WO2005120585A1 - Dual function polymer micelles - Google Patents

Dual function polymer micelles Download PDF

Info

Publication number
WO2005120585A1
WO2005120585A1 PCT/US2005/019308 US2005019308W WO2005120585A1 WO 2005120585 A1 WO2005120585 A1 WO 2005120585A1 US 2005019308 W US2005019308 W US 2005019308W WO 2005120585 A1 WO2005120585 A1 WO 2005120585A1
Authority
WO
WIPO (PCT)
Prior art keywords
micellar structure
agent
micelles
micellar
peg
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2005/019308
Other languages
French (fr)
Inventor
Hua Ai
Jeffrey L. Duerk
Chris Flask
Jinming Gao
Jonathan S. Lewin
Xintao Shuai
Brent Weinberg
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Case Western Reserve University
Original Assignee
Case Western Reserve University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Case Western Reserve University filed Critical Case Western Reserve University
Priority to US11/569,989 priority Critical patent/US8697031B2/en
Publication of WO2005120585A1 publication Critical patent/WO2005120585A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/10Dispersions; Emulsions
    • A61K9/107Emulsions ; Emulsion preconcentrates; Micelles
    • A61K9/1075Microemulsions or submicron emulsions; Preconcentrates or solids thereof; Micelles, e.g. made of phospholipids or block copolymers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/06Nuclear magnetic resonance [NMR] contrast preparations; Magnetic resonance imaging [MRI] contrast preparations
    • A61K49/18Nuclear magnetic resonance [NMR] contrast preparations; Magnetic resonance imaging [MRI] contrast preparations characterised by a special physical form, e.g. emulsions, microcapsules, liposomes
    • A61K49/1806Suspensions, emulsions, colloids, dispersions
    • A61K49/1809Micelles, e.g. phospholipidic or polymeric micelles
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/69Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit
    • A61K47/6905Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a colloid or an emulsion
    • A61K47/6907Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a colloid or an emulsion the form being a microemulsion, nanoemulsion or micelle
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/06Nuclear magnetic resonance [NMR] contrast preparations; Magnetic resonance imaging [MRI] contrast preparations
    • A61K49/08Nuclear magnetic resonance [NMR] contrast preparations; Magnetic resonance imaging [MRI] contrast preparations characterised by the carrier
    • A61K49/10Organic compounds
    • A61K49/12Macromolecular compounds
    • A61K49/126Linear polymers, e.g. dextran, inulin, PEG
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/06Nuclear magnetic resonance [NMR] contrast preparations; Magnetic resonance imaging [MRI] contrast preparations
    • A61K49/18Nuclear magnetic resonance [NMR] contrast preparations; Magnetic resonance imaging [MRI] contrast preparations characterised by a special physical form, e.g. emulsions, microcapsules, liposomes
    • A61K49/1806Suspensions, emulsions, colloids, dispersions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/06Macromolecular compounds, carriers being organic macromolecular compounds, i.e. organic oligomeric, polymeric, dendrimeric molecules
    • A61K51/065Macromolecular compounds, carriers being organic macromolecular compounds, i.e. organic oligomeric, polymeric, dendrimeric molecules conjugates with carriers being macromolecules
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/12Preparations containing radioactive substances for use in therapy or testing in vivo characterised by a special physical form, e.g. emulsion, microcapsules, liposomes, characterized by a special physical form, e.g. emulsions, dispersions, microcapsules
    • A61K51/1217Dispersions, suspensions, colloids, emulsions, e.g. perfluorinated emulsion, sols
    • A61K51/1234Liposomes
    • A61K51/1237Polymersomes, i.e. liposomes with polymerisable or polymerized bilayer-forming substances
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics

