AAEL01001213 3
Chro.60568 AAELOl 000050 3
Chro.70039 AAEL01000011 3 180
Chro.80612 AAELOl 000015 0.373 1 138
Chro.60015 AAEL01000376 0.452 1
Chro.30210 AAEL01000086 0.462 1 272
Chro.10432 AAEL01000340 0.495 1 3
Chro.70483 AAEL01000035 0.508 1 1
Chro.40419 AAEL01000436 0.522 1 342
Chro.30289 AAEL01000068 0.527 1 yes
Ul Chro.60509 AAEL01000166 0.529 1
Chro.70478 AAEL01000004 0.539 1 46
Chro.50507 AAEL01000309 0.549 1 224 1
Chro.50507 AAEL01000309 0.549 1 224 1
Chro.50507 AAEL01000309 0.549 1 224 1
Chro.50507 AAEL01000309 0.549 1 224 1
Chro.50507 AAEL01000309 0.549 1 224 1
Chro.50507 AAEL01000309 0.549 1 224 1
Chro.50507 AAEL01000309 0.549 1 224 1
Chxo.50507 AAEL01000309 0.549 1 224 1
Chro.50507 AAEL01000309 0.549 1 224 1
Chro.50507 AAEL01000309 0.549 1 224 1
Chro.40155 AAEL01000105 0.575 1 2
Chro.40412 AAEL01000216 0.58 1
Chro.80557 AAEL01001350 0.595 1 172 •
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch_Gene Contig Accession Signal anchor peptide TMHMM GO EC Mito gene Gpi anchor cleavage coil
Chro.10068 AAELOl 000049 0.603 1 202 1
Chro.50309 AAEL01000301 0.606 1
Chro.10150 AAEL01000008 0.61 1
Chro.40106 AAEL01000211 0.624 1
Chro.10196 AAEL01000338 0.625 1 2 254
Chro.70267 AAEL01000117 0.635 1
Chro.60596 AAEL01000495 0.636 1
Chro.10109 AAEL01000084 0.643 1 yes
Chro.20074 AAEL01000549 0.663 1 . 1
Chro.80413 AAEL01000122 0.686 1 360 1
Ul Chro.70162 AAEL01000003 0.696 1 3 • 373 •
Chro.40392 AAEL01000315 0.699 1
Chro.70152 AAEL01000024 0.701 1 3 4138 1
Chro.10039 AAEL01000091 0.711 1 338
Chro.70470 AAELOl 000004 0.717 1 3 636
Chro.40023 AAEL01000416 0.736 1 53 •
Chro.50430 AAELOl 000325 0.743 1
Chro.40263 AAEL01000018 0.769 1 76
Chro.30019 AAEL01000207 0.771 1 371 1
Chro.20329 AAEL01000389 0.772 1 2 yes 1617 .
Chro.20329 AAEL01000389 0.772 1 2 yes 1617
Chro.60337 AAEL01000041 0.774 1 . 390
Chro.40321 AAEL01000368 0.777 1 223
Chro.50471 AAEL01000289 0.791 1 • •
Chro.60102 AAEL01000137 0.795 1 3 yes 309 •
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch_Gene Contig Accession Signal anchor peptide TMHMM GO EC Mito gene Gpi anchor cleavage coil
Chro.60556 AAEL01000060 0.803 1
Chro.70476 AAEL01000004 0.81 1 325
Chro.60235 AAEL01000541 0.818 1 994
Chro.10406 AAEL01000777 0.825 1
Chro.70429 AAEL01000028 0.826 1 711
Chro.30483 AAEL01000521 0.827 1 3
Chxo.40348 AAELOl 000002 0.833 1
Chro.40448 AAEL01000702 0.842 1 322
Chro.10047 AAELOl 000727 0.848 1 518 m
Chro.20413 AAELOlOOl 138 0.852 1 227
Ul -4 Chro.30206 AAEL01000247 0.868 1 . 2
Chro.70432 AAEL01000028 0.869 1 m 1644 6
Chro.60563 AAEL01000168 0.876 1 3
Chro.20117 AAELOl 000009 0.888 1 3
Chro.80617 AAEL01000242 0.888 1 3 yes 62
Chro.40216 AAEL01000039 0.896 1 2
Chro.80324 AAEL01000153 0.896 1 .
Chro.80324 AAELOl 000153 0.896 1
Chro.40441 AAEL01000966 0.899 1 282
Chro.60103 AAEL01000308 0.382 1 3 639
Chro.50325 AAELOl 000087 0.492 1 182
Chro.50012 AAELOl 000670 0.503 1 yes 368
Chro.30475 AAEL01000304 0.524 1 3
Chro.20156 AAEL01000065 0.525 1 m 237
Chro.50010 AAEL01000267 0.535 1 751
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch Gene Contig Accession Signal anchor peptide TMHMM GO EC cleavage coil
Chro.80363 AAEL01000982 0.535 1 . .
Chro.20399 AAEL01000152 0.557 1 443
Chro.80016 AAEL01000034 0.559 1 403 ,
Chro.80295 AAEL01000033 0.562 1 3 950 3
Chro.80011 AAELOl 000333 0.565 1 879 5
Chro.80066 AAEL01000139 0.57 1 356 4
Chro.70105 AAEL01000215 0.586 1 61
Chro.20047 AAEL01000097 0.593 1
Chro.60194 AAEL01000133 0.593 1 3 •
Chro.70238 AAEL01000006 0.603 1 3 1
Ul
OO Chro.10153 AAEL01000008 0.633 1 1
Chro.70431 AAEL01000028 0.642 1 1237 .
Chro.70043 AAELOlOOOOll 0.648 1 1
Chro.60092 AAEL01000412 0.652 1 445
Chro.10074 AAEL01000049 0.674 1 3 402 3
