WO2006003179A2 - Antibodies binding to receptors kir2dl1, -2, 3 but not kir2ds4 and their therapeutic use - Google Patents
Antibodies binding to receptors kir2dl1, -2, 3 but not kir2ds4 and their therapeutic use Download PDFInfo
- Publication number
- WO2006003179A2 WO2006003179A2 PCT/EP2005/053122 EP2005053122W WO2006003179A2 WO 2006003179 A2 WO2006003179 A2 WO 2006003179A2 EP 2005053122 W EP2005053122 W EP 2005053122W WO 2006003179 A2 WO2006003179 A2 WO 2006003179A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- antibodies
- kir
- kir2dl1
- human
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/42—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against immunoglobulins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2299/00—Coordinates from 3D structures of peptides, e.g. proteins or enzymes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present invention relates to human antibodies, as well as fragments and deriva- fives thereof, which cross-react with and/or block two or more inhibitory KIR receptors pre ⁇ sent on the surface of NK cells, and potentiate NK cell cytotoxicity in mammalian subjects or in a biological sample.
- the invention also relates to methods of making such antibodies, fragments, variants, and derivatives; pharmaceutical compositions comprising the same; and the use of such molecules and compositions, particularly in therapy, to increase NK cell ac- tivity or cytotoxicity in subjects.
- Natural killer (NK) cells are a sub-population of lymphocytes, involved in immunity and in the host immune surveillance system.
- NK cells are mononuclear cell that develop in the bone marrow from lymphoid pro- genitors, and morphological features and biological properties typically include the expres ⁇ sion of the cluster determinants (CDs) CD16, CD56, and/or CD57; the absence of the al ⁇ pha/beta or gamma/delta TCR complex on the cell surface; the ability to bind to and kill tar ⁇ get cells that fail to express "self" major histocompatibility complex (MHC)/human leukocyte antigen (HLA) proteins; and the ability to kill tumor cells or other diseased cells that express ligands for activating NK receptors.
- CDs cluster determinants
- MHC major histocompatibility complex
- HLA human leukocyte antigen
- NK cells are characterized by their ability to bind and kill several types of tumor cell lines without the need for prior immunization or activation. NK cells can also release soluble proteins and cytokines that exert a regulatory effect on the im ⁇ mune system; and can undergo multiple rounds of cell division and produce daughter cells with similar biologic properties as the parent cell. Upon activation by interferons and/or cyto- kines, NK cells mediate the lysis of tumor cells and of cells infected with intracellular patho ⁇ gens by mechanisms that require direct, physical contacts between the NK cell and the tar ⁇ get cell.
- Lysis of target cells involves the release of cytotoxic granules from the NK cell onto the surface of the bound target, and effector proteins such as perforin and granzyme B that penetrate the target plasma membrane and induce apoptosis or programmed cell death.
- effector proteins such as perforin and granzyme B that penetrate the target plasma membrane and induce apoptosis or programmed cell death.
- Normal, healthy cells are protected from lysis by NK cells.
- NK cell activity is regulated by a complex mechanism that involves both stimulating and inhibitory signals.
- the lytic activity of NK cells is regulated by various cell surface receptors that transduce either positive or negative intracellular signals upon interaction with ligands on the target cell. The balance between positive and negative signals transmitted via these recep ⁇ tors determines whether or not a target cell is lysed (killed) by a NK cell.
- NK cell stimulatory signals can be mediated by Natural Cytotoxicity Receptors (NCR) such as NKp30, NKp44, and NKp46; as well as NKG2C receptors, NKG2D receptors, certain activating Killer Ig-like Receptors (KIRs), and other activating NK receptors (Lanier, Annual Review of Immunology 2005;23:225-74).
- NCR Natural Cytotoxicity Receptors
- KIRs Killer Ig-like Receptors
- NK cell inhibitory signals can be mediated by receptors like Ly49, CD94/NKG2A, as well as certain inhibitory KIRs, which recognize major histocompatibility complex (MHC) class l-molecules (Karre et al., Nature 1986;319:675-8; Ohlen et al, Science 1989;246:666-8).
- MHC major histocompatibility complex
- KIRs sometimes also referred to as Killer Inhibitory Receptors, have been charac ⁇ terized in humans and non-human primates, and are polymorphic type 1 trans-membrane molecules present on certain subsets of lymphocytes, including NK cells and some T cells. KIRs interact with determinants in the alpha 1 and 2 domains of the MHC class I molecules and, as described above, distinct KIRs are either stimulatory or inhibitory for NK cells.
- KIRs The nomenclature for KIRs is based upon the number of extracellular domains (KIR2D and KIR3D having two and three extracellular Ig-domains, respectively) and whether the cytoplasmic tail is long (KIR2DL or KIR3DL) or short (KIR2DS or KIR3DS).
- KIR2DL or KIR3DL the cytoplasmic tail is long
- KIR2DS or KIR3DS the cytoplasmic tail is long
- KIR2DS or KIR3DS KIR3DS
- KIR alleles on NK cells is stochastically regulated, meaning that, in a given individual, a given lymphocyte may express one, two, or more different KIRs, de ⁇ pending on the genoptype of the individual.
- the NK cells of a single individual typically ex ⁇ press different combinations of KIRs, providing a repertoire of NK cells with different speci ⁇ ficities for MHC class I molecules.
- Certain KIR gene products cause stimulation of lymphocyte activity when bound to an appropriate ligand.
- the activating KIRs all have a short cytoplasmic tail with a charged transmembrane residue that associates with an adapter molecule having an lmmunoreceptor Tyrosine-based Activation Motifs (ITAMs) which transduce stimulatory signals to the NK cell.
- ITAMs lmmunoreceptor Tyrosine-based Activation Motifs
- ITIM sine-based Inhibitory Motif
- the known inhibitory KIRs include members of the KIR2DL and KIR3DL subfamilies.
- KIR2DL1 Inhibitory KIRs having two Ig domains (KIR2DL) recognize HLA-C allotypes: KIR2DL2 (formerly designated p58.2) and the closely related, allelic gene product KIR2DL3 both recognize "group 1" HLA-C allotypes (including HLA-CwI , -3, -7, and - 8), whereas KIR2DL1 (p58.1 ) recognizes "group 2" HLA-C allotypes (such as HLA-Cw2, -4, - 5 5, and -6), The recognition by KIR2DL1 is dictated by the presence of a Lys residue at posi ⁇ tion 80 of HLA-C alleles.
- KIR2DL2 and KIR2DL3 recognition is dictated by the presence of an Asn residue at position 80 in HLA-C. Importantly, the great majority of HLA-C alleles have either an Asn or a Lys residue at position 80. Therefore, KIR2DL1 , -2, and -3 collectively rec ⁇ ognize essentially all HLA-C allotypes found in humans.
- KIR3DL1 (p70), recognizes an epitope shared by HLA-Bw4 alleles.
- KIR3DL2 p140
- HLA-A3 and -A11 KIR3DL1
- HLA Hu ⁇ man Histocompatibility Antigen
- TM been shown to mediate potent, life-saving anti-tumor responses after allogeneic bone- marrow transplantation in leukemia patients (Ruggeri et al., Science 2002,295:2097-2100).
- the underlying mechanism is believed to be that HLA mismatched hematopoietic transplan ⁇ tation leads to the expansion of donor-derived NK cells expressing KIR which do not recog-
- KIR2DL1 Certain monoclonal antibodies specific for KIR2DL1 have been shown to block the interaction of KIR2DL1 with "group 2" HLA-C allotypes, such as HLA-Cw4 (Moretta et al., J Exp Med 1993;178:597-604), and to promote NK-mediated lysis of target cells that express those HLA-C allotypes. Monoclonal antibodies against KIR2DL2/3 that block the interaction
- Watzl et al. (Tissue Antigens 2000;56:240-247) produced cross-reacting murine an ⁇ tibodies recognizing multiple isotypes of KIRs, but those antibodies did not potentiate the lytic activity of NK cells. Further, Spaggiari et al. (Blood 2002;99:1706-1714 and Blood 2002;100:4098-4107) carried out experiments utilizing numerous murine monoclonal anti- bodies against various KIRs. One of those antibodies, NKVSF1 (also known as Pan2D), was reported to recognize a common epitope of KIR2DL1 (CD158a), KIR2DL2 (CD158b) and KIR2DS4 (p50.3). Shin et al.
- This invention provides novel and useful human antibodies that specifically bind to KIR2DL1 and at least one of KIR2DL2 and KIR2DL3, or to all three of these KIRs, and/or human antibodies which potentiate NK-cell lytic activity by blocking the interactions between one or more such KIRs and HLA-C. Fragments and derivatives of such antibodies are also provided.
- the invention also pertains to novel and useful antibodies, antibody fragments, and derivatives of antibodies, which comprise VH and VL sequences substantially identical to those of human antibodies 1 -7F9 and 1 -4F1 , as described herein.
- the invention also pro ⁇ vides nucleic acids comprising nucleotide sequences encoding such antibodies; vectors comprising such nucleic acids; host cells and organisms comprising such nucleic acids and/or vectors; and compositions, such as pharmaceutically acceptable compositions and kits, comprising such proteins, nucleic acids, vectors, and/or cells and typically one or more additional ingredients that can be active ingredients or inactive ingredients that promote for ⁇ mulation, delivery, stability, or other characteristics of the composition (e.g., various carriers).
- the invention further provides various new and useful methods making and using such anti ⁇ bodies, nucleic acids, vectors, cells, organisms, and/or compositions, such as in the modula- tion of KIR-mediated biological activities, for example in the treatment of diseases related thereto.
- the invention provides a human or humanized antibody that binds to each one of KIR2DL1 , KIR2DL2, and KIR2DL3, but which does not bind to KIR2DS4. In one embodiment, the antibody further does not bind to KIR2DS3. In another embodiment, the human or humanized antibody blocks the binding of at least one of KIR2DL1 , KIR2DL2, and KIR2DL3 to an HLA-C class I molecule. In a further embodiment, the antibody may block the binding of an HLA-Cw4 molecule to KIR2DL1 , and the binding of an HLA-Cw3 molecule to at least one of KIR2DL2 or KIR2DL3.
- the antibody may block the binding of an HLA-Cw4 molecule to residues M44, F45 and D72 of the extracellular portion of KIR2DL1 (SEQ ID NO:23).
- the antibody potentiates the lytic activity of an NK cell against a human target cell expressing an HLA-C class I molecule.
- the invention provides a human or humanized antibody that com ⁇ petes with an antibody comprising a light chain variable region comprising the amino acid sequence of SEQ ID NO:15, and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:17, in the binding to at least one of KIR2DL1 , KIR2DL2, and
- the antibody competes with an antibody comprising alight chain variable region comprising the amino acid sequence of SEQ ID NO:15, and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:17, in the binding to each of KIR2DL1 , KIR2DL2, and KIR2DL3.
- the antibody com- prises a light chain variable region comprising the amino acid sequence of SEQ ID NO:15.
- the antibody comprises (a) a heavy chain CDR1 amino acid se ⁇ quence corresponding to residues 31 -35 of SEQ ID NO:17; (b) a heavy chain CDR2 amino acid sequence corresponding to residues 50-65 of SEQ ID NO:17; and (c) a heavy chain CDR3 amino acid sequence corresponding to residues 99-112 of SEQ ID NO:17.
- the antibody may comprise a heavy chain variable region comprising the amino acid se ⁇ quence of SEQ ID NO:17.
- the invention provides an isolated human or humanized antibody that binds to a KIR2DL1 epitope substantially comprising the amino acid residues L38, R41 , M44, F45, N46, D47, T48, L49, R50, I52, F64, D72, Y80, P87, and Y88.
- the invention provides an isolated human or humanized antibody that has a dissociation constant (K d ) for KIR2DL1 of no more than about 0.45 nM and/or a K d for KIR2DL3 of no more than about 0.025 nM.
- the invention also provides a human or humanized antibody or antibody fragment, or a derivative thereof, which has any of the foregoing properties, alone or in any suitable combination.
- the antibody is a monoclonal antibody.
- the antibody is an IgGI , lgG2, lgG3, or lgG4 antibody.
- the antibody may be an lgG4 antibody.
- the invention also provides a nucleic acid encoding the human or humanized anti- body or antibody fragment having any of the foregoing properties, a vector comprising such a nucleic acid, a cell comprising such a vector, and a method of producing a human anti-KIR antibody, comprising culturing such a cell under conditions suitable for expression of the anti- KIR antibody.
- the invention also provides a pharmaceutical composition
- a pharmaceutical composition comprising a human or humanized antibody or antibody fragment having one or more of the foregoing properties or produced by any method, in an amount effective to detectably potentiate NK cell cytotoxicity in a patient, together with a pharmaceutically acceptable carrier or excipient.
- the composi ⁇ tion may, for example, comprise Polysorbate 80, sucrose, or both Polysorbate 80 and su ⁇ crose.
- the invention also provides a method of potentiating NK cell activity in a subject in need thereof, which method comprises administering to the subject an effective amount of any of the foregoing compositions.
- the subject is a patient suffering from cancer.
- the patient may be suffering from a cancer selected from acute myeloid leukaemia, chronic myeloid leukaemia, multiple myeloma, and non-Hodgkin's Iym- phoma.
- the patient may be suffering from a cancer selected from colorectal cancer, renal cancer, ovarian cancer, lung cancer, breast cancer, and malignant melanoma.
- the subject is a patient suffering from an infectious disease.
- the method further comprises administering a therapeutic agent se ⁇ lected from an immunomodulatory agent, a hormonal agent, a chemotherapeutic agent, an anti-angiogenic agent, an apoptotic agent, a second antibody that binds to an inhibitory KIR, an anti-infective agent, a targeting agent, and an adjunct compound.
- Figure 1 depicts the murine monoclonal antibody DF200 binding to a common de- terminant of various human KIR2DL receptors.
- A Clone CP11 , KIR2DL1+, DF200.
- B Clone CP502, KIR2DL3+.
- C Clone CP11 , KIR2DL1 +, Anti-KIR2DL1.
- D Clone CP502, KIR2DL3+, Anti-KIR2DL2/3.
- Figure 2 depicts the murine monoclonal antibody DF200 neutralizing the KIR2DL1- mediated inhibition of NK cell cytotoxicity against Cw4-expressing target cells, showing the reconstitution of lysis with the anti-KIR mAb on C1 R-Cw4 target at effector/target [EfT) ratios of 4/1.
- Figure 3 depicts the murine monoclonal antibody DF200, a Fab fragment of DF200, and conventional murine antibodies specific for either KIR2DL1 (mAbs EB6 and XA-141) or KIR2DL2/3 (mAbs GL183 and Y249) neutralizing the KIR2DL1 -mediated inhibition of cytotox- icity against Cw4-positive target cells, and the KIR2DL2/3-mediated inhibition of NK cell cy ⁇ totoxicity against Cw3-positive target cells.
- B KIR2DL2+, target cells 721.221 -Cw3+.
- D KIR2DL3+, target cells 721.221 - Cw3+.
- Figure 4 depicts reconstitution of cell lysis by NK cells that express KIR2DL1 against HLA-Cw4 positive target cells in the presence of F(ab')2 fragments of the DF200 and EB6 antibodies.
- Target cells 721.221 -Cw4; E/T ratio 1.
- Figure 5 depicts induction of NK-mediated killing by cross-reactive murine (DF200 and NKVSF1 (Pan2D)) and human (1-7F9, 1-4F1 , 1-6F5 and 1-6F1) mAbs, and a murine conventional KIR2DL1 -specific mAb (EB6).
- the mAbs induce (reconstitute) killing by
- Figure 6 depicts induction of NK-mediated killing by the same antibodies as in Fig ⁇ ure 5.
- the mAbs induce (reconstitute) killing by KIR2DL1 -expressing NK cells (YTS- KIR2DL1 ) of B-EBV cells expressing endogenous HLA-Cw4.
- E/T ratio 2.
- A 30 ⁇ g/ml mAb.
- B 10 ⁇ g/ml mAb.
- Figure 7 depicts an epitope map showing results of competitive binding experiments obtained by surface plasmon resonance (BIAcore®) analysis with anti-KIR antibodies to KIR2DL1 , where overlapping circles designate overlap among the mAbs in binding to KIR2DL1.
- Results show that 1 -7F9 is competitive with EB6 and 1 -4F1 , but not with NKVSF1 (Pan2D) and DF200, on KIR2DL1.
- Antibody 1-4F1 in turn is competitive with EB6, DF200, NKVSF1 (Pan2D), and 1-7F9.
- Antibody NKVSF1 (Pan2D) competes with DF200, 1-4F1 , and EB6, but not 1-7F9, on KIR2DL1.
- DF200 competes with NKVSF1 (Pan2D), 1-4F1 , and EB6, but not 1 -7F9, on KIR2DL1.
- Figure 8 depicts an epitope map showing results of competitive binding experiments obtained by BIAcore® analysis with anti-KIR antibodies to KIR2DL3, where overlapping cir ⁇ cles designate overlap in binding to KIR2DL3.
- Results show that 1 -4F1 is competitive with NKVSF1 (Pan2D), DF200, gl183, and 1-7F9 on KIR2DL3.
- 1-7F9 is competitive with DF200, gl183, and 1 -4F1 , but not with NKVSF1 (Pan2D), on KIR2DL3.
- NKVSF1 (Pan2D) competes with DF200, 1-4F1 , and GL183, but not 1-7F9, on KIR2DL3.
- DF200 competes with NKVSF1 (Pan2D), 1-4F1 , and 1-7F9, but not with GL183, on KIR2DL3.
- Figure 9 depicts an epitope map showing results of competitive binding experiments obtained by BIAcore® analysis with anti-KIR antibodies to KIR2DS1 , where overlapping cir- cles designate overlap in binding to KIR2DS1.
- Results show that antibody 1 -4F1 is competi ⁇ tive with NKVSF1 (Pan2D), DF200, and 1 -7F9 on KIR2DS1.
- Antibody 1 -7F9 is competitive with 1 -4F1 , but not competitive with DF200 and NKVSF1 (Pan2D) on KIR2DS1.
- NKVSF1 competes with DF200 and 1-4F1 , but not with 1-7F9, on KIR2DS1.
- DF200 competes with NKVSF1 and 1 -4F1 , but not with 1 -7F9, on KIR2DS1.
- Figure 10 depicts Pan2D (NKVSF1 ) mAb titration demonstrating binding of the mAb to cynomolgus NK cells.
- Figure 11 shows the binding of soluble KIR2DL1 and KIR2DL1 (R131W) mutant to cells.
- A Binding of increasing concentrations of soluble KIR2DL1 -Fc, and a KIR2DL1 (R131W)-hFc mutant, to cells expressing HLA-Cw3 or-Cw4.
- the bound KIR-Fc proteins were detected using a secondary fluorochrome-conjugated antibody, and revealed by flow-cytometry. Mean fluorescence is shown on the y-axis.
- Figure 12 provides a comparative alignment of the amino acid sequences of the light chain variable regions, and light chain CDRs of antibodies DF200 and Pan2D (NKVSF1).
- A Alignment of anti-KIR variable light (VL) regions of DF200 (SEQ ID NO:1) and Pan-2D (SEQ ID NO:2). Numbers above amino acid sequences indicate position respective to initiation of translation Met (+1) in the immature (non-secreted) immunoglobulin.
- B Alignment of CDR- L1 sequences. Residue before: Normally Cys. Residues after: Trp. Typically Trp-Tyr- Leu. Length: 10-17 aa.
- C Alignment of CDR-L2 sequences.
- Figure 13 provides the heavy chain variable region, and the heavy-chain CDRs of antibody DF200.
- A DF-200 VH region, immature protein. The secreted, mature VH starts at position 20: residue Q. The VH region ends with residue S and thereafter the constant region (not shown ) continues.
- B CDR-H1. Residues before: Cys-XXX-XXX-XXX. Resi ⁇ dues after: Trp. Generally Trp-Val or Trp-lle. Length: 10-14 aa. Start: Approximately 22-26 aa from the beginning of the secreted protein.
- C CDR-H2. Residues before: Leu-GIu-Trp- He-GIy but other variations possible.
- Figure 14 depicts the nucleotide and amino acid sequences of the VH and VL se ⁇ quence of human antibody 1-7F9.
- A Translation of HuKIR 1-7F9 mature variable light chain.
- B Nucleotide sequence encoding HuKIR 1-7F9 mature variable light chain.
- C Translation of HuKIR 1-7F9 mature variable heavy chain.
- D Nucleotide sequence encod ⁇ ing HuKIR 1 -7F9 mature heavy chain.
- Figure 15 shows the amino acid sequences of the VH and VL sequences of mono ⁇ clonal antibodies 1-7F9, DF200 (VH sequence: SEQ ID NO:19; VL sequence: SEQ ID NO:21 ), and Pan2D (NKVSF1 ; VH sequence: SEQ ID NO:20; VL sequence: SEQ ID NO:22).
- the CDRs are boxed.
- Figure 16 depicts flow cytometry data, showing binding of the murine antibody, Pan2D (NKVSF1 ) and the human mAbs 1 -7F9 and 1 -4F1 to cells transfected with KIR2DL1 , KIR2DL3, KIR2DS1 , KIR2DS2, KIR2DS3 or KIR2DS4, as indicated (purified antibody: 1 ⁇ g/ml).
- A - (R) NKVSF1 (pan2D), 1 -7F9, and 1 -4F1 all bind to KIR2DL1 , KIR2DL3, K1R2DS1 , and KIR2DS2. Neither antibody binds to KIR2DS3.
- NKVSF1 but not 1 -7F9 or 1 - 4F1 , binds to KIR2DS4.
- Figure 17 depicts FACS analysis results.
- A Antibody-mediated neutralization of binding of soluble KIR-Fc to HLA-Cw4 on cells, detected by flow cytometry (FACS). FACS- measurement of KIR2DL1 -mFc binding to LCL721.221 -Cw4 cells, after pre-incubation with various concentrations of the cross-reactive mAb DF200, or the KIR2DL2/3-specific mAb GL183. DF200, but not GL183, reduces binding of KIR2DL1 to HLA-Cw4. Measurements are plotted as a percentage of KIR2DL1-hFc-binding in the absence of inhibitory antibodies.
- Figure 18 depicts results of 51 Cr-release cytotoxicity assays.
- LCL 721.221 -Cw3 cells are efficiently killed by both YTS cells (diamonds) and YTS-2DL1 cells (triangles) at various E:T ratios.
- LCL 721.221-Cw4 cells are efficiently killed by YTS cells (squares), but can not be killed by YTS-2DL1 cells (crosses) due to KIR-restrictions.
- B In the absence of antibody, YTS-2DL1 cells cannot kill LCL-721.221 -Cw4 (E:T ratio 12:1 ). 1 - 7F9 induces killing of LCL 721.221 -Cw4 cells by YTS-2DL1 cells in a dose-dependent fash ⁇ ion.
- Figure 19 depicts a superposition of two crystal complex structures; the KIR2DL1/1- 7F9 Fab' and the KIR2DL1/MHC class I, PDB-code 1 1M9 (Fan et al., Nat. Immunol.
- KIR2DL1/1-7F9 Fab' is indicated in grey line ribbon style while KIR2DL1/MHC class I in a dark tube style.
- 1-7F9 Fab' is labeled 1-7F9' while MHC class I is labeled 'MHC.
- An overlap between the MHC and the Fab' is seen in the superposition, demonstrating the ability of 1 -7F9 Fab' to obstruct MHC class I binding to the KIR2DL1 receptor. See Example 11.
- Figure 20 shows the binding epitope of 1 -7F9 on KIR2DL1 , as indicated in the KIR2DL1 sequence. Amino acids within 4.0 A distance from 1-7F9 are highlighted in grey and black background. Amino acids highlighted by a black background are involved in hy ⁇ drogen-bonding to 1 -7F9.
- active NK cells designate biologically active NK cells, including NK cells having the capacity of lysing target cells or enhancing the immune function of other cells.
- an "active" NK cell can be able to kill cells that express a ligand for an activating NK receptor and/or fail to express MHC/HLA antigens recognized by a KIR on the NK cell.
- NK cells can be obtained by various techniques known in the art, such as isolation from blood samples, cytapheresis, tissue or cell collections, etc. Useful protocols for assays involving NK cells can be found in Natural Killer Cells Protocols (edited by Camp ⁇ bell KS and Colonna M). Human Press, pp. 219-238 (2000).
- a "Killer Ig-like Receptor”, “Killer Inhibitory Receptor”, or “KIR”, re- fers to a protein or polypeptide encoded by a gene that is a member of the KIR gene family or by a cDNA prepared from such a gene.
- KIR gene family includes a detailed review of the KIR gene family, including ⁇ ing the nomenclature of KIR genes and KIR gene products, and Genbank accession num ⁇ bers for exemplary KIRs, is 'The KIR Gene Cluster" by M. Carrington and P.
- Non-limiting exemplary GenBank entries of human KIRs have the following accession numbers: KIR2DL1 : Genbank accession number U24076, NM_014218, , AAR16197, or L41267; KIR2DL2: Genbank accession number U24075 or L76669; KIR2DL3: Genbank accession number U24074 or L41268; KIR2DL4: Genbank accession number X97229; KIR2DS1 : Gen ⁇ bank accession number X89892; KIR2DS2: Genbank accession,number L76667; KIR2DS3: Genbank accession number NM_012312 or L76670 (splice variant); KIR3DL1 : Genbank ac ⁇ cession number L41269; and KIR2DS4: Genbank accession number AAR26325.
- a KIR may comprise from 1 to 3 extracellular domains, and may have a long (i.e., more than 40 amino acids) or short (i.e., less than 40 amino acids) cytoplasmic tail. As previously described herein, these features determine the nomenclature of a KIR.
- KIR2DL1 , KIR2DL2, KIR2DL3, and KIR2DS4 molecules comprise the following respective amino acid sequences: KIR2DL1 extracellular domain: HEGVHRKPSLLAHPGXLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHH DGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQXGPTVL AGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFG SFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH (SEQ ID NO:23), where "X" at position 16 is P or R, and where "X” at position 114 is P or L, representing allelic variants.
- KIR2DL2 extracellular domain HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHH DGVSKANFS[GPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLD[VITGLYEKPSLSAQPGPTV LAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCF GSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLH (SEQ ID NO:24) KIR2DL3 extracellular domain:
- KIR2DS4 extracellular domain KIR2DS4 extracellular domain:
- KIR2DL2/3 refers to either or both of the KIR2DL2 and KIR2DL3 recep ⁇ tors. These two receptors have a very high homology, they are allelic forms of the same gene, and are considered by the art to be functionally similar.
- MHC encompasses MHC molecules in all mam ⁇ mals, whereas an “HLA” molecule refers to a human MHC molecule.
- stating that an antibody "binds" a determinant designates that the antibody binds the determinant with specif icity_and/or affinity.
- GL183 is a con ⁇ ventional monoclonal antibody that binds to KIR2DL2/3.
- EB6 is a conventional monoclonal antibody that binds to KIR2DL1.
- EB6 and GL183 are both commercially available (Beckman Coulter Inc., Fullerton, CA).
- a "cross-reactive" anti-KIR antibody is an antibody that binds more than one KIR molecule with specificity and/or affinity.
- DF200 and 1 -7F9 are monoclonal an ⁇ tibodies cross-reactive with KIR2DL1 , -2, and -3.
- the hybridoma producing antibody DF200 has been deposited at the CNCM culture collection, under identification no. "DF200", regis ⁇ tration no. CNCM I-3224, registered 10 June 2004, Collection Nationale de Cultures de Mi- croorganismes, lnstitut Pasteur, 25, Rue du Do Frankfurt Roux, F-75724 Paris Cedex 15, France.
- NKVSF1 also referred to as "Pan2D” herein, is cross-reactive with KIR2DL1 , -2, and -3 and KIR2DS4.
- This antibody is commercially available from Serotec (Cergy Sainte-Christophe, France), Catalog ref no. MCA2243.
- Specific binding refers to the ability of an antibody or other agent to detectably bind an epitope presented on an antigen, such as a KIR, while having relatively little detectable reactivity with other proteins or structures (such as other proteins presented on NK cells, or on other cell types). Specificity can be relatively determined by binding or competitive binding assays, using, e.g., Biacore instruments, as described elsewhere herein. Specificity can be exhibited by, e.g., an about 10:1 , about 20:1 , about 50:1 , about 100:1 , 10.000:1 or greater ratio of affinity/avidity in binding to the specific antigen versus nonspecific binding to other irrelevant molecules (in this case the specific antigen is a KIR).
- a KIR- binding antibody specific for a KIR presented on the NK cells of a particular organism, such as a human, can sometimes exhibit binding to similar KIRs of other species (i.e., a KIR- binding antibody, or other KIR-binding agent, may cross-react with KIRs of various species).
- Selectivity refers to the preferential binding of a protein to a particular region, tar- get, or peptide as opposed to one or more other biological molecules, structures, cells, tis ⁇ sues, etc.
- a KIR-binding antibody can also be selective for a KIR produced in a particular organism (e.g., in a human as opposed to in a primate), and/or for a particular type of KIR (e.g., a KIR with a long cytoplasmic tail), particularly where the antibody cross-reacts with more than one type of KIR produced in a particular organism, and/or a particular portion of a KIR (such as a particular epitope or antigenic determinant region).
- selectivity can be determined by competitive ELISA or Biacore assays.
- affinity/avidity can be any detectable preference (e.g., a ratio of more than 1 :1.1 , or more than about 1 :5, if detectable, would be suitable, including 1 :10, 1 :100, 1:1000 or more).
- any quantitative data on "affinity” presented herein refers to measurements of bivalent (as opposed to monovalent) binding.
- an “epitope” or “binding site” is an area or region on an antigen to which an antigen- binding peptide (such as an antibody) specifically binds.
- a protein epitope may comprise amino acid residues directly involved in the binding (also called immunodominant component of the epitope) and other amino acid residues, which are not directly involved in the binding, such as amino acid residues which are effectively blocked by the specifically antigen binding peptide (in other words, the amino acid residue is within the "footprint" of the specifically anti ⁇ gen binding peptide).
- epitope herein includes both types of amino acid binding sites in any particular region of a KIR that specifically binds to an anti-KIR antibody, or an ⁇ other KIR-specific agent according to the invention, unless otherwise stated (e.g., in some contexts the invention relates to antibodies that bind directly to particular amino acid resi ⁇ dues) .
- KIRs may comprise a number of different epitopes, which may include, without limita ⁇ tion, (1) linear peptide antigenic determinants, (2) conformational antigenic determinants which consist of one or more non-contiguous amino acids located near each other in a ma ⁇ ture KIR conformation; and (3) post-translational antigenic determinants which consist, either in whole or part, of molecular structures covalently attached to a KIR, such as carbohydrate groups.
- a first antibody binds substantially or partially the same epitope as a second anti ⁇ body means that the first and second antibodies compete in binding to the antigen, as de ⁇ scribed above.
- the term "binds to substantially the same epitope or determinant as" the monoclonal antibody 1 -7F9 means that an antibody "competes" with 1 -7F9.
- an antibody that "binds to substantially the same epitope or determinant as” the monoclonal antibody of interest means that the antibody "competes" with said antibody of interest for binding to one or more KIR molecules, preferably a KIR molecule selected from the group consisting of KIR2DL1 and KIR2DL2/3.
- an anti- body that binds to substantially the same epitope or determinant on a KIR2DL1 molecule as the antibody of interest "competes" with the antibody of interest for binding to KIR2DL1.
- an antibody that binds to substantially the same epitope or determinant on a KIR2DL2/3 mole ⁇ cule as the antibody of interest "competes" with the antibody of interest for binding to KIR2DL2/3.
- the phrase "binds to essentially the same epitope or determinant as” an antibody of interest means that an antibody “competes” with said antibody of interest for at least one, or , for any and all KIR molecules to which said antibody of interest specifically binds.
- the phrase "binds to essentially the same epitope or determinant as” the monoclonal antibody 1 - 7F9 means that an antibody "competes” with 1 -7F9 for at least one, preferably any and all KIR molecules, to which 1-7F9 specifically binds.
- an antibody that binds to es ⁇ sentially the same epitope or determinant as the monoclonal antibodies 1-7F9 or NKVSF1 can "compete" with said 1-7F9 or NKVSF1 respectively for binding to KIR2DL1 , KIR2DL2/3, KIR2DS1 and KIR2DS2.
- An exemplary assay for determining whether an anti-KIR antibody is capable of such blocking is provided in Example 8.
- an anti-KIR antibody to "reduce the inhibitory activity of a KIR", “facili ⁇ tate NK cell activity,” “facilitate NK cell cytotoxicity,” “facilitate NK cells,” “potentiate NK cell activity,” “potentiate NK cell cytotoxicity,” or “potentiate NK cells” means that an NK cell ex ⁇ pressing a KIR, when contacted with the antibody, is capable of lysing target cells that ex- press on their surface a particular MHC or HLA class I which is a ligand for said KIR.
- potentiation in NK cytotoxicity means any substantial potentiation, or at least 5%, 10%, 20%, 30% or greater potentiation in NK cytotoxicity, e.g. at least about 50% potentiation of NK cytotoxicity ⁇ e.g., at least about 60%, at least about 70%, at least about 80%, at least about 85%, at least about 90%, or at least about 95% as compared to a con- trol. This includes, for example, about 55-100%, about 65-100%, about 75-100%, about 80- 100%, or about 90-100% potentiation of NK cell cytotoxicity, as compared to a control.
- cytotoxicity also includes more than about 100%, more than about 500%, more than about 1000%, more than about 2000%, or higher increase in the cytotoxicity. This can be measured in, e.g., an assay, such as a standard cytotoxicity assay, where a higher number, amounting to a higher per- centage, of target cells are lysed by NK cells in the presence of an NK potentiator (such as an anti-KIR mAb) than in the absence of the potentiator (i.e., the control).
- an assay such as a standard cytotoxicity assay, where a higher number, amounting to a higher per- centage, of target cells are lysed by NK cells in the presence of an NK potentiator (such as an anti-KIR mAb) than in the absence of the potentiator (i.e., the control).
- neutralize KIR-mediated inhibition of NK cell cytotoxicity or “neutralize the inhibitory activity of a KIR,” as used herein means the ability to increase specific lysis to more than about 20%, preferably with at least about 30%, at least about 40%, at least about 50%, at least about 100%, or more of the specific lysis obtained at the same effectortarget cell ratio, with NK cells or NK cell lines that are not blocked by their KIR, asumeasured by a classical chromium release test of cytotoxicity.
- Neutralize KIR mediated inhibition can also mean that in a chromium-release assay, or other cytotoxicity assay, using an NK cell clone or transfectant expressing one or several inhibitory KIRs and a target cell expressing at least one HLA class I allele that is recognized by one of the KIRs on the NK cell, the specific lysis obtained with the antibody is more than about 100%, preferably at least about 101%, at least about 150%, at least about 200%, or more (e.g., about 101 -150%, about 120-150%, about 120-200%, about 150-200%, or about 200-1000%), or more of the specific lysis obtained with the same concentration of NKVSF1 (commercially available from Serotec), using the same NK cells and target cells, at the same effectortarget cell ratio.
- NKVSF1 commercially available from Serotec
- human antibody is intended to include antibodies having variable and constant regions identical to, essentially identical to, or derived from human germline immunoglobulin sequences. Such human antibodies can include amino acid resi ⁇ dues not encoded by human germline immunoglobulin sequences (e.g., mutations intro- **d by random or site-specific mutagenesis in vitro or by somatic mutation in vivo). How- ever, the term “human antibody”, as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- treatment refers to preventing, alleviating, managing, curing or reducing one or more symptoms or clinically relevant manifestations of a disease or disorder, unless contradicted by context.
- treatment of a patient in whom no symptoms or clinically relevant manifesta ⁇ tions of a disease or disorder have been identified is preventive therapy, whereas "treatment” of a patient in whom symptoms or clinically relevant manifestations of a disease or disorder have been identified generally does not constitute preventive therapy.
- cancer refers to any neoplastic disorder, in ⁇ cluding, but not limited to, such cellular disorders as sarcoma, carcinoma, melanoma, leu ⁇ kaemia, and lymphoma, which may include cancers in the breast, head and neck, ovaries, bladder, lung, pharynx, larynx, oesophagus, stomach, small intestines, liver, pancreas, colon, female reproductive tract, male reproductive tract, prostate, kidneys and central nervous sys- tern.
- biological sample includes but is not limited to a biological fluid (for example serum, lymph, and blood), cell sample or tissue sample (for example bone marrow or tumor tissue) derived from a human or non-human mammal.
- a biological fluid for example serum, lymph, and blood
- cell sample or tissue sample for example bone marrow or tumor tissue
- substantially identical in the context of two amino acid sequences means that the sequences, when optimally aligned, such as by the programs GAP or BESTFIT us ⁇ ing default gap weights, share at least about 50, at least about 60, at least about 70, at least about 80, at least about 90, at least about 95, at least about 98, or at least about 99 percent sequence identity.