Definitions

  • This invention relates to functionalized micelles suitable for use as delivery vehicles.
  • Background of the Invention An important objective in cancer therapy is to selectively deliver therapeutic agents to the tumor tissue. Low water solubility, rapid phagocytic and renal clearance, and systemic toxicity represent three major barriers that limit the therapeutic use of many hydrophobic anti-tumor agents such as doxorubicin (DOX) and paclitaxel.
  • DOX doxorubicin
  • paclitaxel hydrophobic anti-tumor agents
  • various drug delivery systems among which polymeric micelles have emerged as one important class, have been developed for delivering various drugs with varying degrees of in vitro and in vivo success.
  • the hydrophobic core of the micelles is a carrier compartment that accommodates anti-tumor drugs, and the outside surface of the micelle consists of a brush-like protective corona that stabilizes the nanoparticles in aqueous solution.
  • Polymeric micelles in drug delivery applications are typically characterized by high drug-loading capacity, biodegradability, long blood circulation, and controllable drug release profiles.
  • Polymeric micelles from amphiphilic block copolymers are supramolecular core-shell-type assemblies of tens of nanometers in diameter, which can mimic naturally occurring biological transport systems such as lipoproteins and viruses.
  • polymeric micelles as carriers of hydrophobic drugs have drawn increasing interest, due to their various advantages in drug delivery applications.
  • polymeric micelles are highly stable in aqueous solution because of their intrinsic low critical micelle concentration (cmc), which prevents the drug-entrapped micelles from dissociation upon dilution in the blood stream after intravenous injection. Furthermore, the nanoscale size of polymeric micelles can facilitate their extravasations at tumor sites while avoiding renal clearance and nonspecific reticuloendothelial (RES) uptake.
  • the micelle cores are usually constructed with biodegradable polymers such as aliphatic polyesters and polypeptide, and water-soluble poly(ethylene glycol) is most frequently used to build the micelle corona because it can effectively stabilize the nanoparticles in blood compartments and reduce the uptake at the reticuloendothelial sites (e.g.
  • hydrophobic drugs By encapsulating drugs within the micelles, solubility limits for hydrophobic drugs can be exceeded.
  • Antitumor drugs such as doxorubicin (DOX) and paclitaxel, are widely used in cancer chemotherapy. Besides their low water solubility, major drawbacks of these drugs are the acute toxicity to normal tissue and inherent multi-drug resistance effect. To reduce the acute toxicity of the free drugs and improve their therapeutic efficacy, various liposome and polymeric micelle systems were designed as delivery vehicles. Hydrophobic drugs can be incorporated into the micelle inner core by both chemical conjugation and physical entrapment, depending on the chemical structure of drugs.
  • doxorubicin can also be chemically bound to the core of polymeric micelles through amidation of doxorubicin amino groups, yielding high loading content.
  • an efficient doxorubicin delivery system based on doxorubicin-conjugated poly(ethylene glycol)-poly(aspartic acid) block copolymer (PEG-PAsp-(DOX)) has been developed.
  • the conjugation with DOX converted the hydrophilic poly(aspartic acid) into hydrophobic blocks that formed the hydrophobic micelle core and physically entrapped free DOX as well.
  • DOX conjugation to the micelle cores through an acid-cleavable linkage such as a hydrazone bond, was reported to be an effective way to enhance the bioavailability of the chemically bound DOX.
  • the hydrazone linkage was cleaved in the endosomes/lysosomes (pH around 5) to yield free DOX molecules which then functioned as the physically entrapped DOX.
  • the invention relates in part to micelles that are elaborated with functionality that enables the micelles to selectively target tumor tissue in the delivery of hydrophobic agents.
  • one aspect of the invention is the elaboration of the outer surface (corona) of the micelle with various protein sequences that selectively bind to certain types of tissue.
  • These functionalized micelles may further comprise a hydrophobic chemotherapeutic agent in the core of the micellar structure, such as doxorubicin (DOX) or paclitaxel.
  • DOX doxorubicin
  • paclitaxel doxorubicin
  • these micelles may further comprise a hydrophobic MRI imaging agent in the core of the micellar structure, such as superparamagnetic iron oxide (SPIO).
  • SPIO superparamagnetic iron oxide
  • Another aspect of the invention is the incorporation of radioactive moieties onto the surface of the micellar structure to facilitate single photon emission computed tomography (SPECT), which provides information about the availability of radioisotopes with high sensitivity and the capability to simultaneously monitor multiple probes with different emission wavelengths.
  • SPECT single photon emission computed tomography
  • This technique may be useful in measuring the in vivo pharmacokinetics and tumor targeting efficiency of drug loaded micelles.
  • Figure 1 shows the preparation of cRGD-DOX-micelles.
  • Figure 2a shows the *H MR of MAL-PEG-PCL in CDC1 3 .
  • Figure 2b shows an expanded ! H NMR of MAL-PEG-PCL in CDC1 3 .
  • Figure 3 shows the synthesis of cRGD using solid phase synthesis.
  • Figure 4a shows the size characterization of 0% cRGD-DOX micelles by atomic force microscopy.
  • Figure 4b shows the size characteristics of 0% cRGD-DOX micelles by dynamic light scattering.
  • Figure 4c shows the size characteristics of 76% cRGD-DOX micelles by atomic force microscopy.
  • Figure 4d shows the size characteristics of 76% cRGD-DOX micelles by dynamic light scattering.
  • Figure 5a shows the percentage of micelle uptake in SLK tumor endothelial cells measured by flow cytometry as a function of cRGD density on the micelle surface.
  • Figure 5b shows confocal laser scanning microscopy images of SLK cells treated with 0% cRGD after incubation for 2 h.
  • Figure 5 c shows confocal laser scanning microscopy images of SLK cells treated with 16% cRGD after incubation for 2 h.
  • Figure 6a shows a flow cytometry histogram of micelle uptake in SLK tumor endothelial cells as a function of a cRGD density of 0% on the micelle surface.
  • Figure 6b shows a flow cytometry histogram 76% cRGD-micelles in the presence of free RGS ligands (9mM) in solution.
  • Figure 6c shows a flow cytometry histogram of micelle uptake in SLK tumor endothelial cells as a function of a cRGD density of 76% on the micelle surface.
  • Figure 7 shows the preparation of DOTA-PEG-b-PCL micelles.
  • Figure 8a shows a transmission electron micrograph of a typical micelle containing numerous individual SPIO particles.
  • Figure 8b shows a T 2 - weighted MRI image of a control mouse tumor.
  • Figure 8c shows a T 2 -weighted MRI image of a tumor 72 hours after micelle administration.
  • One strategy to achieve cancer-targeted drug delivery is the utilization of unique molecular markers that are specifically overexpressed in the cancerous tissues. It is well known that tumor endothelial cells show increased expression of several cell surface molecules that potentiate cell invasion and proliferation during tumor vascular remodeling and angiogenesis. Thus, one aspect of the invention is the attachment of moieties to the corona of a polymeric micellar structure that can effectively bind to such molecular markers.
  • the micelles are formed from amphiphilic block copolymers.
  • the polymer is selected from poly- ⁇ -benzyl- L-glutamate-polyethylene oxide (PBLG-PEO), polyethylene oxide)- poly(proplylene oxide) (PEO-PPO-PEO), poly(ethylene glycol)-poly( ⁇ -benzyl-L- aspartate) (PEG-b-PBLA), and poly( ⁇ -caprolactone)-poly(ethylene glycol) (PCL- PEG).
  • PBLG-PEO poly- ⁇ -benzyl- L-glutamate-polyethylene oxide
  • PEO-PPO-PEO polyethylene oxide)- poly(proplylene oxide)
  • PEG-b-PBLA poly( ⁇ -caprolactone)-poly(ethylene glycol)
  • PCL- PEG poly( ⁇ -caprolactone)-poly(ethylene glycol)
  • Micelles may be prepared by adding the copolymer and optionally any additional hydrophobic agent(s) to a hydrophobic solvent in which they are soluble (an organic solvent), the resulting solution being added to water under conditions of vigorous agitation, for example, by ultrasonication, shaking, or other suitable agitation as is well understood in the art.
  • the organic solvent may then be removed by slow evaporation to promote the formation of micelles.
  • the residual organic solvent may then be completely removed to provide the desired micelles in an aqueous medium.
  • micelles may contain a hydrophobic agent in the core, wherein a "hydrophobic agent" is an agent that is poorly soluble in water, such as an agent that is more soluble in octanol than it is soluble in water.
  • a hydrophobic agent is an agent that is poorly soluble in water, such as an agent that is more soluble in octanol than it is soluble in water.
  • the hydrophobic agent is a chemotherapeutic drug.
  • the chemotherapeutic drug is selected from aminoglutethimide, amsacrine, anastrozole, asparaginase, beg, bicalutamide, bleomycin, buserelin, busulfan, campothecin, capecitabine, carboplatin, carmustine, chlorambucil, cisplatin, cladribine, clodronate, colchicine, cyclophosphamide, cyproterone, cytarabme, dacarbazine, dactinomycin, daunorubicin, dienestrol, diethylstilbestrol, docetaxel, doxorubicin, epirubicin, estradiol, estramustine, etoposide, exemestane, filgrastim, fludarabine, fludrocortisone, fluorouracil, fluoxymesterone, flutamide, gemcitabine, genistein, gosereli
  • the chemotherapeutic drug is selected from paclitaxel and doxorubicin.
  • the micelles are functionalized with a targeting moiety.
  • targeting moiety refers to any molecular structure which assists the micelle in localizing to a particular target area, entering a target cell(s), and/or binding to a target receptor.
  • lipids including cationic, neutral, and steroidal lipids, virosomes, and liposomes
  • antibodies, lectins, ligands, sugars, steroids, hormones, nutrients, and proteins can serve as targeting moieties.
  • a number of suitable targeting moieties are disclosed in U.S.
  • Patent Application 2003- 0049203 which is incorporated herein in its entirety. Since tumor endothelial cells show increased expression of several cell surface molecules, the attachment of moieties to the corona of a polymeric micellar structure that can effectively bind to such molecular markers may serve as a way to target such tumor tissue.
  • One molecular marker known to be overexpressed in cancerous tissue is ⁇ v ⁇ 3 integrin, which plays a key role in endothelial cell survival during angiogenesis (Griffioen A.W., Molema G. (2000) Pharmacol. Rev. 52237-268). The ⁇ v ⁇ 3 integrin was found to be unregulated in these cells and can induce cell mternalization (Brooks P.C.
  • an ⁇ v ⁇ 3 ligand is bound to the corona of micelles.
  • c(Arg-Gly-Asp-D-Phe-Lys) (c-RGD) is bound to the corona of micelles.
  • suitable targeting moieties include but are not limited to lipoproteins, glycoproteins, asialoglycoproteins, transferrin, toxins, carbohydrates, cell surface receptor ligands, antibodies, and homing peptides. Synthetic homing peptides with the desired levels of affinity and/or selectivity for specific organs or tissues may be employed as targeting moieties, for example as disclosed in U.S.
  • tissue-specific homing peptides include, but are not limited to, the sequences in Table 1 Table 1
  • peptides that may be useful for targeting tumors in vivo include, but are not limited to, the peptide sequences shown in Table 2, which have been described as potential targeting peptides for tumor cells Table 2
  • a targeting peptide or other targeting moiety into the outer shell may be accomplished by any of the methods known in the art of targeted drug delivery. Suitable methods include but are not limited to covalent attachment of a targeting moiety to one or more components of the outermost shell, either directly or via linkers and electrostatic binding of appropriately charged molecules.
  • Imaging agent is a moiety suitable for generating a detectable signal, e.g., using a technique such as positron emission tomography (PET), single photon emission tomography (SPECT), or magnetic resonance imaging (MRI), such as a radionuclides, unpaired spin atoms and free radicals (e.g., Fe, lanthanides, and Gd), and contrast agents (e.g., chelated (DTP A) manganese).
  • PET positron emission tomography
  • SPECT single photon emission tomography
  • MRI magnetic resonance imaging
  • SPECT can be used for molecular imaging studies to assess both drug distribution and physiological effects with high sensitivity of detection. Furthermore, the use of SPECT allows the simultaneous observation of multiple probes with different emission wavelengths.
  • the radioactive moiety is selected from 225 Ac, 227 Ac, 241 Am, 72 As, 74 As, 211 At, 198 Au, 7 Be, 212 Bi, 213 Bi, 75 Br, 77 Br, n C, 14 C, 48 Ca, 109 Cd, 139 Ce, ,41 Ce, 252 Cf, 55 Co, 57 Co, 60 Co, 51 Cr, ,30 Cs, ,31 Cs, 137 Cs, 61 Cu, 62 Cu, 165 Dy, 152 Eu, 155 Eu, 18 F, 55 Fe, 59 Fe, 64 Ga, 67 Ga, 68 Ga, 153 Gd, 68 Ge, 3 H, 122 1, 123 1, 124 I, I25 1, 131 1, 132 I, m In, U5m In, 191m Ir, 192 Ir, 81m Kr, 177 Lu, 51 Mn, 52 Mn, 99 Mo, 13 N, 95 Nb, 15 0, 19, Os, 194 Os, 32 P, 33 P,
  • 99m Tc-labeled Annexin V 28 is an available apoptosis probe available when using SPECT, wherein Annexin V is a human protein known to bind phosphatidylserine on the exterior of apoptotic cells.
  • the imaging moiety may be incorporated onto the surface of the micellar structure by fabricating a micelle with a chelating group on the surface that is capable of chelating an imaging moiety. This can be accomplished by, for example, synthesizing block copolymers of PEG and PCL, some of which contain a terminal methyl group (MPEG-PCL), and others in which the PEG chain is covalently linked to the chelating group.
  • MPEG-PCL terminal methyl group
  • the chelating group is selected from 1,4,7,10- tetraazacyclododecane-l,4,7,10-tetraacetic acid (DOTA), diethylenetriaminepentaacetic acid bis (methylamide) (DTPA-BMA), N, N'-bis(2- pyridylmethyl)diethylenetriamine-N,N',N"-triacetic acid (DTPA-BP), and trans- 1 ,2-diaminocyclohexane-N,N',N",N' ' '-tetraacetic acid (CDTA).
  • the chelating group is DOTA.
  • radioactive imaging moieties include, but are not limited to, 225 Ac, 227 Ac, 241 Am, 72 As, 74 As, 211 At, ,98 Au, 7 Be, 2I2 Bi, 213 Bi, 75 Br, 77 Br, n C, 14 C, 48 Ca, 109 Cd, 139 Ce, 141 Ce, 252 Cf, 55 Co, 57 Co, 60 Co, 51 Cr, 130 Cs, 13I Cs, 137 Cs, 61 Cu, 62 Cu, 165 Dy, 152 Eu, 155 Eu, 18 F, 55 Fe, 59 Fe, 64 Ga, 67 Ga, 68 Ga, 153 Gd, 68 Ge, 3 H, 122 1, 123 1, 124 I, 125 1, 131 I, I32 I, ⁇ n In, 115m In, 191m Ir, 192 Ir, 81m Kr, 177 Lu, 51 Mn, 52 Mn, 99 Mo, 13 N, 95 Nb, 15 0, 191 Os, 194 Os, 32
  • the radioactive moiety is capable of being chelated by a chelating agent and is selected from 225 Ac, 227 Ac, 241 Am, 198 Au, 7 Be, 212 Bi, 213 Bi, 48 Ca, 109 Cd, 139 Ce, 141 Ce, 252 Cf, 55 Co, 57 Co, 60 Co, 51 Cr, 130 Cs, ,31 Cs, 137 Cs, 61 Cu, 62 Cu, ,65 Dy, 152 Eu, 155 Eu, 18 F, 55 Fe, 59 Fe, 6 Ga, 67 Ga, 68 Ga, 153 Gd, 68 Ge, ⁇ In, U5m In, 191m Ir, 192 Ir,
  • the radioactive moiety is l ⁇ In, 99m Tc-labeled Annexin V 28 , or 99m Tc. In certain such embodiments, the radioactive moiety is In.
  • a magnetic resonance imaging (MRI) contrast imaging agent either alone or in combination with another hydrophobic agent and/or functionalization of the corona of the micelle. Examples of such contrast agents, include, but are not limited to, gadopentetate dimeglumine, gadoteridol, gadoterate meglumine, mangafodipir trisodium, gadodiamide, gadoversetamide, and superparamagnetic iron oxide.