Chro.30147 AAEL01000232 0.681 1 • 1
Chro.80410 AAEL01000453 0.688 1
Chro.40396 AAEL01000198 0.693 1 403
Chro.80015 AAEL01000034 0.706 1 1
Chro.50147 AAEL01000134 0.71 1 2 256
Chro.10146 AAEL01000008 0.711 1 . yes 1
Chro.50104 AAEL01001360 0.712 1 m
Chro.80537 AAELOl 000565 0.715 1
Chro.60433 AAELOl 000124 0.735 1 * *
Cliro.70569 AAEL01000285 0.751 1 519 1
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch Gene Contig Accession Signal anchor peptide TMHMM GO EC Mito gene Gpi anchor cleavage coil
Chro.40506 AAELOl 000355 0.753 1 3 5
Chro.50150 AAEL01000539 0.774 1 m m
Chro.50150 AAEL01000539 0.774 1
Chro.70147 AAEL01000088 0.775 1
Chro.60376 AAEL01000518 0.78 1 276
Chro.80088 AAEL01000778 0.784 1
Chro.40281 AAEL01000058 0.794 1 340
Chro.60014 AAEL01000376 0.796 1 177
Chro.10402 AAEL01000547 0.813 1 116
Chro.30074 AAEL01000053 0.813 1
Chro.30306 AAELOlOOl 198 0.823 1 m
Chro.70500 AAEL01000131 0.826 1 3 1864
Chro.70164 AAELOl 000003 0.832 1 # 170 1
Chro.60427 AAEL01000113 0.833 1 . yes 2217 2
Chro.10274 AAEL01000022 0.836 1 3 443 .
Chro.20316 AAEL01000136 0.854 1 3 . 1
Chro.60437 AAEL01000124 0.859 1 yes 441
Chro.60352 AAEL01000390 0.86 1 986 2
Chro.80013 AAEL01000034 0.867 1 m 846 3
Chro.40405 AAEL01000089 0.869 1 •
Chro.10232 AAEL01000147 0.869 1
Chro.20105 AAEL01000009 0.87 1 yes •
Chro.80353 AAEL01000116 0.884 1 212
Chro.40480 AAELOl 000480 0.885 1 1
Chro.30011 AAEL01000396 0.885 1 351
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch_Gene Contig Accession Signal anchor peptide TMHMM GO EC Mito gene Gpi anchor cleavage coil
Chro.80417 AAEL01000122 0.899 1
Chro.20459 AAEL01000341 0.9 1 1230
Chro.80014 AAELOl 000034 0.901 1
Chro.60626 AAEL01000176 0.907 1 1252
Chro.30096 AAEL01000185 0.91 1
Chro.80474 AAELOl 000085 0.915 1 423
Chro.80327 AAEL01000030 0.927 1 3 538
Chro.10057 AAELOIOOOIOO 0.927 1 . 948 2
Chro.10390 AAELOl 000209 0.928 1 3 663
Chro.20228 AAEL01000258 0.931 1 144 1
Chro.20274 AAEL01000310 0.941 1 156 •
Chro.60485 AAEL01000272 0.943 1
Chro.30010 AAEL01000507 0.949 1 1020 2
Chro.40149 AAEL01000288 0.952 1 454
Chro.80312 AAEL01000121 0.955 1 670 •
Chro.70457 AAEL01000004 0.958 1
Chro.20427 AAEL01000397 0.96 1 •
Chro.60355 AAELOl 000238 0.96 1 626
Chro.40010 AAEL01000613 0.96 1 132
Chro.80209 AAELOl 000026 0.961 1 m 337 1
Chro.10391 AAEL01000209 0.962 1 491
Chro.30207 AAEL01000247 0.967 1 t 1
Chro.10032 AAEL01000091 0.967 1 3
Chro.70298 AAEL01000069 0.968 1 3 1241 ;
Chro.70535 AAEL01000048 0.968 1 yes 361 •
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch_Gene Contig Accession Signal anchor peptide TMHMM GO EC Mito gene Gpi anchor cleavage coil
Chro.60022 AAELOl 000052 0.968 1 3 • • 273
Chro.50108 AAEL01000032 0.971 1 3 1
Chro.60625 AAEL01000176 0.973 1
Chro.60272 AAEL01000012 0.973 1 282
Chro.70146 AAEL01000088 0.976 1
Chro.50236 AAELOl 000054 0.977 1
Chro.10427 AAELOl 000183 0.98 1
Chro.60314 AAEL01000037 0.98 1 390
Chro.70170 AAEL01000003 0.981 1
Chro.10365 AAEL01000504 0.981 1
Chro.60163 AAEL01000241 0.983 1 188
Chro.10416 AAEL01000346 0.984 1 . 760
Chro.10212 AAEL01000191 0.984 1 m 471
Chro.70514 AAEL01000192 0.985 1 • 1
Chro.80293 AAEL01000033 0.985 1 m
Chro.50392 AAEL01000184 0.986 1 1884 1
Chro.40249 AAEL01000337 0.986 1 . 518
Chro.20179 AAEL01000071 0.986 1 3 yes 440 #
Chro.50392 AAEL01000184 0.986 1 1884 1
Chro.70350 AAEL01000016 0.988 1 1 393 .
Chro.50415 AAEL01000381 0.99 1 . 466 1
Chro.60142 AAELOl 000025 0.99 1 yes 523 1
Chro.60106 AAEL01000498 0.99 1 t . 1
Chro.20268 AAELOl 000334 0.99 1 327
Chro.80604 AAEL01000015 0.992 1 yes 796 1
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch_Gene Contig Accession Signal anchor peptide TMHMM GO EC Mito gene Gpi anchor cleavage coil