- residue positions that are not identical differ by con ⁇ servative amino acid substitutions (further described elsewhere herein). Sequence identity is typically measured using sequence analysis software. Protein analysis software matches similar sequences using measures of similarity assigned to various substitutions, deletions and other modifications, including conservative amino acid substitutions.
- the publicly available GCG software contains programs such as "Gap” and "BestFit” which can be used with default parameters to determine sequence homology or sequence identity be- tween closely related polypeptides, such as homologous polypeptides from different species of organisms or between a wild-type protein and a mutein thereof. See, e.g., GCG Version 6.1. Polypeptide sequences can also be compared using FASTA, applying default or rec ⁇ ommended parameters. A program in GCG Version 6.1., FASTA ⁇ e.g., FASTA2 and FASTA3) provides alignments and percent sequence identity of the regions of the best over- lap between the query and search sequences (Pearson, Methods Enzymol.
- a "1 -7F9-like" or "1 -4F1 -like” antibody as used herein means (1 ) an antibody that binds substantially the same epitope as an antibody comprising the VH and VL sequences of 1 -7F9 or 1 -4F1 , respectively, such as, e.g., monoclonal antibody 1 -7F9 or 1 -4F1 , respec ⁇ tively, and/or (2) an antibody comprising VH and VL sequences identical or substantially identical to the VH and VL sequences of 1 -7F9 or 1 -4F1 , respectively.
- a “conservative" amino acid substitution is one in which an amino acid residue is substituted by another amino acid residue having a side chain ("R-group") with similar chemical properties (e.g., charge or hydrophobicity).
- R-group side chain
- a conservative amino acid substitution will not substantially change the functional properties of a protein.
- the per ⁇ cent sequence identity may be adjusted upwards to correct for the conservative nature of the substitution. Means for making this adjustment are well-known to those of skill in the art. See, e.g., Pearson, Methods MoI. Biol. 1994;243:307-31.
- Examples of groups of amino ac ⁇ ids that have side chains with similar chemical properties include 1) aliphatic side chains: glycine, alanine, valine, leucine, and isoleucine; 2) aliphatic-hydroxyl side chains: serine and threonine; 3) amide-containing side chains: asparagine and glutamine; 4) aromatic side chains: phenylalanine, tyrosine, and tryptophan; 5) basic side chains: lysine, arginine, and histidine; 6) acidic side chains: aspartic acid and glutamic acid; and 7) sulfur-containing side chains: cysteine and methionine.
- Exemplary conservative amino acids substitution groups include: valine-leucine-isoleucine, phenylalanine- tyrosine, lysine-arginine, alanine-valine, glutamate-aspartate, and asparagine-glutamine.
- This invention is based on the generation of novel cross-reactive and neutralizing antibodies binding to inhibitory KIRs, the antibodies allowing effective activation of NK cells in most or all individuals in human populations. Described herein are, for example, antibodies that bind to all of KIR2DL1 , KIR2DL2, and KIR2DL3 and potentiate NK-cell lytic activity by blocking the interactions between these KIRs and HLA-C. Such antibodies are referred to herein as "cross-reactive and neutralizing anti-KIR mAbs”.
- the present invention relates to novel cross-reactive, neutraliz- ing, or both crossreacting and neutralizing, fully human anti-KIR antibodies, as well as com ⁇ positions comprising such antibodies and methods of using such antibodies or compositions.
- These antibodies include human antibodies 1-7F9 and 1-4F1 , described in PCT/DK2004/000470, filed on July 1 , 2004, which is hereby incorporated by reference in its entirety.
- Antibodies, compositions, and methods described herein may, among other things, overcome current limitations associated with therapeutic modulation of KIR, and with thera ⁇ Treatmentic NK cell activation, and provide additional advantageous features and benefits.
- the antibodies can cross-react with multiple inhibitory KIRs and reduce or neutral ⁇ ize their inhibitory signals, resulting in potentiation of NK cell cytotoxicity by NK cells express- ing such inhibitory KIR receptors.
- the ability to cross-react with multiple KIR gene products can allow the antibodies of the invention to be effectively used to increase NK cell activity in.,, most or all human subjects, without the burden or expense of pre-determining the KIR or HLA type of the subject.
- the antibodies do not bind KIR2DS4, thus avoiding the reduction in stimulatory potential that would be associated with neutralization of the activating KIR2DS4 receptor. Additionally or alternatively, the antibodies do not bind KIR2DS3.
- Some antibodies of the invention can be characterized as "human", which are typi ⁇ cally associated with a lower risk for an immune response against the antibodies by a human subject to whom they are administered.
- an isolated antibody that facilitates the activation of human NK cells in virtually all humans is described.
- the antibody is human antibody 1-7F9 or a human 1-7F9-like antibody.
- Antibodies, fragments, or derivatives of either thereof can cross-react with at least two inhibitory KIR receptors at the surface of NK cells, reduce or neutralize the inhibitory sig- nals of the NK cells, and potentiate the activity of the NK cells.
- an antibody, antibody fragment, or derivative may bind a common determinant of human KIR2DL recep ⁇ tors, so that the antibody, antibody fragment, or derivative binds at least KIR2DL1 , KIR2DL2, and KIR2DL3 receptors.
- KIR2DL2/3 refers to either or both of the KIR2DL2 and KIR2DL3 receptors.
- the anti-KIR mAbs 1 -7F9 and 1 -4F1 have several advantages over previously produced anti-KIR antibodies. For example, 1 -7F9 and 1 -4F1 are fully hu ⁇ man, thus reducing or minimizing any immune response against the antibody once adminis ⁇ tered to a subject.
- both 1 -7F9 and 1-4F1 are of suitable isotypes for therapeu ⁇ tic anti-KIR antibodies (lgG4 and lgG2, respectively), as described below.
- 1-7F9 is also more more effective at inducing killing by NK cells that express either KIR2DL1 , -2, and/or -3 than murine mAbs EB6, GL183, DF200, and NKVSF1 (Pan2D).
- 1-7F9 induced higher levels of specific lysis by KIR2DL1 -expressing NK cells of target cells that expressed HLA-Cw4 than did EB6, DF200 or NKVSF1 (Pan2D).
- 1- 7F9 further has a higher affinity for KIR compared to previously known anti-KIR mAbs.
- 1 -7F9 binds to KIR2DL1 and KIR2DL3 with dissociation constants (K d 's) of 0,43 nM and 0.025 nM, respectively, representing a higher affinity for both antigens than, for example, DF200 (see Examples 3 and 8).
- K d 's dissociation constants
- NKVSF1 Pan2D
- A210, and A208g none of 1-7F9 and 1-4F1 binds to KIR2DS4, making them better suited for therapeutic purposes.
- 1-7F9 and 1-4F1 also bind to KIR2DS1 and KIR2DS2, but KIR2DS1 and KIR2DS2 are not believed to be important in anti- leukemia efficacy.
- Particular antibodies according to the invention therefore have the same or similar antigen-specificities as 1 -7F9 and/or 1 -4F1.
- antibodies comprising the same or similar VH and VL regions as 1 -7F9 can have the same or similar antigen- binding and/or NK-stimulatory properties as 1-7F9; and antibodies comprising the same or similar VH and VL regions as 1 -4F1 can have the same or similar antigen-binding properties as 1-4F1
- amino acid sequences of the 1 -4F1 VL and VH regions are provided in SEQ ID NOS: 39 and 41, respectively, and the nucleotide sequences encoding the 1-4F1 VL and VH regions are provided in SEQ ID NOS:40 and 42, respectively.
- residues 3, 4, 9, 24, 32, 41 , 47, 50, 55, 71 , and 74 of SEQ ID NO:39 are Q, L, S, R, A, G, L, D, E, F, and A, respectively.
- residues 3, 4, 9, 24, 32, 41 , 47, 50, 55, 71 , and 74 of SEQ ID NO:39 are R, M, F, W, Y, A, F, Y, Q, Y, and T, respectively.
- the amino acid sequences of the 1-7F9 CDRs have been identified as follows: the light chain CDR1 amino acid sequence corresponds to residues 24- 34 of SEQ ID NO:15; the light chain CDR2 amino acid sequence corresponds to residues 50- 56 of SEQ ID NO:15; the light chain GDR3 amino acid sequence corresponds to residues 89- 97 of SEQ ID NO:15; the heavy chain CDR1 amino acid sequence corresponds to residues 31-35 of SEQ ID NO:17; the heavy chain CDR2 amino acid sequence corresponds to resi ⁇ dues 50-65 of SEQ ID NO:17; and the heavy chain CDR3 amino acid sequence corresponds to residues 99-112 of SEQ ID NO:17.
- the amino acid sequences of the 1 -4F1 CDRs have been identified as follows: the light chain CDR1 amino acid sequence corresponds to resi ⁇ dues 24-34 of SEQ ID NO:39; the light chain CDR2 amino acid sequence corresponds to residues 50-56 of SEQ ID NO:39; the light chain CDR3 amino acid sequence corresponds to residues 89-97 of SEQ ID NO:39; the heavy chain CDR1 amino acid sequence corresponds to residues 31 -35 of SEQ ID NO:41 ; the heavy chain CDR2 amino acid sequence corre ⁇ sponds to residues 50-66 of SEQ ID NO:41 ; and the heavy chain CDR3 amino acid se ⁇ quence corresponds to residues 99-113 of SEQ ID NO:41.
- Amino acid sequences for the entire 1-7F9 light and heavy chains are provided in SEQ ID NOS :36 and 37, respectively. Accordingly, additional antibodies of, for example, various human antibody sub ⁇ classes; antibody fragments, antibody derivatives, and other KIR-binding peptides, can be readily produced by, e.g., recombinant techniques, based upon this information.
- the invention provides an antibody having a VL and a VH sequence con- sisting essentially of SEQ ID NO:15 and SEQ ID NO:17, respectively, and/or an antibody having a VL and a VH sequence consisting essentially of SEQ ID NO:39 and SEQ ID NO:41 , respectively.
- the invention provides an antibody comprising CDR regions consisting essentially of the 1 -7F9 or 1 -4F1 VH CDR1 -3 and VL CDR1 -3 described above.
- the invention provides an antibody comprising CDR regions as follows: a light chain CDR1 amino acid sequence corresponding to about residues 24-34 of SEQ ID NO:15; the light chain CDR2 amino acid sequence corresponding to about residues 50-56 of SEQ ID NO:15; the light chain CDR3 amino acid sequence corresponding to about residues 89-97 of SEQ ID NO:15; the heavy chain CDR1 amino acid sequence corresponding to about residues 31-35 of SEQ ID NO:17; the heavy chain CDR2 amino acid sequence corre- sponding to about to residues 50-65 of SEQ ID NO:17; and the heavy chain CDR3 amino acid sequence corresponding to about residues 99-112 of SEQ ID NO:17.
- the invention provides an antibody comprising CDR regions as follows: a light chain CDR1 amino acid sequence corresponding to about residues 24-34 of SEQ ID NO:39; a light chain CDR2 amino acid sequence corresponding to about residues 50-56 of SEQ ID NO:39; a light chain CDR3 amino acid sequence corresponding to about residues 89-97 of SEQ ID NO:39; a heavy chain CDR1 amino acid sequence corresponding to about residues 31-35 of SEQ ID NO:41 ; a heavy chain CDR2 amino acid sequence corresponding to about residues 50-66 of SEQ ID 1x10:41 ; and a heavy chain CDR3 amino acid sequence corresponding to about resi ⁇ dues 99-113 of SEQ ID NO:41.
- the invention provides an antibody com- prising a light chain CDR1 amino acid sequence consisting essentially of residues 24-34 of SEQ ID NO:15; a light chain CDR2 amino acid sequence consisting essentially of residues 50-56 of SEQ ID 1x10:15; a light chain CDR3 amino acid sequence consisting essentially of residues 89-97 of SEQ ID NO:15; a heavy chain CDR1 amino acid sequence consisting es ⁇ sentially of residues 31-35 of SEQ ID NO:17; a heavy chain CDR2 amino acid sequence consisting essentially of residues 50-65 of SEQ ID NO: 17; and a heavy chain CDR3 amino acid sequence consisting essentially of residues 99-112 of SEQ ID NO:17.
- the invention provides an antibody comprising CDR regions as follows: a light chain CDR1 amino acid sequence consisting essentially of residues 24-34 of SEQ ID NO:39; a light chain CDR2 amino acid sequence consisting essentially of residues 50-56 of SEQ ID lxl ⁇ :39; a light chain CDR3 amino acid sequence consisting essentially of residues 89-97 of SEQ ID NO:39; a heavy chain CDR1 amino acid sequence consisting essentially of residues 31-35 of SEQ ID NO:41 ; a heavy chain CDR2 amino acid sequence consisting essentially of residues 50-66 of SEQ ID NO:41 ; and a heavy chain CDR3 amino acid sequence consisting essentially of residues 99-113 of SEQ ID NO:41.
- the invention also encompasses an anti-KIR antibody, antibody fragment, or anti ⁇ body derivative, or a KIR-binding polypeptide, comprising at least one variant amino acid se ⁇ quence substantially identical to the 1 -7F9 or 1 -4F1 VH or VL sequence, or to a CDR-region therein.
- a variant amino acid sequence can comprise or consist essentially of an amino acid sequence that is at least about 50, 80, 90, 95, 98, or 99 (e.g., about 50-99, about 65-99, about 75-99, or about 85-99) percent identical to a 1 -7F9 or 1 -4F1 CDR, VH, or VL region.
- a variant amino acid sequence can also or alternatively comprise 1 , 2, or 3 CDRs that com ⁇ prise or consist of amino acid sequences that are at least about 80%, at least about 90%, or at least about 95% identical to 1 -7F9 or 1 -4F1 CDRs.
- the invention provides a human antibody comprising a light chain CDR1 amino acid sequence at least about 80%, at least about 90%, or at least about 95% identical to residues 24-34 of SEQ ID NO:15 or SEQ ID NO:39; a light chain CDR2 amino acid sequence at least about 80%, at least about 90%, or at least about 95% identical to residues 50-56 of SEQ ID NO:15 or SEQ ID NO:39; a light chain CDR3 amino acid sequence at least about 80%, at least about 90%, or at least about 95% identical to residues 89-97 of SEQ ID NO:15 or SEQ ID NO:39; a heavy chain CDR1 amino acid sequence at least about 80%, at least about 90%, or at least about 95% identical to residues 31:35 of SEQ ID NO:17 or SEQ ID NO:41 ; a heavy chain CDR2 amino acid sequence at least about 80%, at least about 90%, or at least about 95% identical to residues 50-65 of SEQ ID NO:17 or to
- the basic properties of 1 -7F9- or 1 -4F1 -derived KIR-binding amino acid sequences that are retained in such variant amino acid sequences desirably include the specificity and/or avidity of the 1-7F9 or 1-4F1 sequence for one or more KIRs, and may also or alterna ⁇ tively include the capability of 1-7F9 in blocking KIR/HLA-C interaction and potentiating the lytic activity of NK cells.
- the invention provides an anti-KIR antibody, antibody fragment, or antibody derivative, or a KIR-binding polypeptide, that comprises a KIR-binding amino acid sequence that differs from a 1 -7F9 or 1 -4F1 KIR-binding sequence in one or more amino acid residues (e.g., at least 2, 3, 5, at least about 10, at least about 15, at least about 20, at least about 25, at least about 30, at least about 35, at least about 40, at least about 50, or more amino acid residues) by way of one or more residue insertions, deletions, and/or sub ⁇ stitutions.
- amino acid residues e.g., at least 2, 3, 5, at least about 10, at least about 15, at least about 20, at least about 25, at least about 30, at least about 35, at least about 40, at least about 50, or more amino acid residues
- such a variant KIR-binding sequence confers greater affinity; greater or different specificity; less immunogenicity (in terms of host response to the se ⁇ quence); greater in vivo stability; and/or other beneficial properties to the variant sequence over an essentially identical amino acid sequence comprising the native 1 -7F9 or 1 -4F1 se ⁇ quence.
- Suitable sequence variations are further described elsewhere herein.
- a KIR- binding portion of an anti-KIR antibody, antibody fragment, or antibody derivative, or a KIR- binding polypeptide can also comprise any suitable number of non-amino acid components or substituents, such as non-amino acid organic moieties, that facilitate KIR binding and/or provide other advantageous physiochemical or immunological properties.
- Some antibodies of the invention can also or alternatively be characterized by their binding affinity to one or more KIRs.
- DF200 in terms of bivalent binding, has a K d for KIR2DL1 of about 11 nM, and a K d for KIR2DL3 of about 2.0 nM, and 1-7F9 has a K d for KIR2DL1 of about 0.43 nM, and a K d for KIR2DL3 of about 0,025 nM.
- the invention provides human or non-human (e.g., murine, chimeric, or humanized) antibodies having a K d in bivalent binding to KIR2DL1 of no more than about 20 nM, no more than about 11 nM, no more than about 5 nM, no more than about 1 nM, no more than about 0.5 nM, or no more than about 0.43 nM.
- human or non-human (e.g., murine, chimeric, or humanized) antibodies having a K d in bivalent binding to KIR2DL1 of no more than about 20 nM, no more than about 11 nM, no more than about 5 nM, no more than about 1 nM, no more than about 0.5 nM, or no more than about 0.43 nM.
- human or non-human (e.g., murine, chimeric, or humanized) antibodies of the invention may have a K d for KIR2DL3 of no more than about 20 nM, no more than about 2 nM, no more than about 1 nM, no more than about 0.1 nM, or no more than about 0.05 nM, or no more than about 0.025 nM.
- the antibodies have about the same K d values for bivalent binding to KIR2DL1 and KIR2DL3 as 1-7F9.
- 1-7F9 and 1-4F1 have K d -values for KIR2DL3 of about 3.5 and 7 nM, respectively.
- the invention provides human or non-human (e.g., murine, chimeric, or humanized) antibodies having a K d in monovalent binding to KIR2DL3 of no more than about 20 nM, no more than about 10 nM, no more than about 7 nM, or no more than about 3.5 nM.
- human or non-human e.g., murine, chimeric, or humanized antibodies having a K d in monovalent binding to KIR2DL3 of no more than about 20 nM, no more than about 10 nM, no more than about 7 nM, or no more than about 3.5 nM.
- An anti-KIR antibody, antibody fragment, or antibody derivative, or a KIR-binding polypeptide selectively and/or specifically (typically specifically) binds at least one KIR, and more particularly an antigenic determinant region or epitope of at least one KIR, under ap ⁇ intestinalte conditions (e.g., with respect to temperature, pH, etc., which typically will reflect human physiological conditions in a normal or NK cell-associated disease state, and in the context of a suitable protein comprising the sequence or combination).
- the invention relates to antibodies that can be characterized in (among other things) the ability to compete with 1-7F9, 1-4F1 or a 1-7F9- or 1 -4F1 -like antibody, and various methods involving the same.
- Other antibodies of the invention also or alternatively can be characterized on having the ability to compete with one or more of antibody DF200, antibody NKVSF1 , anti- body EB6, and antibody GL183.
- the cross-reactive and neutralizing anti-KIR antibodies, antibody fragments, or de ⁇ rivatives of the invention reduce or neutralize the inhibitory activity of KIR by specifically in ⁇ hibiting binding of MHC and/or HLA molecules to at least two inhibitory KIR receptors and facilitating NK cell activity, meaning that such antibodies, fragments or derivatives permit NK cells expressing an inhibitory KIR receptor on their surface to be capable of lysing cells that express a corresponding HLA ligand for that particular inhibitory KIR receptor (e.g., a particu ⁇ lar HLA antigen).
- the invention provides antibodies that specifically inhibit the binding of HLA-C molecules to KIR2DL1 and KIR2DL2/3 receptors.
- the invention provides antibodies that inhibit the binding of KIR2DL1 and/or KIR2DL2/3 to HLA- C.
- the invention provides antibodies that facilitate NK cell activity in vivo, and/or in vitro.
- At least one of KIR2DL1 or KID2DL2/3 is present in at least about 90% or more of the human population, and the more preferred antibodies of this invention are capable of po ⁇ tentiating the activity of NK cells expressing either or both of these KIR. Therefore, composi- tions of this invention may be used to effectively activate or potentiate NK cells in most hu ⁇ man individuals, typically in about 90% of human individuals or more. Accordingly, a single antibody composition according to the invention may be used to treat most human subjects, and there is seldom need to determine KIR- or HLA-allelic groups or to use mixtures or cock ⁇ tails of two or more anti-KIR mAbs.
- the antibody specifically binds both KIR2DL1 and KIR2DL2/3 human receptors and reverses inhibition of NK cell cytotoxicity mediated by these KIRs.
- the anti ⁇ body may also be human and compete with monoclonal antibody 1-7F9 and/or 1-4F1.
- the term "competes with” when referring to a particular pair of antibodies e.g., one or more anti ⁇ bodies selected from DF200, NKVSF1 (Pan2D), 1-7F9, EB6, and GL183), means that a first antibody detectably competes with a second antibody (or other molecule) in a binding assay using either recombinant KIR molecules or cell-surface expressed KIR molecules.
- the antibodies compete.
- the per- centages of inhibition for a certain antibody pair average at least about 29%, at least about 30%, at least about 40%, or at least about 50%, the antibodies compete.
- the percentage of inhibition of a second antibody binding to KIR2D protein by a first antibody can be calculated as: 100*(1 -(detected binding second antibody)/(detected binding of first antibody)). The same applies to antibody fragments and antibody derivatives.
- an antibody that "competes" with 1 -7F9, 1 -4F1 or a 1 -7F9- or 1 -4F1 -like antibody may compete with 1 -7F9, 1 -4F1 or the 1 -7F9- or 1 -4F1 -like antibody for binding to human KIR2DL1 , human KIR2DL2/3, or both human KIR2DL1 and KIR2DL2/3.
- the antibody DF200 competes with 1-7F9 and 1-4F1 for binding to KIR2DL3.
- an antibody which competes with 1 -7F9 or 1 -4F1 is not 1 -7F9 or 1 -4F1 themselves, respectively (i.e., the invention provides antibodies other than 1 -7F9 and 1 -4F1 that are characterized by, among other things, the ability to compete with 1 -7F9 and/or 1 -4F1 in binding to one or both of these KIRs).
- the antibody binds both KIR2DL1 and KIR2DL2/3 human recep ⁇ tors, reduces or neutralizes or reverses inhibition of NK cell cytotoxicity mediated by these KIRs, and competes with 1 -7F9 for binding to the KIR2DL1 human receptor, the KIR2DL2/3 human receptor, or both KIR2DL1 and KIR2DL2/3 human receptors.
- said anti ⁇ body is a chimeric, human, or humanized antibody.
- the antibody binds both KIR2DL1 and KIR2DL2/3 human recep ⁇ tors, reduces, neutralizes or reverses inhibition of NK cell cytotoxicity mediated by these KIRs, and competes with EB6 for binding to the KIR2DL1 human receptor, or competes with GL183 and/or DF200 fot binding to the KIR2DL2/3 human receptor; or it competes with both EB6 for binding to the KIR2DL1 human receptor and GL183 and/or DF200 for binding to the KIR2DL2/3 human receptor.
- the antibody is not NKVSF1 (Pan2D), not A210, not A803g, and/or not DF200.
- the antibody can be, e.g., a murine, chimeric, human, or humanized antibody.
- the antibody comprises VH, VL, or both VH and VL regions that are at least substantially identical to the VH and/or VL regions of 1 -7F9 or 1 -4F1.
- the anti ⁇ body can be of any subclass, including IgGI, lgG2, lgG3, and lgG4.
- the antibody is a human lgG4 antibody.
- the antibody is a hu- man lgG2 antibody.
- the antibody can be a chimeric, human, or humanized antibody.
- the antibody is human, competes with 1 -7F9 or 1 -4F1 , and rec ⁇ ognizes, binds to, or has immunospecificity for at least partially the same, or the same, epi ⁇ tope or "epitopic site" on a KIR molecule as the monoclonal antibody 1 -7F9 or 1 -4F1.
- said KIR molecule is a human KIR2DL1 or KIR2DL2/3 receptor.
- the antibody binds a common determinant present in both KIR2DL1 and KIR2DL2/3 human receptors and reduces, neutralizes or reverses inhibition of NK cell cytotoxicity mediated by these KIRs.
- the antibody more specifically can bind at least partially the same, substantially the same, or the same epitope on KIR as monoclonal anti- body 1-7F9.
- the antibody is a monoclonal antibody that exhibits one or more of the above-described characteristics.
- functional fragments and derivatives of the antibodies described herein can be prepared which have substantially similar antigen binding, specificity and/or activity, including, without limitation, Fab fragments, Fab'2 fragments, immunoadhesins, di- abodies, camelized antibodies, Janusins, minibodies, CDRs, and ScFv fragments.
- antibodies or bivalent fragments or derivatives thereof are monospecific, i.e., both "arms" of the antibodies, fragments, or derivatives bind the same antigen(s).
- antibody derivatives comprising an antibody of the invention conjugated or covalently bound to a toxin, a radionuclide, a detectable moiety (e.g., a fluor), or a solid support, can be prepared.
- the invention also encompasses pharmaceutical compositions comprising an anti ⁇ body as disclosed above, a fragment thereof, or a derivative of either thereof. Accordingly, the invention also relates to use of an antibody as disclosed herein in a method for the manu ⁇ facture of a medicament.
- the medicamenLor pharmaceutical composition is for the treatment of a cancer or other proliferative disorder, an infection, or for use in transplantation.
- the invention relates to a composition (e.g., a composition formulated for pharmaceutical administration, a kit for preparing such a composition, an assay kit or me ⁇ dia, purification media, etc.) that comprises an antibody that binds at least two different hu ⁇ man inhibitory KIR receptor gene products and is capable of neutralizing KIR-mediated inhi ⁇ bition cytotoxicity by NK cells expressing at least one of said two different human inhibitory KIR receptors, wherein the antibody is incorporated into a liposome.
- a composition e.g., a composition formulated for pharmaceutical administration, a kit for preparing such a composition, an assay kit or me ⁇ dia, purification media, etc.
- the liposome may also comprise an additional substance such as, e.g., a nucleic acid molecule for the delivery of genes for gene therapy; a nucleic acid molecule for the delivery of antisense RNA, RNAi, or siRNA for suppressing a gene in an NK cell; or a toxin or a drug for the targeted killing of NK cells.
- an additional substance such as, e.g., a nucleic acid molecule for the delivery of genes for gene therapy; a nucleic acid molecule for the delivery of antisense RNA, RNAi, or siRNA for suppressing a gene in an NK cell; or a toxin or a drug for the targeted killing of NK cells.
- Described herein are also methods of regulating human NK cell activity in vitro, ex vivo, or in vivo, comprising contacting human NK cells with an effective amount of an anti- body of the invention, a fragment of such an antibody, a derivative of either thereof, or a pharmaceutical composition comprising at least one of any thereof.
- Preferred methods com ⁇ prise administration of an effective amount of a pharmaceutical compositions of this invention and are directed at increasing the cytotoxic activity of human NK cells, most preferably ex vivo or in vivo, in a subject having a cancer, an infectious disease, or an immune disease.
- administration can be effected by intravenous infusion of the antibody in a suit ⁇ able buffer to a patient with cancer or an infectious disease (such as a viral disease).
- the invention also provides a composition
- a composition comprising an antibody that binds at least two different human inhibitory KIR receptor gene products, wherein the antibody is capable of neutralizing KIR-mediated inhibition of NK cell cytotoxicity in NK cells expressing at least one of the two different human inhibitory KIR receptors, the antibody being present in an amount effective to detectably potentiate NK cell cytotoxicity in a patient or in a biological sample comprising NK cells; and a pharmaceutically acceptable carrier or excipient.
- the antibody binds a common determinant present on KIR2DL1 and KIR2DL2/3.
- Compo- sitions comprising an antibody of the invention may optionally further comprise a second therapeutic agent (an agent that induces, promotes, and/or enhances a therapeutic effect in a host that is related to a condition or disorder for which the antibody is administered - e.g., a condition related to a cancer, transplantation, an infectious disease, a viral infection, etc.).
- a second therapeutic agent an agent that induces, promotes, and/or enhances a therapeutic effect in a host that is related to a condition or disorder for which the antibody is administered - e.g., a condition related to a cancer, transplantation, an infectious disease, a viral infection, etc.
- a second therapeutic agent that can be co-administered with an antibody of the invention in such a combination composition may be selected from, for example, an immu ⁇ nomodulatory agent, a hormonal agent, a chemotherapeutic agent, an anti-angiogenic agent, an apoptotic agent, a second antibody specific for a non-KIR antigen, optionally a second antibody that binds to and inhibits and neutralizes an inhibitory KIR, or reduces the signalling from an inhibitory KIR, an anti-infective agent, a targeting agent, or an adjunct compound.
- Advantageous immunomodulatory agents may be selected from IL-1 alpha, IL-1beta, IL-2, IL- 3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11 , IL-12, IL-13, IL-15, IL-21 , TGF-beta, GM-CSF, M-CSF, G-CSF, TNF-alpha, TNF-beta, LAF, TCGF, BCGF, TRF, BAF, BDG, MP, LIF, OSM, TMF, PDGF, IFN-alpha, IFN-beta, or IFN-gamma.
- chemotherapeutic agents include alkylating agents, antimetabolites, cytotoxic antibiotics, adriamycin, dactinomycin, mitomycin, carminomycin, daunomycin, doxorubicin, tamoxifen, taxol, taxotere, vincristine, vinblastine, vinorelbine, etoposide (VP-16), 5-fluorouracil (5FU), cytosine arabinoside, cyclo ⁇ phosphamide, thiotepa, methotrexate, camptothecin, actinomycin-D, mitomycin C, cisplatin (CDDP), aminopterin, combretastatin(s), other vinca alkyloids and derivatives or prodrugs thereof.
- alkylating agents include alkylating agents, antimetabolites, cytotoxic antibiotics, adriamycin, dactinomycin, mitomycin, carminomycin, daunomycin,
- hormonal agents include leuprorelin, goserelin, triptorelin, buserelin, tamoxifen, toremifene, flutamide, nilutamide, cyproterone bicalutamid anastrozole, exeme- stane, letrozole, fadrozole medroxy, chlormadinone, megestrol, other LHRH agonists, other anti-estrogens, other anti-androgens, other aromatase inhibitors, and other progestagens.
- the second antibody that binds to and inhibits an inhibitory KIR receptor is an an ⁇ tibody or a derivative or fragment thereof that binds to an epitope of an inhibitory KIR recep- tor that differs from the epitope bound by the antibody that binds a common determinant pre ⁇ sent on at least two different human inhibitory KIR receptor gene products.
- a second antibody may be directed to a target associated with the disease state that is at least partially treatable by administration of the antibody of the invention (e.g., a cancer- associated antigen, a viral infection-associated antigen, etc.).
- the invention further provides a method of detectably potentiating NK cell activity in a patient in need thereof, comprising the step of administering to the patient a composition according to the invention.
- a patient in need of NK cell activity potentiation can be any pa ⁇ tient diagnosed as having a disease or disorder wherein such potentiation may promote, en ⁇ hance, and/or induce a therapeutic effect (or promotes, enhances, and/or induces such an effect in at least a substantial proportion of patients with the disease or disorder and substan ⁇ tially similar characteristics as the patient - as may determined by, e.g., clinical trials).
- a pa ⁇ tient in need of such treatment may be suffering from, e.g., cancer, another proliferative dis ⁇ order, an infectious disease or an immune disorder.
- the method comprises the additional step of administering to the patient an appropriate additional therapeutic agent se- lected from an immunomodulatory agent, a hormonal agent, a chemotherapeutic agent, an anti-angiogenic agent, an apoptotic agent, a second antibody specific for an antigen distinct from KIR, optionally a second antibody that binds to and inhibits and neutralizes an inhibitory KIR receptor, or reduces the signalling from an inhibitory KIR, an anti-infective agent, a tar ⁇ geting agent or an adjunct compound wherein said additional therapeutic agent is adminis- tered to said patient as a single dosage form together with said antibody, or as separate dosage form.
- the dosage of the antibody (or antibody fragment/derivative) and the dosage of the additional therapeutic agent collectively are sufficient to detectably induce, promote, and/or enhance a therapeutic response in the patient which comprises the potentiation of NK cell activity.
- the antibody, fragment, or derivative and the additional therapeutic agent are desirably administered under conditions (e.g., with respect to timing, number of doses, etc.) that result in a detectable combined therapeutic benefit to the patient.
- the present invention encompasses antibodies which are capable of specifically binding NK cells and/or KIR receptors in a non-human primate, preferably a mon- key. Also encompassed are methods for evaluating the toxicity, dosage and/or activity or efficacy of antibodies of the invention which are candidate medicaments. In one aspect, the invention encompasses a method for determining a dose of an antibody that is toxic to an animal or target tissue by administering an antibody of the invention to an non-human pri ⁇ mate recipient animal having NK cells, and assessing any toxic or deleterious or adverse ef- fects of the agent on the animal, or preferably on a target tissue.
- the in ⁇ vention is a method for identifying an antibody that is toxic to an animal or target tissue by administering an antibody of the invention to an non-human primate recipient animal having NK cells, and assessing any toxic or deleterious or adverse effects of the agent on the ani ⁇ mal, or preferably on a target tissue.
- the invention is a method for identify- ing an antibody that is efficacious as treatment of an infection, disease or tumor by adminis ⁇ tering an antibody of the invention to a non-human primate model of infection, disease or cancer, and identifying the antibody that ameliorates the infection, disease or cancer, or a symptom thereof.
- said antibody of the invention is an antibody which (a) cross reacts with at least two inhibitory human KIR receptors at the surface of human NK cells, and (b) cross-reacts with NK cells or a KIR receptor of the non-human primate.
- a method of detecting the pres ⁇ ence of NK cells bearing an inhibitory KIR on their cell surface in a biological sample or a liv ⁇ ing organism comprising the steps of: a) contacting said biological sample or living organism with an antibody of the inven- tion, wherein said antibody is conjugated or covalently bound to a detectable moiety; and b) detecting the presence of said antibody in said biological sample or living organ ⁇ ism.
- the invention also provides a method of purifying from a sample NK cells bearing an inhibitory KIR on their cell surface comprising the steps of: a) contacting said sample with an antibody of the invention under conditions that al ⁇ low said NK cells bearing an inhibitory KIR on their cell surface to bind to said antibody, wherein said antibody is conjugated or covalently bound to a solid support (e.g., a bead, a matrix, etc.); and b) eluting said bound NK cells from said antibody conjugated or covalently bound to a solid support.
- a solid support e.g., a bead, a matrix, etc.
- NKVSF1 (Pan2D) also binds to NK cells from cyno- molgus monkeys, see Figure 10.
- the invention therefore provides an antibody, as well as fragments and derivatives thereof, wherein said antibody, fragment or derivative cross-reacts with at least two inhibitory human KIR receptors at the surface of human NK cells, and which furthermore binds to NK cells from cynomolgus monkeys.
- the antibody is not antibody NKVSF1 , not A210, and/or not A802g.
- the invention also provides a method of testing the toxicity of an antibody, as well as fragments and derivatives thereof, wherein said antibody, fragment or derivative cross-reacts with at least two inhibitory human KIR receptors at the surface of human NK cells, wherein the method comprises testing the antibody in a cyno ⁇ molgus monkey.
- the invention provides an antibody, antibody fragment, or deriva ⁇ tive of either thereof, that comprises the light variable region or one or more light variable re ⁇ gion CDRs of antibody 1-7F9 or 1-4F1.
- the invention provides an an- tibody, antibody fragment, or derivative of either thereof that comprises a sequence that is highly similar to all or essentially all of the light chain variable region sequence of 1 -7F9 or 1 - 4F1.
- the invention provides an antibody, antibody fragment, or deriva ⁇ tive of either thereof, which comprises the heavy chain variable region or one or more heavy chain variable region CDRs of antibody 1 -7F9 or 1 -4F1.
- the invention provides an antibody, antibody fragment, or derivative of either thereof that comprises a se ⁇ quence that is highly similar to all or essentially all of the heavy chain variable region se ⁇ quence of 1 -7F9 or 1 -4F1.
- the present inventio ⁇ provides novel antibodies and fragments or derivatives thereof that bind common determinants conserved among human inhibitory KIR receptors, preferably including a determinant present on at least two different KIR2DL gene products, but not on KIR2DS4, and which cause potentiation of NK cells expressing at least one of those KIR receptors.
- the invention discloses, for the first time, that such cross-reacting and neutralizing antibodies can be produced, and effectively used in modulation of NK cell activ ⁇ ity, which represents an unexpected result and opens an avenue towards novel and effective NK-based therapies, particularly in human subjects.