  • SPIO nanoparticles are a class of MRI contrast agents that provide extremely strong enhancement of proton relaxation.
  • TI low molecular weight paramagnetic metal chelates
  • SPIO nanoparticles are classified as T2 negative contrast agents, with MR sensitivity approximately 1000 times higher than TI agents.
  • SPIO agents are composed of iron oxide nanocrystals which create a large, dipolar magnetic field gradient that creates a relaxation effect on nearby water molecules. According to their sizes and applications, SPIO nanoparticles have been classified into four different categories: large, standard, ultrasmall, and monocrystalline agents. Large SPIO agents are mainly used for gastrointestinal lumen imaging, while standard SPIO agents are used for liver and spleen imaging.
  • the SPIO nanoparticles When the SPIO nanoparticles are in the range of 20-40 nm (ultrasmall category), they can be injected to visualize lymph node metastases.
  • the smallest monocrystalline SPIO agents are used for tumor-specific imaging when attached to monoclonal antibodies, growth factors, and antigens.
  • the MRI contrast imaging agent is superparamagnetic iron oxide (SPIO).
  • SPIO superparamagnetic iron oxide
  • Figure 8A shows a transmission electron micrograph of a typical micelle containing numerous individual SPIO particles, wherein the white circle denotes the approximate boundary of the micelle core.
  • Another aspect of the invention relates to method for the treatment of cancer, comprising administering micelles of the present invention, wherein the micellar structure comprises an encapsulated chemotherapeutic agent.
  • the coronas of the micelles are functionalized with peptides that are capable of targeting tumor cells. Additionally, or alternatively, the corona of the micelle is functionalized with a peptide that is capable of targeting a specific tissue in the body, preferably a peptide selected from either Table 1 or 2. In certain embodiments, the coronas of the micelles are functionalized with chelating agents that are capable of chelating a radioactive moiety. In preferred such embodiments, the micelles further comprise a radioactive moiety that is capable of being chelated by the chelating agent.
  • a further aspect of the invention relates to a method for monitoring the delivery of a hydrophobic agent, comprising administering micelles, wherein the micellar structure comprises an encapsulated hydrophobic agent, and the hydrophobic agent is an MRI contrast agent.
  • the micellar structure further comprises a functionalized corona and/or an additional hydrophobic agent.
  • the additional hydrophobic agent is a chemotherapeutic agent.
  • Another aspect of the invention is a pharmaceutical composition, comprising micelles as described herein and a pharmaceutically acceptable carrier.
  • phrases "pharmaceutically acceptable” is employed herein to refer to those ligands, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
  • pharmaceutically acceptable carrier means a pharmaceutically acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material, involved in carrying or transporting the subject chemical from one organ or portion of the body, to another organ or portion of the body.
  • Each carrier must be “acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient.
  • materials which can serve as pharmaceutically acceptable carriers include: (1) sugars, such as lactose, glucose, and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose, and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil, and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol, and polyethylene glycol; (12) esters, such as ethyl oleate
  • compositions of the present invention are non-pyrogenic, i.e., do not induce significant temperature elevations when administered to a patient.
  • treating includes reversing, reducing, or arresting the symptoms, clinical signs, and underlying pathology of a condition in manner to improve or stabilize a subject's condition.
  • the present invention may be further appreciated upon consideration of the following illustrative and non-limiting examples.
  • GPC analysis was carried out using a PLgel 5 ⁇ m Mixed-D 300x7.5mm column (Polymer Laboratories) with THF as an eluent (1 mL/min) and polystyrene standards for column calibration. 20 ⁇ L samples were injected. The eluent was analyzed with a Perkin-Elmer Series 200 differential refractive index (RI) detector.
  • RI differential refractive index
  • PCL copolymer (10 mg) and doxorubicin (2 mg) were dissolved in THF (2 mL) in a glass vial. Afterwards, the solution was added dropwise to pure water (20 mL) under vigorous ultrasonic agitation using a Type 60 Sonic Dismembrator (Fisher Scientific) at a power level of 10. The beaker was then open to air overnight, allowing slow evaporation of THF and formation of micelles. The residual THF was completely removed by vacuum distillation with a rotary evaporator.
  • the micelle solution concentrated to 5 mL was filtered with a syringe filter (pore size: 0.45 ⁇ m) to eliminate the polymer and DOX aggregates, and then filtered through a MILLIPORE Centrifugal Filter Device (Mw cut-off: 100,000 Da) to remove free DOX dissolved in the micelle solution.
  • the micelles thus obtained were characterized with photon correlation spectroscopy. Measurements were performed at 25 °C on a 90 Plus Particle Size Analyzer from Brookhaven Instruments Corporation. Scattered light was detected at 90° angle and collected on an autocorrelator. For each sample, data obtained from five measurements were averaged to yield the size and size distribution.
  • DOX-loading content was defined as the weight percentage of DOX in the micelle.
  • DLC was quantified by determining the absorbance at 485 nm using a Perkin-Elmer Lambda 20 UV-Vis spectrophotometer. First, the micelle solutions were frozen and lyophilized to yield the solid micelle samples. Then the dried samples were redissolved in a mixture of chloroform and DMSO (1:1, v/v) for the UV-Vis measurement. DOX solutions of various concentrations were prepared, and the absorbance at 485 mn was measured to generate a calibration curve for the DLC calculations from various micelles.
  • Hemolysis study Blood was freshly obtained from a male beagle dog and collected in heparin- coated tubes. Blood was washed three times with PBS and collected by centrifugation at 2,800 rpm for 5 min. Micelle solutions were prepared at different concentrations in the PBS buffer, and 100 ⁇ L of the erythrocyte suspension were added to 900 ⁇ l of micelle solutions. The samples were incubated for 60 min at 37 °C in a New Brunswick Scientific C24 Incubator Shaker. The release of hemoglobin was measured by UV-Vis analysis of the supernatant at 540 nm after centrifugation at 12,000 g for 60 min.
  • MAL-PEG-PCL as shown in Figure 1, must be conducted at a lower temperature due to the thermal susceptibility of the maleimide end groups. Reaction at 68 °C led to desired molecular weights of PCL segments (e.g., 2.4 kD), while greatly reducing the thermal decomposition of maleimide to a negligible level.
  • DOX-loaded, MAL- PEG-PCL micelles were prepared by a solvent-evaporation method. Different amounts of methoxy-terminated MPEG-PCL copolymer were also introduced to control maleimide density at the micelle surface, which subsequently controls the cRGD density (5, 16, and 76% of all PEG chains).
  • Figure 2a shows the 1H NMR spectrum of MAL-PEG-PCL copolymer in CDC1 3 . Resonances of the PEG methylene protons (mainly at 3.64 ppm) and PCL protons (1.38, 1.65, 2.31 and 4.06 ppm) were observed. A small triplet shown at 4.2 ppm was attributed to proton resonance of the methyleneoxyl group linking PCL and PEG blocks. The integration intensity of maleimide vinyl protons at 6.74 ppm confirms that the maleimide group in MAL-PEG-PCL copolymers remained intact as in the MAL-PEG-OH. These data strongly demonstrated that the desired block copolymers were successfully synthesized.
  • the number-averaged molecular weight of PCL blocks was calculated to be 2.4 kD using the integral intensity of PCL proton at 2.31 ppm versus that of the PEG proton at 3.64 ppm.
  • a post-micellar modification strategy to prepare cRGD-functionalized micelles as shown in Figure 1.
  • the NMR spectrum of the freeze-dried micelles in D 2 O strongly suggests the core-shell structure of DOX- loaded micelles as shown in Figure 2b.
  • the micelle corona shells consisting of PEG blocks were well solvated in D 2 O and showed clear H NMR signals.
  • the C-terminal allyl ester group of the aspartic acid was removed after addition of the last amino acid with palladium tetrakis(triphenylphosphine) (Pd(PPh ) 4 ) (3 eq.) in a solution of chloroform, acetic acid and N-methylmorpholine for 2 h at rt.
  • the mixture was washed with DIPEA in DMF followed by 0.5%w/w diethyldithiocarbamic acid sodium salt in DMF.
  • the head-to-tail cyclization was preformed by removal of the N-terminal Fmoc group before addition of HATU (2 eq.) and DIPEA (4 eq.) in DMF at rt for 16 h.
  • the protecting group of the amino side-chain of lysine (4, 4-dimethyl-2,6-dioxocyclohex-l-ylidene)ethyl, (Dde)) was removed by hydrazine monohydrate-DMF (2:98) for 3 min at rt, 3 time.
  • the thiol addition was preformed by swelling resin with DIPEA (15 eq.) in DMF, followed by addition of S-acetylthioglycolic acid N-hydroxysuccinimide ester (SATA) solution (2 eq.) in DMF (15 mg/mL) for 2 h at rt. The resin was then washed with DMF followed by DCM.
  • CLSM Confocal laser scanning microscopy
  • the emission wavelength of doxorubicin and Hoechst 33342 are 595 and 455 nm, respectively.
  • a significantly increased amount of micelle uptake was observed in micelles with 16% cRGD surface density as shown in Figure 5c compared to those without cRGD as shown in Figure 5b. This result is consistent with those from flow cytometry studies as shown in Figure 5 a.
  • PEG-PCL are synthesized following reported procedures (Shuai, X.T. et al., Macromolecules, 2003. 36 5751-5759; Deng, M.X. et al., Biomaterials, (2004) 25 3553-3558). Briefly, synthesis of H 2 N-PEG-PCL is accomplished by the metalation of acetonitrile with potassium naphthalide to initiate living anionic ring-opening- polymerization with ethylene oxide first and ⁇ -caprolactone ( ⁇ -CL) second.
  • Hydrogenation of the CN-PEG-PCL copolymer using Pd/C as catalyst provides a diblock copolymer with a functionalizable amino group (H 2 N-PEG-PCL).
  • DOTA- NHS ester (Macrocyclics, Inc., Dallas, TX) is added to a H 2 N-PEG-PCL solution in organic solvent.
  • the subsequent copolymer is purified by precipitation in diethyl ether and hexane. Both polymers can be manufactured with various PEG and PCL chain lengths, which can be used to modify both the micelle size and doxorubicin loading within the micelles.
  • the amount of chelating agent can be controlled by varying the weight ratio of DOTA-PEG-PCL to MPEG-PCL used.
  • Micelles with 1, 3, and 5% (w/w) DOTA-PEG-PCL are fabricated using a phase inversion technique. A schematic illustrating this process is shown in Figure 7.
  • Micelle size is characterized through the use of dynamic light scattering and TEM, while drug content and release from the micelles is measured by UV-Vis spectroscopy.
  • ⁇ n In is added to each micelle fo ⁇ nulation to allow binding of the metal ion to the DOTA chelating group.
  • Excess free ⁇ n In ions are removed through a gel filtration process before imaging, and each micelle sample is serially diluted to generate vials containing a logarithmic range of known concentrations.
  • Multiple vials containing concentrations of each of the three formulations are then imaged via both SPECT and computed tomography (CT), and the resulting imaging activity of each vial is plotted against micelle concentration for that formulation.
  • CT computed tomography
  • each of the three micelle formulations are injected into the tail vein of two mice with breast tumors.
  • An additional two sets of mice, one with drug-containing, unlabeled micelles and another with drug-free labeled micelles, are injected and imaged as controls.
  • a separate SPECT imaging probe, 99m Tc-labeled Annexin V can be introduced to simultaneously measure cell apoptosis.
  • SPECT imaging One unique property of SPECT imaging is its ability to discern activity from multiple probes that emit gamma photons of different energy, in this case 245 keV for m In and 140 keV for 99m Tc.
  • an in vitro calibration similar to that described above is performed prior to use in animals.
  • vials containing known concentrations of both m In- labeled micelles and 9m Tc-labeled Annexin V are prepared and used to generate limit of detection values for the simultaneous detection of both labels.
  • Animal groups will be the same as those used for n In imaging with the addition of a group to receive systemic free doxorubicin to ensure that the tumors in this model are susceptible to doxorubicin treatment.
  • the 99m Tc-labeled Annexin V is administered via the tail vein prior to each imaging session, and SPECT imaging is used to generate both micelle concentration and apoptosis density measurements. The results from this section are confirmed via histological measurements taken after the animals are sacrificed. Tumor volume is measured by gross tissue measurement, doxorubicin concentration in tissue is obtained by fluorescence microscopy, apoptosis is validated using TUNEL stained sections, and micelle concentrations are confirmed by scintillation counting of extracted tissues.
  • PEG chain length effects are elucidated by using micelle formulations with a fixed PCL length (5 kD) and varying PEG size (2, 5, and 10 kD), for a total of five experimental groups.
  • Control mice are injected with labeled micelles containing no doxorubicin. Each group contains approximately 6 subjects.
  • the micelles are compared directly with systemically administered, dose-matched doxorubicin on the same measures. Additionally, the data from micelle comparison is used to develop a model to correlate treatment efficacy with micelle accumulation and apoptosis as measured by SPECT.
  • Relationships between micelle accumulation, tumor apoptosis, and tumor volume change over the one week period of monitoring are investigated in order to create a method of predicting the tumor volume change of the tumors based on early ( ⁇ 24 hours) measurements of micelle accumulation and tumor apoptosis.
  • micelle solutions were injected into the tail vein of breast tumor bearing mice (the bi-transgenic mice bearing both the MMTV-c-neu and LHCTP transgenes proposed for use in this study) at and imaged with T 2 - weighted sequences at 1 hour and 72 hours after micelle injection.
  • T 2 - weighted sequences at 1 hour and 72 hours after micelle injection.
  • the peripheral region of the tumor had darkened noticeably, indicating accumulation of SPIO-containing micelles in the region as shown in Figures 8b and 8c.
  • MRI has some intrinsic difficulties, however, such as relatively low sensitivity compared to nuclear medicine and problems distinguishing contrast effects from the anatomical background, that promote the development of other imaging modalities for quantitative micelle tracking.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Dispersion Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Radiology & Medical Imaging (AREA)
  • Engineering & Computer Science (AREA)
  • Physics & Mathematics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Optics & Photonics (AREA)
  • Nanotechnology (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Oncology (AREA)
  • Organic Chemistry (AREA)
  • Communicable Diseases (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