Chro.30383 AAEL01000020 0.993 1 1483
Chxo.30088 AAEL01000081 0.993 1
Chro.80292 AAEL01000033 0.993 1
Chro.10411 AAEL01000128 0.993 1
Chro.60146 AAEL01000162 0.994 1 1319
Chro.20404 AAEL01000409 0.994 1 75
Chro.80136 AAELOl 000509 0.994 1 yes 480
Chro.60234 AAEL01000541 0.994 1
Chro.60146 AAEL01000162 0.994 1 1319
Chro.80206 AAEL01000026 0.995 1
K> Chro.40280 AAELOlOOl 193 0.996 1
Chro.60460 AAEL01000221 0.997 1
Chro.80404 AAEL01000161 0.997 1 3 1104 1
Chro.70256 AAEL01000077 0.997 1 513
Chro.60315 AAEL01000037 0.997 1 yes 227 •
Chro.60419 AAELOl 000096 0.997 1
Chro.10167 AAEL01000061 0.997 1 •
Chro.30111 AAEL01000339 0.998 1 yes 104
Chro.70472 AAEL01000004 0.998 1 1093
Chro.00007 AAEL01000267 0.998 1 1
Chro.50157 AAEL01000074 0.999 1 3 1
Chro.60270 AAEL01000012 0.999 1 322
Chro.60110 AAEL01000284 0.999 1 3 496
Chro.70518 AAELOl 000192 1 1 361
Chro.30418 AAEL01000706 1 yes 49 •
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch Gene Contig Accession Signal anchor peptide TMHMM GO EC Mito gene Gpi anchor cleavage coil
Chro.60444 AAEL01000359 1 yes 280 Chro.20264 AAEL01000321 1 Chro.40283 AAEL01000058 1 3 Chro.40468 AAELOl 000722 1 1 Chro.40508 AAEL01000196 1 325 Chro.10275 AAEL01000022 1 900 Chro.70082 AAEL01000255 1 278 Chro.40137 AAELOl 000424 1 3 584 Chro.40132 AAEL01000559 1 yes Chro.70220 AAELOl 000006 1 93 Chro.40042 AAEL01000293 1 564 Chro.40030 AAELOl 000577 1 269 Chro.30061 AAEL01000014 1 413 Chro.60247 AAELOl 000443 1 187 Chro.20071 AAEL01000203 1 Chro.40178 AAELOl 000457 1 Chro.40222 AAEL01000039 1 3 212 Chro.70513 AAELOl 000192 1 3 146 Chro.50382 AAEL01000699 1 385 Chro.60357 AAEL01000238 1 Chro.70179 AAEL01000003 1 3 44 Chro.50259 AAELOl 000331 1 Chro.50120 AAELOl 000032 1 Chro.50412 AAEL01000786 1 Chxo.50457 AAEL01000428 1 321
Table 10: Vaccine Candidates
Signal Gpi Coiled
Ch_Gene Contig Accession Signal anchor peptide TMHMM C EC Mito gene Gpi anchor cleavage coil
Chro.40438 AAEL01001053 1 t 144 Chro.50126 AAELOl 000070 1 . 44 • Chro.50028 AAEL01000042 1 3 Chro.80443 AAEL01000027 1 3 yes . 307 Chro.50194 AAEL01000013 1 2 yes . 277 • Chro.50248 AAELOl 000393 1 Chro.50247 AAELOl 000434 1 78 Chro.50137 AAEL01000275 1 577 1 Chro.60597 AAEL01000444 1 Chro.40483 AAEL01000757 1 507 Chro.20288 AAELOl 000188 1 yes . 335 Chro.20282 AAEL01000188 1 3 251 • Chro.20233 AAELOl 000772 1 Chro.20084 AAEL01001202 1 • Chro.20364 AAELOl 000045 1 113 Chro.20402 AAELOl 000409 1 . . . 1 Chro.20400 AAELOl 000152 1 651 • Chro.80164 AAEL01000399 1 Chro.20363 AAEL01000149 1 3 810 2 Chro.20358 AAEL01000149 1 3 45 Chro.80338 AAELOl 000030 1 2 1335 Chro.10389 AAELOl 000209 1 98 Chro.80282 AAEL01000059 1 783 Chro.20060 AAEL01000151 1 3 Chro.20358 AAEL01000149 1 3 45
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch_Gene Contig Accession Signal anchor peptide TMHMM GO EC Mito gene Gpi anchor cleavage coil
Chro.20126 AAEL01000205 1 3 283 2 Chro.30326 AAEL01001092 1 Chro.40081 AAEL01000083 1 637 Chro.30338 AAEL01000219 1 Chro.40139 AAEL01000424 1 Chro.30200 AAEL01000146 1 1 Chro.30316 AAEL01000501 1 1 Chro.30307 AAEL01000197 1 Chro.30027 AAEL01000506 1 • Chro.30447 AAEL01000674 1 121 Chro.60593 AAEL01000495 1 275 1 Chro.30485 AAEL01000200 1 185 1 Chro.30385 AAEL01000020 1 1206 . Chro.30444 AAEL01000254 1 yes 401 1 Chro.30092 AAEL01001248 1 82 . Chro.30092 AAEL01001248 1 82 Chro.30183 AAEL01000044 1 128 Chro.50074 AAEL01000661 1 Chro.30142 AAEL01000430 1 69 Chro.30050 AAEL01000063 1 Chro.30144 AAELOl 000232 1 Chro.80037 AAEL01000066 1 Chro.70544 AAEL01000861 1 Chro.50433 AAEL01000325 1 115 Chro.70376 AAEL01000047 1
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch Gene Contig Accession Signal anchor peptide TMHMM GO EC Mito gene Gpi anchor cleavage coil