- a "common determinant” designates a determi- nant or epitope that is shared by several gene products of the human inhibitory KIR recep ⁇ tors.
- the common determinant is shared by at least two members of the KIR2DL receptor group. More preferably, the determinant is shared by at least KIR2DL1 and KIR2DL2/3.
- Certain antibodies of this invention may, in addition to recognizing multiple gene products of the KIR2DL type, also recognize determinants present on other inhibitory KIRs, such as gene product of the KIR3DL receptor group; e.g., KIR3DL1 and/or KIR3DL2.
- the determinant or epitope may represent a peptide fragment or a conformational epitope shared by said members.
- the antibody of this invention specifically binds to substantially the same epitope recognized by monoclonal antibody DF200. This de ⁇ terminant is present on both KIR2DL1 and KIR2DL2/3.
- the antibody of this invention specifically binds to substantially the same epitope recognized by human mAb 1-7F9, or the epitope recognized by human mAb 1-4F1 , said epitopes being present on KIR2DL1 , -2 and -3, but not on KIR2DS4.
- antibodies refers to polyclonal and monoclonal antibod ⁇ ies, as well as to fragments and derivatives of said polyclonal and monoclonal antibodies unless otherwise stated or clearly contradicted by context.
- full length antibodies typically are assigned to one of five major classes: IgA, IgD, IgE, IgG, and IgM.
- IgG immunoglobulin G
- IgM immunoglobulin G
- immunoglobulins The heavy-chain constant domains that correspond to the different classes of immunoglobulins are termed "alpha,” “delta,” “epsi- Ion,” “gamma” and “mu,” respectively.
- the subunit structures and three-dimensional configu ⁇ rations of different classes of immunoglobulins are well known.
- IgG and/or IgM are the pre ⁇ ferred classes of antibodies employed in this invention because they are the most common antibodies in the physiological situation and because they are most easily made in a labora ⁇ tory setting.
- an "antibody” in the context of this invention refers to a monoclonal antibody, more preferably a "human” monoclonal antibody.
- One embodiment of the invention provides a method of blocking the interaction of an inhibitory KIR and its corresponding HLA ligand in vivo, for therapeutic purposes that involve activation of endogenous NK cells.
- the isotype of 1 -7F9 is lgG4.
- lgG2 antibodies are also generally considered to be non- depleting, and may also be more stable molecules than lgG4 antibodies, thereby conferring a longer half-life in vivo.
- 1-4F1 is of the lgG2 isotype.
- the antibodies of this invention may be produced by a variety of techniques known in the art. Typically, they are produced by immunization of a non-human animal, preferably a mouse, with an immunogen comprising an inhibitory KIR polypeptide, preferably a KIR2DL polypeptide, more preferably a human KIR2DL polypeptide.
- the inhibitory KIR polypeptide may comprise the full length sequence of a human inhibitory KIR polypeptide, or a fragment or derivative thereof, typically an immunogenic fragment, i.e., a portion of the polypeptide comprising an epitope exposed on the surface of the cell expressing an inhibitory KIR recep ⁇ tor.
- Such fragments typically contain at least about 7 consecutive amino acids of the mature polypeptide sequence, even more preferably at least about 10 consecutive amino acids thereof. Fragments typically are essentially derived from the extra-cellular domain of the re ⁇ ceptor. Even more preferred is a human KIR2DL polypeptide which includes at least one, more preferably both, extracellular Ig domains, of the full length KIRDL polypeptide and is capable of mimicking at least one conformational epitope present in a KIR2DL receptor.
- said polypeptide comprises at least about 8 consecutive amino acids of an extracellular Ig domain of amino acid positions 1 -224 of the KIR2DL1 polypeptide (amino acid numbering of according to Wagtmann et al., Immunity 1995;2:439-449, which is incorpo ⁇ rated by reference herein in its entirety, or according to the PROW internet website found at the World Wide Web (www) address ncbi.nlm.nih.gov/prow/guide/1326018082.htm).
- the immunogen comprises a wild-type human KIR2DL polypep ⁇ tide in a lipid membrane, typically at the surface of a cell.
- the im ⁇ munogen comprises intact NK cells, particularly intact human NK cells.
- the cells are lysed or otherwise treated so as to not be intact.
- the immunogen can be, for example, suspended or dissolved in a buffer, optionally with an adjuvant, such as com- plete Freund's adjuvant, prior to administration to a non-human mammal, such as a mouse, rabbit, goat, horse, dog, sheep, guinea pig, rat, hamster, etc.
- the step of immunizing a non-human mammal with an antigen may be carried out in any manner well known in the art for stimulating the production of antibodies in a mouse (see, for example, E. Harlow and D. Lane, Antibodies: A Laboratory Manual., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY (1988)).
- the immunogen is then sus ⁇ pended or dissolved in a buffer, optionally with an adjuvant, such as complete Freund's adju ⁇ vant.
- an adjuvant such as complete Freund's adju ⁇ vant.
- the non-human animals are injected intraperitoneally with antigen on day 1 and again about a week later. This is followed by recall injections of the antigen around day 20, optionally with adjuvant such as incomplete Freund's adjuvant.
- the recall injections are performed intravenously and may be repeated for several consecutive days. This is followed by a booster injection at day 40, either intravenously or intraperito ⁇ neal ⁇ , typically without adjuvant.
- This protocol results in the production of antigen-specific antibody-producing B cells after about 40 days.
- Other protocols may also be utilized as long as they result in the production of B cells expressing an antibody directed to the antigen used in immunization.
- serum is obtained from an immunized non- human animal and the antibodies present therein isolated by well-known techniques.
- the serum may be affinity purified using any of the immunogens set forth above linked to a solid support so as to obtain antibodies that react with inhibitory KIR receptors.
- lymphocytes from an unimmunized non-human mam ⁇ mal are isolated, grown in vitro, and then exposed to the immunogen in cell culture. The lymphocytes are then harvested and the fusion step described below is carried out.
- the next step is the isolation of splenocytes from the immunized non-human mammal and the subsequent fusion of those splenocytes with an immortalized cell in order to form an antibody-producing hybridoma.
- the isolation of spleno ⁇ cytes from a non-human mammal is well-known in the art and typically involves removing the spleen from an anesthetized non-human mammal, cutting it into small pieces and squeezing the splenocytes from the splenic capsule and through a nylon mesh of a cell strainer into an appropriate buffer so as to produce a single cell suspension.
- the cells are washed, centri- fuged and resuspended in a buffer that lyses any red blood cells.
- the solution is again cen- trifuged and remaining lymphocytes in the pellet are finally resuspended in fresh buffer.
- the lymphocytes can be fused to an immortal cell line.
- This is typically a mouse myeloma cell line, although many other immortal cell lines useful for creating hybridomas are known in the art.
- Preferred murine myeloma lines include, but are not limited to, those derived from MOPC-21 and MPC-11 mouse tumors (available from the SaIk Institute Cell Distribution Center, San Diego, Calif. U.S.A.), or the X63 Ag8653 and SP-2 cell lines (available from the American Type Culture Collection, Rockville, Maryland U.S.A.).
- the cell fusion is effected using polyethylene glycol or the like.
- the resulting hybridomas are then grown in selective media that contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells.
- the parental myeloma cells lack the enzyme hypoxanthine guanine phospho- ribosyl transferase (HGPRT or HPRT)
- the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient cells.
- HGPRT hypoxanthine guanine phospho- ribosyl transferase
- HAT medium thymidine
- Hybridomas are typically grown on a feeder layer of macrophages.
- the macro ⁇ phages are preferably from littermates of the non-human mammal used to isolate spleno- cytes and are typically primed with incomplete Freund's adjuvant or the like several days be ⁇ fore plating the hybridomas. Fusion methods are described in Goding, "Monoclonal Antibod- ies: Principles and Practice,” pp. 59-103 (Academic Press, 1986), the disclosure of which is herein incorporated by reference.
- the cells are allowed to grow in the selection media for sufficient time for colony formation and antibody production. This is usually between about 7 and about 14 days.
- the hybridoma colonies are then assayed for the production of antibodies that cross-react with multiple inhibitory KIR receptor gene products.
- the assay is typically a colorimetric ELISA- type assay, although several other types of assays may be employed, including immunopre- cipitation and radioimmunoassay, or FACS, Biacore, Scintillation-proximity assays (SPA), or other types of assays well known in the art.
- the wells containing antibodies of the desired specificity are examined to determine if one or more distinct hybridoma cell colonies are pre- sent.
- the cells may be re-cloned and grown to ensure that only a single cell has given rise to the colony producing the desired antibody. Positive wells with a single apparent colony are typically re-cloned and re-assayed to insure that only one monoclonal antibody is being detected and produced.
- the non-human animal used to produce antibodies ac- cording to applicable methods of the invention is a mammal, such as a rodent (e.g., mouse, rat, etc.), bovine, porcine, horse, rabbit, goat ⁇ sheep, etc.
- the non-human mammal may be genetically modified or engineered to produce "human" antibodies, such as the XenomouseTM (Abgenix) or HuMAb-MouseTM (Medarex), as described below.
- Antibodies also may be produced transgenically through the generation of a chor- date (such as a mammal or bird) or a plant that is transgenic for the immunoglobulin heavy and light chain sequences of interest and production of the antibody in a recoverable form therefrom (see, e.g., Ma et al., Nature Rev. Genetics 4:794-805 (2003); Nolke et al., Expert Opin Biol Ther. 2003 Oct;3(7):1153-62; Schillberg et al., Cell MoI Life Sci. 2003 Mar;60(3):433-45; Tekoah et al., Arch Biochem Biophys. 2004 Jun 15;426(2):266-78; Fischer et al., Eur. J.
- antibodies and other proteins can be produced in, and recovered from, the milk of goats, cows, or other mammals. See, e.g., US Patents 5,827,690, 5,756,687, 5,750,172, and 5,741 ,957. Antibodies also may be produced in the eggs of birds and recovered therefrom. See, e.g., Tini et al., Comp Biochem Physiol A MoI lntegr Physiol. 2002 Mar;131 (3):569-74 and US Patent 4,550,019.
- Antibodies may also be produced by selection of combinatorial libraries of immu ⁇ noglobulins, as disclosed for instance in Ward et al., Nature, 341 (1989) p. 544.
- the invention provides a hybridoma derived from a B cell from a non-human host, wherein said B-cell produces an antibody that binds a de ⁇ terminant present on at least two different human inhibitory KIR receptor gene products and said antibody is capable of neutralizing the inhibitory activity of said receptors. More pref ⁇ erably, the hybridoma of this aspect of the invention is not a hybridoma that produces the monoclonal antibody NKVSF1 , not A210, and/or not A802g.
- the hybridoma according to this aspect of the invention can be created as described above by the fusion of splenocytes from the immunized non-human mammal with an immortal cell line. Hybridomas produced by this fusion can be screened for the presence of such a cross-reacting antibody as described elsewhere herein. Preferably, the hybridoma produces an antibody that recognizes a deter- minant present on at least two different KIR2DL gene products, and cause potentiation of NK cells expressing at least one of those KIR receptors.
- the hybridoma produces an antibody that binds to substantially the same epitope or determinant as 1 -7F9 and which potentiates NK cell activity, or which binds substantially the saem epitope as 1 - 4F1.
- the hybridoma is hybridoma 1 -7F9 which produces monoclonal anti- body 1 -7F9, or hybridoma 1 -4F1 which produces monoclonal antibody 1 -4F1.
- Hybridomas that are confirmed to produce a monoclonal antibody of this invention can be grown up in larger amounts in an appropriate medium, such as DMEM or RPMI-1640.
- an appropriate medium such as DMEM or RPMI-1640.
- the hybridoma cells can be grown in vivo as ascites tumors in an animal.
- the growth me- dia containing monoclonal antibody (or the ascites fluid) can be separated away from the cells, and the monoclonal antibody is purified. Purification is typically achieved by chroma ⁇ tography using protein A or protein G-Sepharose, or an anti-mouse Ig linked to a solid sup ⁇ port such as agarose or Sepharose beads (all described, for example, in the Antibody Purifi ⁇ cation Handbook, Amersham Biosciences, publication No. 18-1037-46, Edition AC, the dis- closure of which is hereby incorporated by reference), or by other known techniques such as electrophoresis or dialysis.
- Human Antibodies In one aspect, the invention provides human anti-KIR antibodies. "Human” antibod ⁇ ies are distinguishable from “humanized” antibodies (which are described separately below). Such "human” antibodies may include amino acid residues not encoded by human germ line immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagene- sis in vitro or by somatic mutation in vivo), for example in the CDRs, such as in CDR3.
- human antibody is intended to not include humanized anti ⁇ bodies or human/mouse chimera antibodies in which CDR sequences derived from the germ line of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- Transgenic animals can and have been developed that harbour human Ig-genes and, upon immunization, produce a full repertoire of human antibodies in the absence of mouse immunoglobulin production. Such human Ig-transgenic mice can be employed to pro ⁇ quiz human antibodies.
- Such human antibodies can be generated in human Ig-transgenic animals (e.g., mice, rats, sheep, pigs, goats, cattle, horses, etc.) comprising human immu- noglobulin loci and native immunoglobulin gene deletions, such as in a XenoMouseTM (Ab- genix - Fremont, CA, USA) (see, e.g., Green et al. Nature Genetics 7:13-21 (1994); Mendez et al. Nature Genetics 15:146-156 (1997); Green and Jakobovits J. Exp. Med. 188:483-495 (1998); European Patent No., EP 0 463 151 B1 ; International Patent Application Nos.
- human Ig-transgenic animals e.g., mice, rats, sheep, pigs, goats, cattle, horses, etc.
- human immu- noglobulin loci and native immunoglobulin gene deletions such as in a XenoMouseTM (Ab
- WO 94/02602 WO 96/34096; WO 98/24893, WO 99/45031 , WO 99/53049, and WO 00/037504; and US Patents 5,916,771 , 5,939,598, 5,985,615, 5,998,209, 5,994,619, 6,075,181 ,
- Splenocytes from such transgenic mice can be used to produce hybridomas that secrete human monoclonal antibodies according to well known techniques, as described herein. Similar techniques and principles are described in, e.g., Jakobovits et al., Proc. Natl. Acad. Sci. USA, 90:2551-255 (1993); Jakobovits et al., Na ⁇ ture, 362:255-258 (1993); and Bruggemann et al., Year in Immune, 7:33 (1993)).
- human antibodies or antibodies from other species can be generated through display-type technologies, including, without limitation, phage display, retroviral dis ⁇ play, ribosomal display, and other related techniques, using methods well known in the art, and the resulting molecules can be subjected to additional maturation methods, such as af- finity maturation, as such techniques also are well known (see, e.g., (Hoogenboom et al ., J. MoI. Biol.
- anti-KIR mAbs are promising agents for the treat ⁇ ment of cancer and viral infections and other diseases and disorders.
- Anti-KIR mAbs may be generated by various approaches, such as humani ⁇ ation of murine mAbs or by fusion of splenocytes from human Ig-transgenic mice (XenoMouse, or HuMab mice), by phage- display, or by immortalization of human Ab-producing B cells, or by other methods.
- the antibody can be produced by cell lines and purified in quantities suitable for formu ⁇ lation, packaging and injection into patients in need thereof. Recombinant Production
- Anti-KIR antibodies can also be prepared by recombinant expression in single cell organisms, such as yeast; or in bacterial cell cultures (such as in E. coli); or in eukaryotic cell culture (e.g., in a culture of a mammalian cells) using standard techniques.
- the DNA encoding heavy and light chains of a cross-reactive and neutralizing anti-KIR antibody that binds a determinant pre ⁇ sent on at least two different human inhibitory KIRs, is isolated from the hybridoma of this invention and placed in an appropriate expression vector for transfection into an appropriate host. The host is then used for the recombinant production of the antibody, or variants thereof, such as a humanized version of that monoclonal antibody, active fragments of the antibody, or chimeric antibodies comprising the antigen recognition portion of the antibody.
- the DNA used in this embodiment encodes an antibody that recognizes a deter ⁇ minant present on at least two different KIR2DL gene products, but not on KIR2DS3 or -4, and that cause potentiation of NK cells expressing at least one of those KIR2DL receptors.
- the DNA encodes an antibody that binds to substantially the same epitope or determinant as 1 -7F9 and which potentiates NK cell activity.
- that DNA encodes monoclonal antibody 1 -7F9.
- DNA encoding the monoclonal antibodies of the invention is readily isolated and se- quenced using conventional procedures (e.g., by using oligonucleotide probes that are capa- ble of binding specifically to genes encoding the heavy and light chains of murine or human antibodies).
- the DNA can be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to ob- tain the synthesis of monoclonal antibodies in the recombinant host cells.
- VH variable heavy
- VL variable light
- Ruker et al. Annals of the New York Academy of Sciences. 1991 ;646:212-219
- Bianchi et al. Biotechnology and Bioengineering. 2003;84:439-444
- No Soo Kim et al. Biotechnol. Prog.
- Steps 1-3 describe retrieval of the VH and VL regions from a hybridoma or other cell producing 1 -7F9 or 1 -4F1.
- the cDNA encoding the 1 -7F9 or 1 -4F1 VH and VL sequences (or mutants or de- rivatives thereof), to be used in step 4 can also be prepared from the sequence information provided in Figures 14 or 15, using well-established techniques for synthesizing cDNA frag ⁇ ments.
- VH and VL fragments of 1 -7F9 or 1 -4F1 , or mutants or derivatives thereof may be cloned into any one of a number of expression vectors described in the sci- entific literature or commercially available expression vectors, containing a constant region of the desired Ig subclass, in order to express a full-length antibody.
- VH and VL fragments of 1 -7F9 or 1 -4F1 , or mutants or derivatives thereof can be cloned into vectors en ⁇ coding truncated constant regions in order to express antibody fragments (e.g., Fab frag ⁇ ments).
- pASK84 available from the ATCC (American Type Culture Collection, catalog number 87094).
- 4x10 6 hybridoma cells (such as 1 -7F9 or 1 -4F1 ) secreting antibodies against human KIR are used for isolation of total RNA using RNeasy Mini Kit from Qiagen, according to manufacturers instructions, and briefly outlined here:
- the cells are pelleted by centrifugation for 5 min at 1000 rpm and disrupted by addition of 350 ⁇ l RLT buffer containing 10 ⁇ l/ml ⁇ - mercaptoethanol.
- the lysate is transferred onto a QIAshredder column from Qiagen and cen- trifuged for 2 min at maximum speed.
- the flow-through is mixed with an equal volume of 70% ethanol.
- RNA 1 ⁇ g RNA is used for first-strand cDNA synthesis using SMART RACE cDNA Ampli ⁇ fication Kit from Clontech.
- a reaction mixture is prepared containing RNA isolated as described above, the reverse-primer 5'-CDS primer back, and SMART Il A oligo, and this mixture is incubated at 72 S C for about 2 min., and sub ⁇ sequently cooled on ice for about 2 min. before adding 1 xFirst-Strand buffer, DTT (2OmM), dNTP (1OmM) and PowerScript Reverse Transcriptase.
- a PCR (Polymerase Chain Reaction) reaction mixture containing ixAdvantage HF 2 PCR buffer, dNTP (1OmM) and IxAdvantage HF 2 polymerase mix is established for sepa- rate amplification of variable regions of both VL and VH from cDNA made as above.
- UPM Universal Primer Mix
- Round 2 PCR is run for 5 cycles at 94 9 C for 5s, 70 e C for 10s, .and 72 S C for 1 min.
- Round 3 PCR is run for 28 cycles at 94 e C for 5s, 68 9 C for 10s, and 72 9 C for 1 min.
- PCR products are analyzed by electrophoresis on a 1% agarose gel and the DNA purified from the gel using QIAEX11 agarose gel extraction kit from Qiagen.
- the purified PCR products are introduced into PCR4-TOPO vector using TOPO TA Cloning kit from Invitrogen and used for transformation of TOP10 competent cells.
- a suitable amount of colonies are analyzed by colony PCR using Taq polymerase, 1xTaq polymerase buffer, dNTP (1OmM) and the following primers and PCR program: M13forward primer: ⁇ '-GTAAAACGACGGCCAG-S' (SEQ ID NO:32)
- M13reverse primer S'-CAGGAAACAGCTATGAC-S' (SEQ ID NO:33)
- Plasmid DNA from clones comprising VL and VH inserts, respectively, is extracted and sequenced using primer M13forward and M13reverse listed above.
- the sequences encoding the heavy and light chain variable re ⁇ gions are shown in Fig 15.
- variable light (VL) and variable heavy (VH) chain genes are designed for the amplification of the variable light (VL) and variable heavy (VH) chain genes, respectively.
- the variable regions are formatted by PCR to include a Kozak sequence, leader sequence and unique restriction enzyme sites.
- VL this is achieved by designing 5 1 PCR primers to introduce a Hindlll site, the Kozak sequence and to be homologous to the 5' end of the leader sequence of the variable light chain region.
- the 3' primer is homologous to the 3' end of the variable region and introduced a BsiWI site at the 3 1 boundary of the variable region.
- the VH region is generated in a similar fashion ex ⁇ cept that a Notl and a Nhel site are introduced in the 5' and 3' end instead of Hindlll and BsiWI, respectively.
- the amplified gene products are each cloned into a eukaryotic expression vector containing the light and heavy chain constant regions, using standard techniques.
- the VL DNA fragments is digested with Hindlll and BsiWI and ligated into a eukaryotic expression vector containing the beta-lactamase gene encoding resistance to ampicillin and an E. coli replication origin (pUC); the resulting plasmid is designated VLCL.
- the VH DNA fragments is digested with Notl and Nhel and introduced into the VLCL vector resulting from the intro- duction of VL fragment as described above.
- the resulting plasmid contains functional ex ⁇ pression cassettes encoding both the heavy and light chains,of the antibody on the same plasmid.
- the ligated plasmid is used to transform E. coli. Plasmid DNA is prepared from these ampicillin resistant bacterial populations and used for transfection into Chinese ham ⁇ ster Ovary cells, or other mammalian cell lines. Transfection and cell culture is done be stan- dard methods, as described for example in "Molecular Cloning", Sambrook et al. The result is transfected cell lines that stably express and secrete the antibody molecule of interest, such as the 1 -7F9 or 1 -4F1 human anti-KIR mAb or a mAb comprising the VH and VL regions of 1 -7F9 or 1 -4F1 , or another human anti-KIR mAb.
- the antibody molecule of interest such as the 1 -7F9 or 1 -4F1 human anti-KIR mAb or a mAb comprising the VH and VL regions of 1 -7F9 or 1 -4F1 , or another human anti-KIR mAb.
- Variants of the antibody can easily be generated.
- an antibody with the exact same specificity as 1 -7F9 or 1 -4F1 but of a different isotype than lgG4 or lgG2, respec ⁇ tively, can be obtained by sub-cloning the cDNA encoding VL and VH of 1 -7F9 or 1 -4F1 into plasmids containing cDNA encoding the kappa light chain constant regions and a heavy con ⁇ stant chain region selected from IgGI or lgG2 or lgG3 or lgG4 constant heavy chain regions.
- an antibody as generated can possess any isotype and the antibody can then be iso- type switched using conventional techniques in the art.
- Such techniques include the use of direct recombinant techniques (see, e.g., US Patent 4,816,397), cell-cell fusion techniques (see e.g., US Patent 5,916,771), and other suitable techniques known in the art.
- the effector function of antibodies provided by the invention may be "changed" with re ⁇ spect to the isotype of a parent antibody by isotype switching to, e.g., an IgGI , lgG2, lgG3, lgG4, IgD, IgA, IgE, or IgM antibody for various uses, including therapeutic ones.
- the invention provides a hybridoma comprising: (a) a B cell from a mammalian host (typically a non-human mammalian host) that has been immunized with an antigen that comprises an epitope present on an inhibitory KIR polypeptide, fused to (b) an immortalized cell ⁇ e.g., a myeloma cell), wherein said hybridoma produces a mono- clonal antibody that binds at least two different human inhibitory KIR receptors and is capa ⁇ ble of at least substantially neutralizing KIR-mediated inhibition of NK cell cytotoxicity in a population of NK cells expressing said at least two different human inhibitory KIR receptors.
- a mammalian host typically a non-human mammalian host
- an immortalized cell ⁇ e.g., a myeloma cell
- the mammalian host is a transgenic animal capable of producing human antibodies.
- said hybridoma does not produce monoclonal antibody NKVSF1 , not A210, and/or not A802g.
- the antibody binds KIR2DL1 and
- the hybridoma may produce an antibody that inhibits the binding of a HLA-C allele molecule having a Lys residue at position 80 to a human KIR2DL1 receptor, and the binding of a HLA- C allele molecule having an Asn residue at position 80 to human KIR2DL2/3 receptors.
- the hybridoma may produce an antibody that binds to substantially the same epi ⁇ tope as monoclonal antibody 1-7F9 or 1-4F1 on either KIR2DL1 or KIR2DL2/3 or both K1R2DL1 and KIR2DL2/3.
- the invention also provides methods of producing an antibody which cross-reacts with multiple KIR2DL gene products and which reduces or neutralizes the inhibitory activity of such KIRs, said method comprising the steps of:
- said non- human mammal is a transgenic animal engineered to express a human antibody repertoire (e.g., a non-human mammal comprising human immunoglobulin loci and native immu- noglobulin gene deletions, such as a XenomouseTM (Abgenix - Fremont, CA, USA) or non- human mammal comprising a minilocus of human Ig-encoding genes, such as the HuMab- mouseTM (Medarex - Princeton, NJ, USA)).
- a human antibody repertoire e.g., a non-human mammal comprising human immunoglobulin loci and native immu- noglobulin gene deletions, such as a XenomouseTM (Abgenix - Fremont, CA, USA) or non- human mammal comprising a minilocus of human Ig-encoding genes, such as the HuMab- mouseTM (Medarex - Princeton, NJ, USA)
- step a and b may be replaced by al ⁇ ternative methods for obtaining anti-KIR mAbs, including, without limitation, the use of phage-display or viral transduction of human B cells, or other methods known in the art.
- the method further comprises selecting an antibody that binds to KIR in a primate, preferably a cynomolgus monkey, NK cell or KIR polypeptide.
- the invention fur ⁇ ther comprises a method of evaluating an anti-KIR antibody, wherein an antibody produced according to the above method is administered to a primate, preferably a cynomolgus mon ⁇ key, preferably wherein the monkey is observed for the presence or absence of an indication of toxicity of the antibody.
- the invention also provides a method of producing an antibody that binds at least two different human inhibitory KIR receptor gene products, wherein the antibody is capable of neutralizing KIR-mediated inhibition of cytotoxicity (or potentiating NK cytotoxicity) by a population of NK cells expressing the at least two different human inhibitory KIR receptor gene products, the method comprising the steps of: a) immunizing a non-human mammal with an immunogen comprising an inhibitory KIR polypeptide; b) preparing antibodies from the immunized animal, wherein the antibodies bind the KIR polypeptide, c) selecting antibodies of (b) that cross-react with at least two different human inhibi ⁇ tory KIR receptor gene products, and selecting antibodies of (c) that capable of neutralizing KIR-mediated inhibition of NK cell cytotoxicity on a population of NK cells expressing the at least two different human inhibi ⁇ tory KIR receptor gene products, wherein the order of steps (c) and (d) is optionally reversed and any number of the steps are optional
- the inhibitory KIR polypeptide used for immunization can, in one embodiment, be one or more KIR2DL poly ⁇ peptide ⁇ ) and the antibodies selected in step (c) cross-react with at least KIR2DL1 and KIR2DL2/3.
- the antibody recognizes a common determinant present on at least two different KIR receptor gene products; most preferably the KIRs are KIR2DL1 and KIR2DL2/3.
- step (c) comprises selecting antibodies which react with at least one KIR2DL and one KIR3DL receptor gene products.
- the selected anti ⁇ body could react with KIR2DL1 and KIR2DL2/3 as well as KIR3DL1 and/or KIR3DL2.
- the method further comprises selecting an antibody that binds a primate, preferably a cynomolgus monkey, NK cell or KIR polypeptide.
- the invention further com- prises a method of evaluating an antibody, wherein an antibody produced according to the above method is administered to a primate, preferably a cynomolgus monkey, preferably wherein the monkey is observed for the presence or absence of an indication of toxicity of the antibody.
- the antibody selected in step c) or d) is not NKVSF1 , not A210, and/or not A802g.
- the antibody prepared in step (b) in the above methods is a monoclonal antibody.
- the antibody selected in step (c) in the above methods inhibits the binding of one or more HLA-C allotypes having a Lys residue at position 80 to a human KIR2DL1 receptor, and the binding of one or more HLA-C allotypes having an Asn residue at position 80 to human KIR2DL2/3 receptors.
- the anti- bodies selected in step (d) in the above methods cause a potentiation in NK cytotoxicity, or a neutralization of KIR-mediated inhibition of NK cytotoxicity.
- the antibody binds to substantially the same epitope as monoclonal antibody 1-7F9 on KIR2DL1 and/or KIR2DL2/3.
- the methods also or alternatively comprise the additional step of mak ⁇ ing fragments of the selected monoclonal antibodies, making derivatives of the selected monoclonal antibodies ⁇ e.g., by conjugation with a radionuclide, cytotoxic agent, reporter molecule, or the like), or making derivatives of antibody fragments produced from, or that comprise sequences that correspond to, the sequences of such monoclonal antibodies.
- a variant of such an antibody can be produced by preparing an antibody that comprises a variant amino acid sequence from the antibody obtained by the above-described methods by use of known genetic engineering methods (e.g., a sequence that is modified so as to change the,binding properties of the antibody, increase or decrease the stability of the antibody, enhance purification of the antibody, enhance detection of the antibody, and/or change the immunological properties of the antibody with respect to a host to which it is to be administered).
- known genetic engineering methods e.g., a sequence that is modified so as to change the,binding properties of the antibody, increase or decrease the stability of the antibody, enhance purification of the antibody, enhance detection of the antibody, and/or change the immunological properties of the antibody with respect to a host to which it is to be administered.
- the invention further provides a method of producing an antibody that binds at least two different human inhibitory KIR receptor gene products, wherein the antibody is capable of neutralizing KIR-mediated inhibition of NK cell cytotoxicity on (or potentiating NK cytotoxic ⁇ ity by) a population of NK cells expressing at least one of the different human inhibitory KIR receptor gene products, the method comprising the steps of: (a) selecting, from a library or repertoire, a monoclonal antibody or an antibody fragment that cross-reacts with at least two different human inhibitory KIR2DL receptor gene products, and
- step (b) selecting an antibody of (a) that is capable of neutralizing KIR-mediated inhibition of NK cell cytotoxicity in a population of NK cells expressing the at least two different human inhibitory KIR2DL receptor gene products.
- the antibody binds a common determi- nant present on KIR2DL1 and KIR2DL2/3.
- the antibody selected in step (b) is not NKVSF1.
- the antibody selected in step (b) inhibits the binding of a HLA-c allele molecule having a Lys residue at position 80 to a human KIR2DL1 receptor, and the binding of a HLA-C allele molecule having an Asn residue at position 80 to human KIR2DL2/3 recep- tors.
- the antibody selected in step (b) causes a potentiation in NK cytotoxicity.
- the antibody binds to substantially the same epitope as monoclonal antibody 1 - 7F9 on KIR2DL1 and/or KIR2DL2/3.
- the antibody binds substantially the same epitope as monoclonal antibody 1 -4F1.
- the method comprises the additional step of making fragments of the selected monoclonal antibodies, making derivatives of the se- lected monoclonal antibodies, or making derivatives of selected monoclonal antibody frag ⁇ ments.
- the invention provides a method of producing an antibody that binds at least two different human inhibitory KIR receptor gene products, wherein the antibody is ca ⁇ pable of neutralizing KIR-mediated inhibition of NK cell cytotoxicity in a population of NK cells expressing at least one of the two different human inhibitory KIR receptor gene products, the method comprising the steps of: a) culturing a hybridoma of the invention under conditions permissive for the pro ⁇ duction of the monoclonal antibody; and b) separating the monoclonal antibody from the hybridoma cells.
- the method comprises the additional step of making fragments of the the monoclonal antibody, making derivatives of the monoclonal antibody, or making derivatives of such monoclonal antibody fragments.
- the antibody binds a common determinant present on KIR2DL1 and KIR2DL2/3.
- Also provided by the present invention is a method of producing an antibody that binds at least two different human inhibitory KIR receptor gene products, wherein the anti ⁇ body is capable of neutralizing KIR-mediated inhibition of NK cell cytotoxicity in a population of NK cells expressing at least one of the two different human inhibitory KIR receptor gene products, the method comprising the steps of: a) isolating from a hybridoma of the invention a nucleic acid encoding the mono- clonal antibody; b) optionally modifying the nucleic acid so as to obtain a modified nucleic acid that comprises a sequence that encodes a modified or derivatized antibody comprising an amino acid sequence that corresponds to a functional sequence of the monoclonal antibody or is substantially similar thereto [e.g., is at least about 65%, at least about 75%, at least about 85%, at least about 90%, at least about 95% (such as about 70-99%) identical to such a se- quence) selected from a humanized antibody, a
- Particular antibodies of this invention are able to reduce or neutralize the KIR- mediated inhibition of NK cell cytotoxicity; particularly inhibition mediated by KIR2DL recep ⁇ tors and more particularly at least both KIR2DL1- and KIR2DL2/3-mediated inhibition.
- These antibodies are thus “neutralizing”, “blocking”, or “inhibitory” antibodies, in the sense that they reduce, neutralize and/or block, at least partially and detectably, the inhibitory signaling pathway mediated by KIR.r.eceptors when these interact with MHC class I molecules.
- this neutralization activity is displayed with respect to several types of inhibitory KIR receptors, preferably several KIR2DL receptor gene products, and more preferably at least both KIR2DL1 and KIR2DL2/3 so that these antibodies may be used in most or all hu- man subjects with high efficacy.
- Neutralization of KIR-mediated inhibition of NK cell cytotox ⁇ icity can be assessed by various assays or tests, such as standard in vitro cellular cytotoxic ⁇ ity assays, as described herein.
- the neutralizing activity can be illustrated by the capacity of said antibody to reconstitute lysis by KIR2DL-expressing NK cells of targets ex ⁇ pressing HLA-C.
- the neutralizing activity of the antibody is defined by the ability of the antibody to block or reduce the binding of HLA-C molecules to KIR2DL1 and KIR2DL3 (or the closely related KIR2DL2) receptors, further preferably as it is the capacity of the antibody to alter the binding of KIR2DL2/3 to a HLA-C molecule selected from Cw1 , Cw3, Cw7, and Cw8 (or of another HLA-C molecule having an Asn residue at po ⁇ sition 80), and/or the binding of KIR2DL1 to a HLA-C molecule selected from Cw2, Cw4, Cw5 and Cw6 (or of another HLA-C molecule having a Lys residue at position 80).
- the neutralizing activity of an antibody of this invention can be as- sessed in a cell-based cytotoxicity assay, as disclosed in the Examples provided herein.
- the neutralizing activity of an antibody of this invention can be as ⁇ sessed in a cytokine-release assay, wherein NK cells are incubated with the test antibody and a target cell line expressing one HLA-C allele recognized by a KIR molecule of the NK population, to stimulate NK cell cytokine production (for example IFN- ⁇ and/or GM-CSF pro- duction).
- NK cell cytokine production for example IFN- ⁇ and/or GM-CSF pro- duction.
- IFN- ⁇ production from PBMC is assessed by cell surface and intracytoplasmic staining and analysis by flow cytometry after about 4 days in culture.
- Brefeldin A Sigma Aldrich
- GM-CSF and IFN- production from polyclonal activated NK cells can be measured in supernatants using ELISA (GM-CSF: DuoSet Elisa, R&D Systems, Min ⁇ neapolis, MN; IFN- ⁇ : OptEIA set, Pharmingen).
- Antibodies of this invention may partially (i.e., reduce) or fully neutralize the KIR- mediated inhibition of NK cell cytotoxicity.
- preferred antibodies of this invention are able to induce or augment the lysis of HLA-matched, or HLA-compatible, or autologous target cell populations, /.e.,xell populations that would not be effectively lysed by NK cells in . the absence of said antibody.
- the antibodies of this invention may also be de ⁇ fined as facilitating NK cell activity in vivo, and/or in vitro.
- the antibody binds substantially the same epitope as monoclonal antibody DF200 (produced by hybridoma DF200), 1 -7F9, or 1 -4F1.
- monoclonal antibody DF200 produced by hybridoma DF200
- DF200 like antibodies Such anti ⁇ bodies can be referred to herein as "DF200 like antibodies”, “1 -7F9-like antibodies”, and “1- 4F1 -like antibodies”, respectively.