The invention relates to micelles that are elaborated with functionality useful for imaging and/or selectively targeting tissue, e.g., in the delivery of hydrophobic agents.

Description

Dual Function Polymer Micelles
Field of Invention This invention relates to functionalized micelles suitable for use as delivery vehicles. Background of the Invention An important objective in cancer therapy is to selectively deliver therapeutic agents to the tumor tissue. Low water solubility, rapid phagocytic and renal clearance, and systemic toxicity represent three major barriers that limit the therapeutic use of many hydrophobic anti-tumor agents such as doxorubicin (DOX) and paclitaxel. To overcome these limitations, various drug delivery systems, among which polymeric micelles have emerged as one important class, have been developed for delivering various drugs with varying degrees of in vitro and in vivo success. The hydrophobic core of the micelles is a carrier compartment that accommodates anti-tumor drugs, and the outside surface of the micelle consists of a brush-like protective corona that stabilizes the nanoparticles in aqueous solution. Polymeric micelles in drug delivery applications are typically characterized by high drug-loading capacity, biodegradability, long blood circulation, and controllable drug release profiles. Polymeric micelles from amphiphilic block copolymers are supramolecular core-shell-type assemblies of tens of nanometers in diameter, which can mimic naturally occurring biological transport systems such as lipoproteins and viruses. Recently, polymeric micelles as carriers of hydrophobic drugs have drawn increasing interest, due to their various advantages in drug delivery applications. First, polymeric micelles are highly stable in aqueous solution because of their intrinsic low critical micelle concentration (cmc), which prevents the drug-entrapped micelles from dissociation upon dilution in the blood stream after intravenous injection. Furthermore, the nanoscale size of polymeric micelles can facilitate their extravasations at tumor sites while avoiding renal clearance and nonspecific reticuloendothelial (RES) uptake. The micelle cores are usually constructed with biodegradable polymers such as aliphatic polyesters and polypeptide, and water-soluble poly(ethylene glycol) is most frequently used to build the micelle corona because it can effectively stabilize the nanoparticles in blood compartments and reduce the uptake at the reticuloendothelial sites (e.g. liver and spleen). By encapsulating drugs within the micelles, solubility limits for hydrophobic drugs can be exceeded. Antitumor drugs, such as doxorubicin (DOX) and paclitaxel, are widely used in cancer chemotherapy. Besides their low water solubility, major drawbacks of these drugs are the acute toxicity to normal tissue and inherent multi-drug resistance effect. To reduce the acute toxicity of the free drugs and improve their therapeutic efficacy, various liposome and polymeric micelle systems were designed as delivery vehicles. Hydrophobic drugs can be incorporated into the micelle inner core by both chemical conjugation and physical entrapment, depending on the chemical structure of drugs. For instances, paclitaxel was encapsulated into micelle cores usually by physical entrapment driven by hydrophobic interactions between the drug and the hydrophobic components of polymers. In contrast, doxorubicin can also be chemically bound to the core of polymeric micelles through amidation of doxorubicin amino groups, yielding high loading content. By this way, an efficient doxorubicin delivery system based on doxorubicin-conjugated poly(ethylene glycol)-poly(aspartic acid) block copolymer (PEG-PAsp-(DOX)) has been developed. The conjugation with DOX converted the hydrophilic poly(aspartic acid) into hydrophobic blocks that formed the hydrophobic micelle core and physically entrapped free DOX as well. Recently, DOX conjugation to the micelle cores through an acid-cleavable linkage, such as a hydrazone bond, was reported to be an effective way to enhance the bioavailability of the chemically bound DOX. The hydrazone linkage was cleaved in the endosomes/lysosomes (pH around 5) to yield free DOX molecules which then functioned as the physically entrapped DOX. Compared to the chemical conjugation strategy, physical entrapment of drugs in the micelle cores may be advantageous in terms of easy polymer preparation, simple micelle fabrication, and enhanced drug bioavailability. Although several micellar systems based on non-ionic amphiphilic block polymers such as PEO-PPO-PEO and PEG-b-PBLA have been reported, physically entrapped DOX delivery with polymeric micelles based on the well-known block copolymers of poly(ethylene glycol) and biodegradable polyesters is still very limited. Research on micelles has been greatly advanced; however, the ability to achieve high targeting efficiency at the tumor site and associated cells remains a significant challenge for the development of micelle-mediated drug delivery systems.
Summary of the Invention The invention relates in part to micelles that are elaborated with functionality that enables the micelles to selectively target tumor tissue in the delivery of hydrophobic agents. Thus, one aspect of the invention is the elaboration of the outer surface (corona) of the micelle with various protein sequences that selectively bind to certain types of tissue. These functionalized micelles may further comprise a hydrophobic chemotherapeutic agent in the core of the micellar structure, such as doxorubicin (DOX) or paclitaxel. Alternatively or additionally, these micelles may further comprise a hydrophobic MRI imaging agent in the core of the micellar structure, such as superparamagnetic iron oxide (SPIO). Another aspect of the invention is the incorporation of radioactive moieties onto the surface of the micellar structure to facilitate single photon emission computed tomography (SPECT), which provides information about the availability of radioisotopes with high sensitivity and the capability to simultaneously monitor multiple probes with different emission wavelengths. This technique may be useful in measuring the in vivo pharmacokinetics and tumor targeting efficiency of drug loaded micelles.
Brief Description of the Figures Figure 1 shows the preparation of cRGD-DOX-micelles. Figure 2a shows the *H MR of MAL-PEG-PCL in CDC13. Figure 2b shows an expanded !H NMR of MAL-PEG-PCL in CDC13. Figure 3 shows the synthesis of cRGD using solid phase synthesis. Figure 4a shows the size characterization of 0% cRGD-DOX micelles by atomic force microscopy. Figure 4b shows the size characteristics of 0% cRGD-DOX micelles by dynamic light scattering. Figure 4c shows the size characteristics of 76% cRGD-DOX micelles by atomic force microscopy. Figure 4d shows the size characteristics of 76% cRGD-DOX micelles by dynamic light scattering. Figure 5a shows the percentage of micelle uptake in SLK tumor endothelial cells measured by flow cytometry as a function of cRGD density on the micelle surface. Figure 5b shows confocal laser scanning microscopy images of SLK cells treated with 0% cRGD after incubation for 2 h. Figure 5 c shows confocal laser scanning microscopy images of SLK cells treated with 16% cRGD after incubation for 2 h. Figure 6a shows a flow cytometry histogram of micelle uptake in SLK tumor endothelial cells as a function of a cRGD density of 0% on the micelle surface. Figure 6b shows a flow cytometry histogram 76% cRGD-micelles in the presence of free RGS ligands (9mM) in solution. Figure 6c shows a flow cytometry histogram of micelle uptake in SLK tumor endothelial cells as a function of a cRGD density of 76% on the micelle surface. Figure 7 shows the preparation of DOTA-PEG-b-PCL micelles. Figure 8a shows a transmission electron micrograph of a typical micelle containing numerous individual SPIO particles. Figure 8b shows a T2- weighted MRI image of a control mouse tumor. Figure 8c shows a T2-weighted MRI image of a tumor 72 hours after micelle administration.
Detailed Description of the Invention One strategy to achieve cancer-targeted drug delivery is the utilization of unique molecular markers that are specifically overexpressed in the cancerous tissues. It is well known that tumor endothelial cells show increased expression of several cell surface molecules that potentiate cell invasion and proliferation during tumor vascular remodeling and angiogenesis. Thus, one aspect of the invention is the attachment of moieties to the corona of a polymeric micellar structure that can effectively bind to such molecular markers. In certain embodiments, the micelles are formed from amphiphilic block copolymers. In preferred embodiments, the polymer is selected from poly-γ-benzyl- L-glutamate-polyethylene oxide (PBLG-PEO), polyethylene oxide)- poly(proplylene oxide) (PEO-PPO-PEO), poly(ethylene glycol)-poly(β-benzyl-L- aspartate) (PEG-b-PBLA), and poly(ε-caprolactone)-poly(ethylene glycol) (PCL- PEG). In most preferred embodiments, the polymer is PCL-PEG. Micelles may be prepared by adding the copolymer and optionally any additional hydrophobic agent(s) to a hydrophobic solvent in which they are soluble (an organic solvent), the resulting solution being added to water under conditions of vigorous agitation, for example, by ultrasonication, shaking, or other suitable agitation as is well understood in the art. The organic solvent may then be removed by slow evaporation to promote the formation of micelles. The residual organic solvent may then be completely removed to provide the desired micelles in an aqueous medium. In preferred such embodiments, micelles may contain a hydrophobic agent in the core, wherein a "hydrophobic agent" is an agent that is poorly soluble in water, such as an agent that is more soluble in octanol than it is soluble in water. Preferably, the hydrophobic agent is a chemotherapeutic drug. In certain such embodiments, the chemotherapeutic drug is selected from aminoglutethimide, amsacrine, anastrozole, asparaginase, beg, bicalutamide, bleomycin, buserelin, busulfan, campothecin, capecitabine, carboplatin, carmustine, chlorambucil, cisplatin, cladribine, clodronate, colchicine, cyclophosphamide, cyproterone, cytarabme, dacarbazine, dactinomycin, daunorubicin, dienestrol, diethylstilbestrol, docetaxel, doxorubicin, epirubicin, estradiol, estramustine, etoposide, exemestane, filgrastim, fludarabine, fludrocortisone, fluorouracil, fluoxymesterone, flutamide, gemcitabine, genistein, goserelin, hydroxyurea, idarubicin, ifosfamide, imatinib, interferon, irinotecan, ironotecan, letrozole, leucovorin, leuprolide, levamisole, lomustine, mechlorethamine, medroxyprogesterone, megestrol, melphalan, mercaptopurine, mesna, methotrexate, mitomycin, mitotane, mitoxantrone, nilutamide, nocodazole, octreotide, oxaliplatin, paclitaxel, pamidronate, pentostatin, plicamycin, porfimer, procarbazine, raltitrexed, rituximab, streptozocin, suramin, tamoxifen, temozolomide, teniposide, testosterone, thioguanine, thiotepa, titanocene dichloride, topotecan, trastuzumab, tretinoin, vinblastine, vincristine, vindesine, and vinorelbine. In more preferred such embodiments, the chemotherapeutic drug is selected from paclitaxel and doxorubicin. In certain embodiments, the micelles are functionalized with a targeting moiety. The term "targeting moiety" refers to any molecular structure which assists the micelle in localizing to a particular target area, entering a target cell(s), and/or binding to a target receptor. For example, lipids (including cationic, neutral, and steroidal lipids, virosomes, and liposomes), antibodies, lectins, ligands, sugars, steroids, hormones, nutrients, and proteins can serve as targeting moieties. A number of suitable targeting moieties are disclosed in U.S. Patent Application 2003- 0049203, which is incorporated herein in its entirety. Since tumor endothelial cells show increased expression of several cell surface molecules, the attachment of moieties to the corona of a polymeric micellar structure that can effectively bind to such molecular markers may serve as a way to target such tumor tissue. One molecular marker known to be overexpressed in cancerous tissue is αvβ3 integrin, which plays a key role in endothelial cell survival during angiogenesis (Griffioen A.W., Molema G. (2000) Pharmacol. Rev. 52237-268). The αvβ3 integrin was found to be unregulated in these cells and can induce cell mternalization (Brooks P.C. et al. (1994) Cell. 79, 1157-1164). In preferred embodiments, an αvβ3 ligand is bound to the corona of micelles. In certain embodiments, c(Arg-Gly-Asp-D-Phe-Lys) (c-RGD) is bound to the corona of micelles. Examples of other suitable targeting moieties include but are not limited to lipoproteins, glycoproteins, asialoglycoproteins, transferrin, toxins, carbohydrates, cell surface receptor ligands, antibodies, and homing peptides. Synthetic homing peptides with the desired levels of affinity and/or selectivity for specific organs or tissues may be employed as targeting moieties, for example as disclosed in U.S. patents 6,576,239, 6,306,365, 6,303,573, 6,296,832, 6,232,287, 6,180,084, 6,174,687, 6,068,829, and 5,622,699, U.S. patent applications 2001/0046498, 2002/0041898, 2003/0008819, and 2003/0077826, and PCT application PCT/GB02/04017 (WO 03/020751), all of which are incorporated herein by reference. Methods for identifying and using these and other tissue-homing peptides are known in the art, see for example W. Arap et al., Science 279:377-380 (1998); R. Pasqualini, and E. Ruoslahti, Nature 380:364-366 (1996); D. Rajotte et al., J. Clin. Invest. 102:430-437 (1998); P. Laakkonen et al., Nature Medicine 8(7):751-755 (2002); and K. Essler, E. Ruoslahti, Proc. Natl. Acad. Sci. U.S.A. 99(4):2252-2257 (2002), all of which are hereby incorporated herein by reference in their entirety. Suitable tissue-specific homing peptides include, but are not limited to, the sequences in Table 1 Table 1
Figure imgf000008_0001
Figure imgf000009_0001
Figure imgf000010_0001
Figure imgf000011_0001
Figure imgf000012_0001
Figure imgf000013_0001
Figure imgf000014_0001
Figure imgf000015_0001
In addition, peptides that may be useful for targeting tumors in vivo include, but are not limited to, the peptide sequences shown in Table 2, which have been described as potential targeting peptides for tumor cells Table 2
Figure imgf000015_0002
Figure imgf000016_0001
Table 2 (continued)
YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY
VFIDILDKVENAIHNAAQVGIGFAKPFEKLLNPK
GNNRPVYIPQPRPPHPRI
GNNRPVYIPQPRPPHPRL
GNNRPIYIPQPRPPHPRL
RFRPPIRRPPIRPPFYPPFRPPIRPPIFPPIRPPFRPPLRFP
RRIRPRPPRLPRPRPRPLPFPRPGPRPIPRPLPFPRPGPRPIPRPLPFFRPG PRPIPRP
PRPIPRPLPFFRPGPRPIPR
WNPFKELERAGQRVRDAVISAAPAVATVGQAALARG
WNPFKELERAGQRVRDAIISAGPAVATVGQAAAIA
WNPFKELERAGQRVRDAIISAAPAVATVGQAAAIARG
WNPFKELERAGQRVRDAVISAAPAVATVGQAAAIARGG GIGALSAKGALKGLAKGLAZHFAN
GIGASILSAGKSALKGLAKGLAEHFAN
GIGSAILSAGKSALKGLAKGLAEHFAN
IKITTMLAKLGKVLAHV
SKITDILAKLGKVLAIIV
RPDFCLEPPYTGPCKARII
RYFYNAKAGLCQTFVYG
GCRAKRTNNFKSAEDCMRTCGGA
FLPLLAGLAANFLPKIFCKITRKC
GIMDTLKNLAKTAGKGALQSLLNKASCKLSGQC
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL
GWILKKLGKRIERIGQHTRDATIQGLGIAQQAANVAATARG WNPFKELEKVGQRVRDAVISAGPAVATVAQATALAK
SWLSKTAKKLENSAKKRISEGIAIAIQGGPR
ZFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS
FLPLILRKIVTAL
LRDLVCYCRSRGCKGRERMNGTCRKGHLLYTLCCR
LRDLVCYCRTRGCKRRERMNGTCRKGHLMYTLCCR
WCACRRALCLPRERRAGFCRIRGRIHTPLCCRR WCACRRALCLPLERRAGFCRIRGRIHPLCCRR
RRCICTTRTCRFPYRRLGTCIFQNRVYTFCC
RRCICTTRTCRFPYRRLGTCLFQNRVYTFCC
ACYCRIPACIAGERRYGTCIYQGRLWAFCC
CYCRIPACIAGERRYGTCIYQGRLWAFCC
WCACRRALCLPRERRAGFCRIRGRIHPLCCRR
WCACRRALCLPLERRAGFCRIRGRIHPLCCRR
VTCYCRRTRCGFRERLSGACGYRGRIYRLCCR
VTCYCRSTRCGFRERLSGACGYRGRIYRLCCR
DFASCHTNGGICLPNRCPGHMIQIGICFRPRVKCCRSW
VRNHVTCRLNRGFCVPIRCPGRTRQIGTCFGPRIKCCRSW NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK
ATCDLLSGTGLNHSACAAHCLLRGNRGGYCNGKAVCVCRN
GFGCPLDQMQCHRHCQTITGRSGGYCSGPLKLTCTCYR
GFGCPLNQGACHRHCRSIRRRGGYCAGFFKQTCTCYRN
ALWKTMLKKLGTMALHAGKAALGAADTISQTQ
GKPRPYSPRPTSHPRPIRV
GIFSKLGRKKIKNLLISGLKNVGKENGMDVVRTGIDIAGCKIKGEC
ILPWKWPWWPWRR
FKCRRWQWRMKKLGAPSITCVRRAP
ITSISLCTPGCKTGALMGCΝMKTATCHCSIHVSK
TAGPAIRASVKQCQKTLKATRLFTVSCKGKΝGCK
MSKFDDFDLDWKVSKQDSKITPQWKSESLCTPGCVTGALQTCFLQ TLTCΝCKISK
KYYGΝGVHCTKSGCSVΝ
WGEAFSAGVHRLAΝGGΝGFW
GIGKFLHSAGKFGKAFVGEIMKS
GIGKFLHSAKKFGKAFVGEIMΝS
GMASKAGAIAGKIAKVALKAL
GVLSΝVIGYLKKLGTGALΝAVLKG
GWASKIGQTLGKIAKVGLKELIQPK
ΓΝLKALAALAKKIL
GIGAVLKVLTTGLPALISWIKRKRQQ
ATCDLLSGTGIΝHSACAAHCLLRGΝRGGYCΝGKGVCVCRΝ
ATCDLLSGTGΓΝHSACAAHCLLRGΝRGGYCΝRKGVCVRΝ
RRWCFRVCYRGFCYRKCR
RRWCFRVCYKGFCYRKCR
RGGRLCYCRRRFCVCVGR
RGGRLCYCRRRFCICV
RGGGLCYCRRRFCVCVGR
VTCDLLSFKGQVΝDSACAAΝCLSLGKAGGHCEKGVCICRKTSFKDL WDKYF
GWLKKIGKKIERVGQHTRDATIQGLGIAQQAAΝVAATAR
GWLKKIGKKIERVGQHTRDATIQVIGVAQQAAΝVAATAR
SDEKASPDKHHRFSLSRYAKLAΝRLAΝPKLLETFLSKWIGDRGΝRS
V