Chro.70503 AAEL01000131 1 Chro.80020 AAEL01000034 1 108 Chro.80477 AAELO 1000085 1 Chro.80037 AAEL01000066 1 Chro.70612 AAEL01000177 1 Chro.70605 AAEL01000249 1 199 Chro.70361 AAEL01000016 1 Chro.70351 AAELOl 000016 1 Chro.60079 AAEL01001210 1 140 Chro.70310 AAEL01000377 1 Chro.70347 AAEL01000919 1 Chro.30169 AAELOl 000044 1 465 Chro.60189 AAEL01000021 1 3 518 Chro.70246 AAEL01000115 1 3 Chro.70383 AAEL01000047 1 Chro.60156 AAEL01000553 1 111 Chro.70309 AAEL01000377 1 546 Chro.50058 AAELOl 000156 1 716 Chro.80489 AAEL01000611 1 Chro.80201 AAEL01000026 1 274 Chro.80435 AAELOl 000036 1 3 Chro.30434 AAEL01000627 1 3 Chro.60180 AAEL01000021 1 yes 46 Chro.80531 AAEL01000233 1 Chro.80531 AAEL01000233 1
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch_Gene Contig Accession Signal anchor peptide TMHMM GO EC Mito gene Gpi anchor cleavage coil
Chro.80521 AAEL01000635 1 • • • 1
Chro.80586 AAEL01000170 1 • •
Chro.80092 AAEL01000655 1 119
Chro.70044 AAEL01000011 1 3 1
Chro.80157 AAEL01000426 1 274
Chro.80143 AAELOl 000815 1 235
Chro.50480 AAELOl 000400 1 3 438
Chro.80344 AAEL01000817 1 • • .
Chro.80343 AAEL01000030 1 63
Chro.80244 AAEL01000320 1 • • 1
-4 Chro.80243 AAEL01000623 1 m m yes . 409
Chro.80255 AAEL01000079 1 3 418
Chro.10281 AAEL01000022 1 3 • • . .
Chro.40273 AAEL01000849 1 279
Chro.60266 AAELOl 000527 1 .
Chro.60598 AAEL01000444 1 319
Chro.40150 AAEL01000288 1 569 1
Chro.40166 AAEL01000235 1 112 1
Chro.10080 AAELOl 000489 1 # 263
Chro.20216 AAELOl 000248 1 m 204
Chro.60353 AAEL01000949 1 102 .
Chro.70322 AAEL01000356 1 .
Chro.60303 AAEL01000094 1 • 1
Chro.60028 AAELOlOOl 124 1 β • 1
Chro.60051 AAEL01001084 1
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch_Gene Contig Accession Signal anchor peptide TMHMM GO EC Mito gene Gpi anchor cleavage coil
Chro.60169 AAEL01000691 1 Chro.20327 AAELOIOOOIOI 1 Chro.60101 AAEL01000137 1 183 Chro.60104 AAEL01000137 1 Chro.70103 AAEL01000215 1 113 Chro.70220 AAEL01000006 1 93 Chro.70160 AAEL01000003 1 Chro.70066 AAEL01000175 1 Chro.70091 AAELOl 000473 1 282 Chro.70085 AAEL01000282 1
OO Chro.70211 AAEL01000006 1 Chro.70268 AAELOl 000117 1 64 Chro.60090 AAEL01000774 1 3 Chro.70210 AAELOl 000006 1 1211 Chro.60466 AAEL01000169 1 732 Chro.20248 AAEL01000075 1 yes 1648 Chro.60503 AAEL01000847 1 55 Chro.10292 AAELOl 000283 1 Chro.50335 AAEL01000517 1 Chro.70028 AAELOl 000031 1 Chro.40410 AAEL01000604 1 Chro.60503 AAELOl 000847 1 55 Chro.50248 AAEL01000393 1 Chro.60519 AAEL01000040 1 767 Chro.10241 AAEL01000555 1
Table 10: Vaccine Candidates
Signal Gpi Coiled-
Ch_Gene Contig Accession Signal anchor peptide TMHMM GO EC Mito gene Gpi anchor cleavage coil
Chro.10033 AAEL01000091 1 3 Chro.10325 AAEL01000029 1 Chro.10170 AAEL01000061 1 Chro.60435 AAEL01000124 1 501 Chro.10077 AAELOl 000440 1 54 Chro.50308 AAEL01000301 1 Chro.10317 AAELOIOOOOIO 1 Chro.10197 AAEL01000338 1 894 Chro.70289 AAEL01000208 1 221 Chro.10403 AAELOl 000547 1 yes 478
Table 11: Summary of Results
O
Figure imgf000372_0001
Table 12: Numerical results of parasite small subunit rRNA detection and quantification in HCT-8 cells infected with Cryptosporidium*
Sample Detector Quanti ty
Well Name Name Reporter Task Ct (picogram) Ct Mean
253 CrypA CryplδS FAM Std 11.770909 5000
254 CrypA CryplδS FAM Std 11.692187 5000
255 CrypA Crypl8S FAM Std 11.575516 5000
280 CrypA Crypl8S FAM Std 13 853597 1000
281 CrypA Crypl8S FAM Std 13.590645 1000
282 CrypA CryplδS FAM Std 13.463628 1000
283 CrypA CryplδS FAM Std 16.330664 200
284 CrypA Crypl8S FAM Std 16.366682 200
285 CrypA CryplδS FAM Std 15.90779 200
286 CrypA CryplδS FAM Std 18.330755 40