- the antibody is a monoclonal antibody. More preferred "DF200 like antibodies” of this invention are antibodies other than the monoclonal antibody NKVSF1. Most preferred is monoclonal antibody 1 -7F9 or 1 -4F1 , and antibodies comprising the VH and/or VL regions of 1 -7F9 or 1 -4F1.
- test antibodies to be examined are obtained from different source animals, or are even of a different Ig isotype
- a simple competition assay may be em ⁇ ployed in which the control antibody (DF200, for example) is mixed with the test antibody and then applied to a sample containing either or both KIR2DL1 and/or KIR2DL2/3, each of which is known to be bound by DF200.
- Protocols based upon ELISAs, radioimmunoassays, West- ern blotting, and the use of BIACORE analysis are suitable for use in such simple competition studies.
- the control and varying amounts of test antibody can simply be added separately and admixed during exposure to the KIR antigen sample.
- test antibody e.g., by using separation or washing techniques to eliminate un ⁇ bound antibodies
- control antibody from the test antibody
- the binding of the (labeled) control antibody in the presence of a completely irrelevant antibody (that does not bind KIR) can serve as the con ⁇ trol high value.
- the control low value can be obtained by incubating the labeled control anti- body with the same but unlabelled control antibody, where competition would occur and re ⁇ Jerusalem binding of the labeled antibody.
- a significant reduction in labeled anti ⁇ body reactivity in the presence of a test antibody is indicative of a test antibody that recog ⁇ nizes substantially the same epitope, i.e., one that competes with the labeled control anti ⁇ body.
- any test antibody that reduces the binding of 1 -7F9 or 1 -4F1 to both of KIR2DL1 and KIR2DL2/3 antigens by at least about 50%, such as at least about 60%, or more preferably at least about 70% (e.g., about 65-100%), at any ratio of 1 -7F9:test antibody or 1 -4F1 :test antibody between about 1 :1 or 1 :10 and about 1 :100 is considered to be an an ⁇ tibody that binds to substantially the same epitope or determinant as 1 -7F9 or 1 -4F1 , respec ⁇ tively.
- test antibody will reduce the binding of 1-7F9 to at least one other, preferably each of the KIR2DL antigens preferably at least about 50%, at least about 60%, at least about 80% or at least about 90% (e.g., about 95%) of the binding of 1 -7F9 or 1 -4F1 ob ⁇ served in the absence of the test antibody.
- each of the KIR2DL antigens preferably at least about 50%, at least about 60%, at least about 80% or at least about 90% (e.g., about 95%) of the binding of 1 -7F9 or 1 -4F1 ob ⁇ served in the absence of the test antibody.
- KIR2DL antigens preferably at least about 50%, at least about 60%, at least about 80% or at least about 90% (e.g., about 95%) of the binding of 1 -7F9 or 1 -4F1 ob ⁇ served in the absence of the test antibody.
- such methods can be adapted to identify and/or evaluate antibodies that compete with other antibodies and/or KIR antigen
- Competition can also or alternatively be assessed by, for example, a flow cytometry test.
- cells bearing a given KIR can be incubated first with a control antibody (1 -7F9 or 1 -4F1 , for example), and then with the test antibody labeled with a f luorochrome or biotin.
- the antibody is said to compete with control antibody if the binding obtained upon pre ⁇ incubation with saturating amount of control antibody is about 80%, preferably about 50%, about 40% or less (e.g., about 30%) of the binding (as measured by mean of fluorescence) obtained by the test antibody without preincubation with control antibody.
- an antibody is said to compete with the control antibody if the binding obtained with a labeled control antibody (by a fluorochrome or biotin) on cells preincubated with saturating amount of test antibody is about 80%, preferably about 50%, about 40%, or less (e.g., about 30%) of the binding obtained without preincubation with the test antibody.
- a simple competition assay in which a test antibody is pre-adsorbed and applied at saturating concentration to a surface onto which either KIR2DL1 or KIR2DL2/3, or both, are immobilized also may be advantageously employed.
- the surface in the simple competition assay is preferably a BIACORE chip (or other media suitable for surface plasmon resonance analysis).
- control antibody e.g., 1-7F9 or 1-4F1
- This binding to the KIR-containing surface of the control antibody alone is compared with the binding of the control antibody in the presence of a test antibody.
- a sig ⁇ nificant reduction in binding to the KIR2DL1 and KIR2DL2/3-containing surface by the control antibody in the presence of a test antibody indicates that the test antibody recognizes sub ⁇ stantially the same epitope as the control antibody such that the test antibody "competes" with the control antibody. Any test antibody that reduces the binding of control antibody
- test antibody will reduce the bind- ing of the control antibody (e.g., 1 -7F9 or 1 -4F1 ) to each of the KIR2DL antigens by at least about 50% (e.g., at least about 60%, at least about 70%, or more).
- control and test antibodies can be reversed; i.e. the control antibody can be first bound to the surface and then the test antibody is brought into contact with the surface thereafter in a competition assay.
- the antibody having higher affinity for KIR2DL1 and KIR2DL2/3 antigens is bound to the KIR2DL1 and KIR2DL2/3-containing surface first, as it will be expected that the decrease in binding seen for the second antibody (assuming the antibodies are competing) will be of greater magnitude.
- assays are provided in the Examples herein, and in e.g., Saunal and Regenmortel, (1995) J. Immunol. Methods 183: 33-41 , the disclosure of which is incorporated herein by reference.
- screening assays can also be used to identify antibodies that compete with one or more of NKVSF1 , DF200, EB6, GL183, and other anti ⁇ bodies, antibody fragments, and antibody derivatives according to the invention.
- the invention Upon immunization and production of antibodies in a vertebrate or cell, particular se- lection steps may be performed to isolate antibodies as claimed.
- the invention also relates to methods of producing such antibodies, comprising:
- an additional step is performed between steps (c) and (d) above, to select anti-KIR mAbs that do not react with KIR2DS4.
- the selection of an antibody that cross-reacts with at least two different inhibitory KIR gene products may be achieved by screening the antibody against two or more different inhibitory KIR antigens.
- the antibodies prepared in step (b) are monoclonal antibodies.
- the term "preparing antibodies from said immunized ani ⁇ mal," as used herein, includes obtaining B-cells from an immunized animal and using those B cells to produce a hybridoma that expresses antibodies, as well as obtaining antibodies di ⁇ rectly from the serum of an immunized animal.
- the anti- bodies selected in step (c) are those that cross-react with at least KIR2DL1 and KIR2DL2/3.
- the antibodies selected in step (d) cause at least about 10% more specific lysis mediated by NK cells displaying at least one KIR recog ⁇ nized by the antibody, and preferably at least about 40% more specific lysis, at least about 50% higher specific lysis, or more preferably at least about 70% increased specific lysis (e.g., about 60-100% increased specific lysis), as measured in a standard chromium release assay towards a target cell expressing cognate HLA class I molecule, compared to the specific lysis in the absence of an anti-KIR mAb..
- the antibodies selected in step (d) when used in a chromium-release assay employing an NK cell clone expressing one or several in ⁇ hibitory KIRs and a target cells expressing at least one HLA allele that is recognized by one of the KIRs on the NK clone the level of cytotoxicity obtained with the antibody should be at least about 20%, preferably at least about 30 %, or more of the specific cytotoxicity obtained with the same concentration of DF200 or with a blocking anti-MHC class I antibody, at the same effecto ⁇ target cell ratio.
- steps (c) and (d) of the immediately above-described method can be changed.
- the method also or alternatively may further comprise additional steps of making fragments of the monoclonal antibody or derivatives of the monoclonal antibody or such fragments, e.g., as described elsewhere herein.
- the invention provides a method for obtaining an antibody that comprises: (a) selecting, from a library or repertoire, a monoclonal antibody, a fragment of a monoclonal antibody, or a derivative of either thereof that cross-reacts with at least two dif ⁇ ferent human inhibitory KIR2DL receptor gene products, and
- the repertoire may be any (recombinant) repertoire of antibodies or fragments thereof, optionally displayed by any suitable structure (e.g., phage, bacteria, synthetic com ⁇ plex, etc.). Selection of inhibitory antibodies may be performed as disclosed above and fur ⁇ ther illustrated in the examples.
- the present invention provides antibodies that exclusively bind to KIR2DL1 within a region defined by the amino acid resi ⁇ dues (105, 106, 107, 108, 109, 110, 111 , 127, 129, 130, 131 , 132, 133, 134, 135, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161 , 162, 163, 181 , and 192).
- the invention provides antibodies that bind to KIR2DL1 and KIR 2DL2/3 without interacting with amino acid residues outside the region defined by the residues (105, 106, 107, 108, 109, 110, 111 , 127, 129, 130, 131 , 132, 133, 134, 135, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161 , 162, 163, 181 , and 192).
- the invention provides antibodies that bind to KIR2DL1 and which does not bind to a mutant of KIR2DL1 in which R131 ⁇ i.e., the Arg residue at position 131 of the KIR2DL1 mutant) is (i.e., is substituted with) an Ala residue.
- the invention provides antibodies that bind to KIR2DL1 and which does not bind to a mutant of KIR2DL1 in which R157 is Ala.
- the invention provides antibodies that bind to KIR2DL1 and which does not bind to a mutant of KIR2DL1 in which R158 is Ala. In another embodiment, the invention provides antibodies that bind to KIR2DL1 residues 131 , 157, and 158.
- the invention provides antibodies that bind to KIR2DS3(R131W), but not to wild type KIR2DS3.
- the antibodies exclusively bind to KIR2DL1 within a re- gion defined by the amino acid residues L38, R41 , M44, F45, N46, D47, T48, L49, R50, 152, F64, D72, Y80, P87, and Y88 (in which the letters designate amino acids in single-letter code, and the number is the position of that residue in KIR2DL1 (SEQ ID NO:23), using the numbering system described in Wagtmann et al., Immunity 1995;2:439-449). These resi ⁇ dues have been identified as the 1-7F9 KIR2DL1 epitope (see Example 11 ).
- the antibodies bind to an antigenic epitope in a KIR2DL1 sequence consisting of the fragment L38 to Y88 of SEQ ID NO:23.
- the antibodies bind to an antigenic epitope in a KIR2DL1 sequence comprising the fragment L38 to Y88 of SEQ ID NO:23.
- the invention provides antibodies that bind to KIR2DL1 and KIR 2DL2/3 without interacting with amino acid residues outside the region defined by the residues L38, R41 , M44, F45, N46, D47, T48, L49, R50, I52, F64, D72, Y80, P87, and Y88.
- the antibodies bind to KIR2DL1 within a region comprising at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more of the amino acid resi ⁇ dues L38, R41 , M44, F45, N46, D47, T48, L49, R50, I52, F64, D72, Y80, P87, and Y88.
- the KIR2DL1 epitope for the antibodies comprises the amino acid residues M44 and F45 (see Examples 9 and 11 ).
- the antibodies bind to KIR2DL1 within a region comprising at least 1 , 2, 4, 6, 8, 10, or 12 or all of the amino acid residues L38, R41 , M44, F45, N46, D47, T48, L49, R50, 152, F64, D72, Y80, P87, and Y88.
- the re- gion comprises amino acid residues M44 and F45, and optionally at least 1 , 2, 4, 6, 8, 10, or all of L38, R41 , N46, D47, T48, L49, R50, I52, F64, D72, Y80, P87, and Y88 (see Examples 9 and 11).
- the region comprises at least amino acid resi ⁇ dues M44, F45, and D72, which are in the KIR2DL1 region where the 1-7F9 epitope and the HLA-C binding sites overlap.
- the invention provides antibodies that bind to KIR2DL1 ,
- the invention provides antibodies that bind to both KIR2DL1 and KIR2DL2/3, but not to KIR2DS4.
- the invention provides antibodies that bind to both KIR2DL1 and KIR2DL2/3, but not to KIR2DS3 or to KIR2DS4.
- an epitope region for an anti-KIR antibody may be determined by epitope "foot-printing" using chemical modification of the exposed amines/carboxyls in the KIR2DL1 or KIR2DL2/3 protein.
- HXMS hydrogen-deuterium exchange detected by mass spectrometry
- a hydrogen/deuterium exchange of receptor and ligand protein amide protons, binding, and back exchange occurs, wherein the backbone amide groups participat- ing in protein binding are protected from back exchange and therefore will remain deuter- ated.
- Relevantregions can be identified at this point by peptic proteolysis, fast microbore high-performance liquid chromatography separation, and/or electrospray ionization mass spectrometry. See, e.g., Ehring H, Analytical Biochemistry, Vol. 267 (2) pp. 252-259 (1999) and/or Engen, J.R.
- NMR nuclear magnetic resonance epitope mapping
- Antigen signals originating from amino acids involved in the in ⁇ teraction with the antigen binding peptide typically will shift position in the spectres of the complex compared to the spectres of the free antigen, and the amino acids involved in the binding can be identified that way. See, e.g., Ernst Schering Res Found Workshop. 2004;(44):149-67; Huang et al, Journal of Molecular Biology, Vol. 281 (1) pp. 61-67 (1998); and Saito and Patterson, Methods. 1996 Jun;9(3):516-24. Epitope mapping/characterization also can be performed using mass spectrometry methods. See, e.g., Downward, J Mass Spectrom. 2000 Apr;35(4):493-503 and Kiselar and Downard, Anal Chem. 1999 May 1 ;71 (9):1792-801.
- Protease digestion techniques also can be useful in the context of epitope mapping and identification.
- Antigenic determinant-relevant regions/sequences can be determined by protease digestion, e.g. by using trypsin in a ratio of about 1 :50 to KIR2DL1 or KIR2DL2/3 o/n digestion at 37 0 C and pH 7-8, followed by mass spectrometry (MS) analysis for peptide identification.
- MS mass spectrometry
- the peptides protected from trypsin cleavage by the anti-KIR antibody can subsequently be identified by comparison of samples subjected to trypsin digestion and samples incubated with antibody and then subjected to digestion by e.g. trypsin (thereby re ⁇ vealing a foot print for the antibody).
- enzy ⁇ matic digestion can provide a quick method for analyzing whether a potential antigenic de ⁇ terminant sequence is within a region of the KIR2DL1 in the context of a KIR-binding poly- peptide. If the polypeptide is not surface exposed, it is most likely not relevant in terms of immunogenicity/antigenicity. See, e.g., Manca, Ann 1st Super Sanita. 1991 ;27(1):15-9 for a discussion of similar techniques.
- Site-directed mutagenesis is another technique useful for elucidation of a binding epitope. For example, in “alanine-scanning", each residue within a protein segment is re- placed with an alanine residue, and the consequences for binding affinity measured. If the mutation leads to a significant resuction in binding affinity, it is mast likely involved in binding. Monoclonal antibodies specific for structural epitopes ⁇ i.e., antibodies which do not bind the unfolded protein) can be used to verify that the alanine-replacement does not influence over ⁇ all fold of the protein. See, e.g., Clackson and Wells, Science 1995;267:383-386; and Wells, Proc Natl Acad Sci USA 1996;93:1-6.
- Electron microscopy can also be used for epitope "foot-printing".
- Wang et al., Nature 1992;355:275-278 used coordinated application of cryoelectron micros ⁇ copy, three-dimensional image reconstruction, and X-ray crystallography to determine the physical footprint of a Fab-fragment on the capsid surface of native cowpea mosaic virus.
- Other forms of "label-free" assay for epitope evaluation include surface plasmon resonance (SPR, BIACORE) and reflectometric interference spectroscopy (RifS). See, e.g., Fagerstam et al., Journal Of Molecular Recognition 1990;3:208-14; Nice et al., J. Chroma- togr.
- fragments and derivatives of antibodies of this invention (which are encompassed by the terms “antibody” and “antibodies” as used in this application, unless otherwise stated or clearly contradicted by context), preferably a 1-7F9- or 1 -4F1 -like antibody, can be pro- prised by techniques that are known in the art.
- Immunoreactive fragments comprise a por ⁇ tion of the intact antibody, generally the antigen binding site or variable region. Examples of antibody fragments include “kappa bodies” (see, e.g., Ill et al., Protein Eng 10: 949-57 (1997)) and "janusins” (described further elsewhere herein).
- Fab, Fab', Fab'-SH, F(ab)2, F(ab')2, dAb (Ward et al., (1989) Nature 341 :544-546); consisting essentially of a VH do- main), Fd (consisting essentially of the VH and CH1 domains), and Fv (consisting essentially of the VL and VH domains) fragments; diabodies; kappa bodies; and janusins.
- antibody fragments include a polypeptide having a primary structure consisting of one unin ⁇ terrupted sequence of contiguous amino acid residues (referred to herein as a "single-chain antibody fragment” or “single chain polypeptide”), including without limitation (1 ) single-chain Fv (scFv) molecules (2) single chain polypeptides containing only one light chain variable domain, or a fragment thereof that contains the three CDRs of the light chain variable do ⁇ main, without an associated heavy chain moiety and (3) single chain polypeptides containing only one heavy chain variable region, or a fragment thereof containing the three CDRs of the heavy chain variable region, without an associated light chain moiety; and multispecific anti- bodies formed from antibody fragments.
- Fab or F(ab')2 fragments may be pro ⁇ quizurgeal digestion of the isolated antibodies, according to conventional techniques.
- immunoreactive fragments can be modified using known methods, for example to slow clearance in vivo and obtain a more desirable pharmacokinetic profile.
- the fragment may be modified with polyethylene glycol (PEG) or poly- oxyethylated polyols.
- PEG polyethylene glycol
- Methods for coupling and site-specifically conjugating PEG to a Fab' fragment are described in, for example, Leong et al, Cytokine 16(3) :106-119 (2001) and Delgado et al, Br. J. Cancer 73(2):175-182 (1996), the disclosures of which are incorporated herein by reference.
- the invention provides antibodies, antibody fragments, and antibody derivatives comprising the light and/or heavy chain variable region sequence of 1 - 7F9 or 1-4F1 as set forth in Figure 14.
- the invention provides antibodies, antibody fragments, and derivatives thereof that comprise one or more of the light and/or heavy chain variable region CDRs of 1-7F9 or 1-4F1 as set forth in Fig. 15 or described above.
- Functional variants/analogs of such sequences can be generated by making suitable substitutions, additions, and/or deletions in these disclosed amino acid sequences using standard techniques, which may be aided by the comparison of the sequences.
- Functional variants/analogs of such sequences can be generated by making suit ⁇ able substitutions, additions, and/or deletions in these disclosed amino acid sequences using standard techniques, which may be aided by the comparison of the sequences.
- positions where a residue is present in a sequence of one of these antibodies, but not another may be suitable for deletions, substitutions, and/or insertions.
- the DNA of a encoding an antibody of this invention may be modified so as to encode for a fragment of this invention.
- the modified DNA is then inserted into an expression vector and used to transform or transfect an appropriate cell, which then expresses the desired fragment, as described elsewhere herein.
- the DNA of a hybridoma producing a murine antibody of this invention can be modified prior to insertion into an ex ⁇ pression vector, for example, by substituting the coding sequence for human heavy- and light-chain constant domains in place of the homologous non-human sequences (as de ⁇ scribed by e.g., Morrison et al., Proc. Natl. Acad. Sci. U.S.A., 81 , pp. 6851 (1984)).
- variable regions encoding the antibody of this invention may be joined, by recombinant DNA engineering, to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide. In that manner, “chimeric” or “hybrid” antibodies are prepared that have the binding specificity of the original antibody.
- non-immunoglobulin polypeptides are substituted for the constant domains of an antibody of the invention.
- the antibody of this invention preferably a DF-200-like antibody is humanized.
- “Humanized” forms of antibodies according to this in- vention are specific chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab') 2, or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from the murine immunoglobulin.
- hu ⁇ manized antibodies are human immunoglobulins (recipient antibody) in which residues from a complementary-determining region (CDR) of the recipient are replaced by residues from a CDR of the original antibody (donor antibody) while maintaining the desired specificity, affin- ity, and capacity of the original antibody.
- CDR complementary-determining region
- Fv framework residues of the human immunoglobulin may be replaced by corresponding non-human residues.
- humanized antibodies can comprise residues that are not found in either the recipient antibody or in the imported CDR or framework sequences.
- the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of the original antibody and all or substantially all of the FR regions are those of a human immunoglobulin consensus se ⁇ quence.
- the humanized antibody optimally also will comprise at least a portion of an immu- noglobulin constant region (Fc), typically that of a human immunoglobulin.
- Fc immu- noglobulin constant region
- a humanized antibody according to the present invention has one or more amino acid residues introduced into it from the original antibody. These murine or other non-human amino acid residues are often referred to as "import" residues, which are typically taken from an "import” variable domain. Humanization can be essentially performed following the method of Winter and co-workers (Jones et al., Nature, 321 , pp. 522 (1986); Riechmann et al., Nature, 332, pp. 323 (1988); Verhoeyen et al., Science, 239, pp. 1534 (1988)). Accord- ingly, such "humanized” antibodies are chimeric antibodies (Cabilly et al., U.S. Pat. No.
- hu ⁇ manized antibodies according to this invention are typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in the original murine antibody.
- variable domains both light and heavy
- sequence of the variable domain of an antibody of this invention is screened against the entire library of known human variable-domain sequences.
- the human sequence which is closest to that of the mouse is then accepted as the human framework (FR) for the humanized antibody (Sims et al., J. Immunol., 151, pp. 2296 (1993); Chothia and Lesk, J. MoI. Biol., 196, pp. 901 (1987)).
- Another method uses a particular framework from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains.
- the same framework can be used for several different humanized antibodies (Carter et al., Proc. Natl. Acad. ScL U.S.A., 89, pp. 4285 (1992); Presta et al., J. Immunol., 51 , pp. 1993)).
- humanized antibodies are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three- dimensional models of the parental and humanized sequences.
- Three-dimensional immu ⁇ noglobulin models are commonly available and are familiar to those skilled in the art.
- Com ⁇ puter programs are available which illustrate and display probable three-dimensional confor- mational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e., the analysis of residues that influence the ability of the can ⁇ didate immunoglobulin to bind its antigen.
- FR residues can be selected and combined from the consensus and import sequences so that the desired antibody character- istic, such as increased affinity for the target antigen(s), is achieved.
- the CDR residues are directly and most substantially involved in influencing antigen binding.
- a method of making human monoclonal antibodies is to use a XenoMouse® (Abgenix, Fremont, CA) as the mouse used for immunization.
- a XenoMouse is a murine host according to this invention that has had its immunoglobulin genes replaced by functional human immunoglobulin genes.
- antibodies produced by this mouse or in hybridomas made from the B cells of this mouse are already humanized.
- the XenoMouse is described in United States Patent No. 6,162,963, which is herein incorporated in its en ⁇ tirety by reference.
- An analogous method can be achieved using a HuMAb-MouseTM (Me- darex).
- Human antibodies may also be produced according to various other techniques, such as by using, for immunization, other transgenic animals that have been engineered to express a human antibody repertoire (Jakobovitz et al., Nature 362 (1993) 255), or by selec ⁇ tion of antibody repertoires using phage display methods. Such techniques are known to the skilled person and can be implemented starting from monoclonal antibodies as disclosed in the present application.
- the antibodies of the present invention may also be derivatized to "chimeric" antibodies (immunoglobulins) in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in the original antibody, while the remainder of the chain(s) is identical with or homologous to cor- responding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (Cabilly et al., supra; Morrison et al., Proc. Natl. Acad. Sci. U.S.A., 81 , pp. 6851 (1984)).
- chimeric antibodies immunoglobulins
- a toxin such as ricin, diphtheria toxin, abrin and Pseudomonas exotoxin
- a therapeutic radionuclide such as, e.g., 90 Y or 131 I
- a detectable moiety such as a fluorescent moiety, a diagnostic radioisotope or an im ⁇ aging agent
- solid support such as agarose beads or the like.
- Conjugation to a toxin is useful for targeted killing of NK cells displaying one of the cross-reacting KIR receptors on its cell surface. Once the antibody of the invention binds to the cell surface of such cells, it is internalized and the toxin is released inside of the cell, se ⁇ lectively killing that cell. Such use is an alternate embodiment of the present invention.
- Conjugation to a detectable moiety is useful when the antibody of this invention is used for diagnostic purposes. Such purposes include, but are not limited to, assaying bio ⁇ logical samples for the presence of the NK cells bearing the cross-reacting KIR on their cell surface and detecting the presence of NK cells bearing the cross-reacting KIR in a living or ⁇ ganism. Such assay and detection methods are also alternate embodiments of the present invention. Conjugation of an antibody of this invention to a solid support is useful as a tool for affinity purification of NK.,cells bearing the cross-reacting KIR on their cell surface from a source, such as a biological fluid. This method of purification is another alternate embodi ⁇ ment of the present invention, as is the resulting purified population of NK cells.
- compositions that comprise a human or humanized antibody, or fragments and derivatives thereof, wherein said antibody, fragment or derivative cross-reacts with at least two inhibitory KIR receptors at the surface of NK cells, reduces or neutralizes their inhibitory signals and potentiates the activity of those cells, in any suitable vehicle in an amount effective to detectably potentiate NK cell cytotoxicity in a pa- tient or in a biological sample comprising NK cells.
- compositions com ⁇ prising a human or humanized anti-KIR mAb, optionally together with another active agent, for use according to the present invention may be formulated with pharmaceutically accept ⁇ able carriers or diluents as well as any other known adjuvants and excipients in accordance with conventional techniques such as those disclosed in Remington: The Science and Prac- tice of Pharmacy, 19th Edition, Gennaro, Ed., Mack Publishing Co., Easton, PA, 1995.
- the compositions may appear in conventional forms, for example, capsules, tablets, aerosols, solutions or suspensions, or as freeze-dried powder.
- one object of the present invention is to provide a pharmaceutical for- mulation comprising a human or humanized antibody, or fragments or derivatives thereof, which is present in a concentration from 1 mg/ml to 500 mg/ml, and wherein said formulation has a pH from 2.0 to 10.0.
- the formulation may further comprise a buffer system, preserva ⁇ tive ⁇ ), tonicity agent(s), chelating agent(s), stabilizers and surfactants.
- the pharmaceutical formulation is an aqueous formulation, i.e., a formulation comprising water. Such formulation is typically a solution or a suspension.
- the pharmaceutical formulation is an aqueous solution.
- aqueous formulation is a formulation comprising at least 50 %w/w water.
- aqueous solution is a solution comprising at least 50 %w/w water, and the term “aqueous suspension” a suspension comprising at least 50 %w/w water.
- the pharmaceutical formulation is a freeze-dried formula ⁇ tion, whereto the physician or the patient adds solvents and/or diluents prior to use.
- the pharmaceutical formulation is a dried formulation (e.g., freeze-dried or spray-dried) ready for use without any prior dissolution.
- the invention relates to a pharmaceutical formulation
- a pharmaceutical formulation comprising an aqueous solution of an antibody as described herein, and a buffer, wherein said the anti- bodyJs present in a concentration from 1 mg/ml or above, and wherein «said formulation has a pH from about 2.0 to about 10.0.
- the pH of the formulation is selected from the list consisting of 2.0, 2.1 , 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1 , 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.1 , 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5.0, 5.1 , 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0,
- the buffer is selected from the group consisting of sodium acetate, sodium carbonate, citrate, glycylglycine, histidine, glycine, lysine, arginine, sodium dihydrogen phosphate, disodium hydrogen phosphate, sodium phosphate, and tris(hydroxymethyl)-aminomethan, bicine, tricine, malic acid, succinate, maleic acid, fumaric acid, tartaric acid, aspartic acid or mixtures thereof.
- Each one of these specific buffers consti ⁇ tutes an alternative embodiment of the invention.
- the formulation also comprises a pharmaceutically accept- able preservative.
- the preservative is selected from the group con- sisting of phenol, o-cresol, m-cresol, p-cresol, methyl p-hydroxybenzoate, propyl p- hydroxybenzoate, 2-phenoxyethanol, butyl p-hydroxybenzoate, 2-phenylethanol, benzyl al ⁇ cohol, chlorobutanol, and thiomerosal, bronopol, benzoic acid, imidurea, chlorohexidine, so ⁇ dium dehydroacetate, chlorocresol, ethyl p-hydroxybenzoate, benzethonium chloride, chlor- phenesine (3p-chlorphenoxypropane-1 ,2-diol) or mixtures thereof.
- the preservative is present in a concentration from 0.1 mg/ml to 20 mg/ml. In another embodi ⁇ ment, the preservative is present in a concentration from 0.1 mg/ml to 5 mg/ml. In yet an ⁇ other embodiment, the preservative is present in a concentration from 5 mg/ml to 10 mg/ml. In still another embodiment, the preservative is present in a concentration from 10 mg/ml to 20 mg/ml.
- Each one of the specific preservatives listed constitutes an alternative embodi ⁇ ment of the invention. While the use of a preservative in pharmaceutical compositions is well- known to the skilled person; for convenience, reference is made to Remington: The Science and Practice of Pharmacy, 19th edition, 1995.
- the formulation also comprises an isotonic agent.
- the isotonic agent is selected from the group consisting of a salt (e.g., sodium chloride), a sugar, a sugar alcohol, an amino sugar, an amino acid (e.g., L-glycine, L- histidine, arginine, lysine, isoleucine, aspartic acid, tryptophan, threonine), an alditol (e.g., glycerol (glycerine), 1 ,2-propanediol (propyleneglycol), 1 ,3-propanediol, 1 ,3-butanediol), and polyethyleneglycol (e.g., PEG400), or mixtures thereof.
- a salt e.g., sodium chloride
- a sugar e.g., a sugar alcohol
- an amino sugar e.g., an amino acid (e.g., L-glycine, L- hist
- Any suitable sugar can be used, in- eluding, but not limited to mono-, di-, or polysaccharides; and water-soluble glucans, such as, for example, fructose, glucose, mannose, sorbose, xylose r maltose, lactose, sucrose, treha ⁇ lose, dextran, pullulan, dextrin, cyclodextrin, soluble starch, hydroxyethyl starch and car- boxymethylcellulose-Na.
- the sugar additive is sucrose.
- Sugar alcohol is defined as a C4-C8 hydrocarbon having at least one -OH group and includes, for example, mannitol, sorbitol, inositol, galactitol, dulcitol, xylitol, and arabitol.
- the sugar alcohol additive is mannitol.
- the sugars or sugar alcohols mentioned above may be used individually or in combination. There is no fixed limit to the amount used, as long as the sugar or sugar alcohol is soluble in the liquid preparation and does not adversely effect the stabilizing effects achieved using the methods of the invention.
- the sugar or sugar alcohol concentration is between about 1 mg/ml and about 150 mg/ml.
- the isotonic agent is present in a concentration from 1 mg/ml to 50 mg/ml. In another embodiment, the isotonic agent is present in a concentration from 1 mg/ml to 7 mg/ml. In another embodiment, the isotonic agent is present in a concentration from 8 mg/ml to 24 mg/ml. In another embodiment, the isotonic agent is present in a concentration from 25 mg/ml to 50 mg/ml.
- Each one the specific isotonic agents listed above constitutes an alterna- tive embodiment of the invention. While the use of an isotonic agent in pharmaceutical com ⁇ positions is well-known to the skilled person; for convenience, reference is made to Reming ⁇ ton: The Science and Practice of Pharmacy, 19th edition, 1995.
- the formulation also comprises a chelating agent.
- the chelating agent is selected from salts of ethylenediaminetetraacetic acid (EDTA), citric acid, and aspartic acid, and mixtures thereof.
- the che ⁇ lating agent is present in a concentration from 0.1 mg/ml to 5mg/ml.
- the chelating agent is present in a concentration from 0.1 mg/ml to 2 mg/ml.
- the chelating agent is present in a concentration from 2 mg/ml to 5 mg/ml.
- Each one of these specific chelating agents constitutes an alternative embodiment of the invention.
- the use of a chelating agent in pharmaceutical compositions is well-known to the skilled person. For convenience reference is made to Remington: The Science and Prac ⁇ tice of Pharmacy, 19th edition, 1995.
- the formulation also comprises a stabilizer. While the use of a stabilizer in pharmaceutical compositions is well-known to the skilled person; for conven ⁇ ience, reference is made to Remington: The Science and Practice of Pharmacy, 19th edition, 1995.
- compositions of the invention may, for example, be stabilized liquid pharmaceutical compositions whose therapeutically active components include a polypeptide that possibly exhibits aggregate formation during storage in liquid pharmaceutical formulations.
- aggre ⁇ gate formation is intended a physicaLinteraction between the polypeptide molecules that re ⁇ sults in formation of oligomers, which may remain soluble, or large visible aggregates that precipitate from the solution.
- during storage is intended a liquid pharmaceutical compo ⁇ sition or formulation once prepared, is not immediately administered to a subject. Rather, fol- lowing preparation, it is packaged for storage, either in a liquid form, in a frozen state, or in a dried form for later reconstitution into a liquid form or other form suitable for administration to a subject.
- liquid pharmaceutical composition or formulation is dried either by freeze drying (i.e., lyophilization; see, for example, Williams and PoIIi (1984) J. Parenteral Sci. Technol. 38:48-59), spray drying (see Masters (1991) in Spray-Drying Hand- book (5th ed; Longman Scientific and Technical, Essez, U.K.), pp. 491-676; Broadhead et al. (1992) Drug Devel. Ind. Pharm. 18:1169-1206; and Mumenthaler et al. (1994) Pharm. Res. 11 :12-20), or air drying (Carpenter and Crowe (1988) Cryobiology 25:459-470; and Roser (1991) Biopharm.
- Aggregate formation by a polypeptide during storage of a liquid pharmaceutical composition can adversely affect biological activity of that polypeptide, result- ing in loss of therapeutic efficacy of the pharmaceutical composition. Furthermore, aggregate formation may cause other problems such as blockage of tubing, membranes, or pumps when the polypeptide-containing pharmaceutical composition is administered using an infu ⁇ sion system.
- compositions of the invention may also comprise an amount of an amino acid base sufficient to decrease aggregate formation by the polypeptide during storage of the composition.
- amino acid base is intended an amino acid or a combination of amino acids, where any given amino acid is present either in its free base form or in its salt form. Where a combination of amino acids is used, all of the amino acids may be present in their free base forms, all may be present in their salt forms, or some may be present in their free base forms while others are present in their salt forms.
- amino acids to use in preparing the compositions of the invention are those carrying a charged side chain, such as arginine, lysine, aspartic acid, and glutamic acid.
- Any stereoisomer i.e., L, D, or a mixture thereof
- a particular amino acid e.g. methionine, histidine, imidazole, arginine, ly ⁇ sine, isoleucine, aspartic acid, tryptophan, threonine and mixtures thereof
- a particular amino acid e.g. methionine, histidine, imidazole, arginine, ly ⁇ sine, isoleucine, aspartic acid, tryptophan, threonine and mixtures thereof
- Compositions of the invention may also be formu ⁇ lated with analogues of these amino acids.
- amino acid analogue is intended a derivative of the naturally occurring amino acid that brings about the desired effect of decreasing ag- gregate formation by the polypeptide during storage of the liquid pharmaceutical composi ⁇ tions of the invention.
- Suitable arginine analogues include, for example, aminoguanidine, or ⁇ nithine and N-monoethyl L-arginine
- suitable methionine analogues include ethionine and buthionine
- suitable cysteine analogues include S-methyl-L cysteine.
- the amino acid analogues are incorporated into the compositions in either their free base form or their salt form.
- the amino acids or amino acid analogues are used in a concentration, which is sufficient to prevent or delay ag ⁇ gregation of the protein.
- methionine may be added to inhibit oxidation of methionine residues to methionine sulfoxide when the polypeptide acting as the therapeutic agent is a polypeptide comprising at least one methionine residue susceptible to such oxidation.
- inhibitor is intended minimal accumula ⁇ tion of methionine oxidized species overtime. Inhibiting methionine oxidation results in greater retention of the polypeptide in its proper molecular form. Any stereoisomer of me ⁇ thionine (L or D) or combinations thereof can be used.
- the amount to be added should be an amount sufficient to inhibit oxidation of the methionine residues such that the amount of me- thionine sulfoxide is acceptable to regulatory agencies. Typically, this means that the compo ⁇ sition contains no more than about 10% to about 30% methionine sulfoxide. Generally, this can be achieved by adding methionine such that the ratio of methionine added to methionine residues ranges from about 1 :1 to about 1000:1 , such as 10:1 to about 100:1.
- the formulation also comprises a stabilizer selected from the group of high molecular weight polymers or low molecular compounds. In one embodi ⁇ ment, the stabilizer is selected from polyethylene glycol ⁇ e.g.
- PEG 3350 polyvinyl alcohol (PVA), polyvinylpyrrolidone, carboxy-/hydroxycellulose or derivates thereof (e.g., HPC, HPC- SL, HPC-L and HPMC), cyclodextrins, sulphur-containing substances as monothioglycerol, thioglycolic acid and 2-methylthioethanol, and different salts (e.g. sodium chloride).