KWCFRVCYRGICYRRCR RWCFRVCYRGICYRKCR KSCCKDTLARNCYNTCRFAGGSRPVCAGACRCKIIGPKCPSDYPK GGKPDLRPCIIPPCHYIPRPKPR VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNA CYCKLPDHVRTKGPGRCH Incorporation of a targeting peptide or other targeting moiety into the outer shell may be accomplished by any of the methods known in the art of targeted drug delivery. Suitable methods include but are not limited to covalent attachment of a targeting moiety to one or more components of the outermost shell, either directly or via linkers and electrostatic binding of appropriately charged molecules. These and other methods are well known in the art; see for example A. Coombes et al., Biomaterials 18:1153-1161, 1997. Another aspect of the invention relates to the functionalization of the surface of the micelles with one or more imaging agents. An "imaging agent" is a moiety suitable for generating a detectable signal, e.g., using a technique such as positron emission tomography (PET), single photon emission tomography (SPECT), or magnetic resonance imaging (MRI), such as a radionuclides, unpaired spin atoms and free radicals (e.g., Fe, lanthanides, and Gd), and contrast agents (e.g., chelated (DTP A) manganese). A number of suitable imaging agents that can be employed in the micelles of the present invention are disclosed in U.S. Patent Application No. 2003-0049203, which is hereby incorporated herein by reference in its entirety. For example, SPECT can be used for molecular imaging studies to assess both drug distribution and physiological effects with high sensitivity of detection. Furthermore, the use of SPECT allows the simultaneous observation of multiple probes with different emission wavelengths. In certain embodiments, the radioactive moiety is selected from 225Ac, 227Ac, 241Am, 72As, 74As, 211At, 198Au, 7Be, 212Bi, 213Bi, 75Br, 77Br, nC, 14C, 48Ca, 109Cd, 139Ce, ,41Ce, 252Cf, 55Co, 57Co, 60Co, 51Cr, ,30Cs, ,31Cs, 137Cs, 61Cu, 62Cu, 165Dy, 152Eu, 155Eu, 18F, 55Fe, 59Fe, 64Ga, 67Ga, 68Ga, 153Gd, 68Ge, 3H, 1221, 1231, 124I, I251, 1311, 132I, mIn, U5mIn, 191mIr, 192Ir, 81mKr, 177Lu, 51Mn, 52Mn, 99Mo, 13N, 95Nb, 150, 19,Os, 194Os, 32P, 33P, 203Pb, 212Pb, 103Pd, 109Pd, 238Pu, 223Ra, 226Ra, 82Rb, 186Re, ,88Re, 105Rlι, 97Ru, ,03Ru, 35S, 72Se, 75Se, 28Si, 145Sm, 153Sm, 117mSn, 85Sr, 89Sr, 90Sr, 178Ta, 179Ta, 182Ta, 149Tb, 96Tc, 99mTc, 228Th, 229Th, 201T1, 170Tm, 171Tm, 188W, 127Xe, 88Y, 90Y, 91Y, 169Yb, 62Zn, 65Zn, 95Zr, and 99mTc-labeled Annexin V28. Additionally, 99mTc-labeled Annexin V28 is an available apoptosis probe available when using SPECT, wherein Annexin V is a human protein known to bind phosphatidylserine on the exterior of apoptotic cells. In certain embodiments, the imaging moiety may be incorporated onto the surface of the micellar structure by fabricating a micelle with a chelating group on the surface that is capable of chelating an imaging moiety. This can be accomplished by, for example, synthesizing block copolymers of PEG and PCL, some of which contain a terminal methyl group (MPEG-PCL), and others in which the PEG chain is covalently linked to the chelating group. In certain embodiments, the chelating group is selected from 1,4,7,10- tetraazacyclododecane-l,4,7,10-tetraacetic acid (DOTA), diethylenetriaminepentaacetic acid bis (methylamide) (DTPA-BMA), N, N'-bis(2- pyridylmethyl)diethylenetriamine-N,N',N"-triacetic acid (DTPA-BP), and trans- 1 ,2-diaminocyclohexane-N,N',N",N' ' '-tetraacetic acid (CDTA). In preferred embodiments, the chelating group is DOTA. Examples of radioactive imaging moieties include, but are not limited to, 225Ac, 227Ac, 241Am, 72As, 74As, 211At, ,98Au, 7Be, 2I2Bi, 213Bi, 75Br, 77Br, nC, 14C, 48Ca, 109Cd, 139Ce, 141Ce, 252Cf, 55Co, 57Co, 60Co, 51Cr, 130Cs, 13ICs, 137Cs, 61Cu, 62Cu, 165Dy, 152Eu, 155Eu, 18F, 55Fe, 59Fe, 64Ga, 67Ga, 68Ga, 153Gd, 68Ge, 3H, 1221, 1231, 124I, 1251, 131I, I32I, ι nIn, 115mIn, 191mIr, 192Ir, 81mKr, 177Lu, 51Mn, 52Mn, 99Mo, 13N, 95Nb, 150, 191Os, 194Os, 32P, 33P, 203Pb, 2,2Pb, I03Pd, 109Pd, 238Pu, 223Ra, 226Ra, 82Rb, 186Re, 188Re, 105Rh, 97Ru, 103Ru, 35S, 72Se, 75Se, 28Si, 145Sm, 153Sm, 117mSn, 85Sr, 89Sr, 90Sr, 178Ta, 179Ta, 182Ta, 149Tb, 96Tc, 99mTc, 228Th, 229Th, 201T1, 170Tm, 171Tm, 188W, ,27Xe, 88Y, 90Y, 91Y, 169Yb, 62Zn, 65Zn, 95Zr, and 99mTc-labeled Annexin V28. In preferred embodiments, the radioactive moiety is capable of being chelated by a chelating agent and is selected from 225Ac, 227Ac, 241Am, 198Au, 7Be, 212Bi, 213Bi, 48Ca, 109Cd, 139Ce, 141Ce, 252Cf, 55Co, 57Co, 60Co, 51Cr, 130Cs, ,31Cs, 137Cs, 61Cu, 62Cu, ,65Dy, 152Eu, 155Eu, 18F, 55Fe, 59Fe, 6 Ga, 67Ga, 68Ga, 153Gd, 68Ge, ιπIn, U5mIn, 191mIr, 192Ir,
177Lu, 51Mn, 5 Mn, 99Mo, 95Nb, 194Os, 203Pb, 212Pb, 103Pd, 109Pd, 238Pu, 223Ra, 226Ra,
82- Rb, I 18860τRe, 188Re, 1 ι0υ5DτRh, 9 y7/ τRu, 1 ι0υ3JτRu, 145Sm, ,53Sm, 117mSn, 85Sr, 89Sr, 90Sr, 178Ta, 179Ta, 182Ta, 149Tb, 96Tc, 99mTc, 228Th, 229Th, 20,T1, 170Tm, 17,Tm, 188W, 88Y, 90Y, 91Y, 169Yb, 62Zn, 65Zn, 99mTc-labeled Aimexin V28, and 95Zr. In certain embodiments, the radioactive moiety is In, 99mTc-labeled Annexin V28, or 99mTc. In certain such embodiments, the radioactive moiety is In. Yet another aspect of the invention relates to micelles containing within the hydrophobic core, a magnetic resonance imaging (MRI) contrast imaging agent either alone or in combination with another hydrophobic agent and/or functionalization of the corona of the micelle. Examples of such contrast agents, include, but are not limited to, gadopentetate dimeglumine, gadoteridol, gadoterate meglumine, mangafodipir trisodium, gadodiamide, gadoversetamide, and superparamagnetic iron oxide. Superparamagnetic iron oxide (SPIO) nanoparticles are a class of MRI contrast agents that provide extremely strong enhancement of proton relaxation. In contrast to low molecular weight "TI" paramagnetic metal chelates such as Gd-DTPA, SPIO nanoparticles are classified as T2 negative contrast agents, with MR sensitivity approximately 1000 times higher than TI agents. SPIO agents are composed of iron oxide nanocrystals which create a large, dipolar magnetic field gradient that creates a relaxation effect on nearby water molecules. According to their sizes and applications, SPIO nanoparticles have been classified into four different categories: large, standard, ultrasmall, and monocrystalline agents. Large SPIO agents are mainly used for gastrointestinal lumen imaging, while standard SPIO agents are used for liver and spleen imaging. When the SPIO nanoparticles are in the range of 20-40 nm (ultrasmall category), they can be injected to visualize lymph node metastases. The smallest monocrystalline SPIO agents are used for tumor-specific imaging when attached to monoclonal antibodies, growth factors, and antigens. In preferred embodiments, the MRI contrast imaging agent is superparamagnetic iron oxide (SPIO). Figure 8A shows a transmission electron micrograph of a typical micelle containing numerous individual SPIO particles, wherein the white circle denotes the approximate boundary of the micelle core. Another aspect of the invention relates to method for the treatment of cancer, comprising administering micelles of the present invention, wherein the micellar structure comprises an encapsulated chemotherapeutic agent. In certain such embodiments, the coronas of the micelles are functionalized with peptides that are capable of targeting tumor cells. Additionally, or alternatively, the corona of the micelle is functionalized with a peptide that is capable of targeting a specific tissue in the body, preferably a peptide selected from either Table 1 or 2. In certain embodiments, the coronas of the micelles are functionalized with chelating agents that are capable of chelating a radioactive moiety. In preferred such embodiments, the micelles further comprise a radioactive moiety that is capable of being chelated by the chelating agent. A further aspect of the invention relates to a method for monitoring the delivery of a hydrophobic agent, comprising administering micelles, wherein the micellar structure comprises an encapsulated hydrophobic agent, and the hydrophobic agent is an MRI contrast agent. In preferred embodiments, the micellar structure further comprises a functionalized corona and/or an additional hydrophobic agent. In more preferred embodiments, the additional hydrophobic agent is a chemotherapeutic agent. Another aspect of the invention is a pharmaceutical composition, comprising micelles as described herein and a pharmaceutically acceptable carrier. The phrase "pharmaceutically acceptable" is employed herein to refer to those ligands, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio. The phrase "pharmaceutically acceptable carrier" as used herein means a pharmaceutically acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material, involved in carrying or transporting the subject chemical from one organ or portion of the body, to another organ or portion of the body. Each carrier must be "acceptable" in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient. Some examples of materials which can serve as pharmaceutically acceptable carriers include: (1) sugars, such as lactose, glucose, and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose, and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil, and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol, and polyethylene glycol; (12) esters, such as ethyl oleate and ethyl laurate; (13) agar; (14) buffering agents, such as magnesium hydroxide and aluminum hydroxide; (15) alginic acid; (16) pyrogen-free water; (17) isotonic saline; (18) Ringer's solution; (19) ethyl alcohol; (20) phosphate buffer solutions; and (21) other non-toxic compatible substances employed in pharmaceutical formulations. In certain embodiments, pharmaceutical compositions of the present invention are non-pyrogenic, i.e., do not induce significant temperature elevations when administered to a patient. As used herein, the term "treating" or "treatment" includes reversing, reducing, or arresting the symptoms, clinical signs, and underlying pathology of a condition in manner to improve or stabilize a subject's condition. The present invention may be further appreciated upon consideration of the following illustrative and non-limiting examples.
Examples
Synthesis of diblock copolymers of PCL and MPEG Detailed synthetic method for this class of block copolymers was described in a recent publication (X. Shuai et al., Macromolecules (2003) 36 5751-5759. Briefly, the diblock copolymers (MPEG-b-PCL), with yields >95%, were synthesized by ring-opening polymerization of ε-caprolactone at 115 °C using MPEG as a macro-initiator and Sn(Oct)2 as a catalyst. The degree of polymerization of the PCL block was calculated by comparing integrals of characteristic peaks of the PCL block at -2.25 ppm and PEG block at 3.35ppm in the JH NMR spectrum.
Characterization of copolymers Fourier transform infrared (FTIR) spectral studies were carried out with a BIO-RAD FTS-575C FTIR spectrometer in the range between 4000 and 750 cm"1, with a resolution of 2 cm"1. Powdery samples were compressed into KBr pellets for the FTIR measurements. !H NMR spectra were recorded on a Varian 600-MHz NMR spectrometer in deuterated water (D2O) or chloroform (CDC13) at room temperature. Gel permeation chromatography (GPC) was employed to determine the molecular weight and the molecular weight distribution. GPC analysis was carried out using a PLgel 5μm Mixed-D 300x7.5mm column (Polymer Laboratories) with THF as an eluent (1 mL/min) and polystyrene standards for column calibration. 20 μL samples were injected. The eluent was analyzed with a Perkin-Elmer Series 200 differential refractive index (RI) detector.
Preparation of DOX-loaded micelles Polymeric micelles containing DOX were prepared as following: MPEG-b-
PCL copolymer (10 mg) and doxorubicin (2 mg) were dissolved in THF (2 mL) in a glass vial. Afterwards, the solution was added dropwise to pure water (20 mL) under vigorous ultrasonic agitation using a Type 60 Sonic Dismembrator (Fisher Scientific) at a power level of 10. The beaker was then open to air overnight, allowing slow evaporation of THF and formation of micelles. The residual THF was completely removed by vacuum distillation with a rotary evaporator. The micelle solution concentrated to 5 mL was filtered with a syringe filter (pore size: 0.45 μm) to eliminate the polymer and DOX aggregates, and then filtered through a MILLIPORE Centrifugal Filter Device (Mw cut-off: 100,000 Da) to remove free DOX dissolved in the micelle solution. The micelles thus obtained were characterized with photon correlation spectroscopy. Measurements were performed at 25 °C on a 90 Plus Particle Size Analyzer from Brookhaven Instruments Corporation. Scattered light was detected at 90° angle and collected on an autocorrelator. For each sample, data obtained from five measurements were averaged to yield the size and size distribution.
Determination of DOX-loading content (DLC) The DOX-loading content (DLC) was defined as the weight percentage of DOX in the micelle. DLC was quantified by determining the absorbance at 485 nm using a Perkin-Elmer Lambda 20 UV-Vis spectrophotometer. First, the micelle solutions were frozen and lyophilized to yield the solid micelle samples. Then the dried samples were redissolved in a mixture of chloroform and DMSO (1:1, v/v) for the UV-Vis measurement. DOX solutions of various concentrations were prepared, and the absorbance at 485 mn was measured to generate a calibration curve for the DLC calculations from various micelles. In vitro release of DOX from polymer micelles Freeze-dried micelle samples (15 mg each) were re-suspended in PBS or acetate buffered solutions and transferred into dialysis tubing (Mw cut-off: 50,000 Da, supplied by Spectrum Laboratories Inc., USA). The tubing was placed into 50 mL PBS or acetate buffered solutions. Release study was performed at 37 °C in a New Brunswick Scientific C24 Incubator Shaker. At selected time intervals, buffered solution outside the dialysis bag was removed for UV-Vis analysis and replaced with fresh buffer solution. DOX concentration was calculated based on the absorbance intensity at 485 nm.
Hemolysis study Blood was freshly obtained from a male beagle dog and collected in heparin- coated tubes. Blood was washed three times with PBS and collected by centrifugation at 2,800 rpm for 5 min. Micelle solutions were prepared at different concentrations in the PBS buffer, and 100 μL of the erythrocyte suspension were added to 900 μl of micelle solutions. The samples were incubated for 60 min at 37 °C in a New Brunswick Scientific C24 Incubator Shaker. The release of hemoglobin was measured by UV-Vis analysis of the supernatant at 540 nm after centrifugation at 12,000 g for 60 min. The complete hemolysis was achieved by incubating the same amount of erythrocytes with 0.2% Triton X-100, and all hemolysis data points are presented as the percentage of the complete hemolysis. Confocal laser scanning microscopy (CLSM) Free DOX and DOX-containing micelles were incubated in MCF-7 cell culture for 2 and 24 hours before confocal laser scanning microscopy (CLSM) examination. To identify the micelle location, cell nuclei were stained with Hoechst 33342 (Molecular Probes, Inc.) and culture media were replaced with PBS during microscopy. Samples were examined by CLSM using a Zeiss LSM 510 (Zurich, Switzerland) with a confocal plane of 300 nm. Hoechst 33342 and DOX were excited at 352 and 485 nm with emissions at 455 and 595 nm, respectively.