287 CrypA CryplδS FAM Std 18.53698 40
288 CrypA Crypl8S FAM Std 18.356537 40
313 HIA Crypl8S FAM Unkn Undeter 0
315 HIA CryplδS FAM Unkn Undeter 0
316 LVA Crypl8S FAM Unkn lδ.677315 33
317 LVA Crypl8S FAM Unkn 18.917334 28 18.82753
318 LVA Crypl8S FAM Unkn 18.887953 28
319 HI3 CryplδS FAM Unkn Undeter 0
320 HI3 CryplδS FAM Unkn Undeter 0
321 HI3 Crypl8S FAM Unkn Undeter 0
322 LV3 CryplδS FAM Unkn 19.93794 13
323 LV3 Crypl8S FAM Unkn 20 637247 8 20.31858
324 LV3 Crypl8S FAM Unkn 20.38055 10
325 HI4 Crypl8S FAM Unkn Undeter 0
326 HI4 CryplδS FAM Unkn Undeter 0
327 HI4 Crypl8S FAM Unkn Undeter 0
328 LV8 Crypl8S FAM Unkn 21.146332 6
329 LV8 Crypl8S FAM Unkn 21.05012 6 21 2334
330 LV8 Crypl8S FAM Unkn 21.503738 4
331 HI12 Crypl8S FAM Unkn Undeter 0
332 HI12 CryplδS FAM Unkn Undeter 0
333 HI12 CryplδS FAM Unkn Undeter 0
334 LVl2 CryplδS FAM Unkn 20.95546 7
335 LVl2 CryplδS FAM Unkn 20.937841 7 20.91369
336 LVl2 CryplδS FAM Unkn 20.846356 0.0070476
262 NTC Crypl8S FAM NTC 32.33444 2.09E-06 31.69137
263 NTC Crypl8S FAM NTC 31.048296 5.18E-06
Figure imgf000373_0001
31.69137
*The results were generated using standard software m the Nucleic Acids Research Facilities at VCU, and are based on the curve plots shown Figure 2 and other similar plots not shown CrypA, purified Cryptosporidium KNA, LV, RNA isolated from HCT-8 cells infected with live Cryptosporidium, HI, RNA isolated from HCT-8 cells infected with heat inactivated Cryptosporidium, A, 3, 4, 8 and 12 denote different experimental infections NTC, assay without added parasite RNA, for determining the baseline Table 13: tRNA
amino chromosom acid e containing length encoded Anticodon Identity score Sequence Id orphan Length: 76 bp Thr Anticodon: TGT at 37-39 (1781-1779) Score: 76.45 SEQ ID NO: 4015 chr_1 Length: 71 bp GIy Anticodon: GCC at 33-35 (178153-178155) Score: 68.87 SEQ ID NO: 4016 chr_1 Length: 73 bp VaI Anticodon: CAC at 34-36 (268891-268893) Score: 79.85 SEQ ID NO: 4017 chr_1 Length: 73 bp His Anticodon: GTG at 35-37 (458886-458888) Score: 65.15 SEQ ID NO: 4018 chr_1 Length: 81 bp Leu Anticodon: TAG at 36-38 (677633-677635) Score: 64.71 SEQ ID NO: 4019 chrj Length: 74 bp Lys Anticodon: TTT at 35-37 (603749-603747) Score: 75.42 SEQ ID NO: 4020 chr_2 Length: 85 bp Leu Anticodon: TAA at 36-38 (344532-344534) Score: 68.11 SEQ ID NO: 4021 chr_2 Length: 73 bp Phe Anticodon: GAA at 34-36 (667552-667554) Score: 76.42 SEQ ID NO: 4022 chr_2 Length: 72 bp Cys Anticodon: GCA at 33-35 (672662-672660) Score: 72.24 SEQ ID NO: 4023 chr_3 Length: 74 bp Met Anticodon: CAT at 35-37 (139865-139867) Score: 65.00 SEQ ID NO: 4024 chr_3 Length: 72 bp GIy Anticodon: TCC at 34-36 (325060-325062) Score: 59.90 SEQ ID NO: 4025 chr_3 Length: 73 bp GIu Anticodon: CTC at 35-37 (930667-930669) Score: 75.02 SEQ ID NO: 4026 chr_3 Length: 73 bp Trp Anticodon: CCA at 34-36 (1011588-1011586) Score: 63.53 SEQ IDNO 4027 chr_3 Length: 72 bp GIu Anticodon: TTC at 34-36 (843268-843266) Score: 70.92 SEQ ID Nt/ 4028 chr_3 Length: 73 bp Arg Anticodon: TCG at 34-36 (484869-484867) Score: 67.42 SEQ ID NO: 4029 chr_4 Length: 72 bp Pro Anticodon: TGG at 33-35 (330755-330757) Score: 71.52 SEQ ID NO: 4030 chr_4 Length: 74 bp Asn Anticodon: GTT at 35-37 (521942-521944) Score: 85.22 SEQ ID NO: 4031 chr_4 Length: 74 bp VaI Anticodon: TAC at 35-37 (629387-629389) Score: 74.92 SEQ ID NO: 4032 chr_4 Length: 75 bp Ne Anticodon: TAT at 36-38 (635627-635629) Score: 74.00 SEQ ID NO: 4033 chr_4 Length: 72 bp Thr Anticodon: CGT at 33-35 (635308-635306) Score: 68.15 SEQ ID NO: 4034 chr_4 Length: 83 bp Tyr Anticodon: GTA at 33-35 (491639-491637) Score: 66.44 SEQ ID NO- 4035 chr_4 Length: 85 bp Leu Anticodon: CAA at 36-38 (423329-423327) Score: 74.57 SEQ ID NO: 4036 chr_4 Length: 72 bp Pro Anticodon: AGG at 33-35 (330148-330146) Score: 73.02 SEQ ID NO: 4037 chr_5 Length: 72 bp Asp Anticodon: GTC at 34-36 (676354-676352) Score: 74.94 SEQ ID NO: 4038 chr_5 Length: 73 bp Thr Anticodon: AGT at 34-36 (660750-660748) Score: 76.65 SEQ ID NO: 4039 chr_5 Length: 74 bp Arg Anticodon: TCT at 35-37 (236085-236083) Score: 75.87 SEQ ID NO: 4040 chr_5 Length: 74 bp Arg Anticodon: ACG at 35-37 (235912-235910) Score: 70.31 SEQ ID NO: 4041 chr_6 Length: 72 bp Pro Anticodon: CGG at 33-35 (512461-512463) Score: 72.12 SEQ ID NO: 4042 chr_6 Length: 71 bp GIn Anticodon: TTG at 33-35 (546398-546400) Score: 68.09 SEQ ID NO: 4043 chr_6 Length: 73 bp VaI Anticodon: AAC at 34-36 (1112263-1112265) Score: 73.07 SEQ ID NO: 4044 chr_6 Length: 74 bp Leu Anticodon: CAG at 35-37 (1062579-1062577) Score: 61.91 SEQ ID NO: 4045 chr_6 Length: 74 bp Leu Anticodon: GAG at 35-37 (857072-857070) Score: 57.74 SEQ ID NO: 4046 chr_6 Length: 83 bp Ser Anticodon: TGA at 35-37 (770474-770472) Score: 84.10 SEQ ID NO: 4047 chr_6 Length: 73 bp Arg Anticodon: CCT at 34-36 (320667-320665) Score: 75.54 SEQ ID NO: 4048 chr_6 Length: 82 bp Ser Anticodon: AGA at 34-36 (220308-220306) Score: 80.58 SEQ ID NO: 4049 chr_7 Length: 74 bp Met Anticodon: CAT at 35-37 (156815-156817) Score: 65.16 SEQ ID NO: 4050 chr_7 Length: 82 bp Ser Anticodon: GCT at 34-36 (750719-750717) Score: 78.53 SEQ ID NO: 4051 chr_7 Length: 71 bp GIy Anticodon: CCC at 33-35 (353931-353929) Score: 61.50 SEQ ID NO: 4052 chr_8 Length: 74 bp lie Anticodon: AAT at 35-37 (721625-721627) Score: 84.44 SEQ ID NO: 4053 chr_8 Length: 73 bp Ala Anticodon: AGC at 34-36 (1018248-1018250) Score: 54.27 SEQ ID NO: 4054 chr_8 Length: 82 bp Ser Anticodon: CGA at 34-36 (1088480-1088482) Score: 76.80 SEQ ID NO: 4055 chr_8 Length: 72 bp GIn Anticodon: CTG at 34-36 (1161624-1161626) Score: 71.74 SEQ ID NO: 4056 chr_8 Length: 73 bp Ala Anticodon: TGC at 34-36 (1177971-1177973) Score: 71.91 SEQ ID NO: 4057 chr_8 Length: 72 bp Ala Anticodon: CGC at 33-35 (1195545-1195543) Score: 71.72 SEQ ID NO: 4058 chr 8 Length: 74 bp Lys Anticodon: CTT at 35-37 (382723-382721 ) Score: 80.68 SEQ ID NO: 4059 Table 14: Ribosomal RNA Ribosomal RNA SEQ ID NO:
>rRNA-AAEL01000024-25S-5.8S-18S|AAEL01000024 [organism=Cryptosporidium hominis] [StTaUi=TUSOl][IeCh=WgS][ClIrOnIOSOmB=?] 4003
^RNA-AAELOlOOOOβS-lSS-S.SS-lδSIAAELOlOOOOβS [organism=Cryptosporidium hominis] [strain=TU502] [tech=wgs] [chromosome=2] 4004
>rRNA- AAELO 1000081-5S | AAELO 1000081 [organism=Cryptosporidium hominis][strain=TU502][tech=wgs][chromosome=3] 4005
>rRNA- AAELOl 000159-5S|AAEL01000159 [organism=Cryptosρoridium hominis] [strain=TU502] [tech=wgs] [chromosome=7] 4006
>rRNA-AAEL01000159-5 S I AAELO 1000159 [organism=Cryptosporidium hominis] [strain=TU502] [tech=wgs] [chromosome=7] 4007 w >rRNA-AAEL01000159-5S|AAEL01000159 [organism=Cryptosporidium w hominis] [stxain=TU502] [tech=wgs] [chromosome=7] 4008
>rRNA-AAEL01000195-18S|AAEL01000195 [organism=Cryptosporidium hominis] [strain=TU502] [tech=wgs] [chromosome=2] 4009
>rRNA-AAEL01000242-18S-5.8S-|AAEL01000242 [organism=Cryptosporidium hominis] [strain=TU502] [tech=wgs] [chromosome=2] 4010
>rRNA-AAEL01000364-25S-5.8S-l 8S|AAEL01000364 [organism=Cryptosporidium hominis] [strain=TU502] [tech=wgs] [chromosome=2] 4011
>rRNA-AAEL01000664-25S-5.8S-|AAEL01000664 [organism=Cryptosporidium hominis] [strain=TU502][tech=wgs][chromosome=2] 4012
>rRNA-AAEL01000893-18S|AAEL01000893 [organism=Cryptosporidium hominis] [strain=TU502][tech=wgs][chromosome=8] 4013
^RNA-AAELOlOOllOS-lδSiAAELOlOOllOS [organism=Cryptosporidium
Figure imgf000375_0001
4014