- PVA polyvinyl alcohol
- PVC-SL polyvinylpyrrolidone
- carboxy-/hydroxycellulose or derivates thereof e.g., HPC, HPC- SL, HPC-L and HPMC
- cyclodextrins e.g., sulphur-containing substances as monothioglycerol, thioglycolic acid and 2-methylthioethanol, and different salts (e.g. sodium chloride).
- salts e.g. sodium chloride
- compositions may also comprise additional stabilizing agents, which further enhance stability of a therapeutically active polypeptide therein.
- Stabilizing agents of particular interest to the present invention include, but are not limited to, methion- ine and EDTA, which protect the polypeptide against methionine oxidation, and a nonionic surfactant, which protects the polypeptide against aggregation associated with freeze- thawing or mechanical shearing.
- the formulation also comprises a surfactant.
- the surfactant is selected from a detergent, ethoxylated castor oil, polyglycolyzed glycerides, acetylated monoglycerides, sorbitan fatty acid esters, polyoxypropylene- polyoxyethylene block polymers (eg. poLoxamers such as Pluronic® F68, poloxamer 188 and 407, Triton X-100 ), polyoxyethylene sorbitan fatty acid esters, polyoxyethylene and polyeth ⁇ ylene derivatives such as alkylated and alkoxylated derivatives (tweens, e.g.
- Tween-20, Tween-40, Tween-80 and Brij-35 monoglycerides or ethoxylated derivatives thereof, diglyc- erides or polyoxyethylene derivatives thereof, alcohols, glycerol, lectins and phospholipids (eg. phosphatidyl serine, phosphatidyl choline, phosphatidyl ethanolamine, phosphatidyl inositol, diphosphatidyl glycerol and sphingomyelin), derivates of phospholipids (eg. dipalmi- toyl phosphatidic acid) and lysophospholipids (eg.
- phospholipids eg. dipalmi- toyl phosphatidic acid
- lysophospholipids eg.
- sphingoglycol- ipids eg. ceramides, gangliosides
- dodecylphosphocholine e.g. hen egg lysolecithin
- fusidic acid derivatives- e.g. sodium tauro-dihydrofusidate etc.
- long-chain fatty acids and salts thereof C6-C12 (eg.
- acylcamitines and derivatives N ⁇ -acylated derivatives of lysine, arginine or histidine, or side-chain acylated derivatives of lysine or ar- ginine, N ⁇ -acylated derivatives of dipeptides comprising any combination of lysine, arginine or histidine and a neutral or acidic amino acid, N ⁇ -acylated derivative of a tripeptide compris ⁇ ing any combination of a neutral amino acid and two charged amino acids, DSS (docusate sodium, CAS registry no [577-11-7]), docusate calcium, CAS registry no [128-49-4]), docu ⁇ sate potassium, CAS registry no [7491-09-0]), SDS (sodium dodecyl sulphate or sodium lauryl sulphate), sodium caprylate, cholic acid or derivatives thereof, bile acids and salts thereof and glycine
- N-alkyl-N,N-dimethylammonio-1-propanesulfonates 3-cholamido-1- propyldimethylammonio-1 -propanesulfonate
- cationic surfactants quaternary ammonium bases
- cetyl-trimethylammonium bromide cetylpyridinium chloride
- non-ionic surfac ⁇ tants e.g.
- dodecyl ⁇ -D-glucopyranoside poloxamines (e.g., Tetronic's), which are tetrafunc- tional block copolymers derived from sequential addition of propylene oxide and ethylene ox ⁇ ide to ethylenediamine, or the surfactant may be selected from the group of imidazoline de- rivatives, or mixtures thereof. Each one of these specific surfactants constitutes an alterna ⁇ tive embodiment of the invention.
- the formulation also comprises protease inhibitors such as
- protease inhibitor is particular useful in pharmaceutical compositions comprising zymogens of proteases in or ⁇ der to inhibit autocatalysis.
- Other ingredients may also be present in the pharmaceutical formulation of the pre ⁇ sent invention.
- Such additional ingredients may include wetting agents, emulsifiers, antioxi ⁇ dants, bulking agents, tonicity modifiers, chelating agents, metal ions, oleaginous vehicles, proteins (e.g., human serum albumin, gelatine or proteins) and a zwitterion (e.g., an amino acid such as betaine, taurine, arginine, glycine, lysine and histidine).
- proteins e.g., human serum albumin, gelatine or proteins
- a zwitterion e.g., an amino acid such as betaine, taurine, arginine, glycine, lysine and histidine.
- Such additional ingredi- ents preferably do not adversely affect the overall stability of the pharmaceutical formulation of the present invention.
- compositions containing an antibody according to the present inven ⁇ tion may be administered to a patient in need of such treatment at several sites, for example, at topical sites, for example, skin and mucosal sites, at sites which bypass absorption, for example, administration in an artery, in a vein, in the heart, and at sites which involve ab ⁇ sorption, for example, administration in the skin, under the skin, in a muscle or in the abdo ⁇ men.
- Administration of pharmaceutical compositions according to the invention may be through several routes of administration, for example, lingual, sublingual, buccal, in the mouth, oral, in the stomach and intestine, nasal, pulmonary, for example, through the bron ⁇ chioles and alveoli or a combination thereof, epidermal, dermal, transdermal, vaginal, rectal, ocular, for examples through the conjunctiva, uretal, and parenteral to patients in need of such a treatment.
- routes of administration for example, lingual, sublingual, buccal, in the mouth, oral, in the stomach and intestine, nasal, pulmonary, for example, through the bron ⁇ chioles and alveoli or a combination thereof, epidermal, dermal, transdermal, vaginal, rectal, ocular, for examples through the conjunctiva, uretal, and parenteral to patients in need of such a treatment.
- compositions of the current invention may be administered in several dosage forms, for example, as solutions, suspensions, emulsions, microemulsions, multiple emulsion, foams, salves, pastes, plasters, ointments, tablets, coated tablets, rinses, capsules, for ex ⁇ ample, hard gelatine capsules and soft gelatine capsules, suppositories, rectal capsules, drops, gels, sprays, powder, aerosols, inhalants, eye drops, ophthalmic ointments, ophthal- mic rinses, vaginal pessaries, vaginal rings, vaginal ointments, injection solution, in situ transforming solutions, for example in situ gelling, in situ setting, in situ precipitating, in situ crystallization, infusion solution, and implants.
- compositions of the invention may further be compounded in, or attached to, for ex ⁇ ample through covalent, hydrophobic and electrostatic interactions, a drug carrier, drug de- livery system and advanced drug delivery system in order to further enhance stability of the antibody, increase bioavailability, increase solubility, decrease adverse effects, achieve chronotherapy well known to those skilled in the art, and increase patient compliance or any combination thereof.
- Examples of carriers, drug delivery systems and advanced drug deliv ⁇ ery systems include, but are not limited to, polymers, for example cellulose and derivatives, polysaccharides, for example dextran and derivatives, starch and derivatives, polyvinyl al ⁇ cohol), acrylate and methacrylate polymers, polylactic and polyglycolic acid and block co ⁇ polymers thereof, polyethylene glycols, carrier proteins, for example albumin, gels, for exam ⁇ ple, thermogeiling systems, for example block co-polymeric systems well known to those skilled in the art, micelles, liposomes, microspheres, nanoparticulates, liquid crystals and dispersions thereof, L2 phase and dispersions there of, well known to those skilled in the art of phase behaviour in lipid-water systems, polymeric micelles, multiple emulsions, self- emulsifying, self-microemulsifying, cyclodextrins and derivatives thereof, and dendrimers.
- polymers for example cellulose and derivatives, poly
- compositions of the current invention are useful in the formulation of solids, semisol ⁇ ids, powder and solutions for pulmonary administration of the antibody, using, for example a metered dose inhaler, dry powder inhaler and a nebulizer, all being devices well known to those skilled in the art.
- compositions of the current invention are specifically useful in the formulation of controlled, sustained, protracting, retarded, and slow release drug delivery systems. More specifically, but not limited to, compositions are useful in formulation of parenteral controlled release and sustained release systems (both systems leading to a many-fold reduction in number of administrations), well known to those skilled in the art. Even more preferably, are controlled release and sustained release systems administered subcutaneous.
- parenteral controlled release and sustained release systems both systems leading to a many-fold reduction in number of administrations
- examples of useful controlled release system and composi ⁇ tions are hydrogels, oleaginous gels, liquid crystals, polymeric micelles, microspheres, nanoparticles,
- Methods to produce controlled release systems useful for compositions of the cur ⁇ rent invention include, but are not limited to, crystallization, condensation, co-crystallization, precipitation, co-precipitation, emulsification, dispersion, high pressure homogenisation, en ⁇ capsulation, spray drying, microencapsulating, coacervation, phase separation, solvent evaporation to produce microspheres, extrusion and supercritical fluid processes.
- General reference is made to Handbook of Pharrrjaceutical Controlled Release (Wise, D.L., ed. Mar ⁇ cel Dekker, New York, 2000) and Drug and the Pharmaceutical Sciences vol. 99: Protein Formulation and Delivery (MacNally, E.J., ed. Marcel Dekker, New York, 2000).
- Parenteral administration may be performed by subcutaneous, intramuscular, in- traperitoneal or intravenous injection by means of a syringe, optionally a pen-like syringe.
- parenteral administration can be performed by means of an infusion pump.
- a further option is a composition which may be a solution or suspension for the administration of the antibody in the form of a nasal or pulmonal spray.
- the pharmaceuti ⁇ cal compositions containing the antibody of the invention can also be adapted to transdermal administration, e.g. by needle-free injection or from a patch, optionally an iontophoretic patch, or transmucosal, e.g. buccal, administration.
- the antibody can be administered via the pulmonary route in a vehicle, as a solu ⁇ tion, suspension or dry powder using any of known types of devices suitable for pulmonary drug delivery.
- examples of these comprise of, but are not limited to, the three general types of aerosol-generating for pulmonary drug delivery, and may include jet or ultrasonic nebuliz- ers, metered-dose inhalers, or dry powder inhalers (Cf. Yu J, Chien YW. Pulmonary drug de ⁇ livery: Physiologic and mechanistic aspects. Crit Rev Ther Drug Carr Sys 14(4) (1997) 395- 453).
- the aerodynamic diameter (d a ) of a particle is defined as the geometric equivalent diameter of a reference standard spherical particle of unit density (1 g/cm3).
- d a is related to a reference diameter (d) as a function of the square root of the density ratio as described by:
- Mass median aerodynamic diameter (MMAD) and mass median effective aerodynamic diameter (MMEAD) are used inter-changeably, are statistical parameters, and empirically describe the size of aerosol particles in relation to their potential to deposit in the lungs, independent of actual shape, size, or density (cf. Edwards DA, Ben-Jebria A, Langer R. Recent advances in pulmonary drug delivery using large, porous inhaled particles. J Appl Physiol 84(2) (199S)" 379-385).
- MMAD is normally calculated from the measurement made with impactors, an instrument that measures the particle inertial behaviour in air.
- the formulation could be aerosolized by any known aero- solisation technology, such as nebulisation, to achieve a MMAD of aerosol particles less than 10 ⁇ m, more preferably between 1-5 ⁇ m, and most preferably between 1-3 ⁇ m.
- the pre- ferred particle size is based on the most effective size for delivery of drug to the deep lung, where protein is optimally absorbed (cf. Edwards DA, Ben-Jebria A, Langer A, Recent ad ⁇ vances in pulmonary drug delivery using large, porous inhaled particles. J Appl Physiol 84(2) (1998) 379-385).
- Deep lung deposition of the pulmonal formulations comprising the antibody may op- tional be further optimized by using modifications of the inhalation techniques, for example, but not limited to: slow inhalation flow (eg. 30 L/min), breath holding and timing of actuation.
- stabilized formulation refers to a formulation with increased physical sta ⁇ bility, increased chemical stability or increased physical and chemical stability.
- physical stability of the protein formulation as used herein refers to the tendency of the protein to form biologically inactive and/or insoluble aggregates of the protein as a result of exposure of the protein to thermo-mechanical stresses and/or interaction with interfaces and surfaces that are destabilizing, such as hydrophobic surfaces and interfaces.
- aqueous protein formulations Physical stability of the aqueous protein formulations is evaluated by means of visual inspec ⁇ tion and/or turbidity measurements after exposing the formulation filled in suitable containers (e.g. cartridges or vials) to mechanical/physical stress (e.g. agitation) at different tempera ⁇ tures for various time periods.
- Visual inspection of the formulations is performed in a sharp focused light with a dark background.
- the turbidity of the formulation is characterized by a visual score ranking the degree of turbidity for instance on a scale from 0 to 3 (a formulation showing no turbidity corresponds to a visual score 0, and a formulation showing visual turbid ⁇ ity in daylight corresponds to visual score 3).
- a formulation is classified physical unstable with respect to protein aggregation, when it shows visual turbidity in daylight.
- the turbidity of the formulation can be evaluated by simple turbidity measurements well- known to the skilled person.
- Physical stability of the aqueous protein formulations can also be evaluated by using a spectroscopic agent or probe of the conformational status of the pro ⁇ tein.
- the probe is preferably a small molecule that preferentially binds to a non-native con- former of the protein.
- One example of a small molecular spectroscopic probe of protein struc ⁇ ture is Thioflavin T.
- Thioflavin T is a fluorescent dye that has been widely used for the detec- tion of amyloid fibrils.
- Thioflavin T gives rise to a new excitation maximum at aboyt 450 nm and enhanced emission at about 482 nm when bound to a fibril protein form. Unbound Thioflavin T is essen ⁇ tially non-fluorescent at the wavelengths.
- hydrophobic patch probes that bind pref ⁇ erentially to exposed hydrophobic patches of a protein.
- the hydrophobic patches are gener ⁇ ally buried within the tertiary structure of a protein in its native state, but become exposed as a protein begins to unfold or denature.
- these small molecular, spectroscopic probes are aromatic, hydrophobic dyes, such as antrhacene, acridine, phenanthroline or the like.
- spectroscopic probes are metal-amino acid complexes, such as cobalt metal complexes of hydrophobic amino acids, such as phenylalanine, leucine, isoleucine, methion ⁇ ine, and valine, or the like.
- chemical stability of the protein formulation refers to chemical covalent changes in the protein structure leading to formation of chemical degrada- tion products with potential less biological potency and/or potential increased immunogenic properties compared to the native protein structure.
- Various chemical degradation products can be formed depending on the type and nature of the native protein and the environment to which the protein is exposed. Elimination of chemical degradation can most probably not be completely avoided and increasing amounts of chemical degradation products is often seen during storage and use of the protein formulation as well-known by the person skilled in the art.
- Most proteins are prone to deamidation, a process in which the side chain amide group in glutaminyl or asparaginyl residues is hydrolysed to form a free carboxylic acid.
- de ⁇ gradations pathways involves formation of high molecular weight transformation products where two or more protein molecules are covalently bound to each other through transami- dation and/or disulfide interactions leading to formation of covalently bound dimer, oligomer and polymer degradation products (Stability of Protein Pharmaceuticals, Ahern. TJ. & Man ⁇ ning M.C., Plenum Press, New York 1992). Oxidation (of for instance methionine residues) can be mentioned as another variant of chemical degradation.
- the chemical stability of the protein formulation can be evaluated by measuring the amount of the chemical degradation products at various time-points after exposure to different environmental conditions (the for ⁇ mation of degradation products can often be accelerated by for instance increasing tempera ⁇ ture).
- a "stabilized formulation” refers to a formulation with in ⁇ creased physical stability, increased chemical stability or increased physical and chemical stability. In general, a formulation must be stable during use and storage (in compliance with recommended use and storage conditions) until the expiration date is reached.
- the pharmaceutical formulation comprising the antibody is stable for more than 6 weeks of usage and for more than 3 years of storage.
- the pharmaceutical formulation comprising the antibody is stable for more than 4 weeks of usage and for more than 3 years of storage. In a further embodiment of the invention the pharmaceutical formulation comprising the antibody is stable for more than 4 weeks of usage and for more than two years of stor- age.
- the pharmaceutical formulation com ⁇ prising the antibody is stable for more than 2 weeks of usage and for more than two years of storage.
- pharmaceutically acceptable carriers that may be used in these compositions include, but are not limited to, ion exchangers; alumina; aluminium stearate; lecithin; serum proteins such as human serum albumin; buffer substances such as phosphates and glycine; sorbic acid; potassium sorbate; partial glyceride mixtures of satu ⁇ rated vegetable fatty acids; water; salts or electrolytes such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, and zinc salts; colloi- dal silica; magnesium trisilicate; polyvinyl pyrrolidone; cellulose-based substances; polyeth ⁇ ylene glycol; sodium carboxymethylcellulose; polyacrylates; waxes; polyethylene- polyoxypropylene-block polymers; polyethylene glycol; and wool fat.
- compositions of this invention may be employed in a method of potentiating the activity of NK cells in a patient or a biological sample. This method comprises the step of contacting said composition with said patient or biological sample. Such method will be use ⁇ ful for both diagnostic and therapeutic purposes.
- the antibody composition can be administered by simply mixing with or applying directly to the sample, depending upon the nature of the sample (fluid or solid).
- the biological sample may be contacted directly with the antibody in any suitable device (plate, pouch, flask, etc.).
- the composition For use in conjunction with a patient, the composition must be formulated for administration to the patient.
- compositions of the present invention may be administered orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir.
- parenteral as used herein includes subcutaneous, intra- venous, intramuscular, intra-articular, intra-synovial, intrasternal, intrathecal, intrahepatic, in- tralesional and intracranial injection or infusion techniques.
- the compositions are administered orally, intraperitoneal Iy or intravenously.
- Sterile injectable forms of the compositions of this invention may be aqueous or an oleaginous suspension. These suspensions may be formulated according to techniques known in the art using suitable dispersing or wetting agents and suspending agents.
- the sterile injectable preparation may also be a sterile injectable solution or suspension in a non ⁇ toxic parenterally acceptable diluent or solvent, for example as a solution in 1,3-butanediol.
- the acceptable vehicles and solvents that may be employed are water, Ringer's solu ⁇ tion and isotonic sodium chloride solution.
- sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose, any bland fixed oil may be employed including synthetic mono- or diglycerides.
- Fatty acids such as oleic acid and its glyceride derivatives are useful in the preparation of injectables, as are natural pharmaceuti- cally-acceptable oils, such as olive oil or castor oil, especially in their polyoxyethylated ver ⁇ sions.
- These oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, such as carboxymethyl cellulose or similar dispersing agents that are commonly used in the formulation of pharmaceutically acceptable dosage forms including emulsions and suspensions.
- Other commonly used surfactants such as Tweens, Spans and other emulsifying agents or bioavailability enhancers which are commonly used in the manufacture of pharmaceutically acceptable solid, liquid, or other dosage forms may also be used for the purposes of formulation.
- compositions of this invention may be orally administered in any orally accept ⁇ able dosage form including, but not limited to, capsules, tablets, aqueous suspensions or so ⁇ lutions.
- carriers commonly used include lactose and corn starch.
- Lubricating agents, such as magnesium stearate, are also typically added.
- useful diluents include lactose and dried cornstarch.
- aqueous suspensions are required for oral use, the active ingredient is combined with emul ⁇ sifying and suspending agents. If desired, certain sweetening, flavoring or coloring agents may also be added.
- compositions of this invention may be administered in the form of suppositories for rectal administration.
- suppositories for rectal administration.
- suppositories can be prepared by mixing the agent with a suitable non-irritating excipient that is solid at room temperature but liquid at rectal tempera ⁇ ture and therefore will melt in the rectum to release the drug.
- suitable non-irritating excipient include cocoa butter, beeswax and polyethylene glycols.
- compositions of this invention may also be administered topically, especially when the target of treatment includes areas or organs readily accessible by topical applica ⁇ tion, including diseases of the eye, the skin, or the lower intestinal tract. Suitable topical for ⁇ mulations are readily prepared for each of these areas or organs.
- Topical application for the lower intestinal tract can be effected in a rectal supposi ⁇ tory formulation (see above) or in a suitable enema formulation. Topically-transdermal patches may also be used.
- compositions may be formulated in a suitable ointment containing the active component suspended or dissolved in one or more carriers.
- Carriers for topical administration of the compounds of this invention include, but are not limited to, mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene, poly- oxypropylene compound, emulsifying wax and water.
- the compositions can be formulated in a suitable lotion or cream containing the active components suspended or dis ⁇ solved in one or more pharmaceutically acceptable carriers.
- Suitable carriers include, but are not limited to, mineral oil, sorbitan monostearate, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.
- the compositions may be formulated as micronized suspen ⁇ sions in isotonic, pH adjusted sterile saline, or, preferably, as solutions in isotonic, pH ad ⁇ justed sterile saline, either with or without a preservative such as benzylalkonium chloride.
- the compositions may be formulated in an ointment such as petrolatum.
- compositions of this invention may also be administered by nasal aerosol or in ⁇ halation.
- Such compositions are prepared according to techniques well-known in the art of pharmaceutical formulation and may be prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, fluorocarbons, and/or other conventional solubilizing or dispersing agents.
- Several monoclonal antibodies have been shown to be efficient in clinical situations, such as Rituxan (Rituximab), Herceptin (Trastuzumab) or Xolair (Omalizumab), and similar administration regimens (i.e., formulations and/or doses and/or administration protocols) may be used with the antibodies of this invention.
- Schedules and dosages for administration of the antibody in the pharmaceutical compositions of the present invention can be determined in accordance with known methods for these products, for example using the manufacturers' instructions.
- an antibody present in a pharmaceutical composition of this inven ⁇ tion can be supplied at a concentration of 10 mg/mL in either 100 mg (10 ml_) or 500 mg (50 ml_) single-use vials.
- the product is formulated for IV administration in 9.0 mg/mL sodium chloride, 7.35 mg/mL sodium citrate dihydrate, 0.7 mg/mL polysorbate 80, and Sterile Water for Injection.
- the pH is adjusted to 6.5.
- An exemplary suitable dosage rangeJor an antibody in a pharmaceutical composition of this invention may between about 10 mg/m2 and 500 mg/m2.
- these schedules are exemplary and that an op ⁇ timal schedule and regimen can be adapted taking into account the affinity and tolerability of the particular antibody in the pharmaceutical composition that must be determined in clinical trials.
- the antibody compositions of this invention may further comprise another therapeutic agent, including agents normally utilized for the particu ⁇ lar therapeutic purpose for which the antibody is being administered.
- the additional thera ⁇ Treatmentic agent will normally be present in the composition in amounts typically used for that agent in a monotherapy for the particular disease or condition being treated.
- Such therapeu- tic agents include, but are not limited to, therapeutic agents used in the treatment of cancers, therapeutic agents used to treat infectious disease, therapeutic agents used in other immu ⁇ notherapies, cytokines (such as IL-2 or IL-15), other antibodies and fragments of other anti ⁇ bodies.
- an antibody that binds a common determinant present on at least two different human inhibitory KIR receptor gene products wherein said antibody is capable of neutralizing KIR-mediated inhibition of NK cell cytotoxicity on NK cells express ⁇ ing at least one of said two different human inhibitory KIR receptors of this invention, may be incorporated into liposomes ("immunoliposomes"), alone or together with another substance for targeted delivery to a tumor, or the site of an infection, in a human or other non-human mammal.
- liposomes liposomes
- Such other substances include nucleic acids for the delivery of genes for gene therapy or for the delivery of antisense RNA, RNAi or siRNA for suppressing a gene in an NK cell, or toxins or drugs for the targeted killing of NK cells.
- a number of therapeutic agents are available for the treatment of can ⁇ cers.
- the antibody compositions and methods of the present invention may be combined with any other methods generally employed in the treatment of the particular disease, par ⁇ ticularly a tumor, cancer disease, or other disease or disorder that the patient exhibits. So long as a particular therapeutic approach is not known to be detrimental to the patient's con ⁇ dition in itself, and does not significantly counteract the activity of the antibody in a pharma ⁇ ceutical composition of this invention, its combination with the present invention is contem- plated.
- the pharmaceutical compositions of the present invention may be used in combination with classical approaches, such as surgery, radiotherapy, chemotherapy, and the like.
- the invention therefore provides combined thera ⁇ pies in which a pharmaceutical composition of this invention is used simultaneously with, be- fore, or after surgery or radiation treatment; or is administered to patients with, before, or af ⁇ ter conventional chemotherapeutic, radiotherapeutic or anti-angiogenic agents, or targeted immunotoxins or coaguligands.
- an antibody composition of this invention and anti ⁇ cancer agents may be administered to the patient simultaneously, either in a single com ⁇ bined composition, or as two distinct compositions using the same or different administration routes.
- the administration of an antibody composition of this invention may precede, or follow, the anti-cancer agent treatment by, e.g., intervals ranging from minutes to weeks and months.
- mAbs of the present invention may be administered to patients with Non- Hodgkin's Lymphoma (NHL). Such patients are typically treated with a combination of Ri- tuximab and a combination of chemotherapy agents known as CHOP. Accordingly, anti-KIR antibodies of this invention may be used to treat NHL patients who are undergoing treatment with Rituximab and CHOP, by combining the administration of all the agents in a treatment schedule where the agents are given on the same day, or on different days, with a longer treatment-period.
- NHL patients who are undergoing treatment with Rituximab and CHOP
- anti-capcer agents may be given prior to, at the same time as, or following,,, administration of an anti-KIR antibody composition of this invention.
- vari ⁇ ous anti-cancer agents may be simultaneously or subsequently administered.
- an anti-KIR anti ⁇ body-based composition of this invention or the anti-cancer agent will be utilized. These agents may be administered interchangeably, on alternate days or weeks; or a cycle of treatment with an anti-KIR antibody composition of this invention, followed by a cycle of anti ⁇ cancer agent therapy.
- all that is required is to deliver both agents in a combined amount effective to exert an anti ⁇ tumor effect, irrespective of the times for administration.
- any surgical intervention may be practiced in combination with the present invention.
- any mechanism for inducing DNA damage locally within cancer cells is contemplated, such as gamma-irradiation, X-rays, UV- irradiation, microwaves and even electronic emissions and the like.
- the directed delivery of radioisotopes to cancer cells is also contemplated, and this may be used in connection with a targeti ng antibody o r oth er targeti ng means .
- immunomodulatory compounds or regimens may be administered in combination with or as part of the antibody compositions of the present invention.
- immunomodulatory compounds include cytokines.
- cytokines may be employed in such combined approaches.
- Examples of cytokines useful in the combina- tions contemplated by this invention include IL-1 alpha IL-1beta, IL-2, IL-3, IL-4, IL-5, IL-6, IL- 7, IL-8, IL-9, IL-10, IL-11 , IL-12, IL-13, IL-15, IL-21 , TGF-beta, GM-CSF, M-CSF, G-CSF, TNF-alpha, TNF-beta, LAF, TCGF, BCGF, TRF, BAF, BDG, MP, LIF, OSM, TMF, PDGF, IFN-alpha, IFN-beta, IFN-gamma.
- Cytokines used in the combination treatment or composi ⁇ tions of this invention are administered according to standard regimens, consistent with clini- cal indications such as the condition of the patient and relative toxicity of the cytokine.
- Other immunomodulatory compounds that may be administered in combination with, or ⁇ as part of, the antibody compositions of the present invention include antibodies that bind specifically to other inhibitory receptors on lymphocytes, including without limitation antibodies such as anti- CTLA4 antibodies, or anti-CD94/NKG2A antibodies (see, for example, U.S. published patent application 20030095965). Variants and derivatives of these molecules that are known in the art also or alternatively can be used in such methods, and incorporated into compositions of the invention, as appropriate.
- the cross-reacting, blocking, and/or inhibitory anti-KIR anti ⁇ body-comprising therapeutic compositions of the present invention may be administered in combination with or may further comprise a chemotherapeutic or hormonal therapy agent.
- a chemotherapeutic or hormonal therapy agent may be used in the combined treatment methods disclosed herein.
- Chemotherapeutic agents contemplated as exemplary include, but are not limited to, alkylating agents, antimetabolites, cytotoxic antibiotics, vinca alkaloids, for example adriamycin, dactinomycin, mitomycin, carminomycin, daunomycin, doxorubicin, tamoxifen, taxol, taxotere, vincristine, vinblastine, vinorelbine, etoposide (VP- 16), 5-fluorouracil (5FU), cytosine arabinoside, cyclophosphamide, thiotepa, methotrexate, camptothecin, actinomycin-D, mitomycin C, cisplatin (CDDP), aminopterin, combretastatin(s) and derivatives and prodrugs thereof.
- alkylating agents for example adriamycin, dactinomycin, mitomycin, carminomycin, daunomycin, doxor
- Hormonal agents include, but are not limited to, for example LHRH agonists such as leuprorelin, goserelin, triptorelin, and buserelin; anti-estrogens such as tamoxifen and tore- mifene; anti-androgens such as flutamide, nilutamide, cyproterone and bicalutamide; aroma- tase inhibitors such as anastrozole, exemestane, letrozole and fadrozole; and progestagens such as medroxy, chlormadinone and megestrol.
- LHRH agonists such as leuprorelin, goserelin, triptorelin, and buserelin
- anti-estrogens such as tamoxifen and tore- mifene
- anti-androgens such as flutamide, nilutamide, cyproterone and bicalutamide
- chemotherapeutic agents will approximate those already employed in clinical therapies wherein the chemotherapeutics are administered alone or in combination with other chemot- herapeutics.
- agents such as cisplatin, and other DNA alkylating may be used.
- Cisplatin has been widely used to treat cancer, with efficacious doses used in clini ⁇ cal applications of 20 mg/m2 for 5 days every three weeks for a total of three courses.
- Cis- platin is not absorbed orally and must therefore be delivered via injection intravenously, sub- cutaneously, intratumorally or intraperitoneal ⁇ .
- chemotherapeutic agents include compounds that interfere with DNA replication, mitosis and chromosomal segregation, and agents that disrupt the synthesis and fidelity of polynucleotide precursors.
- a number of exemplary chemotherapeutic agents for combined therapy are listed in Table C of U.S. Patent No. 6,524,583, the disclosure of which agents and indications are specifically incorporated herein by_.reference. Each of the agents listed are exemplary and not limiting. The skilled artisan is directed to "Remington's Pharma ⁇ ceutical Sciences" 15th Edition, chapter 33, in particular pages 624-652. Variation in dosage will likely occur depending on the condition being treated. The physician administering treat- ment will be able to determine the appropriate dose for the individual subject.
- the present cross-reacting, blocking, and/or inhibitory anti-KIR antibody composi ⁇ tions of this invention may be used in combination with any one or more anti-angiogenic therapies or may further comprise anti-angiogenic agents.
- anti-angiogenic agents include neutralizing antibodies, antisense RNA, siRNA, RNAi, RNA aptamers and ribozymes each directed against VEGF or VEGF receptors (U.S. Patent No. 6,524,583, the disclosure of which is incorporated herein by reference).
- Variants of VEGF with antagonistic properties may also be employed, as described in WO 98/16551 , specifically incorporated herein by reference.
- anti-angiogenic agents that are useful in connection with com ⁇ bined therapy are listed in Table D of U.S. Patent No. 6,524,583, the disclosure of which agents and indications are specifically incorporated herein by reference.
- the anti-KIR antibody compositions of this invention may also be advantageously used in combination with methods to induce apoptosis or may comprise apoptotic agents. For example, a number of oncogenes have been identified that inhibit apoptosis, or pro ⁇ grammed cell death.
- Exemplary oncogenes in this category include, but are not limited to, bcr-abl, bcl-2 (distinct from bcl-1 , cyclin D1 ; GenBank accession numbers M14745, X06487; U.S. Pat. Nos. 5,650,491 ; and 5,539,094; each incorporated herein by reference) and family members including Bcl-x1 , Mcl-1 , Bak, A1 , and A20.
- Overexpression of bcl-2 was first dis ⁇ covered in T cell lymphomas. The oncogene bcl-2 functions by binding and inactivating Bax, a protein in the apoptotic pathway.
- Inhibition of bcl-2 function prevents inactivation of Bax, and allows the apoptotic pathway to proceed.
- Inhibition of this class of oncogenes e.g., us ⁇ ing antisense nucleotide sequences, RNAi, siRNA or small molecule chemical compounds, is contemplated for use in the present invention to give enhancement of apoptosis (U.S. Pat. Nos. 5,650,491 ; 5,539,094; and 5,583,034; each incorporated herein by reference).
- the anti-KIR antibody compositions of this invention may also comprise or be used in combination with molecules that comprise a targeting portion, e.g., antibody, ligand, or conjugate thereof, directed to a specific marker on a target cell ("targeting agent"), for exam ⁇ ple a target tumor cell.
- a targeting portion e.g., antibody, ligand, or conjugate thereof
- targeting agents for use in these additional as ⁇ pects of the invention will preferably recognize accessible tumor antigens that are preferen ⁇ tially, or specifically, expressed in the tumor site.
- the targeting agents will generally bind to a surface-expressed, surface-accessible or surface-localized component of a tumor cell.
- the targeting agents will also preferably exhibit properties of high affinity; and will not exert sig ⁇ nificant in vivo side effects against life-sustaining normal tissues, such as one or more tis ⁇ sues selected from heart, kidney, brain, liver, bone marrow, colon, breast, prostate, thyroid, gall bladder, lung, adrenals, muscle, nerve fibers, pancreas, skin, or other life-sustaining or- gan or tissue in the human body.
- life-sustaining normal tissues such as one or more tis ⁇ sues selected from heart, kidney, brain, liver, bone marrow, colon, breast, prostate, thyroid, gall bladder, lung, adrenals, muscle, nerve fibers, pancreas, skin, or other life-sustaining or- gan or tissue in the human body.
- the term "not exert significant side effects,” as used herein, refers to the fact that a targeting agent, when administered in vivo, will produce only negligi ⁇ ble or clinically manageable side effects, such as those normally encountered during chemo ⁇ therapy.
- an antibody composition of this invention may addition- ally comprise or may be used in combination with adjunct compounds.
- Adjunct compounds may include by way of example anti-emetics such as serotonin antagonists and therapies such as phenothiazines, substituted benzamides, antihistamines, butyrophenones, corticos ⁇ teroids, benzodiazepines and cannabinoids; bisphosphonates such as zoledronic acid and pamidronic acid; and hematopoietic growth factors such as erythropoietin and G-CSF, for example filgrastim, lenograstim and darbepoietin.
- anti-emetics such as serotonin antagonists and therapies such as phenothiazines, substituted benzamides, antihistamines, butyrophenones, corticos ⁇ teroids, benzodiazepines and cannabinoids
- bisphosphonates such as zoledronic acid and
- two or more antibodies of this invention recognizing differ ⁇ ent epitopes or determinants, including NKVSF1 , DF200, 1 -4F1 and/or 1 -7F9, may be com ⁇ bined in a single composition so as to reduce or neutralize the inhibitory effects of as many KIR gene products as possible.
- Compositions comprising combinations of cross-reactive inhibitory KIR antibodies of this invention, or fragments or derivatives thereof, will allow even wider utility because there likely exists a small percentage of the human population that may lack each of the inhibitory KIR gene products recognized by a single cross-reacting antibody.
- an antibody composition of this invention may further comprise one or more anti ⁇ bodies that recognize single inhibitory KIR subtypes.
- an antibody of this invention can be combined with another anti-KIR antibody binding to one or more of, e.g., KIR2DL1 , KIR2DLK2, KIR2DL3, KIR3DL1 , KIR3DL2, and KIR3DL3.
- the invention also provides a method of potentiating NK cell activity in a patient in need thereof, comprising the step of administering a composition according to this invention to said patient.
- the method is more specifically directed at increasing NK cell activity in pa ⁇ tients having a disease in which increased NK cell activity is beneficial, which involves, af ⁇ fects or is caused by cells susceptible to lysis by NK cells, or which is caused or character ⁇ ized by insufficient NK cell activity, such as a cancer, another proliferative disorder, an infec ⁇ tious disease or an immune disorder.