In vitro cytotoxicitv study against MCF-7 breast tumor cells Human MCF-7 breast cancer cells were seeded onto 48-well plates with a seeding density of 7,000 cells/well. Cells were maintained in Roswell Park Memorial Institute (RPMI-1640, Sigma) media supplemented with 5% heat- inactivated fetal bovine serum, 2 mM L-glutamine, 5,000 units/ml penicillin, 5 mg/ml streptomycin, 0.1 mg/ml gentamicin sulfate and Amphotericin-B, 25 mM KC1, 25 mM D-glucose, and incubated at 37 °C in a humidified atmosphere with 5% CO2. Cells were incubated for one day, and then micelle or free DOX solutions were added. After one or five days, cells were harvested and DNA levels were analyzed through a DNA assay with a Perkin-Elmer HTS 7000 Bioassay Reader. The cytotoxicity of DOX and DOX-containing micelles in aqueous solution was analyzed and compared. Synthesis of maleimide-terminated block copolymer (MAL-PEG-PCL) In contrast to the reported f-caprolactone polymerization procedure with stannous (II) octoate as a catalyst (X. Shuai, T. Merdan, A. K. Schaper, F. Xi, T. Kissel, Bioconjug. Chem. (2004) 15 441-448), synthesis of MAL-PEG-PCL, as shown in Figure 1, must be conducted at a lower temperature due to the thermal susceptibility of the maleimide end groups. Reaction at 68 °C led to desired molecular weights of PCL segments (e.g., 2.4 kD), while greatly reducing the thermal decomposition of maleimide to a negligible level. DOX-loaded, MAL- PEG-PCL micelles were prepared by a solvent-evaporation method. Different amounts of methoxy-terminated MPEG-PCL copolymer were also introduced to control maleimide density at the micelle surface, which subsequently controls the cRGD density (5, 16, and 76% of all PEG chains). Figure 2a shows the 1H NMR spectrum of MAL-PEG-PCL copolymer in CDC13. Resonances of the PEG methylene protons (mainly at 3.64 ppm) and PCL protons (1.38, 1.65, 2.31 and 4.06 ppm) were observed. A small triplet shown at 4.2 ppm was attributed to proton resonance of the methyleneoxyl group linking PCL and PEG blocks. The integration intensity of maleimide vinyl protons at 6.74 ppm confirms that the maleimide group in MAL-PEG-PCL copolymers remained intact as in the MAL-PEG-OH. These data strongly demonstrated that the desired block copolymers were successfully synthesized. The number-averaged molecular weight of PCL blocks was calculated to be 2.4 kD using the integral intensity of PCL proton at 2.31 ppm versus that of the PEG proton at 3.64 ppm. To ensure the localization of cRGD on the surface of micelles, we used a post-micellar modification strategy to prepare cRGD-functionalized micelles as shown in Figure 1. The NMR spectrum of the freeze-dried micelles in D2O strongly suggests the core-shell structure of DOX- loaded micelles as shown in Figure 2b. The micelle corona shells consisting of PEG blocks were well solvated in D2O and showed clear H NMR signals. In contrast, DOX was loaded inside the solid PCL cores of micelles, and thus resonance peaks of both PCL blocks and DOX molecules were significantly reduced due to their insufficient chain mobility in D2O. Moreover, successful conjugation of cRGDfK onto the well-solvated PEG corona shells was verified by the resonance peaks of phenyl protons of cRGDfK at 7.4 ppm and complete disappearance of maleimide peak at 6.74 ppm (Fig. IB).
Synthesis of cRGD using solid phase peptide synthesis chemistry The synthetic scheme for cRGD as shown in Figure 3 is revised based on a reported procedure by Schatzlein et al. Bioorg. Med. Chem. Lett. (2002) 12 547- 549. NovaSyn TGT alcohol resin (1.25 mmol) (Novabiochem, CA) was converted to its active chloride form with acetyl chloride (1 ml/g resin) (62.5 mmol) in toluene for 3 h at 60 °C. The resin was then washed with dry toluene and dichloromethane (DCM). The synthesis of linear peptide started with the attachment of aspartic acid, by mixing the chlorinated resin with a solution of Fmoc-Asp-OAU (2.5 eq.) and N, N-diisopropylethylamine (DIPEA) (10 eq.) in dry DCM at rt for 1.5-2.5 h. The solution of DCM, methanol and DIPEA was added to cap the unreacted sites of resin. After 30 min the resin was washed with dimethylformamide (DMF). The Fmoc protecting group was removed with a solution of piperidine-DMF (1:4) at rt for 4 min, 2 times. The rest of amino acids were added consecutively (Fmoc-Gly- OH, Fmoc-Arg(Pbf)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Lys(Dde)-OH and Fmoc-D- Phe-OH) using standard Fmoc strategy. The amino acid (2 eq.) was added first followed by N,N,N',N'-tetramethyl-0-(7-azabenzotriazol-l-yl)uronium hexafluorophosphate (HATU) (2 eq.) and DIPEA (4 eq.) and allowed to react for 1.5 h at rt. The C-terminal allyl ester group of the aspartic acid was removed after addition of the last amino acid with palladium tetrakis(triphenylphosphine) (Pd(PPh )4) (3 eq.) in a solution of chloroform, acetic acid and N-methylmorpholine for 2 h at rt. The mixture was washed with DIPEA in DMF followed by 0.5%w/w diethyldithiocarbamic acid sodium salt in DMF. The head-to-tail cyclization was preformed by removal of the N-terminal Fmoc group before addition of HATU (2 eq.) and DIPEA (4 eq.) in DMF at rt for 16 h. The protecting group of the amino side-chain of lysine (4, 4-dimethyl-2,6-dioxocyclohex-l-ylidene)ethyl, (Dde)) was removed by hydrazine monohydrate-DMF (2:98) for 3 min at rt, 3 time. The thiol addition was preformed by swelling resin with DIPEA (15 eq.) in DMF, followed by addition of S-acetylthioglycolic acid N-hydroxysuccinimide ester (SATA) solution (2 eq.) in DMF (15 mg/mL) for 2 h at rt. The resin was then washed with DMF followed by DCM. Next, the protecting group of arginine (pentamethyl- dihydrobenzofuran-5-sulfonyl, (Pfb)) was removed using TFA-DCM (1 : 1) for 2 h before washing with trifiuoroacetic acid-DCM (1 :9). The solutions were concentrated and precipitated with cold ether several times. The precipitate was then redissolved in aqueous buffer, purified using reverse phase HPLC and lyophilized to give cRGD peptide (90 mg, 10% yield based on initial loading of resin).
Preparation of cRGD-DOX-Micelles. 20 mg of MAL-PEG-PCL and 2 mg of doxorubicin were dissolved in 0.5 mL THF in a glass vial. Next, the mixture was slowly added into 10 mL of an aqueous solution of 0.05 M HEPES and 0.01 M EDTA under sonication (60 Sonic Dismembrator, Fisher Scientific). The mixture was vigorously stirred under argon for 3 h to remove THF. Then different amounts of c(RGDf(£-S-acetylthioacetyl)K and 0.05 M hydroxyamine in HEPES/EDTA aqueous solution were added into solutions of micelles with 5, 16, and 76% maleimide density. The conjugation was allowed to occur for 4 h followed by filtration through a Millipore centrifugal filter (pore size 0.45 μm) to remove DOX aggregates in micelle solution. Then the cRGD-micelles were dialyzed with Spectra/Por dialysis membrane (molecular weight cutoff = 50,000 Da) until free cRGD was completely removed. Micelles were then characterized by dynamic light scattering and atomic force microscopy. Micelle solutions were then lyophilized to obtain the powdery form. !H NMR was used to confirm the formation of core-shell structure and conjugation of cRGD to micelles. The strong resonance of methylene proton in PEG was detected where as all of caprolactone proton resonance were hardly observed demonstrating the core- shell structure of these micelles. The successful conjugation of cRGD onto the surface of micelles was verified by the appearance of phenyl protons of cRGD at 7.4 ppm.
Atomic force microscopy (AFM) Two group of micelles were used for AFM study. The first group was DOX- micelles without cRGD ligand and the second group was DOX-micelles with 76% cRGD density. The micelle suspension (2 μL) was placed on the mica surface, and allowed to dry at room temperature overnight before imaging with an atomic force microscope (Multimode, Digital Instruments, Santa Barbara, CA) operated in tapping mode using a silicon cantilever (Pointprobe, Nanoworld, Switzerland). The constant force mode was used with a scan frequency of 2 Hz. Both non- functionalized and 76% cRGD containing micelles show discrete and round-shaped nanoparticles. These results were shown in Figures 4a and 4c. Micelles with 76% cRGD attachment (43.2 ± 3.9 nm, n=29) showed a mean size slightly larger than that of RGD-free micelles (37.5 + 2.6 nm, n=29).
Dynamic light scattering (DLS DLS was performed on a 90 Plus Particle Size Analyzer (Brookhaven Instruments Corporation). Scattered light was detected at 90° at room temperature and collected on an autocorrelator. The data for each sample was obtained in five measurements and the average number was used. The same two groups of micelles as in AFM studies were used for DLS characterization. The sizes of these micelles are 20.9 ± 1.7 and 24.4 + 2.7 nm for cRGD-free and 76% cRGD micelles, respectively. The results were shown in Figure 4b and 4d.
Flow cytometry analysis SLK cells were seeded at 125,000 cells /well in 6-well plates in 2 mL
DMEM with 10% FBS. After 24 h, 1 mg of micelles (from 3.3 mg/ml micelle suspension) for each micelle formulation with different cRGD density (0, 5, 16, 76% cRGD) was added into each well and incubated at 37 °C for 2 h. Then, cells were washed, trypsinized and neutralized. After centrifugation at 1200 rpm for 5 min, cells were re-suspended in 1 mL PBS, followed by filtration and analysis using flow cytometry. Cell uptake was found to increase up to 30-fold with 76% cRGD-DOX- micelles compared to those not attached with cRGD (0% cRGD). In the control experiment, SLK cells were first incubated with a free blocking peptide, Ala-Ala- Arg-Gly-Asp-Tyr (AARGDY), and then co-incubated with 76% cRGD- functionalized micelles. Almost 100%o inhibition by AARGDY at 9 mM concentration was observed as demonstrated by the flow cytometry histograms as shown in Figure 6.
Confocal laser scanning microscopy (CLSM) DOX-micelles with 0 and 16% cRGD density (0.5 mg/well) were incubated with SLK cells (6000 cells/well) culture wells for 2 hrs. Before the CLSM examination, cell nuclei were stained with Hoechst 33342 (Molecular Probes, Inc.). Cells were examined by a Zeiss LSM 510 microscope (Zurich, Switzerland, laser: Ar 351-364 nm, Ar 458-488 nm) with a confocal plane of 300 nm. Doxorubicin and Hoechst 33342 were excited at 485 and 352 nm, respectively. The emission wavelength of doxorubicin and Hoechst 33342 are 595 and 455 nm, respectively. A significantly increased amount of micelle uptake was observed in micelles with 16% cRGD surface density as shown in Figure 5c compared to those without cRGD as shown in Figure 5b. This result is consistent with those from flow cytometry studies as shown in Figure 5 a.
Synthesis of DOTA-PEG-PCL The MPEG-PCL and amino group terminated PEG-PCL polymer (H2N-
PEG-PCL) are synthesized following reported procedures (Shuai, X.T. et al., Macromolecules, 2003. 36 5751-5759; Deng, M.X. et al., Biomaterials, (2004) 25 3553-3558). Briefly, synthesis of H2N-PEG-PCL is accomplished by the metalation of acetonitrile with potassium naphthalide to initiate living anionic ring-opening- polymerization with ethylene oxide first and ε-caprolactone (ε-CL) second.
Hydrogenation of the CN-PEG-PCL copolymer using Pd/C as catalyst provides a diblock copolymer with a functionalizable amino group (H2N-PEG-PCL). To synthesize the DOTA containing PEG-PCL polymer (DOTA-PEG-PCL), DOTA- NHS ester (Macrocyclics, Inc., Dallas, TX) is added to a H2N-PEG-PCL solution in organic solvent. The subsequent copolymer is purified by precipitation in diethyl ether and hexane. Both polymers can be manufactured with various PEG and PCL chain lengths, which can be used to modify both the micelle size and doxorubicin loading within the micelles. Potassium V7 naphthalene O ε_CL |_j+ / \ /O \ H3C-CN * KCH2CN *- NCHaCCCHaCHzOfcK— * *- NC-^^OT^"(CH2)5° PH THF 18-crown-6 n m THF H2, Pd/C water, LiOH I Raney-Nic el DDOOTTAA--NNHHSS eesstteerr
Figure imgf000030_0001
Figure imgf000030_0002
DOTA-PEG-b-PCL Scheme 1 After syntheses of both block copolymers, polymer micelles that incorporate different amounts of chelating agent are fabricated. The amount of chelating agent can be controlled by varying the weight ratio of DOTA-PEG-PCL to MPEG-PCL used. Micelles with 1, 3, and 5% (w/w) DOTA-PEG-PCL are fabricated using a phase inversion technique. A schematic illustrating this process is shown in Figure 7. Micelle size is characterized through the use of dynamic light scattering and TEM, while drug content and release from the micelles is measured by UV-Vis spectroscopy.
Incorporation of radioactive moieties Immediately prior to each imaging experiment, ιnIn is added to each micelle foπnulation to allow binding of the metal ion to the DOTA chelating group. Excess free ι nIn ions are removed through a gel filtration process before imaging, and each micelle sample is serially diluted to generate vials containing a logarithmic range of known concentrations. Multiple vials containing concentrations of each of the three formulations are then imaged via both SPECT and computed tomography (CT), and the resulting imaging activity of each vial is plotted against micelle concentration for that formulation. In this manner, the lower detection limit as well as a calibration value which can be used to convert SPECT activity to micelle concentration is determined for each of the three formulations. Following in vitro calibration, each of the three micelle formulations are injected into the tail vein of two mice with breast tumors. An additional two sets of mice, one with drug-containing, unlabeled micelles and another with drug-free labeled micelles, are injected and imaged as controls. Additionally, a separate SPECT imaging probe, 99mTc-labeled Annexin V can be introduced to simultaneously measure cell apoptosis. One unique property of SPECT imaging is its ability to discern activity from multiple probes that emit gamma photons of different energy, in this case 245 keV for mIn and 140 keV for 99mTc. Prior to use in animals, an in vitro calibration similar to that described above is performed. In this study, vials containing known concentrations of both mIn- labeled micelles and 9mTc-labeled Annexin V are prepared and used to generate limit of detection values for the simultaneous detection of both labels. Animal groups will be the same as those used for n In imaging with the addition of a group to receive systemic free doxorubicin to ensure that the tumors in this model are susceptible to doxorubicin treatment. The 99mTc-labeled Annexin V is administered via the tail vein prior to each imaging session, and SPECT imaging is used to generate both micelle concentration and apoptosis density measurements. The results from this section are confirmed via histological measurements taken after the animals are sacrificed. Tumor volume is measured by gross tissue measurement, doxorubicin concentration in tissue is obtained by fluorescence microscopy, apoptosis is validated using TUNEL stained sections, and micelle concentrations are confirmed by scintillation counting of extracted tissues.
In vivo efficacy data to optimize the design of drug-loaded micelles Different micelle formulations are compared based on their treatment efficacy as measured by total micelle accumulation, apoptotic response, and tumor volume change, all of which are measured non-invasively. Five different micelle formulations are used to investigate the effects of two different micelle properties: size and PEG chain length. These two parameters affect the blood circulations times as well as the extravasation efficiency across the tumor endothelium. Micelle size will be investigated using three micelle formulations with the same PEG length (MW 5kD) and different PCL lengths (2, 5, and 10 kD). Alternatively, PEG chain length effects are elucidated by using micelle formulations with a fixed PCL length (5 kD) and varying PEG size (2, 5, and 10 kD), for a total of five experimental groups. Control mice are injected with labeled micelles containing no doxorubicin. Each group contains approximately 6 subjects. Once optimized, the micelles are compared directly with systemically administered, dose-matched doxorubicin on the same measures. Additionally, the data from micelle comparison is used to develop a model to correlate treatment efficacy with micelle accumulation and apoptosis as measured by SPECT. Relationships between micelle accumulation, tumor apoptosis, and tumor volume change over the one week period of monitoring are investigated in order to create a method of predicting the tumor volume change of the tumors based on early (<24 hours) measurements of micelle accumulation and tumor apoptosis.
Micelles containing SPIO particles In Figure 8a, hydrophobic SPIO particles of approximately 4 nm in diameter were incorporated into the hydrophobic micellar core. In vitro imaging of particle solutions was performed on a Siemens Sonata 1.5T clinical MRI scanner using a fast low angle shoot (FLASH) pulse sequence, and the T2 contrast effect of the micelles was quantified. Particle T2 relaxivity values ranged from 76 - 102 (mM Fe*s)_1, suggesting that the particles had largely retained their contrast despite micellar incorporation. For in vivo studies, micelle solutions were injected into the tail vein of breast tumor bearing mice (the bi-transgenic mice bearing both the MMTV-c-neu and LHCTP transgenes proposed for use in this study) at and imaged with T2- weighted sequences at 1 hour and 72 hours after micelle injection. By 72 hours, the peripheral region of the tumor had darkened noticeably, indicating accumulation of SPIO-containing micelles in the region as shown in Figures 8b and 8c. MRI has some intrinsic difficulties, however, such as relatively low sensitivity compared to nuclear medicine and problems distinguishing contrast effects from the anatomical background, that promote the development of other imaging modalities for quantitative micelle tracking.
Equivalence Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, numerous equivalents to the compounds and methods of use thereof described herein. Such equivalents are considered to be within the scope of this invention and are covered by the following claims. All of the above-cited references and publications are hereby incorporated by reference.