Claims

CLAIMSWe claim:
1. A an amino acid sequence as represented in a SEQ ID selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, SEQ ID NO: 22, and
SEQ ID NO: 24.
2. A nucleotide sequence as represented in a SEQ ID selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ DD NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, and SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 21, SEQ ID NO: 23 and SEQ ID NOS: 25-4000.
3. A method of diagnosing C. hominis infection in a patient in need thereof, comprising the step of obtaining a biological sample from said patient, amplifying nucleotide sequences from said sample, and determining infection based on whether one or more amplicons are produced.
4. A method for immunizing a patient against C. hominis infection, comprising the step of administering to said patient a non-virulent C. hominis peptide or nucleotide in an amount sufficient to permit said patient to mount an antibody response to said non- virulent C. hominis peptide or nucleotide.
5. A method for detecting C. hominis in a sample, comprising the steps of obtaining said sample; amplifying nucleotide sequences from said sample; detecting amplicons produced in said step of amplifying, wherein production of amplicons indicates the presence of C. hominis in said sample.
6. The method of claim 5, further comprising the step of quantifying an amount of said amplicons.
7. The method of claim 5, wherein said sample is an environmental sample.
8. The method of claim 7, wherein said sample is water.
9. The method of claim 5, wherein said sample includes Cryptosporidium species other than C. hominis and said determining step discriminates said C. hominis from said Cryptosporidium species other than C. hominis.
10. An array for assessing the presence or expression of genes in C. hominis, said array comprising probes comprising nucleotide sequences homologous to nucleotide sequences of said C. hominis.
11. The array of claim 10, wherein said nucleic acid probes are 70 nucleotides in length.
12. An array for assessing the interaction of C. hominis macromolecules, said array comprising probes comprising nucleotide sequences homologous to nucleotide sequences of said C. hominis, or amino acid sequences encoded by nucleotide sequences of said C. hominis, or antibodies to said nucleotide sequences or said amino acid sequences.
PCT/US2005/031657 2004-09-07 2005-09-07 Cryptosporidium hominis genes and gene products for chemotherapeutic, immunoprophylactic and diagnostic applications Ceased WO2006044045A2 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US11/575,245 US8114976B2 (en) 2004-09-07 2005-09-07 Cryptosporidium hominis genes and gene products for chemotherapeutic, immunoprophylactic and diagnostic applications

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US60735604P 2004-09-07 2004-09-07
US60/607,356 2004-09-07

Publications (2)

Publication Number Publication Date
WO2006044045A2 true WO2006044045A2 (en) 2006-04-27
WO2006044045A3 WO2006044045A3 (en) 2006-10-05

Family

ID=36203367

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2005/031657 Ceased WO2006044045A2 (en) 2004-09-07 2005-09-07 Cryptosporidium hominis genes and gene products for chemotherapeutic, immunoprophylactic and diagnostic applications

Country Status (2)

Country Link
US (1) US8114976B2 (en)
WO (1) WO2006044045A2 (en)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009055688A3 (en) * 2007-10-26 2009-12-30 Virginia Commonwealth University Vaccine targets and delivery systems for cryptosporidium
WO2010136209A1 (en) * 2009-05-28 2010-12-02 ETH Zürich N-glycan core beta-galactosyltransferase and uses thereof
CN111116727A (en) * 2020-01-14 2020-05-08 中国农业大学 Eimeria tenella rod-shaped body protein 41 and preparation method and application thereof
CN111118189A (en) * 2020-01-07 2020-05-08 西北农林科技大学 A specific primer for Cryptosporidium parvum and its PCR detection method and application
CN111514284A (en) * 2020-04-27 2020-08-11 中国农业大学 Chicken coccidiosis multivalent recombinant protein vaccine and preparation method and application thereof
CN118667987A (en) * 2024-06-20 2024-09-20 中国农业科学院上海兽医研究所(中国动物卫生与流行病学中心上海分中心) Application of chicken coccidian ribosomal proteins RPL27 and RPP0 in chicken coccidian drug resistance regulation and control
WO2024243278A1 (en) * 2023-05-22 2024-11-28 University Of Virginia Cryptosporidium antigens