- the methods of the present invention are utilized for the treatment of a variety of cancers and other proliferative diseases including, but not limited to, carcinoma, including that of the bladder, breast, colon, kidney, liver, lung, ovary, prostate, pancreas, stomach, cervix, thyroid and skin, including squamous cell carci ⁇ noma; hematopoietic tumors of lymphoid lineage, including leukemia, acute lymphocytic leu ⁇ kemia, acute lymphoblastic leukemia, B-cell lymphoma, T-cell lymphoma, Hodgkins lym- phoma, non-Hodgkins lymphoma, hairy cell lymphoma and Burketts lymphoma; hematopoi ⁇ etic tumors of myeloid lineage, including acute and chronic myelogenous leukemias and promyelocyte leukemia; tumors of mesenchymal origin, including fibrosarcoma and rhabdo- my
- T-cell disorders such as T-prolymphocytic leukemia (T-PLL), including of the small cell and cerebriform cell type; large granular lymphocyte leukemia (LGL) preferably of the T-cell type; Sezary syndrome (SS); Adult T-cell leukemia lymphoma (ATLL); a/d T-NHL hepatosplenic lymphoma; peripheral/post-thymic T cell lymphoma (pleomorphic and im- munoblastic subtypes); angio immunoblastic T-cell lymphoma; angiocentric (nasal) T-cell lymphoma; anaplastic (Ki 1 +) large cell lymphoma; intestinal T-cell lymphoma; T- lymphoblastic; and lymphoma/leukaemia (T-Lbly/T
- T-PLL T-prolymphocytic leukemia
- LGL large granular lymphocyte leukemia
- SS Sezary syndrome
- ATLL Adult T-cell
- proliferative disorders can also be treated according to the invention, including for example hyperplasias, fibrosis (especially pulmonary, but also other types of fibrosis, such as renal fibrosis), angiogenesis, psoriasis, atherosclerosis and smooth muscle prolifera ⁇ tion in the blood vessels, such as stenosis or restenosis following angioplasty.
- the cross- reacting inhibitory KIR antibody of this invention can be used to treat or prevent infectious diseases, including preferably any infections caused by viruses, bacteria, protozoa, molds or fungi.
- Such viral infectious organisms include, but are not limited to, hepatitis type A, hepati- tis type B, hepatitis type C, influenza, varicella, adenovirus, herpes simplex type I (HS V- 1 ), herpes simplex type 2 (HSV-2), rinderpest, rhinovirus, echovirus, rotavirus, respiratory syncytial virus, papilloma virus, papilloma virus, cytomegalovirus, echinovirus, arbovirus, huntavirus, coxsackie virus, mumps virus, measles virus, rubella virus, polio virus, Ebola- virus, and human immunodeficiency virus type I or type 2 (HIV-1 , HIV-2).
- Bacterial infections that can be treated according to this invention include, but are not limited to, infections caused by the following: Staphylococcus; Streptococcus, inpjuding S. pyogenes; Enterococcl; Bacillus, including Bacillus anthracis, and Lactobacillus; Listeria; Corynebacterium diphtheriae; Gardnerella including G. vaginalis; Nocardia; Streptomyces; Thermoactinomyces vulgaris; Treponema; Camplyobacter, Pseudomonas including Raeruginosa; Legionella; Neisseria including N.gonorrhoeae and N.meningitides; Flavobac- terium including F.
- meningosepticum and F. odoraturn Brucella; Bordetella including B. per ⁇ tussis and B. bronchiseptica; Escherichia including E. coli, Klebsiella; Enterobacter, Serratia including S. marcescens and S. liquefaciens; Edwardsielia; Proteus including P. mirabilis and P. vulgaris; Streptobacillus; Rickettsiaceae including R. fickettsfi, Chlamydia including C. psit- tad and C. trachomatis; Mycobacterium including M. tuberculosis, M. intracellular, M. follui- turn, M. laprae, M. avium, M. bovis, M. africanum, M. kansasii, M. intracellular, and M. lepraernurium; and Nocardia.
- Protozoa infections that may be treated according to this invention include, but are not limited to, infections caused by leishmania, kokzidioa, and trypanosoma.
- NCID National Center for Infectious Dis- ease
- CDC Center for Disease Control
- All of said diseases are candidates for treatment using the cross-reacting inhibitory KIR antibodies of the inven ⁇ tion.
- Such methods of treating various infectious diseases may employ the antibody composition of this invention, either alone or in combination with other treatments and/or therapeutic agents known for treating such diseases, including anti-viral agents, anti-fungal agents, antibacterial agents, antibiotics, anti-parasitic agents and anti-protozoal agents.
- therapeutic agents known for treating such diseases, including anti-viral agents, anti-fungal agents, antibacterial agents, antibiotics, anti-parasitic agents and anti-protozoal agents.
- those 0 agents may be administered together with the antibodies of this invention as either a single dosage form or as separate, multiple dosage forms.
- the additional agent may be administered prior to, simultaneously with, of following administration of the antibody of this invention.
- Example 1 Purification of PBLs and generation of polyclonal or clonal NK cell lines Q,.. PBLs were derived from healthy donors by Ficoll-Hypapjue gradients and depletion of plastic adherent cells. To obtain enriched NK cells, PBLs were incubated with anti-CD3, anti-CD4 and anti-HLA-DR mAbs for 30 minutes at 4 0 C, followed by incubation with goat anti-mouse magnetic beads (Dynal) (30 minutes at 4 0 C) and immunomagnetic selection by methods known in the art (Pende et al., J Exp Med 1999;190:1505-1516).
- CD3 ⁇ CD4 ⁇ DR " 5 cells were cultivated on irradiated feeder cells and 100 U/ml lnterleukin 2 (Proleukin, Chiron Corporation) and 1 .5 ng/ml Phytohemagglutinin A (Gibco BRL) to obtain polyclonal NK cell populations.
- NK cells were cloned by limiting dilution and clones of NK cells were character ⁇ ized by flow cytometry for expression of cell surface receptors.
- the mAbs used were JT3A (lgG2a, anti-CD3), EB6 and GL183 (IgGI , anti-KIR2DL1 0 and KIR2DL3, respectively), XA-141 (IgM, anti-KIR2DL1 with the same specificity as EB6), anti-CD4 (HP2.6), and anti-DR (D1.12, lgG2a).
- JT3A LgG2a, anti-CD3
- EB6 and GL183 are commercially available (Beckman Coulter Inc., Fullerton, CA).
- XA-141 is not commercially available, but mAb EB6 can equally well be used for control reconstitution of lysis, as shown in the examples and Figures herein, as described by Moretta et al., J Exp Med 1993 ;178:597-604.
- Ceils were stained with the appropriate antibodies (30mns at 4 0 C) followed by PE- or FITC-conjugated polyclonal anti-mouse antibodies (Southern Biotechnology Associates Inc). Samples were analyzed by cytofluorometric analysis (flow cytometry) on a FACScan apparatus (Becton Dickinson, Mountain View, CA).
- NK cell clones were used in this study.
- CP11 , CN5 and CN505 are KIR2DL1 positive clones and are stained by EB6 (IgGI , anti-KIR2DL1) or XA-141 (IgM, anti KIR2DL1 with same specificity as compared to EB6 antibodies).
- CN12 and CP502 are KIR2DL3-expressing NK clones and are stained by GL183 antibody (IgGI , anti-KIR2DL2/3).
- cytolytic activity of NK clones was assessed by a standard 4-hour 51 Cr-release assay in which effector NK cells were tested for their ability to kill target cells expressing HLA-Cw3 or -Cw4, HLA positive cell lines known for their sensitivity to NK cell lysis. All the targets were used at 5000 cells per well in microtitration 96-well plates and the effecto ⁇ target ratio is indicated in the Figures (usually 4 effectors per target cells).
- the cytolytic assay was performed with or without hybridoma supernatant of the indicated monoclonal antibodies at a Vz (1 :1 ) dilution. The procedure was essentially the same as described in Moretta et al., J Exp Med 1993;178:597-604.
- Example 2 Generation of new mAbs mAbs were generated by immunizing 5 week old Balb/C mice with activated poly ⁇ clonal or monoclonal human NK cell lines as described in (Moretta et al., J Exp Med 1990;172:1589-1598). After different cell fusions, the mAbs were first selected for their abil ⁇ ity to cross-react with EB6- and GL183-positive NK cell lines and clones. Positive mono- clonal antibodies were further screened for their ability to reconstitute lysis by EB6- positive or GL183-positive NK clones of Cw4 or Cw3 positive targets, respectively.
- Cell staining was carried out as follows. Cells were stained with a panel of antibod ⁇ ies (1 ⁇ g/ml or 50 ⁇ l supernatant, 30mns at 4°C) followed by PE-conjugated goat F(ab')2 fragments anti-mouse IgG (H+L) or PE-conjugated goat F(ab')2 fragment anti-human IgG (Fc gamma) antibodies (Beckman Coulter). Cytofluorometric analysis was performed on an Ep ⁇ ics XL.MCL apparatus (Beckman Coulter).
- DF200 mAb One of the monoclonal antibodies, the DF200 mAb, was found to react with various members of the KIR family including KIR2DL1 , and KIR2DL2/3. Both KIR2DL1 -positive and KIR2DL2/3-positive NK cells were stained brightly with DF200mAb ( Figure 1). NK clones expressing one or another (or even both) of these HLA class l-specific inhibitory receptors were used as effectors cells against target cells expressing one or more HLA-C alleles. Cytotoxicity assays were carried out as follows. The cytolytic activity of YTS- KIR2DL1 or YTS-Eco (KIR-negative) cell lines was assessed by a standard 4 hours Cr-51 release assay.
- the target cells were HLA-Cw4-positive or -negative B-EBV cell lines, or HLA-Cw4-transfected 721.221 cells. All targets were used at 3000 cells per well in microti- tration plate. The effector/target ratio is indicated in the figures.
- the cytolytic assay was per ⁇ formed with or without the indicated full length or F(ab')2 fragments of monoclonal mouse or human antibodies. As expected, KIR2DL1 -positive (KIR2DL1 + ) NK clones displayed little if any cytolytic activity against target cells expressing HLA-Cw4 and KIR2DL3+ NK clones dis ⁇ played little or no activity on Cw3 positive targets.
- NK clones became unable to recognize their HLA-C ligands and displayed strong cytolytic activity against Cw3- or Cw4-expressing targets (ex ⁇ amples of results are shown in Figures 2-6) .
- the C1 R cell line (CW4+ EBV cell line, ATCC No. CRL-1993), which expresses HLA-Cw4 (but no group 1 HLA-C allotypes) was not killed by KIR2DL1 -positive NK clones (CN5/CN505), but the inhibition could be efficiently reversed by the use of either DF200 or a conventional anti KIR2DL1 mAb.
- NK clones expressing the KIR2DL2/3 + KIR2DL1 ' phenotype efficiently killed C1 R cells and this killing was unaf- fected by the DF200mAb ( Figure 2). Similar results are obtained with KIR2DL2- or KIR2DL3- positive NK clones onjCw3-positive targets.
- the Cw4+ 221 EBV cell line was not killed by KIR2DL1 ⁇ transfected NK cells, but the inhibition could be efficiently reversed by the use of the DF200 mAb, a Fab fragment of DF200, or the a conventional anti-KIR2DL1 mAbs EB6 or XA141.
- a Cw3- positive 721.221 -transfectant was not killed by KIR2DL2 + NK cells, but this inhibition could be reversed by the use of either DF200 or a DF200 Fab fragment.
- KIR2DL1 and KIR2DL3 recombinant proteins were produced in E. coil cDNA encoding the entire extracellular do- main of KIR2DL1 (SEQ ID NO:23) and KIR2DL3 (SEQ ID NO:25) were amplified by PCR from pCDM ⁇ clone 47.11 vector (Biassoni et al, Eur J Immunol. 1993;23:1083-7) and RSV.5(gpt)183 clone 6 vector (Wagtmann et al, Immunity 1995;2:439-49 and 1995;3:801- 809) respectively, using the following primers:
- Anti-sense 5'- CGGGATCCCAGGTGTCTGGGGTTACC -3' (SEQ ID NO:14) They were cloned into the pML1 expression vector in frame with a sequence encod ⁇ ing a biotinylation signal (Saulquin et al, J Exp Med. 2003;197:933-8).
- Proteins were recovered from inclusion bodies under denaturing conditions (8 M urea). Refolding of the recombinant proteins was performed in 20 mM Tris, pH 7.8, NaCI 150 mM buffer containing L-arginine (400 mM, Sigma) and ⁇ -mercaptoethanol (1 mM), at room temperature, by decreasing the urea concentration in a six step dialysis (4, 3, 2, 1 0.5 and 0 M urea, respectively). Reduced and oxidized glutathione (5 mM and 0.5 mM respec ⁇ tively, Sigma) were added during the 0.5 and 0 M urea dialysis steps. Finally, the proteins were dialyzed extensively against 10 mM Tris, pH 7.5, NaC1 150 mM buffer. Soluble, re ⁇ folded proteins were concentrated and then purified on a Superdex 200 size-exclusion col- umn (Pharmacia; AKTA system).
- Biacore Surface plasmon resonance measurements were performed on a Biacore apparatus (Biacore). In all Biacore experiments HBS buffer supplemented with 0.05% surfactant P20 served as running buffer.
- the soluble analyte (40 ⁇ l at various concentrations) was injected at a flow rate of 20 ⁇ l/min in HBS buffer, on dextran layers containing 500 or 540 reflectance units (RU), and 1000 or 700 RU of KIR2DL1 and KIR2DL3, respectively. Data are representative of 6 independent ex ⁇ periments. The results are shown in Table 1 , below.
- Human monoclonal anti-KIR mAbs were generated by immunizing transgenic mice, engineered to express a human antibody repertoire, with recombinant, soluble KIR proteins. /cAfter different cell fusions to establish hybridomas, mAbs were first-selected for their ability to cross-react with immobilized KIR2DL1 and KIR2DL3 protein (produced as described in Ex- ample 3, above).
- Several human monoclonal antibodies, including 1-7F9, 1-4F1 , 1-6F5 and 1 -6F1 were found to be cross-reactive with KIR2DL1 and KIR2DL2/3.
- Positive monoclonal antibodies were further screened for their ability to reconstitute lysis by KIR2DL1 -positive NK transfectants against Cw4-positive target cells.
- the NK cells expressing the HLA class l-specific inhibitory receptors were used as effectors cells against target cells expressing one or more HLA-C alleles ( Figures 5 and 6). Cytotoxicity assays were carried out as described above. The effector/target ratio is indicated in the figure leg ⁇ ends, and antibodies were used at either 10 ⁇ g/ml or 30 ⁇ g/ml.
- KIR2DL1+ NK cells displayed little if any cytolytic activity against tar ⁇ get cells expressing HLA-Cw4.
- NK cells became unable to recognize their HLA-C (i.e., were no longer inhibited by HLA-C molecules), and now displayed strong cytolytic activity against the Cw4-positive targets.
- the two cell lines tested were not killed by KIR2DL1+ NK cells, but the inhibition could be efficiently reversed by the use of either mAb 1-7F9 or the conventional anti-KIR2DL1 mAb EB6.
- the murine mAbs DF200 and Pan2D were compared to the human mAb 1-7F9 and in all experiments 1 -7F9 was more potent than any of the other mAbs tested in terms of inducing cytotoxicity by the NK cells.
- Antibodies 1 -4F1 , 1 -6F5 and 1 -6F1 on the other hand were not able to reconstitute cell lysis by NK cells against Cw4-positive targets.
- Example 5 Biacore competitive binding analysis of murine and human anti-KIR anti ⁇ bodies Epitope mapping analysis was performed according to a previously described method (Gauthier et al., Journal of Immunology 1999;162:41 -50; Saunal and van Regenmor- tel, Journal of Immunology 1995;183:33-41) on immobilized KIR2DL1 (900 RU), KIR 2DL3 (2000 RU) and KIR2DS1 (1000 RU) with mouse anti-KIR 2D antibodies DF200, NKVSF1 (Pan2D), gl183 and EB6, and human anti-KIR2D antibodies 1 -4F1 , 1 -6F1 , 1 -6F5 and 1-7F9.
- Results are shown in Tables 2, 3 and 4, where the antibodies designated "first anti ⁇ body" are listed on vertical column and the 'second antibody' are listed on the horizontal col- umn.
- the values for direct binding level (RU) of the antibodies to the chip are listed in the table, where direct binding of the second antibody to the KIR2D chip is listed in the upper portion of the field and the value for binding of the sec ⁇ ond antibody to the KIR2D chip when the first antibody is present is listed in the lower portion of the field.
- Listed in the right of each field is the percentage inhibition of second antibody binding.
- Table 2 shows binding on a KIR2DL1 chip
- Table 3 shows binding of antibodies to a KIR2DL3 chip
- Table 4 shows binding of antibodies to a KIR2DS1 chip.
- Example 6 Anti-KIR mAb titration with cynomolgus NK cells
- Anti-KIR antibody NKVSF1 was tested for its ability to bind to NK cells from cyno ⁇ molgus monkeys.
- Cynomol ⁇ gus Macaque PBMC were prepared from Sodium citrate CPT tube (Becton Dickinson). NK cells purification was performed by negative depletion (Macaque NK cell enrichment kit, Stem Cell Technology). NK cells were cultivated on irradiated human feeder cells with 300 U/ml lnterleukin 2 (Proleukin, Chiron Corporation) and " I ng/ml Phytohemagglutinin A (Invitro- gen, Gibco) to obtain polyclonal NK cell populations. Pan2D mAb titration with cynomolgus NK cells. Cynomolgus NK cells (NK bulk day
- Human monoclonal anti-KIR Abs were generated by immunizing transgenic mice engineered to express a human antibody repertoire with recombinant KIR protein, as de- scribed in Example 4. To generate cross-reactive anti-KIR antibodies, animals were sequen ⁇ tially immunized with different KIRs, either in soluble form as described in Example 3, or ex ⁇ pressed at the surface of cells.
- the mAbs were first selected for their ability to cross-react with immobilized KIR2DL1 and KIR2DL3 protein, by ELISA, using standard methods.
- Several human monoclonal antibodies including 1 -7F9, 1 -4F1 , 1 -6F5 and 1 -6F1 , were found to react with all of KIR2DL1, KIR2DL2 and KIR2DL3, by ELISA.
- the mAbs that reacted with both KIR2DL1 and KIR2DL2/3 were designated "KIR2DL-crossreactive mAbs.”
- the KIR2DL cross-reactive mAbs were then tested for their ability to react with KIR at the surface of cells by flow cytometry.
- the binding of the human anti-KIR mAbs was tested by incubating them with various cell lines stably over-expressing KIRs (e.g., YTS- 2DL1 , BWZ-KIR2DL2 and BWZ-KIR2DS4) or not expressing KIRs (e.g., YTS and BWZ).
- KIRs e.g., YTS- 2DL1 , BWZ-KIR2DL2 and BWZ-KIR2DS4
- YTS and BWZ stably over-expressing KIRs
- YTS and BWZ e.g., YTS and BWZ.
- cells were incubated with various concentrations (typically 0-50 ⁇ g/ml) of human anti- KIR mAb1-7F9 in DMEM-medium containing 2% FCS. After incubation, cells were washed and incubated with APC-conjugated secondary antibodies specific for human IgG. All incuba-
- the capacity of human anti-KIR mAbs, including 1 - 7F9, to block the interaction between HLA-C and KIR-molecules was assessed by competing the binding of soluble, recombinant KIR-Fc fusion proteins to cells expressing HLA-C.
- the KIR-Fc proteins were produced as described (Wagtmann et al., Immunity 1995;3(6):801 -9), except that the human Fc was replaced with murine IgGI Fc.
- Soluble KIR-Fc binds to cells expressing the specific HLA-C allotypes that are recognized by KIR2DL1, and this binding can be visualized by flow-cytometry using a secondary fluorochrome-conjugated Ab specific for the murine Fc part of the KIR-Fc protein.
- KIR2DL1 -Fc binds to cells trans- fected with HLA-Cw * 0402 (LCL 721.221 -Cw4 transfectants) (Litwin et al., J Exp Med. 1993;178:1321 -36) but not to untransfected LCL 721.221 cells (see Figure 11 A).
- KIR2DL1-FC proteins were pre-incubated with increasing concentrations of anti-KIR mAbs, and then added to LCL 721.221 -Cw4 cells, incubated at 4 5 C, washed, incubated with an APC-conjugated anti-murine IgGI Fc, washed, and analyzed by flow cytometry on a FACScalibur, or a FACScanto (Beckton Dickinson), by standard methods.
- Some murine anti- KIR mAbs such as DF200, and some human anti-KIR mAbs, namely 1-7F9 and 1-4F1 , pre- vented the binding of KIR2DL1 -Fc to the cells expressing HLA-Cw4, showing that these mAbs block the interaction between KIR2DL1 and HLA-Cw4.
- Figu ⁇ 17A shows that DF200 prevents binding of KIR2DL1-Fc to cells expressing HLA-Cw4.
- Figure 17B shows that the 1-7F9 mAbs prevented KIR2DL1 from binding to HLA-Cw4.
- the anti-KIR mAbs were tested for their ability to prevent the binding of KIR2DL2 to HLA-Cw3.
- Antibodies that prevented the binding of KIR2DL-Fc to HLA-C-expressing cells in a dose-dependent fashion were designated "blocking mAbs" and were further tested in functional cytotoxicity assays, as follows.
- the therapeutic utility of the human anti-KIR mAbs is linked to their ability to induce KIR-expressing NK cells to kill tumor ceils, by preventing inhibitory signaling via KIR.
- KIR2DL cross-reactive and blocking mAbs were able to induce lysis of target cells expressing HLA-C by NK cells expressing KIR2DL. For this purpose, the following experiments were performed:
- KIR2DL1 -expressing YTS cells can kill LCL 721.221 -Cw3, but not LCL 721.221 -Cw4 cells ( Figure 18A).
- YTS effec- tor-cells that lack KIRs kill both cell-lines efficiently.
- YTS-2DL1 effector cells cannot kill LCL 721.221 -Cw4 cells due to HLA-Cw4-induced inhibitory signaling via KIR2DL1.
- Example 8 Affinity measurements of 1-7F9 The affinity of 1 -7F9 for binding to KIR2DL1 and KIR2DL3 was measured by Biacore analysis, using soluble recombinant KIR proteins produced as described in Example 3. The Biacore experiments were performed as described in Example 3, except that the antibody used was the human mAb 1-7F9.
- Epitope mapping of a given monoclonal antibody onto a given antigen can be ob ⁇ tained by in silico methods when suitable X-ray structures/homology models exist of both the antibody and the antigen by performing protein-protein docking.
- a homology-model of an antibody can be obtained by aligning the sequence of the Light and Heavy Chain, respectively, with a selection of antibodies for which a 3D structure exists.
- the length of the 6 Complementarity Determining Regions (CDRs) can be calculated and the best template selected from antibodies with the same CDR lengths.
- CDRs Complementarity Determining Regions
- the results can be filtered and scored, by a range of methods, e.g., shape complementarity, Van der Waals interactions, hydrophobicity, electrostatics, desolvation, hydrogen bonding, atomic contact energy, residue-residue pairing statistics and hydrophilic group pairing.
- the top-scoring complexes can be evaluated in detail and interacting residues and thereby the epitope can be identified.
- 1 NKR.pdb 2000 solutions were obtained. They were filtered for their closeness to D183 (atoms ⁇ 6 A from CD) and R131 (atoms ⁇ 12 A from CZ) and 133 result- ing solutions were analyzed in detail.
- KIR2DL1 KIR2DL1
- S20 Hyd, CB
- E21 Hyd, CB, CG
- M44 Hyd, SD, CE
- F45 Hyd, CD1 , CD1 , CZ, CE2
- R68 HydDonor, NH2
- T70 Hyd, CB, CG2
- Q71 Hyd, CG
- L104 Hyd, CB, CG, CD1 , CD2
- Y105 Hyd, CG, CD2, CE2
- R131 Ion, NH2) (HydDonor, NH2), S133 (Hyd,
- Results are shown in Tables 6 and 7, where the antibodies designated "first anti ⁇ body" are listed on vertical column and the 'second antibody' are listed on the horizontal col ⁇ umn. For each antibody combination tested, the percentage inhibition of second antibody binding is listed. Where the percentages of inhibition for a certain antibody pair were above 40%, regardless of which antibody was used as first antibody, the antibodies were consid ⁇ ered competitive. Table 6 shows binding on a KIR2DL1 chip, and Table 7 shows binding of antibodies to a KIR2DL3 chip.
- KIR2DL1 competitive binding between first and second antibodies.
- KIR2DL1 competitive binding between first and second antibodies.
- Example 11 Crystal structure of KIR2DL1 in complex with HuKIRI -7F9-Fab'
- Extracellular KIR2DL1 (amino acid 1-223 of SEQ ID NO:23, with residue 16 being arginine (R) and residue 114 being leucine (L), and including an additional N-terminal me ⁇ thionine (M) residue) and HuKIRI -7F9 Fab' (with the light chain sequence of SEQ ID NO:36 and heavy chain sequence of residues 1-221 of SEQ ID NO:37) were mixed, with a slight excess of KIR2DL1 , and the complex was purified on a gel-filtration column. The complex was then concentrated to about 13.5 mg/ml. Crystals were grown with the hanging drop- technique in 10 % PEG6000 and 500 mM citrate buffer with a pH of 4.2.
- Crystals were flash frozen in liquid N 2 and crystallographic data to 2.35 A resolution were collected at 100 K us- ing the beam-line BL7111, MAX-lab, Lund, Sweden. Data were integrated by the XDS pro ⁇ gram (Kabsch, J. Appl. Crystallogr. 1993;26:795-800).
- MOLREP program of the CCP4 suite (Bailey, Acta Crystallogr. Sect. D-Biol. Crystallogr. 1994;50:760-763) and the PDB-deposited structures 1 RZJ (the Fab parti ) and 1 NKR (KIR), were used. Phase improvements were made with the ARP/WARP program (Lamzin and Wilson, Acta Crystallogr. Sect.
- the contacts were identified by the CONTACT computer program of the CCP4 suite using a cut-off distance of 4.0 A between the Fab' and KIR2DL1 molecules.
- the resulting KIR2DL1 epitope for human 1 -7F9 was found to comprise the following residues of KIR2DL1 (SEQ ID NO:23): L38, R41 , M44, F45, N46, D47, T48, L49, R50, I52, F64, D72, Y80, P87, and Y88 (Tables 8 and 9).
- Residues of 1 -7F9 involved in interactions with KIR2DL1 included S28, V29, S30, Y32, S92, N93, and W94 of the 1-7F9 variable light (VL) chain (SEQ ID NO:15, Table 8), and T28, F29, S30, F31 , I54, F55, E74, S77, G102, S103, Y105, Y106, D107, and Y108 of the variable heavy (VH) chain (SEQ ID NO:17).
- the KIR2DL1 epitope, and the residues involved in hydrogen-binding, are also indicated in the amino-acid se ⁇ quence of KIR2DL1 in Figure 20.
- the isotropic displacement factors (also called “tempera ⁇ ture factors” or "B-values") obtained from the coordinate refinement showed relatively lower values for the N-terminal domain of KIR2DL1 and the variable domains of the 1 -7F9 antibody Fab' fragment, all domains directly involved in the intermolecular binding. This showed that the binding forces between the two molecules in the complex of the crystal were strong and stable, also supporting that the crystal structure depicted a stable KIR2DL1/1-7F9 Fab' com ⁇ plex.
- KIR2DL1 KIR2DL1 ; ⁇ -strand C (amino acids L38 and R41 ), the loop between ⁇ -strands C and C, L2 (M44, F45 and N46), ⁇ - strand C (D47, T48, L49, R50 and I52), ⁇ -strand E (F64), the loop between the E and F ⁇ - strands, L3 (D72), ⁇ -stand F (Y80) and the loop between the F and G ⁇ -strands (P87 and Y88).
- ⁇ -strand C amino acids L38 and R41
- L2 M44, F45 and N46
- ⁇ - strand C D47, T48, L49, R50 and I52
- ⁇ -strand E F64
- the loop between the E and F ⁇ - strands L3 (D72)
- ⁇ -stand F Y80
- the loop between the F and G ⁇ -strands P87 and Y88.
- HLA-Cw4 molecule binds both to the D1 and D2 domain of the KIR2DL1 molecule (Fan et al. Nat. Immunol. 2001 ; 2: 452-460) the 1 -7F9 antibody binds to the
- KIR2DL1 D1 dorriain only There is, however, a spatial overlap between a bound 1-7F9 and a bound HLA-Cw4 molecule, large enough for the 1-7F9 antibody to successfully displace HLA-Cw4.
- contact residues between KIR2DL1 and HLA-Cw4 can be calculated with the CONTACT program.
- a distance cut-off of 4.0 A it can be seen that three KIR2DL1 residues involved in contacts with HLA-Cw4 residues are common to contact residues in the 1 -7F9/KIR2DL1 complex (Table 8 and 9). Those three KIR2DL1 residues are M44, F45 and D72.
- the biophysical properties and stability of human antibody 1 -7 F9 were studied.
- the folding and secondary structure of the protein was studied by circular dichroism (CD) and the oligomerization and aggregation by dynamic light scattering (DLS).
- CD circular dichroism
- DLS dynamic light scattering
- Circular dichroism CD measurements were performed at 25 0 C with a protein concentration of 2.0 mg/ml on a Chirascan circular dichroism spectrometer (Applied Photo- physics) equipped with a peltier element for temperature control. 1-7F9 samples were in cy ⁇ lindrical quartz cells with 0.1 mm path length. Buffer scans were recorded and subtracted for each sample spectra.
- DLS Dynamic light scattering
- the CD measurements showed characteristics of an all beta structure and revealed that the samples formulated at pH 7.0 maintained their secondary structure throughout the accelerated study, although there was a slight drop in the signal for the sample containing only Polysorbate 80 as excipient. This might be due to a weak precipitation of the sample since the overall form of the spectra is unchanged. The sample containing sucrose showed no such decrease over time.
- the CD measurements of the samples formulated at pH 3.0 and 8.5 showed a strong change in spectral characteristics over time, probably as a result of unfolding or other conformational changes, which could lead to non-functional 1-7F9 protein. The changes were observed immediately and were most significant at pH 3.0.
- Example 13 Affinity determination (monovalent binding) of 1-7F9 and 1-4F1
- affinities of 1-7F9 and 1 -4F1 in monovalent binding to KIR2DL1 and KIR2DL3 antigen were determined by surface plasmon resonance technology, using a Biacore 3000.
- an anti-human IgG (Dako RAHIgG, # 0423 ) was used together with an HBS-EP buffer at a flow rate of 20 ⁇ !_/min.
- Purified antibodies were diluted to 10 ⁇ g/mL
- KIR2DL1 or KIR2DL3 and buffer was injected.
- the antigens were tested at concentrations of 2000, 500, 200, 50 og 2OnM.
- Flowrate was maintained at 20 ⁇ l_/min. Re ⁇ generation of the surfacec was accomplished by a single 30s injection of Glycine-HCI pH 1.8.
- An antibody comprising a light chain variable region comprising an amino acid sequence at least 50% identical to SEQ ID NO:15 or SEQ ID NO:39, and/or a heavy chain variable re- gion comprising an amino acid sequence at least 50% identical to SEQ ID NO:17 or SEQ ID NO:41.
- An antibody comprising a light chain variable region comprising an amino acid sequence at least 80% identical to SEQ ID NO:15 or SEQ ID NO:39, and/or a heavy chain variable re- gion comprising an amino acid sequence at least 80% identical to SEQ ID NO:17 or SEQ ID NO:41.
- An antibody comprising a light chain variable region comprising an amino acid sequence at least 90% identical to SEQ ID NO:15 or SEQ ID NO:39, and/or a heavy chain variable re ⁇ gion comprising an amino acid sequence at least 90% identical to SEQ ID NO:17 or SEQ ID NO:41.
- An antibody comprising a light chain variable region comprising an amino acid sequence at least 95% identical to SEQ ID NO:15 or SEQ ID NO:39, and/or a heavy chain variable re ⁇ gion comprising an amino acid sequence at least 95% identical to SEQ ID NO:17 or SEQ ID NO:41.
- An antibody comprising a light chain variable region comprising an amino acid sequence at least 98% identical to SEQ ID NO:15 or SEQ ID NO:39, and/or a heavy chain variable re ⁇ gion comprising an amino acid sequence at least 98% identical to SEQ ID NO:17 or SEQ ID NO:41.
- the light chain variable region comprises at least one conservative amino acid substitution, each amino acid substitution being conservative as compared to the amino acid at the corresponding position in SEQ ID NO:15 or SEQ ID NO:39.
- the heavy chain variable region comprises at least one conservative amino acid substitution, each amino acid substitution being conservative as compared to the amino acid at the corresponding position in SEQ ID NO:17 or SEQ ID NO:41.
- the antibody of any of aspects 8-10 comprising at least 5 of (a) to (f). 15. The antibody of any of aspects 8-10, comprising all of (a) to (f). 16. The antibody of any of the preceding claims, comprising a light chain variable region comprising the amino acid sequence of SEQ ID NO:15, and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:17.
- SEQ ID NO:41 SEQ ID NO:41 ; and (I) a heavy chain CDR3 amino acid sequence at least 90% identical to residues 99-113 of SEQ ID NO:41.
- SEQ ID NO:41 SEQ ID NO:41 ; and (I) a heavy chain CDR3 amino acid sequence consisting essentially of residues 99-113 of SEQ ID NO:41.
- the antibody of any of the preceding aspects which is a human or humanized antibody.
- the antibody of any of the preceding aspects which is an IgGI , lgG2, lgG3, or lgG4 an ⁇ tibody.
- the antibody of any of the preceding aspects which is a human lgG4 antibody.
- a human lgG4 antibody comprising a light chain variable region comprising the amino acid sequence of SEQ ID NO:15, and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:17.
- a human lgG2 antibody comprising a light chain variable region comprising the amino acid sequence of SEQ ID NO:39, and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:41.
- the antibody of any of the preceding aspects which has a K d to KIR2DL1 of no more than about 20 nM.
- the antibody of any of the preceding aspects which has a K d to KIR2DL3 of no more than 0.025 nM.
- the antibody of any of the preceding aspects which is human. 52. A human or humanized antibody that competes with 1 -7F9 in the binding to KIR2DL1.
- the human or humanized antibody of any of aspects 52-47 which potentiates the lytic activity of an NK cell against a human target cell expressing an HLA-C class I molecule.
- the human or humanized antibody of any of aspects 52-62 which antibody comprises a light chain variable region comprising an amino acid sequence at least 90% identical to SEQ ID NO:15, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to SEQ ID NO:17, or a light chain variable region at least 90% identical to SEQ ID NO:39, and a heavy chain variable region comprising an amino acid sequence at least 90% identical to SEQ ID NO:41.
- the human or humanized antibody of any of aspects 52-63 which is an IgGI , lgG2, lgG3, or lgG4 antibody.
- the human or humanized antibody of aspect 64 which is an lgG4 antibody.
- the human antibody of aspect 64 which is an lgG2 antibody.
- a human or humanized antibody that binds to each o.ne of KIR2DL1 , -2, and -3, and which blocks KIR2DL1 , -2, or -3 binding to an HLA-C class I molecule.
- the antibody of aspect 68 which further interacts with one or more of KIR2DL1 residues L38, R41 , N46, D47, T48, L49, R50, I52, F64, D72, Y80, P87, and Y88.
- An antibody fragment or antibody derivative comprising at least one light chain CDR of the antibody of any of the preceding aspects.
- An antibody fragment or antibody derivative comprising at least two light chain CDRs of the antibody of any of the preceding aspects.
- 75. An antibody fragment or antibody derivative comprising at least three light chain CDRs of the antibody of any of the preceding aspects.
- An antibody fragment or antibody derivative comprising a VL region of the antibody of any of the preceding aspects.
- An antibody fragment or antibody derivative comprising at least one heavy chain CDR of the antibody of any of the preceding aspects.
- An antibody fragment or antibody derivative comprising at least two heavy chain CDRs of the antibody of any of the preceding aspects.
- An antibody fragment or antibody derivative comprising at least three heavy chain CDRs of the antibody of any of the preceding aspects.
- An antibody fragment or antibody derivative comprising all CDRs of the antibody of any of the preceding aspects.
- An antibody fragment or antibody derivative comprising the VH and VL regions of the antibody of any of the preceding aspects.
- a vector comprising the nucleic acid of aspect 84.
- a cell comprising the vector of aspect 85.
- a method of producing an anti-KIR antibody or antibody fragment comprising culturing the cell of aspect 86 under conditions suitable for expression of the anti-KIR antibody, anti- body fragment, respectively.
- a method of producing a derivative of an anti-KIR antibody or anti-KIR antibody fragment comprising providing an an anti-KIR antibody or antibody fragment and conjugating at least one derivative moiety thereto.
- a method of treating a cancer in a subject comprises administering to a subject suffering from cancer an effective amount of the antibody or antibody fragment or de ⁇ rivative of any of aspects 1 -82.
- a method of treating a disease or disorder caused by a virus in a subject which method comprises administering to a subject suffering from disease or disorder caused by a virus an effective amount of the antibody or antibody fragment or derivative of any of aspects 1 -82.
- a composition comprising the antibody or antibody fragment or derivative of any of as ⁇ pects 1 -82, and a pharmaceutically acceptable carrier or excipient.
- the composition of aspect 95 comprising Polysorbate 80.
- composition of aspect 95 comprising Sucrose.