Claims

Claims:
1. A micellar structure comprising an amphiphilic block copolymer, a hydrophobic agent encapsulated within the micellar structure, and a functionalized corona.
2. A micellar structure of claim 1, wherein the amphiphilic block copolymer is selected from PBLG-PEO, PEO-PPO-PEO, PEG-b-PBLA, and PCL-PEG.
3. A micellar structure of claim 2, wherein the amphiphilic copolymer is PCL- PEG.
4. A micellar structure of any one of claims 1 to 3, wherein the hydrophobic agent is a chemotherapeutic agent.
5. A micellar structure of claim 4, wherein the chemotherapeutic agent is selected from aminoglutethimide, amsacrine, anastrozole, asparaginase, beg, bicalutamide, bleomycin, buserelin, busulfan, campothecin, capecitabine, carboplatin, carmustine, chlorambucil, cisplatin, cladribine, clodronate, colchicine, cyclophosphamide, cyproterone, cytarabine, dacarbazine, dactinomycin, daunorubicin, dienestrol, diethylstilbestrol, docetaxel, doxorubicin, epirubicin, estradiol, estramustine, etoposide, exemestane, filgrastim, fludarabine, fludrocortisone, fluorouracil, fluoxymesterone, flutamide, gemcitabine, genistein, goserelin, hydroxyurea, idarubicin, ifosfamide, imatinib, interferon, irinotecan, ironotecan, letrozole, leucovorin, leuprolide, levamisole, lomustine, mechlorethamine, medroxyprogesterone, megestrol, melphalan, mercaptopurine, mesna, methotrexate, mitomycin, mitotane, mitoxantrone, nilutamide, nocodazole, octreotide, oxaliplatin, paclitaxel, pamidronate, pentostatin, plicamycin, porfimer, procarbazine, raltitrexed, rituximab, streptozocin, suramin, tamoxifen, temozolomide, teniposide, testosterone, thioguanine, thiotepa, titanocene dichloride, topotecan, trastuzumab, tretinoin, vinblastine, vincristine, vindesine, and vinorelbine.
6. A micellar structure of claim 5, wherein the chemotherapeutic agent is selected from paclitaxel and doxorubicin.
7. A micellar structure of any one of claims 1 to 6, wherein the functionalized corona comprises a targeting moiety.
8. A micellar structure of claim 7, wherein the targeting moiety is a peptide sequence.
9. A micellar structure of claim 8, wherein the peptide sequence is a vβ3 ligand.
10. A micellar structure of claim 9, wherein the αvβ3 ligand is cRGD.
11. A micellar structure of any one of claims 1 to 7, wherein the functionalized corona comprises an imaging agent.
12. A micellar structure of claim 11, wherein the imaging agent comprises a chelating agent.
13. A micellar structure of claim 12, wherein the chelating agent is selected from DOTA, DTPA-BMA, DTPA-BP, and CDTA.
14. A micellar structure of claim 12 or 13, further comprising a radioactive moiety that is chelated by the chelating agent.
15. A micellar structure of claim 14, wherein the radioactive moiety is selected from 225Ac, 227Ac, 24IAm, I98Au, 7Be, 212Bi, 213Bi, 48Ca, 109Cd, 139Ce, ,41Ce, 252Cf, 55Co, 57Co, 60Co, 51Cr, 130Cs, 131Cs, I37Cs, 61Cu, 62Cu, 165Dy, 152Eu, ,55Eu, 18F, 55Fe, 59Fe, 64Ga, 67Ga, 68Ga, 153Gd, 68Ge, π lIn, 115mIn, I91mIr, 192Ir, 177Lu, 5,Mn, 52Mn, 99Mo, 95Nb, I94Os, 203Pb, 212Pb, 103Pd, 109Pd, 238Pu, 223Ra, 226Ra, 82Rb, ,86Re, 188Re, 105Rh, 97Ru, 103Ru, 145Sm, 153Sm, 117mSn, 85Sr, 89Sr, 90Sr, 178Ta, 179Ta, 182Ta, 149Tb, 96Tc, 99mTc, 228Th, 229Th, 201T1, 170Tm, 171Tm, 188W, 88Y, 90Y, 91Y, 169Yb, 62Zn, 65Zn, 99mTc-labeled Annexin V28, and 95Zr.
16. A micellar structure of claim 15, wherein the radioactive moiety is selected from 99mTc-labeled Annexin V28, and n ιIn.
17. A micellar structure of claim 1, wherein the imaging agent comprises an MRI contrast agent.
18. A micellar structure of claim 17, wherein the MRI contrast agent is selected from gadopentetate dimeglumine, gadoteridol, gadoterate meglumine, mangafodipir trisodium, gadodiamide, gadoversetamide, and superparamagnetic iron oxide.
19. A micellar structure of claim 18 , wherein the MRI contrast agent is superparamagnetic iron oxide.
20. A micellar structure comprising an amphiphilic block copolymer and an imaging agent encapsulated within the micellar structure.
21. A micellar structure of claim 20, wherein the amphiphilic block copolymer is selected from PBLG-PEO, PEO-PPO-PEO, PEG-b-PBLA, and PCL-PEG.
22. A micellar structure of claim 20 or 21 , wherein the imaging agent is an MRI contrast agent.
23. A micellar structure of claim 22, wherein the MRI contrast agent is selected from gadopentetate dimeglumine, gadoteridol, gadoterate meglumine, mangafodipir trisodium, gadodiamide, gadoversetamide, and superparamagnetic iron oxide.
24. A micellar structure of claim 23, wherein the MRI contrast agent is superparamagnetic iron oxide.
25. A method for administering a hydrophobic agent to a patient, comprising administering to the patient micellar structures of any one of claims 1 to 19.
26. A method for monitoring the delivery of a hydrophobic agent to a patient, comprising administering micellar structures of any one of claims 11 to 19 and imaging the imaging agent in the patient.
27. A method for treating cancer, comprising administering to a patient micellar structures of claim 4, 5, or 6.
28. A pharmaceutical composition comprising micelles of any one of claims 1 to 24 and a pharmaceutically acceptable carrier.
29. A method for the preparation a micellar structure, comprising
(i) adding an amphiphilic block copolymer and an imaging agent to a. hydrophobic solvent;
(ii) adding the resulting mixture to water under conditions of vigorous agitation; and (iii) removing the hydrophobic solvent by slow evaporation, thereby preparing a micellar structure comprising an imaging agent encapsulated in the micellar structure.
30. A method for the preparation a micellar structure, comprising (i) adding an amphiphilic block copolymer to a hydrophobic solvent; (ii) adding the resulting mixture to water under conditions of vigorous agitation; (iii) removing the hydrophobic solvent by slow evaporation, thereby preparing a micellar structure having a corona; and (iv) coupling a targeting moiety and/or an imaging moiety to the corona of the micellar structure.
PCT/US2005/019308 2004-06-04 2005-06-02 Dual function polymer micelles Ceased WO2005120585A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US11/569,989 US8697031B2 (en) 2004-06-04 2005-06-02 Dual function polymer micelles