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN115820922B (en) * 2022-12-19 2024-07-05 领航基因科技(杭州)有限公司 Primer probe combination and kit for detecting cryptococcus
CN117004747B (en) * 2023-08-16 2024-08-13 河北科技师范学院 Primer probe set for multiplex real-time fluorescence PCR, detection method and application

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6514697B1 (en) 1992-05-29 2003-02-04 The Regents Of The University Of California Methods for detection of Crytosporidium species and isolates and for diagnosis of Cryptosporidium infections

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009055688A3 (en) * 2007-10-26 2009-12-30 Virginia Commonwealth University Vaccine targets and delivery systems for cryptosporidium
WO2010136209A1 (en) * 2009-05-28 2010-12-02 ETH Zürich N-glycan core beta-galactosyltransferase and uses thereof
AU2010252230B2 (en) * 2009-05-28 2013-07-04 Eth Zurich N-glycan core beta-galactosyltransferase and uses thereof
CN111118189A (en) * 2020-01-07 2020-05-08 西北农林科技大学 A specific primer for Cryptosporidium parvum and its PCR detection method and application
CN111116727A (en) * 2020-01-14 2020-05-08 中国农业大学 Eimeria tenella rod-shaped body protein 41 and preparation method and application thereof
CN111514284A (en) * 2020-04-27 2020-08-11 中国农业大学 Chicken coccidiosis multivalent recombinant protein vaccine and preparation method and application thereof
WO2024243278A1 (en) * 2023-05-22 2024-11-28 University Of Virginia Cryptosporidium antigens
CN118667987A (en) * 2024-06-20 2024-09-20 中国农业科学院上海兽医研究所(中国动物卫生与流行病学中心上海分中心) Application of chicken coccidian ribosomal proteins RPL27 and RPP0 in chicken coccidian drug resistance regulation and control

Also Published As

Publication number Publication date
US8114976B2 (en) 2012-02-14
US20090304732A1 (en) 2009-12-10
WO2006044045A3 (en) 2006-10-05

Similar Documents

Publication Publication Date Title
Ehrenkaufer et al. Identification of developmentally regulated genes in Entamoeba histolytica: insights into mechanisms of stage conversion in a protozoan parasite
Mitreva et al. Biology and genome of Trichinella spiralis
WO2002057303A2 (en) Protein-protein interactions between shigella flexneri polypeptides and mammalian polypeptides
Stucki et al. Eimeria tenella: characterization of a 5S ribosomal RNA repeat unit and its use as a species-specific probe
Schirmeister et al. Evaluation of molecular methods to discriminate the closely related species Vibrio fluvialis and Vibrio furnissii
Wendte et al. Limited genetic diversity among Sarcocystis neurona strains infecting southern sea otters precludes distinction between marine and terrestrial isolates
Wang et al. Gene discovery in the Entamoeba invadens genome
RU2458141C1 (en) Method for identifying toxigenic v cholerae o1 strains, determining its biovar and differentiating biovar eltor strains by typical and changed by multiplex polymerase chain reaction, and test system for implementation thereof
WO2006044045A2 (en) Cryptosporidium hominis genes and gene products for chemotherapeutic, immunoprophylactic and diagnostic applications
Burnens et al. Evolutionary origin of a monophasic Salmonella serovar, 9, 12: l, v:-, revealed by IS200 profiles and restriction fragment polymorphisms of the fljB gene
Lew et al. Molecular approaches to detect and study the organisms causing bovine tick borne diseases: babesiosis and anaplasmosis
US9011878B2 (en) Vaccine strains of Brachyspira hyodysenteriae
Hodgkinson Molecular diagnosis and equine parasitology
CN1798761A (en) Enterococcus antigens
Verra et al. Contrasting signatures of selection on the Plasmodium falciparum erythrocyte binding antigen gene family
Igolkina et al. “Candidatus Rickettsia uralica” and “Candidatus Rickettsia thierseensis” are genetic variants of one species
FR3055339A1 (en) METHOD OF IN VITRO DETECTION AND IDENTIFICATION OF ONE OR MORE TARGET PATHOGENS PRESENT IN A BIOLOGICAL SAMPLE
Permadi et al. Isolation of yidRhv Gene from Hypervirulent Klebsiella pneumoniae Indonesia Strain and in silico study of Gene product
Kronstad Serial analysis of gene expression in eukaryotic pathogens
EP2074231B1 (en) A method for specific detection of salmonella spp
Li et al. DupA: a key regulator of the amoebal MAP kinase response to Legionella pneumophila
Bell Regulation of Virulence Gene Transcripts by the Francisella Orphan Response Regulator PmrA: Role of Phosphorylation and Evidence of MglA/SspA Interaction
Lin Mechanisms of the P44-multigene family expression and characterization of the P44 homologous gene MSP2 expression in anaplasma phagocytophilum
Das et al. MOLECULAR ASPECTS OF BACTERIAL GENOME STUDIES
Omsland et al. Exploring the cause of human Q fever: recent advances in Coxiella burnetii research

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KM KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NG NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SM SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU LV MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase
WWE Wipo information: entry into national phase

Ref document number: 11575245

Country of ref document: US