- composition of aspect 95 comprising Polysorbate 80 and Sucrose.
- KIR is not KIR2DL1 , KIR2DL2, KIR2DL3, KIR2DS1 , or KIR2DS2.
- a method of increasing the lytic activity of a cell selected from a lymphocyte and an NK cell comprising contacting the cell with the antibody, antibody fragment or derivative of any of aspects 1-82. 104.
- a method of reducing the interaction between a KIR expressed by a cell selected from a lymphocyte, T cell, and an NK cell, and an HLA-C class I molecule expressed by a target cell comprising contacting the cell with the antibody or antibody fragment or de ⁇ rivative of any of aspects 1 -82.
- a method of neutralizing the inhibitory activity of a KIR expressed by an NK cell comprising contacting the NK cell with the antibody or antibody fragment or deriva ⁇ tive of any of aspects 1 -82.
- An antibody or antibody derivative comprising a light chain comprising the sequence of SEQ ID NO:36.
- An antibody or antibody derivative comprising a heavy chain comprising the sequence of SEQ ID NO:37.
- An antibody or antibody derivative comprising the light chain of aspect 109 and the heavy chain of aspect 110.
Abstract
Description
Claims
Priority Applications (24)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
ES05758642T ES2360467T3 (en) | 2004-07-01 | 2005-07-01 | ANTIBODIES THAT JOIN KIR2DL1, -2, -3 RECEPTORS BUT NOT KIR2DS4 AND THERAPEUTIC USE. |
EP10178924.6A EP2287195B1 (en) | 2004-07-01 | 2005-07-01 | Pan-kir2dl nk-receptor antibodies and their use in diagnostik and therapy |
DK05758642.2T DK1791868T3 (en) | 2004-07-01 | 2005-07-01 | Antibodies that bind to receptors KIR2DL1, -2, 3 but not KIR2DS4, as well as therapeutic use |
CA2601417A CA2601417C (en) | 2004-07-01 | 2005-07-01 | Human anti-kir antibodies |
AU2005259221A AU2005259221B2 (en) | 2004-07-01 | 2005-07-01 | Antibodies binding to receptors KIR2DL1, -2, 3 but not KIR2DS4 and their therapeutic use |
JP2007518617A JP5112863B2 (en) | 2004-07-01 | 2005-07-01 | Human anti-KIR antibody |
EP05758642A EP1791868B1 (en) | 2004-07-01 | 2005-07-01 | Antibodies binding to receptors kir2dl1, -2, 3 but not kir2ds4 and their therapeutic use |
BRPI0512911-7A BRPI0512911B1 (en) | 2004-07-01 | 2005-07-01 | ISOLATED HUMAN ANTIBODY, NUCLEIC ACID, VECTOR, CELL, METHOD OF PRODUCING A HUMAN ANTI-KIR ANTIBODY, PHARMACEUTICAL COMPOSITION, AND METHOD OF ENHANCED NK CELL ACTIVITY IN A PATIENT IN NEED OF THE SAME |
PL10178924T PL2287195T3 (en) | 2004-07-01 | 2005-07-01 | Pan-kir2dl nk-receptor antibodies and their use in diagnostik and therapy |
CN200580022633.1A CN1997670B (en) | 2004-07-01 | 2005-07-01 | Human anti-KIR antibodies |
DE602005026538T DE602005026538D1 (en) | 2004-07-01 | 2005-07-01 | TO THE RECEPTORS KIR2DL1, -2, -3, BUT NOT KIR2DS4, BINDING ANTIBODIES AND THEIR THERAPEUTIC USE |
MX2007000210A MX2007000210A (en) | 2004-07-01 | 2005-07-01 | Antibodies binding to receptors kir2dl1, -2, 3 but not kir2ds4 and their therapeutic use. |
KR1020077000069A KR101299167B1 (en) | 2004-07-01 | 2005-07-01 | Human anti-kir antibodies |
AT05758642T ATE499386T1 (en) | 2004-07-01 | 2005-07-01 | ANTIBODIES BINDING TO THE RECEPTORS KIR2DL1, -2, -3, BUT NOT KIR2DS4, AND THEIR THERAPEUTIC USE |
IL179635A IL179635A0 (en) | 2004-07-01 | 2006-11-27 | Human anti-kir antibodies |
ZA2007/00736A ZA200700736B (en) | 2004-07-01 | 2007-01-26 | Human anti-kir antibodies |
NO20070585A NO341198B1 (en) | 2004-07-01 | 2007-01-31 | Human anti-KIR antibody. |
US12/244,170 US8119775B2 (en) | 2004-07-01 | 2008-10-02 | Human anti-KIR antibodies |
US13/347,832 US8614307B2 (en) | 2004-07-01 | 2012-01-11 | Nucleic acids encoding human anti-kir antibodies |
US13/936,486 US8981065B2 (en) | 2004-07-01 | 2013-07-08 | Human anti-KIR antibodies |
US14/659,045 US20150191547A1 (en) | 2004-07-01 | 2015-03-16 | Human anti-kir antibodies |
US14/829,170 US20150344576A1 (en) | 2004-07-01 | 2015-08-18 | Human anti-kir antibodies |
NO20171133A NO344566B1 (en) | 2004-07-01 | 2017-07-07 | Isolated antibody or fragment thereof, nucleic acid encoding said antibody or antibody fragment, vector comprising the nucleic acid, cell comprising the vector or hybridoma expressing the antibody or antibody fragment, method of making antibody or antibody fragment, pharmaceutical composition comprising said antibody fragment or method production of antibody. |
CY20191100871T CY1122391T1 (en) | 2004-07-01 | 2019-08-13 | PAN-KIR2DL NK-RECEPTOR ANTIBODIES AND THEIR USE IN DIAGNOSTIC AND THERAPEUTIC |
Applications Claiming Priority (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
PCT/DK2004/000470 WO2005003168A2 (en) | 2003-07-02 | 2004-07-01 | Methods for the production and cytotoxicity evaluation of kir2dl nk-receptor antibodies |
IBPCT/IB2004/002464 | 2004-07-01 | ||
DKPCT/DK2004/000470 | 2004-07-01 | ||
PCT/IB2004/002464 WO2005003172A2 (en) | 2003-07-02 | 2004-07-01 | Pan-kir2dl nk-receptor antibodies and their use in diagnostik and therapy |
DKPA200500025 | 2005-01-06 | ||
DKPA200500025 | 2005-01-06 |
Related Child Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11630176 A-371-Of-International | 2005-07-01 | ||
US12/244,170 Continuation US8119775B2 (en) | 2004-07-01 | 2008-10-02 | Human anti-KIR antibodies |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2006003179A2 true WO2006003179A2 (en) | 2006-01-12 |
WO2006003179A3 WO2006003179A3 (en) | 2006-05-26 |
Family
ID=35431942
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2005/053122 WO2006003179A2 (en) | 2004-07-01 | 2005-07-01 | Antibodies binding to receptors kir2dl1, -2, 3 but not kir2ds4 and their therapeutic use |
Country Status (10)
Country | Link |
---|---|
US (5) | US8119775B2 (en) |
EP (2) | EP2287195B1 (en) |
JP (1) | JP5112863B2 (en) |
CN (1) | CN1997670B (en) |
AU (1) | AU2005259221B2 (en) |
CA (1) | CA2601417C (en) |
DK (1) | DK2287195T3 (en) |
PL (1) | PL2287195T3 (en) |
SI (1) | SI2287195T1 (en) |
WO (1) | WO2006003179A2 (en) |
Cited By (62)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2006050270A2 (en) * | 2004-11-02 | 2006-05-11 | The Government Of The United States Of America As Represented By The Secretary Department Of Health & Human Services | Compositions and methods for treating hyperproliferative disorders |
WO2006072626A1 (en) * | 2005-01-06 | 2006-07-13 | Novo Nordisk A/S | Kir-binding agents and methods of use thereof |
WO2008084106A1 (en) * | 2007-01-11 | 2008-07-17 | Novo Nordisk A/S | Anti-kir antibodies, formulations, and uses thereof |
WO2010065939A1 (en) * | 2008-12-05 | 2010-06-10 | Indiana University Research & Technology Corporation | Combination therapy to enhace nk cell mediated cytotoxicty |
EP2322557A2 (en) | 2005-10-14 | 2011-05-18 | Innate Pharma | Compositions and methods for treating proliferative disorders |
EP2494062A2 (en) * | 2009-10-28 | 2012-09-05 | Janssen Biotech, Inc. | Anti-glp-1r antibodies and their uses |
WO2012160448A2 (en) | 2011-05-25 | 2012-11-29 | Innate Pharma, S.A. | Anti-kir antibodies for the treatment of inflammatory disorders |
WO2012175613A1 (en) | 2011-06-21 | 2012-12-27 | Innate Pharma | NKp46-MEDIATED NK CELL TUNING |
CN103209988A (en) * | 2010-10-06 | 2013-07-17 | 圣朱德儿童研究医院 | Molecular determinant-based typing of kir alleles and kir-ligands |
WO2014055648A1 (en) | 2012-10-02 | 2014-04-10 | Bristol-Myers Squibb Company | Combination of anti-kir antibodies and anti-pd-1 antibodies to treat cancer |
WO2015069785A1 (en) * | 2013-11-06 | 2015-05-14 | Bristol-Myers Squibb Company | Combination of anti-kir and anti-cs1 antibodies to treat multiple myeloma |
US9150636B2 (en) | 2004-07-10 | 2015-10-06 | Fox Chase Cancer Center | Genetically modified human natural killer cell lines |
WO2016069589A1 (en) | 2014-10-28 | 2016-05-06 | University Children's Hospital Tübingen | Treatment of pediatric bcp-all patients with an anti-kir antibody |
WO2016070001A1 (en) * | 2014-10-31 | 2016-05-06 | Jounce Therapeutics, Inc. | Methods of treating conditions with antibodies that bind b7-h4 |
WO2016126213A1 (en) | 2015-02-06 | 2016-08-11 | National University Of Singapore | Methods for enhancing efficacy of therapeutic immune cells |
AU2013237638B2 (en) * | 2007-01-11 | 2016-10-13 | Novo Nordisk A/S | Anti-kir antibodies, formulations, and uses thereof |
EP2359834B1 (en) | 2006-03-15 | 2016-11-09 | Alexion Pharmaceuticals, Inc. | Treatment of paroxysmal nocturnal hemoglobinuria patients by an inhibitor of complement |
WO2017009842A2 (en) | 2015-07-16 | 2017-01-19 | Biokine Therapeutics Ltd. | Compositions and methods for treating cancer |
WO2017079746A2 (en) | 2015-11-07 | 2017-05-11 | Multivir Inc. | Methods and compositions comprising tumor suppressor gene therapy and immune checkpoint blockade for the treatment of cancer |
WO2017201502A1 (en) | 2016-05-20 | 2017-11-23 | Biohaven Pharmaceutical Holding Company Ltd. | Use of glutamate modulating agents with immunotherapies to treat cancer |
US9844593B2 (en) | 2010-11-22 | 2017-12-19 | Innate Pharma Sa | Methods for treatment of recurrent hematological malignancies |
US9902936B2 (en) | 2003-07-02 | 2018-02-27 | Innate Pharma S.A. | PAN-KIR2DL NK-receptor antibodies and their use in diagnostics and therapy |
EP3187583A4 (en) * | 2014-08-29 | 2018-03-07 | National University Corporation Hokkaido University | Monoclonal antibody against kir2ds1 |
WO2018064165A2 (en) | 2016-09-27 | 2018-04-05 | Board Of Regents, The University Of Texas System | Methods for enhancing immune checkpoint blockade therapy by modulating the microbiome |
WO2018071668A1 (en) | 2016-10-12 | 2018-04-19 | Board Of Regents, The University Of Texas System | Methods and compositions for tusc2 immunotherapy |
WO2018111902A1 (en) | 2016-12-12 | 2018-06-21 | Multivir Inc. | Methods and compositions comprising viral gene therapy and an immune checkpoint inhibitor for treatment and prevention of cancer and infectious diseases |
WO2018183928A1 (en) | 2017-03-31 | 2018-10-04 | Bristol-Myers Squibb Company | Methods of treating tumor |
EP3444271A1 (en) | 2013-08-08 | 2019-02-20 | Cytune Pharma | Il-15 and il-15raplha sushi domain based modulokines |
US10253095B2 (en) * | 2005-01-06 | 2019-04-09 | Innate Pharma S.A.S. | Anti-KIR combination treatments and methods |
WO2019075468A1 (en) | 2017-10-15 | 2019-04-18 | Bristol-Myers Squibb Company | Methods of treating tumor |
WO2019191676A1 (en) | 2018-03-30 | 2019-10-03 | Bristol-Myers Squibb Company | Methods of treating tumor |
WO2019185551A1 (en) | 2018-03-25 | 2019-10-03 | Snipr Biome Aps. | Treating & preventing microbial infections |
US10463049B2 (en) | 2015-05-06 | 2019-11-05 | Snipr Technologies Limited | Altering microbial populations and modifying microbiota |
WO2019241730A2 (en) | 2018-06-15 | 2019-12-19 | Flagship Pioneering Innovations V, Inc. | Increasing immune activity through modulation of postcellular signaling factors |
US10512689B2 (en) | 2015-04-17 | 2019-12-24 | Bristol-Myers Squibb Company | Compositions comprising a combination of nivolumab and ipilimumab |
WO2020036635A2 (en) | 2018-03-19 | 2020-02-20 | Multivir Inc. | Methods and compositions comprising tumor suppressor gene therapy and cd122/cd132 agonists for the treatment of cancer |
EP3659622A1 (en) | 2013-08-08 | 2020-06-03 | Cytune Pharma | Combined pharmaceutical composition |
US10760075B2 (en) | 2018-04-30 | 2020-09-01 | Snipr Biome Aps | Treating and preventing microbial infections |
EP3478320A4 (en) * | 2016-06-30 | 2020-09-09 | Trellis Bioscience, LLC | Monoclonal antibodies targeting killer immunoglobulin-like receptor (kir) family signaling |
WO2020227159A2 (en) | 2019-05-03 | 2020-11-12 | Flagship Pioneering Innovations V, Inc. | Methods of modulating immune activity |
WO2020243568A1 (en) | 2019-05-30 | 2020-12-03 | Bristol-Myers Squibb Company | Methods of identifying a subject suitable for an immuno-oncology (i-o) therapy |
WO2020243570A1 (en) | 2019-05-30 | 2020-12-03 | Bristol-Myers Squibb Company | Cell localization signature and combination therapy |
WO2020243563A1 (en) | 2019-05-30 | 2020-12-03 | Bristol-Myers Squibb Company | Multi-tumor gene signatures for suitability to immuno-oncology therapy |
WO2021113644A1 (en) | 2019-12-05 | 2021-06-10 | Multivir Inc. | Combinations comprising a cd8+ t cell enhancer, an immune checkpoint inhibitor and radiotherapy for targeted and abscopal effects for the treatment of cancer |
WO2021127217A1 (en) | 2019-12-17 | 2021-06-24 | Flagship Pioneering Innovations V, Inc. | Combination anti-cancer therapies with inducers of iron-dependent cellular disassembly |
WO2022006179A1 (en) | 2020-06-29 | 2022-01-06 | Flagship Pioneering Innovations V, Inc. | Viruses engineered to promote thanotransmission and their use in treating cancer |
US11242393B2 (en) | 2018-03-23 | 2022-02-08 | Bristol-Myers Squibb Company | Antibodies against MICA and/or MICB and uses thereof |
WO2022047412A1 (en) | 2020-08-31 | 2022-03-03 | Bristol-Myers Squibb Company | Cell localization signature and immunotherapy |
US11351252B2 (en) | 2016-06-05 | 2022-06-07 | Snipr Technologies Limited | Selectively altering microbiota for immune modulation |
WO2022120179A1 (en) | 2020-12-03 | 2022-06-09 | Bristol-Myers Squibb Company | Multi-tumor gene signatures and uses thereof |
WO2022146947A1 (en) | 2020-12-28 | 2022-07-07 | Bristol-Myers Squibb Company | Antibody compositions and methods of use thereof |
WO2022146948A1 (en) | 2020-12-28 | 2022-07-07 | Bristol-Myers Squibb Company | Subcutaneous administration of pd1/pd-l1 antibodies |
WO2022169825A1 (en) | 2021-02-03 | 2022-08-11 | Mozart Therapeutics, Inc. | Binding agents and methods of using the same |
WO2022212876A1 (en) | 2021-04-02 | 2022-10-06 | The Regents Of The University Of California | Antibodies against cleaved cdcp1 and uses thereof |
WO2022212784A1 (en) | 2021-03-31 | 2022-10-06 | Flagship Pioneering Innovations V, Inc. | Thanotransmission polypeptides and their use in treating cancer |
WO2023278641A1 (en) | 2021-06-29 | 2023-01-05 | Flagship Pioneering Innovations V, Inc. | Immune cells engineered to promote thanotransmission and uses thereof |
WO2023076876A1 (en) | 2021-10-26 | 2023-05-04 | Mozart Therapeutics, Inc. | Modulation of immune responses to viral vectors |
US11648269B2 (en) | 2017-08-10 | 2023-05-16 | National University Of Singapore | T cell receptor-deficient chimeric antigen receptor T-cells and methods of use thereof |
WO2023110937A1 (en) | 2021-12-14 | 2023-06-22 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Depletion of nk cells for the treatment of adverse post-ischemic cardiac remodeling |
WO2023178329A1 (en) | 2022-03-18 | 2023-09-21 | Bristol-Myers Squibb Company | Methods of isolating polypeptides |
WO2023235847A1 (en) | 2022-06-02 | 2023-12-07 | Bristol-Myers Squibb Company | Antibody compositions and methods of use thereof |
WO2024077191A1 (en) | 2022-10-05 | 2024-04-11 | Flagship Pioneering Innovations V, Inc. | Nucleic acid molecules encoding trif and additionalpolypeptides and their use in treating cancer |
Families Citing this family (44)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20090191213A9 (en) * | 2003-07-02 | 2009-07-30 | Novo Nordisk A/S | Compositions and methods for regulating NK cell activity |
DK2287195T3 (en) | 2004-07-01 | 2019-08-19 | Innate Pharma | PAN-KIR2DL NK-RECEPTOR ANTIBODIES AND USE IN DIAGNOSTICS AND THERAPY |
KR101299167B1 (en) * | 2004-07-01 | 2013-08-30 | 노보 노르디스크 에이/에스 | Human anti-kir antibodies |
CN102617707B (en) * | 2011-09-19 | 2014-01-29 | 江苏师范大学 | Preparation method of new homologue 2-methyl-actinomycin D of actinomycin D |
KR102196009B1 (en) | 2011-10-25 | 2021-01-04 | 프로테나 바이오사이언시즈 리미티드 | Antibody formulations and methods |
BR112014009925B1 (en) | 2011-10-28 | 2022-09-20 | Teva Pharmaceuticals Australia Pty Ltd | POLYPEPTIDE BUILDERS AND THEIR USES |
AU2014220668B2 (en) | 2013-02-20 | 2018-12-13 | Innate Pharma | A compound that specifically binds to KIR3DL2 for use in the treatment of peripheral T cell lymphoma |
MX2015014181A (en) | 2013-04-09 | 2016-05-24 | Boston Biomedical Inc | 2-acetylnaphtho[2,3-b]furan -4,9-dione for use on treating cancer. |
EA033115B1 (en) | 2013-04-29 | 2019-08-30 | Тева Фармасьютикалз Острэйлиа Пти Лтд. | Anti-cd38 antibodies and fusion proteins with attenuated interferon alpha-2b |
US11117975B2 (en) | 2013-04-29 | 2021-09-14 | Teva Pharmaceuticals Australia Pty Ltd | Anti-CD38 antibodies and fusions to attenuated interferon alpha-2B |
CA2917858A1 (en) | 2013-08-02 | 2015-02-05 | Aduro Biotech Holdings, Europe B.V. | Combining cd27 agonists and immune checkpoint inhibition for immune stimulation |
KR101966408B1 (en) * | 2014-04-10 | 2019-04-05 | 오비아이 파머 인코퍼레이티드 | Antibodies, pharmaceutical compositions and uses thereof |
US11058768B2 (en) * | 2014-04-16 | 2021-07-13 | Biocon Ltd. | Stable protein formulations comprising a molar excess of sorbitol |
UA119352C2 (en) | 2014-05-01 | 2019-06-10 | Тева Фармасьютикалз Острейліа Пті Лтд | Combination of lenalidomide or pomalidomide and cd38 antibody-attenuated interferon-alpha constructs, and the use thereof |
KR102639037B1 (en) | 2014-10-29 | 2024-02-20 | 테바 파마슈티컬즈 오스트레일리아 피티와이 엘티디 | INTERFERON α2b VARIANTS |
CN105669862A (en) * | 2014-11-21 | 2016-06-15 | 上海中信国健药业股份有限公司 | Anti-human PD-L1/KIR bispecific antibody, preparation method and application thereof |
US20180133327A1 (en) | 2015-03-16 | 2018-05-17 | Amal Therapeutics Sa | Cell Penetrating Peptides and Complexes Comprising the Same |
JP2018521979A (en) | 2015-06-03 | 2018-08-09 | ボストン バイオメディカル, インコーポレイテッド | Composition comprising a cancer stem cell inhibitor and an immunotherapeutic agent for use in the treatment of cancer |
USD784565S1 (en) * | 2015-07-03 | 2017-04-18 | Arktura Llc | Architectural fixture |
USD785212S1 (en) * | 2015-07-03 | 2017-04-25 | Arktura Llc | Architectural fixture |
USD777951S1 (en) * | 2015-07-03 | 2017-01-31 | Arktura, Llc | Architectural fixture |
USD771281S1 (en) * | 2015-07-03 | 2016-11-08 | Arktura Llc | Architectural fixture |
AU2016299166B2 (en) | 2015-07-24 | 2022-03-31 | Innate Pharma | Methods for detecting tissue infiltrating NK cells |
SG10201601719RA (en) | 2016-03-04 | 2017-10-30 | Agency Science Tech & Res | Anti-LAG-3 Antibodies |
FI3429618T3 (en) | 2016-03-16 | 2024-03-15 | Amal Therapeutics Sa | Combination of an immune checkpoint modulator and a complex comprising a cell penetrating peptide, a cargo and a tlr peptide agonist for use in medicine |
SG10201603721TA (en) | 2016-05-10 | 2017-12-28 | Agency Science Tech & Res | Anti-CTLA-4 Antibodies |
KR20230131498A (en) | 2016-09-21 | 2023-09-13 | 아말 테라퓨틱스 에스에이 | A novel complex comprising a cell penetrating peptide, a cargo and a tlr peptide agonist for treatment of colorectal cancer |
US10550183B2 (en) | 2016-11-22 | 2020-02-04 | National University Of Singapore | Blockade of CD7 expression and chimeric antigen receptors for immunotherapy of T-cell malignancies |
WO2018099539A1 (en) | 2016-11-29 | 2018-06-07 | Horst Lindhofer | Combination of t-cell redirecting multifunctional antibodies with immune checkpoint modulators and uses thereof |
WO2018102427A1 (en) | 2016-11-29 | 2018-06-07 | Boston Biomedical, Inc. | Naphthofuran derivatives, preparation, and methods of use thereof |
CA3052291A1 (en) * | 2017-02-09 | 2018-08-16 | Memorial Sloan Kettering Cancer Center | Anti-kir3dl1 antibodies |
JP2020520923A (en) | 2017-05-17 | 2020-07-16 | ボストン バイオメディカル, インコーポレイテッド | Methods for treating cancer |
MX2019014192A (en) | 2017-05-29 | 2021-04-12 | Gamamabs Pharma | Cancer-associated immunosuppression inhibitor. |
CN109125247A (en) * | 2018-09-06 | 2019-01-04 | 广州苿莱生物科技有限公司 | The preparation method of adult stem cell freeze-dried powder and its application in cosmetics |
WO2021024020A1 (en) | 2019-08-06 | 2021-02-11 | Astellas Pharma Inc. | Combination therapy involving antibodies against claudin 18.2 and immune checkpoint inhibitors for treatment of cancer |
US20220409642A1 (en) | 2019-11-04 | 2022-12-29 | Astrazeneca Ab | Combination therapy for treating cancer |
WO2021245071A1 (en) | 2020-06-03 | 2021-12-09 | Mv Biotherapeutics Sa | Combination of an atp-hydrolyzing enzyme and an immune checkpoint modulator and uses thereof |
JP2023532768A (en) | 2020-07-07 | 2023-07-31 | バイオエヌテック エスエー | RNA for treatment of HPV-positive cancer |
CN117693530A (en) * | 2020-07-16 | 2024-03-12 | 达娜-法勃肿瘤研究所公司 | Antibodies to MUC 1-C/extracellular domain (MUC 1-C/ECD) |
WO2022135666A1 (en) | 2020-12-21 | 2022-06-30 | BioNTech SE | Treatment schedule for cytokine proteins |
WO2022135667A1 (en) | 2020-12-21 | 2022-06-30 | BioNTech SE | Therapeutic rna for treating cancer |
TW202245808A (en) | 2020-12-21 | 2022-12-01 | 德商拜恩迪克公司 | Therapeutic rna for treating cancer |
WO2023285552A1 (en) | 2021-07-13 | 2023-01-19 | BioNTech SE | Multispecific binding agents against cd40 and cd137 in combination therapy for cancer |
TW202333802A (en) | 2021-10-11 | 2023-09-01 | 德商拜恩迪克公司 | Therapeutic rna for lung cancer |
Citations (41)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4550019A (en) | 1978-03-22 | 1985-10-29 | South Africa Inventions Development Corporation | Manufacture and use of fowl egg antibodies |
US4816397A (en) | 1983-03-25 | 1989-03-28 | Celltech, Limited | Multichain polypeptides or proteins and processes for their production |
US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
WO1992022647A1 (en) | 1991-06-12 | 1992-12-23 | Genpharm International, Inc. | Early detection of transgenic emryros |
WO1992022645A1 (en) | 1991-06-14 | 1992-12-23 | Genpharm International, Inc. | Transgenic immunodeficient non-human animals |
WO1993012227A1 (en) | 1991-12-17 | 1993-06-24 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
WO1994000569A1 (en) | 1992-06-18 | 1994-01-06 | Genpharm International, Inc. | Methods for producing transgenic non-human animals harboring a yeast artificial chromosome |
WO1994002602A1 (en) | 1992-07-24 | 1994-02-03 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
WO1994025585A1 (en) | 1993-04-26 | 1994-11-10 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
WO1996014436A1 (en) | 1994-11-04 | 1996-05-17 | Genpharm International, Inc. | Method for making recombinant yeast artificial chromosomes |
EP0463151B1 (en) | 1990-01-12 | 1996-06-12 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
US5591669A (en) | 1988-12-05 | 1997-01-07 | Genpharm International, Inc. | Transgenic mice depleted in a mature lymphocytic cell-type |
US5612205A (en) | 1990-08-29 | 1997-03-18 | Genpharm International, Incorporated | Homologous recombination in mammalian cells |
WO1997013852A1 (en) | 1995-10-10 | 1997-04-17 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US5625825A (en) | 1993-10-21 | 1997-04-29 | Lsi Logic Corporation | Random number generating apparatus for an interface unit of a carrier sense with multiple access and collision detect (CSMA/CD) ethernet data network |
US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
WO1998024884A1 (en) | 1996-12-02 | 1998-06-11 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies |
WO1998024893A2 (en) | 1996-12-03 | 1998-06-11 | Abgenix, Inc. | TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM |
US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
US5789215A (en) | 1991-08-20 | 1998-08-04 | Genpharm International | Gene targeting in animal cells using isogenic DNA constructs |
US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
US5916771A (en) | 1996-10-11 | 1999-06-29 | Abgenix, Inc. | Production of a multimeric protein by cell fusion method |
WO1999045031A2 (en) | 1998-03-03 | 1999-09-10 | Abgenix, Inc. | Cd147 binding molecules as therapeutics |
WO1999053049A1 (en) | 1998-04-15 | 1999-10-21 | Abgenix, Inc. | Epitope-driven human antibody production and gene expression profiling |
US5985615A (en) | 1996-03-20 | 1999-11-16 | Abgenix, Inc. | Directed switch-mediated DNA recombination |
US5994619A (en) | 1996-04-01 | 1999-11-30 | University Of Massachusetts, A Public Institution Of Higher Education Of The Commonwealth Of Massachusetts, As Represented By Its Amherst Campus | Production of chimeric bovine or porcine animals using cultured inner cell mass cells |
US5998209A (en) | 1995-04-21 | 1999-12-07 | Abgenix, Inc. | Generation of large genomic DNA deletions |
US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
WO2000037504A2 (en) | 1998-12-23 | 2000-06-29 | Pfizer Inc. | Human monoclonal antibodies to ctla-4 |
US6091001A (en) | 1995-03-29 | 2000-07-18 | Abgenix, Inc. | Production of antibodies using Cre-mediated site-specific recombination |
US6130364A (en) | 1995-03-29 | 2000-10-10 | Abgenix, Inc. | Production of antibodies using Cre-mediated site-specific recombination |
WO2003040170A2 (en) | 2001-11-09 | 2003-05-15 | Pfizer Products Inc. | Antibodies to cd40 |
US20030095965A1 (en) | 2001-05-02 | 2003-05-22 | Katrien Van Beneden | Antibodies to Ly49E and CD94/NKG2 receptors |
WO2003064606A2 (en) | 2002-01-28 | 2003-08-07 | Medarex, Inc. | Human monoclonal antibodies to prostate specific membrane antigen (psma) |
Family Cites Families (25)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5750172A (en) | 1987-06-23 | 1998-05-12 | Pharming B.V. | Transgenic non human mammal milk |
US5633076A (en) | 1989-12-01 | 1997-05-27 | Pharming Bv | Method of producing a transgenic bovine or transgenic bovine embryo |
US6673986B1 (en) | 1990-01-12 | 2004-01-06 | Abgenix, Inc. | Generation of xenogeneic antibodies |
JPH0515592A (en) | 1991-07-05 | 1993-01-26 | Morishita Roussel Kk | Method, device and appliance for administering flowable nutriments dropwise |
JPH05112863A (en) | 1991-10-21 | 1993-05-07 | Nippon Steel Corp | Formation of thin film |
US5776427A (en) | 1992-03-05 | 1998-07-07 | Board Of Regents, The University Of Texas System | Methods for targeting the vasculature of solid tumors |
DK0804070T3 (en) | 1993-03-09 | 2000-08-07 | Genzyme Corp | Method for isolating proteins from milk |
US5539094A (en) | 1993-11-12 | 1996-07-23 | La Jolla Cancer Research Foundation | DNA encoding Bcl-2-associated proteins |
US5827690A (en) | 1993-12-20 | 1998-10-27 | Genzyme Transgenics Corporatiion | Transgenic production of antibodies in milk |
US5583034A (en) | 1994-02-22 | 1996-12-10 | La Jolla Institute For Allergy And Immunology | Enhancement of adoptosis using antisense oligonucleotides |
US5808028A (en) | 1994-05-24 | 1998-09-15 | The United States Of America As Represented By The Department Of Health And Human Services | Molecular clone of a P58 receptor protein and uses thereof |
NZ298145A (en) | 1994-12-29 | 1998-08-26 | Yamanouchi Pharma Co Ltd | Monoclonal antibodies having inhibitory effect on type ii phospholipase a2, proteins forming part thereof, cells producing them, dna encoding them, recombinant vector comprising the dna and medicament |
US6750044B1 (en) | 1996-10-17 | 2004-06-15 | Genentech, Inc. | Variants of vascular endothelial cell growth factor having antagonistic properties, nucleic acids encoding the same and host cells comprising those nucleic acids |
WO2000026671A1 (en) * | 1998-10-29 | 2000-05-11 | Connex Gmbh | Detection of acid-resistant micro-organisms in a stool |
CN101073668A (en) | 1999-04-28 | 2007-11-21 | 德克萨斯大学董事会 | Antibody compositions for selectively inhibiting vegf |
KR100419555B1 (en) | 2000-05-29 | 2004-02-19 | 주식회사유한양행 | A variable region of the monoclonal antibody against a s-surface antigen of hepatitis b virus and a gene encoding the same |
EP1404851A4 (en) | 2001-06-08 | 2005-05-25 | Icon Genetics Inc | Production of proteins in plants |
RU2404993C2 (en) | 2003-07-02 | 2010-11-27 | Иннейт Фарма | Nk cytolergy control compositions and methods |
KR101299599B1 (en) * | 2003-07-24 | 2013-08-23 | 위니베르시따 데글리 스뚜디 디 뻬루지아 | Methods and compositions for increasing the efficiency of therapeutic antibodies using nk cell potentiating compounds |
KR20050111185A (en) * | 2004-05-21 | 2005-11-24 | 삼성에스디아이 주식회사 | Plasma display panel |
DK2287195T3 (en) | 2004-07-01 | 2019-08-19 | Innate Pharma | PAN-KIR2DL NK-RECEPTOR ANTIBODIES AND USE IN DIAGNOSTICS AND THERAPY |
SI1835937T1 (en) * | 2005-01-06 | 2012-08-31 | Novo Nordisk As | Compositions and methods for treating viral infection |
CN104829720B (en) * | 2005-01-06 | 2019-01-01 | 诺和诺德公司 | KIR bonding agent and the method for using it |
US8709411B2 (en) * | 2008-12-05 | 2014-04-29 | Novo Nordisk A/S | Combination therapy to enhance NK cell mediated cytotoxicity |
SG195082A1 (en) * | 2011-05-25 | 2013-12-30 | Innate Pharma Sa | Anti-kir antibodies for the treatment of inflammatory disorders |
-
2005
- 2005-07-01 DK DK10178924.6T patent/DK2287195T3/en active
- 2005-07-01 EP EP10178924.6A patent/EP2287195B1/en active Active
- 2005-07-01 WO PCT/EP2005/053122 patent/WO2006003179A2/en active Application Filing
- 2005-07-01 AU AU2005259221A patent/AU2005259221B2/en active Active
- 2005-07-01 PL PL10178924T patent/PL2287195T3/en unknown
- 2005-07-01 CN CN200580022633.1A patent/CN1997670B/en active Active
- 2005-07-01 EP EP05758642A patent/EP1791868B1/en active Active
- 2005-07-01 SI SI200532256T patent/SI2287195T1/en unknown
- 2005-07-01 CA CA2601417A patent/CA2601417C/en active Active
- 2005-07-01 JP JP2007518617A patent/JP5112863B2/en active Active
-
2008
- 2008-10-02 US US12/244,170 patent/US8119775B2/en active Active
-
2012
- 2012-01-11 US US13/347,832 patent/US8614307B2/en active Active
-
2013
- 2013-07-08 US US13/936,486 patent/US8981065B2/en active Active
-
2015
- 2015-03-16 US US14/659,045 patent/US20150191547A1/en not_active Abandoned
- 2015-08-18 US US14/829,170 patent/US20150344576A1/en not_active Abandoned
Patent Citations (48)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4550019A (en) | 1978-03-22 | 1985-10-29 | South Africa Inventions Development Corporation | Manufacture and use of fowl egg antibodies |
US4816397A (en) | 1983-03-25 | 1989-03-28 | Celltech, Limited | Multichain polypeptides or proteins and processes for their production |
US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
US5591669A (en) | 1988-12-05 | 1997-01-07 | Genpharm International, Inc. | Transgenic mice depleted in a mature lymphocytic cell-type |
US5939598A (en) | 1990-01-12 | 1999-08-17 | Abgenix, Inc. | Method of making transgenic mice lacking endogenous heavy chains |
US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
US6114598A (en) | 1990-01-12 | 2000-09-05 | Abgenix, Inc. | Generation of xenogeneic antibodies |
EP0463151B1 (en) | 1990-01-12 | 1996-06-12 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
EP0546073A1 (en) | 1990-08-29 | 1993-06-16 | Genpharm Int | Transgenic non-human animals capable of producing heterologous antibodies. |
US5721367A (en) | 1990-08-29 | 1998-02-24 | Pharming B.V. | Homologous recombination in mammalian cells |
US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US5612205A (en) | 1990-08-29 | 1997-03-18 | Genpharm International, Incorporated | Homologous recombination in mammalian cells |
US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
WO1992022647A1 (en) | 1991-06-12 | 1992-12-23 | Genpharm International, Inc. | Early detection of transgenic emryros |
WO1992022670A1 (en) | 1991-06-12 | 1992-12-23 | Genpharm International, Inc. | Early detection of transgenic embryos |
WO1992022645A1 (en) | 1991-06-14 | 1992-12-23 | Genpharm International, Inc. | Transgenic immunodeficient non-human animals |
US5789215A (en) | 1991-08-20 | 1998-08-04 | Genpharm International | Gene targeting in animal cells using isogenic DNA constructs |
WO1993012227A1 (en) | 1991-12-17 | 1993-06-24 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
WO1994000569A1 (en) | 1992-06-18 | 1994-01-06 | Genpharm International, Inc. | Methods for producing transgenic non-human animals harboring a yeast artificial chromosome |
WO1994002602A1 (en) | 1992-07-24 | 1994-02-03 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
WO1994025585A1 (en) | 1993-04-26 | 1994-11-10 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US5625825A (en) | 1993-10-21 | 1997-04-29 | Lsi Logic Corporation | Random number generating apparatus for an interface unit of a carrier sense with multiple access and collision detect (CSMA/CD) ethernet data network |
WO1996014436A1 (en) | 1994-11-04 | 1996-05-17 | Genpharm International, Inc. | Method for making recombinant yeast artificial chromosomes |
US5643763A (en) | 1994-11-04 | 1997-07-01 | Genpharm International, Inc. | Method for making recombinant yeast artificial chromosomes by minimizing diploid doubling during mating |
US6130364A (en) | 1995-03-29 | 2000-10-10 | Abgenix, Inc. | Production of antibodies using Cre-mediated site-specific recombination |
US6091001A (en) | 1995-03-29 | 2000-07-18 | Abgenix, Inc. | Production of antibodies using Cre-mediated site-specific recombination |
US5998209A (en) | 1995-04-21 | 1999-12-07 | Abgenix, Inc. | Generation of large genomic DNA deletions |
WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
WO1997013852A1 (en) | 1995-10-10 | 1997-04-17 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US5985615A (en) | 1996-03-20 | 1999-11-16 | Abgenix, Inc. | Directed switch-mediated DNA recombination |
US5994619A (en) | 1996-04-01 | 1999-11-30 | University Of Massachusetts, A Public Institution Of Higher Education Of The Commonwealth Of Massachusetts, As Represented By Its Amherst Campus | Production of chimeric bovine or porcine animals using cultured inner cell mass cells |
US5916771A (en) | 1996-10-11 | 1999-06-29 | Abgenix, Inc. | Production of a multimeric protein by cell fusion method |
WO1998024884A1 (en) | 1996-12-02 | 1998-06-11 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies |
WO1998024893A2 (en) | 1996-12-03 | 1998-06-11 | Abgenix, Inc. | TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM |
WO1999045031A2 (en) | 1998-03-03 | 1999-09-10 | Abgenix, Inc. | Cd147 binding molecules as therapeutics |
WO1999053049A1 (en) | 1998-04-15 | 1999-10-21 | Abgenix, Inc. | Epitope-driven human antibody production and gene expression profiling |
WO2000037504A2 (en) | 1998-12-23 | 2000-06-29 | Pfizer Inc. | Human monoclonal antibodies to ctla-4 |
US20030095965A1 (en) | 2001-05-02 | 2003-05-22 | Katrien Van Beneden | Antibodies to Ly49E and CD94/NKG2 receptors |
WO2003040170A2 (en) | 2001-11-09 | 2003-05-15 | Pfizer Products Inc. | Antibodies to cd40 |
WO2003064606A2 (en) | 2002-01-28 | 2003-08-07 | Medarex, Inc. | Human monoclonal antibodies to prostate specific membrane antigen (psma) |
Non-Patent Citations (92)
Title |
---|
"Natural Killer Cells Protocols", 2000, HUMAN PRESS., pages: 219 - 238 |
"Protein Formulation and Delivery", vol. 99, 2000, MARCEL DEKKER, article "Drug and the Pharmaceutical Sciences" |
AHERN. T.J.; MAN- NING M.C.: "Stability of Protein Pharmaceuticals", 1992, PLENUM PRESS |
BAILEY, ACTA CRYSTALLOGR. SECT. D-BIOL. CRYSTALLOGR., vol. 50, 1994, pages 760 - 763 |
BIANCHI ET AL., BIOTECHNOLOGY AND BIOENGINEERING., vol. 84, 2003, pages 439 - 444 |
BIASSONI ET AL., EUR J IMMUNOL., vol. 23, 1993, pages 1083 - 7 |
BOYINGTON ET AL., NATURE, vol. 405, 2000, pages 537 - 543 |
BROADHEAD ET AL., DRUG DEVEL. IND. PHARM., vol. 18, 1992, pages 1169 - 1206 |
BRUGGEMANN ET AL., YEAR IN IMMUNO., vol. 7, 1993, pages 33 |
CALARESE ET AL., SCIENCE, vol. 300, 2003, pages 2065 |
CARPENTER; CROWE, CRYOBIOLOGY, vol. 25, 1988, pages 459 - 470 |
CARTER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 89, 1992, pages 4285 |
CHISWELL; MCCAFFERTY, TIBTECH, vol. 10, 1992, pages 80 - 84 |
CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 |
CLACKSON; WELLS, SCIENCE, vol. 267, 1995, pages 383 - 386 |
CWIRLA ET AL., PNAS USA, vol. 87, 1990, pages 6378 - 6382 |
DOWNWARD, J, MASS SPECTROM., vol. 35, no. 4, April 2000 (2000-04-01), pages 493 - 503 |
E. HARLOW; D. LANE: "Antibodies: A Laboratory Manual.", 1988, COLD SPRING HARBOR LABORATORY PRESS, COLD SPRING HARBOR |
EDWARDS DA; BEN-JEBRIA A; LANGER A: "Recent advances in pulmonary drug delivery using large, porous inhaled particles", J APPL PHYSIOL, vol. 84, no. 2, 1998, pages 379 - 385 |
EDWARDS DA; BEN-JEBRIA A; LANGER R.: "Recent advances in pulmonary drug delivery using large, porous inhaled particles", J APPL PHYSIOL, vol. 84, no. 2, 1998, pages 379 - 385 |
EDWARDS DA; BEN-JEBRIA A; LANGER R: "Recent advances in pulmonary drug delivery using large, porous inhaled particles", J APPL PHYSIOL, vol. 84, no. 2, 1998, pages 379 - 385 |
FAGERSTAM ET AL., JOURNAL OF MOLECULAR RECOGNITION, vol. 3, 1990, pages 208 - 14 |
FAN ET AL., NAT. IMMUNOL., vol. 2, 2001, pages 452 - 460 |
FAN ET AL., NATURE IMMUNOLOGY, vol. 2, 2001, pages 452 - 460 |
FAN ET AL., NATURE, vol. 389, 1997, pages 96 - 100 |
GREEN ET AL., NATURE GENETICS, vol. 7, 1994, pages 13 - 21 |
GREEN; JAKOBOVITS, J. EXP. MED., vol. 188, 1998, pages 483 - 495 |
HANES; PLUCTHAU, PNAS USA, vol. 94, 1997, pages 4937 - 4942 |
HOGANBOOM ET AL., IMMUNOL. REVIEWS, vol. 130, 1992, pages 43 - 68 |
HOOGENBOOM ET AL., J. MOL. BIOL., vol. 227, 1991, pages 381 |
HUANG ET AL., JOURNAL OF MOLECULAR BIOLOGY, vol. 281, no. 1, 1998, pages 61 - 67 |
III ET AL., PROTEIN ENG, vol. 10, 1997, pages 949 - 57 |
JAKOBOVITS ET AL., NATURE, vol. 362, 1993, pages 255 - 258 |
JAKOBOVITS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 2551 - 255 |
JAKOBOVITZ ET AL., NATURE, vol. 362, 1993, pages 255 |
JONES ET AL., NATURE, vol. 321, 1986, pages 522 |
KABSCH, J. APPL. CRYSTALLOGR., vol. 26, 1993, pages 795 - 800 |
KARRE ET AL., NATURE, vol. 319, 1986, pages 675 - 8 |
KING ET AL., BIOCHEMICAL JOURNAL, vol. 281, 1992, pages 317 - 323 |
KISELAR; DOWNARD, ANAL CHEM., vol. 71, no. 9, 1 May 1999 (1999-05-01), pages 1792 - 801 |
KR6GER ET AL., BIOSENSORS AND BIOELECTRONICS, vol. 17, 2002, pages 937 - 944 |
LAMZIN; WILSON, ACTA CRYSTALLOGR. SECT. D-BIOL. CRYSTALLOGR., vol. 49, 1993, pages 129 - 147 |
LANIER, ANNU REV IMMUNOL, vol. 16, 1998, pages 359 - 93 |
LANIER, ANNUAL REVIEW OF IMMUNOLOGY, vol. 23, 2005, pages 225 - 74 |
LEIPERT ET AL., ANGEW. CHEM. INT. ED., vol. 37, 1998, pages 3308 - 3311 |
LITWIN ET AL., J EXP MED., vol. 178, 1993, pages 1321 - 36 |
MAENAKA ET AL., STRUCTURE WITH FOLDING AND DESIGN, vol. 7, 1999, pages 391 - 398 |
MANCA, ANN 1ST SUPER SANITA, vol. 27, no. 1, 1991, pages 15 - 9 |
MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 |
MASTERS: "Spray-Drying Handbook(5th ed;", 1991, LONGMAN SCIENTIFIC AND TECHNICAL, pages: 491 - 676 |
MENDEZ ET AL., NATURE GENETICS, vol. 15, 1997, pages 146 - 156 |
MORETTA ET AL., EUR J IMMUNOGENET., vol. 24, no. 6, 1997, pages 455 - 68 |
MORETTA ET AL., J EXP MED, vol. 172, 1990, pages 1589 - 1598 |
MORETTA ET AL., J EXP MED, vol. 178, 1993, pages 597 - 604 |
MORRISON ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 81, 1984, pages 6851 |
MUMENTHALER ET AL., PHARM. RES., vol. 11, 1994, pages 12 - 20 |
NICE ET AL., J. CHROMA- TOGR., vol. 646, 1993, pages 159 - 168 |
OHIEN ET AL., SCIENCE, vol. 246, 1989, pages 666 - 8 |
PARMLEY; SMITH, GENE, vol. 73, 1988, pages 305 - 318 |
PEARSON, METHODS MOL. BIOL., vol. 243, 1994, pages 307 - 31 |
PLUCKTHUN, IMMUNOL. REVS., vol. 130, 1992, pages 151 |
PRESTA ET AL., J. IMMUNOL., vol. 51, 1993 |
PRESTA, CURR. OP. STRUCT. BIOL., vol. 2, 1992, pages 593 |
REICHMANN ET AL., NATURE, vol. 332, 1988, pages 323 |
REMINGTON: "The Science and Practice of Pharmacy, 19th Edition", 1995 |
REMINGTON: "The Science and Practice of Pharmacy, 19th Edition", 1995, MACK PUBLISHING CO. |
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 |
ROSER, BIOPHARM, vol. 4, 1991, pages 47 - 53 |
RUGGERI ET AL., SCIENCE, vol. 295, 2002, pages 2097 - 2100 |
RUKER ET AL., ANNALS OF THE NEW YORK ACADEMY OF SCIENCES., vol. 646, 1991, pages 212 - 219 |
RUSSEL ET AL., NUCL. ACIDS RESEARCH, vol. 21, 1993, pages 1081 - 1085 |
SAITO; PATTERSON, METHODS, vol. 9, no. 3, June 1996 (1996-06-01), pages 516 - 24 |
SAULQUIN ET AL., J EXP MED., vol. 197, 2003, pages 933 - 8 |
SCHNEIDMAN-DUHOVNY ET AL., CURR MED CHEM, vol. 11, 2004, pages 91 - 107 |
SCOTT, TIBS, vol. 17, 1992, pages 241 - 245 |
SIMS ET AL., J. IMMUNOL., vol. 151, 1993, pages 2296 |
SKERRA ET AL., CURR. OPINION IN IMMUNOL., vol. 5, 1993, pages 256 |
SOO KIM ET AL., BIOTECHNOL. PROG., vol. 17, 2001, pages 69 - 75 |
TINI ET AL., COMP BIOCHEM PHYSIOL A MOL INTEGR PHYSIOL., vol. 131, no. 3, March 2002 (2002-03-01), pages 569 - 74 |
VALIANTE ET AL., IMMUNOL REV, vol. 155, 1997, pages 155 - 64 |
VAUGHAN ET AL., NATURE BIOTECH, vol. 14, 1996, pages 309 |
VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 |
WAGTMANN ET AL., IMMUNITY, vol. 2, 1995, pages 439 - 449 |
WAGTMANN ET AL., IMMUNITY, vol. 2, 3, 1995, pages 439 - 49,801-809 |
WAGTMANN ET AL., IMMUNITY, vol. 3, no. 6, 1995, pages 801 - 9 |
WANG ET AL., NATURE, vol. 355, 1992, pages 275 - 278 |
WARD ET AL., NATURE, vol. 341, 1989, pages 544 |
WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
WELLS, PROC NATL ACAD SCI USA, vol. 93, 1996, pages 1 - 6 |
WILLIAMS; POLLI, J. PARENTERAL SCI. TECHNOL., vol. 38, 1984, pages 48 - 59 |
WISE, D.L.: "Handbook of Pharmaceutical Controlled Release", 2000, MARCEL DEKKER |
YU J; CHIEN YW: "Pulmonary drug delivery: Physiologic and mechanistic aspects", CRIT REV THER DRUG CARR SYS, vol. 14, no. 4, 1997, pages 395 - 453 |
Cited By (127)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US9902936B2 (en) | 2003-07-02 | 2018-02-27 | Innate Pharma S.A. | PAN-KIR2DL NK-receptor antibodies and their use in diagnostics and therapy |
US11365393B2 (en) | 2003-07-02 | 2022-06-21 | Innate Pharma | Compositions and methods for regulating NK cell activity |
US9150636B2 (en) | 2004-07-10 | 2015-10-06 | Fox Chase Cancer Center | Genetically modified human natural killer cell lines |
US9181322B2 (en) | 2004-07-10 | 2015-11-10 | Fox Chase Cancer Center | Genetically modified human natural killer cell lines |
WO2006050270A2 (en) * | 2004-11-02 | 2006-05-11 | The Government Of The United States Of America As Represented By The Secretary Department Of Health & Human Services | Compositions and methods for treating hyperproliferative disorders |
WO2006050270A3 (en) * | 2004-11-02 | 2006-08-10 | Us Gov Health & Human Serv | Compositions and methods for treating hyperproliferative disorders |
US10253095B2 (en) * | 2005-01-06 | 2019-04-09 | Innate Pharma S.A.S. | Anti-KIR combination treatments and methods |
US8222376B2 (en) | 2005-01-06 | 2012-07-17 | Novo Nordisk A/S | KIR-binding agents and methods of use thereof |
US9018366B2 (en) | 2005-01-06 | 2015-04-28 | Innate Pharma S.A.S | KIR-binding agents and methods of use thereof |
WO2006072626A1 (en) * | 2005-01-06 | 2006-07-13 | Novo Nordisk A/S | Kir-binding agents and methods of use thereof |
US8388970B2 (en) | 2005-01-06 | 2013-03-05 | Novo Nordisk A/S | KIR-binding agents and methods of use thereof |
US9708403B2 (en) | 2005-01-06 | 2017-07-18 | Novo Nordisk A/S | KIR-binding agents and methods of use thereof |
EP2322557A2 (en) | 2005-10-14 | 2011-05-18 | Innate Pharma | Compositions and methods for treating proliferative disorders |
US10703809B1 (en) | 2006-03-15 | 2020-07-07 | Alexion Pharmaceuticals, Inc. | Treatment of paroxysmal nocturnal hemoglobinuria patients by an inhibitor of complement |
EP2359834B1 (en) | 2006-03-15 | 2016-11-09 | Alexion Pharmaceuticals, Inc. | Treatment of paroxysmal nocturnal hemoglobinuria patients by an inhibitor of complement |
US10590189B2 (en) | 2006-03-15 | 2020-03-17 | Alexion Pharmaceuticals, Inc. | Treatment of paroxysmal nocturnal hemoglobinuria patients by an inhibitor of complement |
CN105037549B (en) * | 2007-01-11 | 2018-09-28 | 诺和诺德公司 | Anti-KIR antibodies, preparation and its application |
CN101578113B (en) * | 2007-01-11 | 2015-04-22 | 诺和诺德公司 | Anti-KIR antibodies, formulations, and uses thereof |
US9879082B2 (en) | 2007-01-11 | 2018-01-30 | Novo Nordisk A/S | Anti-KIR antibodies, formulations, and uses thereof |
US10815299B2 (en) | 2007-01-11 | 2020-10-27 | Novo Nordisk A/S | Anti-KIR antibodies, formulations, and uses thereof |
JP2014050393A (en) * | 2007-01-11 | 2014-03-20 | Novo Nordisk As | Anti-kir antibodies, formulations, and uses thereof |
CN105037549A (en) * | 2007-01-11 | 2015-11-11 | 诺和诺德公司 | Anti-KIR antibodies, formulations, and uses thereof |
EP2604278A1 (en) * | 2007-01-11 | 2013-06-19 | Novo Nordisk A/S | Anti-KIR antibodies, formulations, and uses thereof |
JP2010515709A (en) * | 2007-01-11 | 2010-05-13 | ノヴォ ノルディスク アクティーゼルスカブ | Anti-KIR antibodies, formulations and uses thereof |
AU2008204433B2 (en) * | 2007-01-11 | 2014-03-13 | Novo Nordisk A/S | Anti-KIR antibodies, formulations, and uses thereof |
WO2008084106A1 (en) * | 2007-01-11 | 2008-07-17 | Novo Nordisk A/S | Anti-kir antibodies, formulations, and uses thereof |
AU2013237638B2 (en) * | 2007-01-11 | 2016-10-13 | Novo Nordisk A/S | Anti-kir antibodies, formulations, and uses thereof |
US9415104B2 (en) | 2008-12-05 | 2016-08-16 | Novo Nordisk A/S | Combination therapy to enhance NK cell mediated cytotoxicity |
WO2010065939A1 (en) * | 2008-12-05 | 2010-06-10 | Indiana University Research & Technology Corporation | Combination therapy to enhace nk cell mediated cytotoxicty |
US8709411B2 (en) | 2008-12-05 | 2014-04-29 | Novo Nordisk A/S | Combination therapy to enhance NK cell mediated cytotoxicity |
EP2494062A4 (en) * | 2009-10-28 | 2013-05-29 | Janssen Biotech Inc | Anti-glp-1r antibodies and their uses |
EP2494062A2 (en) * | 2009-10-28 | 2012-09-05 | Janssen Biotech, Inc. | Anti-glp-1r antibodies and their uses |
US8883447B2 (en) | 2009-10-28 | 2014-11-11 | Janssen Biotech, Inc. | Anti-GLP-1R antibodies and their uses |
EP2625188A4 (en) * | 2010-10-06 | 2014-05-07 | St Jude Childrens Res Hospital | Molecular determinant-based typing of kir alleles and kir-ligands |
CN103209988A (en) * | 2010-10-06 | 2013-07-17 | 圣朱德儿童研究医院 | Molecular determinant-based typing of kir alleles and kir-ligands |
EP2625188A1 (en) * | 2010-10-06 | 2013-08-14 | St. Jude Children's Research Hospital | Molecular determinant-based typing of kir alleles and kir-ligands |
US9844593B2 (en) | 2010-11-22 | 2017-12-19 | Innate Pharma Sa | Methods for treatment of recurrent hematological malignancies |
JP2014520092A (en) * | 2011-05-25 | 2014-08-21 | イナート・ファルマ・ソシエテ・アノニム | Anti-KIR antibodies for the treatment of inflammatory disorders |
WO2012160448A2 (en) | 2011-05-25 | 2012-11-29 | Innate Pharma, S.A. | Anti-kir antibodies for the treatment of inflammatory disorders |
EP2714741B1 (en) * | 2011-05-25 | 2019-10-30 | Innate Pharma, S.A. | Anti-kir antibodies for the treatment of inflammatory disorders |
AU2012260601B2 (en) * | 2011-05-25 | 2018-02-01 | Innate Pharma, S.A. | Anti-KIR antibodies for the treatment of inflammatory disorders |
US20150376275A1 (en) * | 2011-05-25 | 2015-12-31 | Innate Pharma, Sa | Anti-kir antibodies for the treatment of inflammatory and autoimmune disorders |
WO2012175613A1 (en) | 2011-06-21 | 2012-12-27 | Innate Pharma | NKp46-MEDIATED NK CELL TUNING |
EP3263601B1 (en) * | 2012-10-02 | 2021-11-24 | Bristol-Myers Squibb Company | Combination of anti-kir antibodies and anti-pd-1 antibodies to treat cancer |
EP3263601A1 (en) | 2012-10-02 | 2018-01-03 | Bristol-Myers Squibb Company | Combination of anti-kir antibodies and anti-pd-1 antibodies to treat cancer |
WO2014055648A1 (en) | 2012-10-02 | 2014-04-10 | Bristol-Myers Squibb Company | Combination of anti-kir antibodies and anti-pd-1 antibodies to treat cancer |
EP3995507A1 (en) | 2013-08-08 | 2022-05-11 | Cytune Pharma | Il-15 and il-15ralpha sushi domain based on modulokines |
EP4269441A2 (en) | 2013-08-08 | 2023-11-01 | Cytune Pharma | Il-15 and il-15ralpha sushi domain based on modulokines |
EP3659622A1 (en) | 2013-08-08 | 2020-06-03 | Cytune Pharma | Combined pharmaceutical composition |
EP3444271A1 (en) | 2013-08-08 | 2019-02-20 | Cytune Pharma | Il-15 and il-15raplha sushi domain based modulokines |
WO2015069785A1 (en) * | 2013-11-06 | 2015-05-14 | Bristol-Myers Squibb Company | Combination of anti-kir and anti-cs1 antibodies to treat multiple myeloma |
US10494433B2 (en) | 2013-11-06 | 2019-12-03 | Bristol-Myers Squibb Company | Combination of anti-KIR and anti-CS1 antibodies to treat multiple myeloma |
EP3187583A4 (en) * | 2014-08-29 | 2018-03-07 | National University Corporation Hokkaido University | Monoclonal antibody against kir2ds1 |
WO2016069589A1 (en) | 2014-10-28 | 2016-05-06 | University Children's Hospital Tübingen | Treatment of pediatric bcp-all patients with an anti-kir antibody |
US11639384B2 (en) | 2014-10-28 | 2023-05-02 | University Children's Hospital Tübingen | Treatment of pediatric BCP-ALL patients with an anti-KIR antibody |
WO2016070001A1 (en) * | 2014-10-31 | 2016-05-06 | Jounce Therapeutics, Inc. | Methods of treating conditions with antibodies that bind b7-h4 |
US10626176B2 (en) | 2014-10-31 | 2020-04-21 | Jounce Therapeutics, Inc. | Methods of treating conditions with antibodies that bind B7-H4 |
WO2016126213A1 (en) | 2015-02-06 | 2016-08-11 | National University Of Singapore | Methods for enhancing efficacy of therapeutic immune cells |
US10765699B2 (en) * | 2015-02-06 | 2020-09-08 | National University Of Singapore | Methods for enhancing efficacy of therapeutic immune cells |
US11679132B2 (en) | 2015-02-06 | 2023-06-20 | National University Of Singapore | Methods for enhancing efficacy of therapeutic immune cells |
EP4134430A1 (en) | 2015-02-06 | 2023-02-15 | National University of Singapore | Methods for enhancing efficacy of therapeutic immune cells |
EP3738610A1 (en) | 2015-04-17 | 2020-11-18 | Bristol-Myers Squibb Company | Compositions comprising a combination of ipilimumab and nivolumab |
US10512689B2 (en) | 2015-04-17 | 2019-12-24 | Bristol-Myers Squibb Company | Compositions comprising a combination of nivolumab and ipilimumab |
US11612654B2 (en) | 2015-04-17 | 2023-03-28 | Bristol-Myers Squibb Company | Combination therapy comprising nivolumab and ipilimumab |
US10524477B2 (en) | 2015-05-06 | 2020-01-07 | Snipr Technologies Limited | Altering microbial populations and modifying microbiota |
US10582712B2 (en) | 2015-05-06 | 2020-03-10 | Snipr Technologies Limited | Altering microbial populations and modifying microbiota |
US11612617B2 (en) | 2015-05-06 | 2023-03-28 | Snipr Technologies Limited | Altering microbial populations and modifying microbiota |
US10624349B2 (en) | 2015-05-06 | 2020-04-21 | Snipr Technologies Limited | Altering microbial populations and modifying microbiota |
US10561148B2 (en) | 2015-05-06 | 2020-02-18 | Snipr Technologies Limited | Altering microbial populations and modifying microbiota |
US11147830B2 (en) | 2015-05-06 | 2021-10-19 | Snipr Technologies Limited | Altering microbial populations and modifying microbiota |
US10506812B2 (en) | 2015-05-06 | 2019-12-17 | Snipr Technologies Limited | Altering microbial populations and modifying microbiota |
US11517582B2 (en) | 2015-05-06 | 2022-12-06 | Snipr Technologies Limited | Altering microbial populations and modifying microbiota |
US10463049B2 (en) | 2015-05-06 | 2019-11-05 | Snipr Technologies Limited | Altering microbial populations and modifying microbiota |
US11400110B2 (en) | 2015-05-06 | 2022-08-02 | Snipr Technologies Limited | Altering microbial populations and modifying microbiota |
US11642363B2 (en) | 2015-05-06 | 2023-05-09 | Snipr Technologies Limited | Altering microbial populations and modifying microbiota |
US11547716B2 (en) | 2015-05-06 | 2023-01-10 | Snipr Technologies Limited | Altering microbial populations and modifying microbiota |
US11844760B2 (en) | 2015-05-06 | 2023-12-19 | Snipr Technologies Limited | Altering microbial populations and modifying microbiota |
EP3744340A2 (en) | 2015-07-16 | 2020-12-02 | Biokine Therapeutics Ltd. | Compositions and methods for treating cancer |
EP3943098A2 (en) | 2015-07-16 | 2022-01-26 | Biokine Therapeutics Ltd. | Compositions and methods for treating cancer |
WO2017009842A2 (en) | 2015-07-16 | 2017-01-19 | Biokine Therapeutics Ltd. | Compositions and methods for treating cancer |
WO2017079746A2 (en) | 2015-11-07 | 2017-05-11 | Multivir Inc. | Methods and compositions comprising tumor suppressor gene therapy and immune checkpoint blockade for the treatment of cancer |
WO2017201502A1 (en) | 2016-05-20 | 2017-11-23 | Biohaven Pharmaceutical Holding Company Ltd. | Use of glutamate modulating agents with immunotherapies to treat cancer |
US11471530B2 (en) | 2016-06-05 | 2022-10-18 | Snipr Technologies Limited | Selectively altering microbiota for immune modulation |
US11351252B2 (en) | 2016-06-05 | 2022-06-07 | Snipr Technologies Limited | Selectively altering microbiota for immune modulation |
EP3478320A4 (en) * | 2016-06-30 | 2020-09-09 | Trellis Bioscience, LLC | Monoclonal antibodies targeting killer immunoglobulin-like receptor (kir) family signaling |
US11725055B2 (en) | 2016-06-30 | 2023-08-15 | Trellis Bioscience, Llc | Monoclonal antibodies targeting killer immunoglobulin-like receptor (KIR) family signaling |
WO2018064165A2 (en) | 2016-09-27 | 2018-04-05 | Board Of Regents, The University Of Texas System | Methods for enhancing immune checkpoint blockade therapy by modulating the microbiome |
WO2018071668A1 (en) | 2016-10-12 | 2018-04-19 | Board Of Regents, The University Of Texas System | Methods and compositions for tusc2 immunotherapy |
US11278592B2 (en) | 2016-10-12 | 2022-03-22 | Board Of Regents, The University Of Texas System | Methods and compositions for TUSC2 immunotherapy |
WO2018111902A1 (en) | 2016-12-12 | 2018-06-21 | Multivir Inc. | Methods and compositions comprising viral gene therapy and an immune checkpoint inhibitor for treatment and prevention of cancer and infectious diseases |
WO2018183928A1 (en) | 2017-03-31 | 2018-10-04 | Bristol-Myers Squibb Company | Methods of treating tumor |
US11648269B2 (en) | 2017-08-10 | 2023-05-16 | National University Of Singapore | T cell receptor-deficient chimeric antigen receptor T-cells and methods of use thereof |
US11919957B2 (en) | 2017-10-15 | 2024-03-05 | Bristol-Myers Squibb Company | Methods of treating tumor |
WO2019075468A1 (en) | 2017-10-15 | 2019-04-18 | Bristol-Myers Squibb Company | Methods of treating tumor |
WO2020036635A2 (en) | 2018-03-19 | 2020-02-20 | Multivir Inc. | Methods and compositions comprising tumor suppressor gene therapy and cd122/cd132 agonists for the treatment of cancer |
US11242393B2 (en) | 2018-03-23 | 2022-02-08 | Bristol-Myers Squibb Company | Antibodies against MICA and/or MICB and uses thereof |
EP4085923A1 (en) | 2018-03-25 | 2022-11-09 | SNIPR Biome ApS. | Treating and preventing microbial infections |
WO2019185551A1 (en) | 2018-03-25 | 2019-10-03 | Snipr Biome Aps. | Treating & preventing microbial infections |
EP4066851A1 (en) | 2018-03-25 | 2022-10-05 | SNIPR Biome ApS. | Treating & preventing microbial infections |
WO2019191676A1 (en) | 2018-03-30 | 2019-10-03 | Bristol-Myers Squibb Company | Methods of treating tumor |
US11643653B2 (en) | 2018-04-30 | 2023-05-09 | Snipr Biome Aps | Treating and preventing microbial infections |
US11421227B2 (en) | 2018-04-30 | 2022-08-23 | Snipr Biome Aps | Treating and preventing microbial infections |
US11788085B2 (en) | 2018-04-30 | 2023-10-17 | Snipr Biome Aps | Treating and preventing microbial infections |
US10920222B2 (en) | 2018-04-30 | 2021-02-16 | Snipr Biome Aps | Treating and preventing microbial infections |
US11485973B2 (en) | 2018-04-30 | 2022-11-01 | Snipr Biome Aps | Treating and preventing microbial infections |
US10760075B2 (en) | 2018-04-30 | 2020-09-01 | Snipr Biome Aps | Treating and preventing microbial infections |
WO2019241730A2 (en) | 2018-06-15 | 2019-12-19 | Flagship Pioneering Innovations V, Inc. | Increasing immune activity through modulation of postcellular signaling factors |
WO2020227159A2 (en) | 2019-05-03 | 2020-11-12 | Flagship Pioneering Innovations V, Inc. | Methods of modulating immune activity |
WO2020243570A1 (en) | 2019-05-30 | 2020-12-03 | Bristol-Myers Squibb Company | Cell localization signature and combination therapy |
WO2020243568A1 (en) | 2019-05-30 | 2020-12-03 | Bristol-Myers Squibb Company | Methods of identifying a subject suitable for an immuno-oncology (i-o) therapy |
WO2020243563A1 (en) | 2019-05-30 | 2020-12-03 | Bristol-Myers Squibb Company | Multi-tumor gene signatures for suitability to immuno-oncology therapy |
WO2021113644A1 (en) | 2019-12-05 | 2021-06-10 | Multivir Inc. | Combinations comprising a cd8+ t cell enhancer, an immune checkpoint inhibitor and radiotherapy for targeted and abscopal effects for the treatment of cancer |
WO2021127217A1 (en) | 2019-12-17 | 2021-06-24 | Flagship Pioneering Innovations V, Inc. | Combination anti-cancer therapies with inducers of iron-dependent cellular disassembly |
WO2022006179A1 (en) | 2020-06-29 | 2022-01-06 | Flagship Pioneering Innovations V, Inc. | Viruses engineered to promote thanotransmission and their use in treating cancer |
WO2022047412A1 (en) | 2020-08-31 | 2022-03-03 | Bristol-Myers Squibb Company | Cell localization signature and immunotherapy |
WO2022120179A1 (en) | 2020-12-03 | 2022-06-09 | Bristol-Myers Squibb Company | Multi-tumor gene signatures and uses thereof |
WO2022146947A1 (en) | 2020-12-28 | 2022-07-07 | Bristol-Myers Squibb Company | Antibody compositions and methods of use thereof |
WO2022146948A1 (en) | 2020-12-28 | 2022-07-07 | Bristol-Myers Squibb Company | Subcutaneous administration of pd1/pd-l1 antibodies |
WO2022169825A1 (en) | 2021-02-03 | 2022-08-11 | Mozart Therapeutics, Inc. | Binding agents and methods of using the same |
WO2022212784A1 (en) | 2021-03-31 | 2022-10-06 | Flagship Pioneering Innovations V, Inc. | Thanotransmission polypeptides and their use in treating cancer |
WO2022212876A1 (en) | 2021-04-02 | 2022-10-06 | The Regents Of The University Of California | Antibodies against cleaved cdcp1 and uses thereof |
WO2023278641A1 (en) | 2021-06-29 | 2023-01-05 | Flagship Pioneering Innovations V, Inc. | Immune cells engineered to promote thanotransmission and uses thereof |
WO2023076876A1 (en) | 2021-10-26 | 2023-05-04 | Mozart Therapeutics, Inc. | Modulation of immune responses to viral vectors |
WO2023110937A1 (en) | 2021-12-14 | 2023-06-22 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Depletion of nk cells for the treatment of adverse post-ischemic cardiac remodeling |
WO2023178329A1 (en) | 2022-03-18 | 2023-09-21 | Bristol-Myers Squibb Company | Methods of isolating polypeptides |
WO2023235847A1 (en) | 2022-06-02 | 2023-12-07 | Bristol-Myers Squibb Company | Antibody compositions and methods of use thereof |
WO2024077191A1 (en) | 2022-10-05 | 2024-04-11 | Flagship Pioneering Innovations V, Inc. | Nucleic acid molecules encoding trif and additionalpolypeptides and their use in treating cancer |
Also Published As
Publication number | Publication date |
---|---|
CN1997670A (en) | 2007-07-11 |
DK2287195T3 (en) | 2019-08-19 |
US8981065B2 (en) | 2015-03-17 |
US20130287770A1 (en) | 2013-10-31 |
CA2601417C (en) | 2018-10-30 |
US8119775B2 (en) | 2012-02-21 |
US20150191547A1 (en) | 2015-07-09 |
CA2601417A1 (en) | 2006-01-12 |
US8614307B2 (en) | 2013-12-24 |
EP1791868A2 (en) | 2007-06-06 |
EP2287195A2 (en) | 2011-02-23 |
US20090081240A1 (en) | 2009-03-26 |
EP2287195B1 (en) | 2019-05-15 |
WO2006003179A3 (en) | 2006-05-26 |
US20150344576A1 (en) | 2015-12-03 |
JP2008506368A (en) | 2008-03-06 |
PL2287195T3 (en) | 2019-10-31 |
SI2287195T1 (en) | 2019-08-30 |
AU2005259221B2 (en) | 2011-02-10 |
CN1997670B (en) | 2014-04-30 |
EP2287195A3 (en) | 2013-12-04 |
AU2005259221A1 (en) | 2006-01-12 |
US20120208237A1 (en) | 2012-08-16 |
EP1791868B1 (en) | 2011-02-23 |
JP5112863B2 (en) | 2013-01-09 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2005259221B2 (en) | Antibodies binding to receptors KIR2DL1, -2, 3 but not KIR2DS4 and their therapeutic use | |
US9708403B2 (en) | KIR-binding agents and methods of use thereof | |
JP5770142B2 (en) | Human anti-KIR antibody |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KM KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NG NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SM SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU LV MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
WWE | Wipo information: entry into national phase |
Ref document number: 179635 Country of ref document: IL |
|
WWE | Wipo information: entry into national phase |
Ref document number: 7162/DELNP/2006 Country of ref document: IN |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2005259221 Country of ref document: AU |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2007518617 Country of ref document: JP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2005758642 Country of ref document: EP |
|
ENP | Entry into the national phase |
Ref document number: 2005259221 Country of ref document: AU Date of ref document: 20050701 Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2601417 Country of ref document: CA |
|
WWP | Wipo information: published in national office |
Ref document number: 2005259221 Country of ref document: AU |
|
WWE | Wipo information: entry into national phase |
Ref document number: 1020077000069 Country of ref document: KR |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
WWW | Wipo information: withdrawn in national office |
Ref document number: DE |
|
WWE | Wipo information: entry into national phase |
Ref document number: 200580022633.1 Country of ref document: CN |
|
WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2007/000210 Country of ref document: MX |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2007/00736 Country of ref document: ZA Ref document number: 200700736 Country of ref document: ZA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2006144820 Country of ref document: RU |
|
WWP | Wipo information: published in national office |
Ref document number: 1020077000069 Country of ref document: KR |
|
WWP | Wipo information: published in national office |
Ref document number: 2005758642 Country of ref document: EP |
|
ENP | Entry into the national phase |
Ref document number: PI0512911 Country of ref document: BR |