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US57714204P 2004-06-04 2004-06-04
US60/577,142 2004-06-04

Publications (1)

Publication Number Publication Date
WO2005120585A1 true WO2005120585A1 (en) 2005-12-22

Family

ID=35502839

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2005/019308 Ceased WO2005120585A1 (en) 2004-06-04 2005-06-02 Dual function polymer micelles

Country Status (2)

Country Link
US (1) US8697031B2 (en)
WO (1) WO2005120585A1 (en)

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010060131A1 (en) * 2008-11-03 2010-06-03 Commonwealth Scientific And Industrial Research Organisation Liquid crystal contrast agents
WO2012020337A1 (en) * 2010-08-09 2012-02-16 Commissariat A L'energie Atomique Et Aux Energies Alternatives Polymerized micelles for diagnosis
WO2012040513A1 (en) * 2010-09-22 2012-03-29 The Board Of Regents Of The University Of Texas System Compositions and methods for the delivery of beta lapachone
WO2013075394A1 (en) * 2011-11-22 2013-05-30 原创生医股份有限公司 Drug carrier with chelating composite micell and use thereof
US8524783B2 (en) 2009-04-30 2013-09-03 Intezyne Technologies, Incorporated Polymer micelles containing anthracylines for the treatment of cancer
US8524784B2 (en) 2009-04-30 2013-09-03 Intezyne Technologies, Incorporated Polymer micelles containing anthracylines for the treatment of cancer
CN105709231A (en) * 2014-12-04 2016-06-29 上海中医药大学附属普陀医院 Bufalin-loaded polypeptide-modified poly(oligo(ethylene glycol)methacrylate)-polycaprolactone (Ph PCL b P(OEGMA co RGD) bufalin) nanometer preparation
CN107007571A (en) * 2017-02-24 2017-08-04 福州市传染病医院 Coordinate self-assembly nanoparticle and the application altogether of the sensitive copper medicine of tumour subacidity
CN111012928A (en) * 2019-11-26 2020-04-17 安徽医科大学 A kind of multifunctional nanocluster and preparation method thereof

Families Citing this family (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7968115B2 (en) * 2004-03-05 2011-06-28 Board Of Regents, The University Of Texas System Liposomal curcumin for treatment of cancer
US8784881B2 (en) 2004-03-05 2014-07-22 Board Of Regents, The University Of Texas System Liposomal curcumin for treatment of diseases
EP1992360A4 (en) * 2006-02-01 2010-02-17 Univ Tokyo USE IN ASSOCIATION OF A TGF-BETA SIGNAL INHIBITOR AND ANTITUMMER AGENT
JP2010526091A (en) * 2007-04-30 2010-07-29 インテザイン テクノロジーズ, インコーポレイテッド Modification of biological target groups for the treatment of cancer
CA2695611C (en) * 2008-07-29 2011-02-01 Nanocarrier Co., Ltd. Active targeting polymer micelle encapsulating drug, and pharmaceutical composition
EP2161020A1 (en) 2008-09-09 2010-03-10 Koninklijke Philips Electronics N.V. Chelating amphiphilic polymers
PT2568980E (en) * 2010-05-12 2016-03-15 Merial Inc LEVAMISOLE INJECTABLE PARASITICID FORMULATIONS AND MACROCYCLIC LACTONES
US20120121518A1 (en) * 2010-11-16 2012-05-17 Zhihua Lu Multifunctional imaging and therapeutic nanoparticles
WO2013124867A1 (en) 2012-02-21 2013-08-29 Amrita Vishwa Vidyapeetham University Polymer - polymer or polymer - protein core - shell nano medicine loaded with multiple drug molecules
EP3777896A1 (en) * 2012-03-15 2021-02-17 Immix Corporation Micelle comprising an inhibitor of nf-kb
WO2014141289A1 (en) 2013-03-12 2014-09-18 Amrita Vishwa Vidyapeetham University Photo - chemo composition on the basis of microcapsules with a core -shell structure
KR102296946B1 (en) * 2014-11-28 2021-09-02 주식회사 엘지생활건강 Cosmetic compositions comprising liposome
US10226484B2 (en) * 2014-12-01 2019-03-12 Peter Y Novak Pharmaceutical composition for improving health, cure abnormalities and degenerative disease, achieve anti-aging effect of therapy and therapeutic effect on mammals and method thereof
EP3313374B1 (en) * 2015-06-29 2025-02-12 Technion Research & Development Foundation Limited Amphiphilic polymers encapsulating therapeutically active agents, process of preparing same and use thereof
KR101710702B1 (en) * 2015-09-02 2017-02-28 재단법인대구경북과학기술원 Amphiphilic copolymer, manufacturing method thereof, and functional composites including the same
KR102009972B1 (en) * 2015-11-25 2019-10-21 주식회사 엘지화학 the amphiphilic polymer
KR102184376B1 (en) * 2015-11-25 2020-11-30 주식회사 엘지화학 the micelle comprising amphiphilic polymer
KR102009969B1 (en) * 2015-11-25 2019-10-21 주식회사 엘지화학 Amphiphilic Polymer
JP6887713B2 (en) * 2016-06-16 2021-06-16 エルジー・ケム・リミテッド Amphiphilic polymer
WO2021026483A1 (en) * 2019-08-08 2021-02-11 Fluidigm Canada Inc. Additional mass tag polymers for mass cytometry
CN112481362B (en) * 2020-12-14 2021-11-19 南通大学 Detection method for RGDFK inhibition PDL1 and application of detection method in preparation of anti-PDL 1 medicine
KR20230173150A (en) 2021-04-20 2023-12-26 테라파워, 엘엘씨 Titania-based generator for generating AC-225
WO2023225462A1 (en) * 2022-05-15 2023-11-23 Nanoprobes, Inc. Endothelial damage and nanoparticle targeting: compositions, processes, uses

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20050025819A1 (en) * 1997-07-14 2005-02-03 Hayat Onyuksel Materials and methods for making improved micelle compositions

Family Cites Families (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2087125A1 (en) * 1992-01-23 1993-07-24 Mridula Nair Chemically fixed micelles
HUT77530A (en) * 1994-05-06 1998-05-28 Pfizer Inc. Controlled release dosage forms containing azithromycin
US20030008819A1 (en) 1995-09-08 2003-01-09 Schnitzer Jan E. Targeting endothelium for tissue-specific delivery of agents
US5622699A (en) 1995-09-11 1997-04-22 La Jolla Cancer Research Foundation Method of identifying molecules that home to a selected organ in vivo
US6068829A (en) 1995-09-11 2000-05-30 The Burnham Institute Method of identifying molecules that home to a selected organ in vivo
US6576239B1 (en) 1996-09-10 2003-06-10 The Burnham Institute Angiogenic homing molecules and conjugates derived therefrom
US6180084B1 (en) 1998-08-25 2001-01-30 The Burnham Institute NGR receptor and methods of identifying tumor homing molecules that home to angiogenic vasculature using same
US6174687B1 (en) 1999-02-26 2001-01-16 The Burnham Institute Methods of identifying lung homing molecules using membrane dipeptidase
US6232287B1 (en) 1998-03-13 2001-05-15 The Burnham Institute Molecules that home to various selected organs or tissues
US6303573B1 (en) 1999-06-07 2001-10-16 The Burnham Institute Heart homing peptides and methods of using same
US20020041898A1 (en) 2000-01-05 2002-04-11 Unger Evan C. Novel targeted delivery systems for bioactive agents
US20010046498A1 (en) 2000-01-21 2001-11-29 Ruoslahti Erkki I. Chimeric prostate-homing peptides with pro-apoptotic activity
US20030077826A1 (en) 2001-02-02 2003-04-24 Lena Edelman Chimeric molecules containing a module able to target specific cells and a module regulating the apoptogenic function of the permeability transition pore complex (PTPC)
US20030049203A1 (en) 2001-08-31 2003-03-13 Elmaleh David R. Targeted nucleic acid constructs and uses related thereto
WO2003020751A2 (en) 2001-09-05 2003-03-13 King's College London Homing peptides
US7204997B2 (en) * 2002-01-29 2007-04-17 Supratek Pharma Inc. Responsive microgel and methods related thereto

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20050025819A1 (en) * 1997-07-14 2005-02-03 Hayat Onyuksel Materials and methods for making improved micelle compositions

Cited By (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010060131A1 (en) * 2008-11-03 2010-06-03 Commonwealth Scientific And Industrial Research Organisation Liquid crystal contrast agents
US8629186B2 (en) 2009-04-30 2014-01-14 Intezyne Technologies, Inc. Polymer micelles containing anthracyclines for the treatment of cancer
US8524783B2 (en) 2009-04-30 2013-09-03 Intezyne Technologies, Incorporated Polymer micelles containing anthracylines for the treatment of cancer
US8524784B2 (en) 2009-04-30 2013-09-03 Intezyne Technologies, Incorporated Polymer micelles containing anthracylines for the treatment of cancer
WO2012020337A1 (en) * 2010-08-09 2012-02-16 Commissariat A L'energie Atomique Et Aux Energies Alternatives Polymerized micelles for diagnosis
EP2425817A1 (en) * 2010-08-09 2012-03-07 Commissariat à l'Énergie Atomique et aux Énergies Alternatives Polymerized micelles for diagnosis
US9839700B2 (en) 2010-08-09 2017-12-12 Commissariat A L'energie Atomique Et Aux Energies Alternatives Polymerized micelles for diagnosis
WO2012040513A1 (en) * 2010-09-22 2012-03-29 The Board Of Regents Of The University Of Texas System Compositions and methods for the delivery of beta lapachone
WO2013075394A1 (en) * 2011-11-22 2013-05-30 原创生医股份有限公司 Drug carrier with chelating composite micell and use thereof
CN105709231A (en) * 2014-12-04 2016-06-29 上海中医药大学附属普陀医院 Bufalin-loaded polypeptide-modified poly(oligo(ethylene glycol)methacrylate)-polycaprolactone (Ph PCL b P(OEGMA co RGD) bufalin) nanometer preparation
CN107007571A (en) * 2017-02-24 2017-08-04 福州市传染病医院 Coordinate self-assembly nanoparticle and the application altogether of the sensitive copper medicine of tumour subacidity
CN107007571B (en) * 2017-02-24 2020-08-21 福州市传染病医院 Tumor slightly acidic sensitive copper-drug co-coordination self-assembly nanoparticle and application thereof
CN111012928A (en) * 2019-11-26 2020-04-17 安徽医科大学 A kind of multifunctional nanocluster and preparation method thereof

Also Published As

Publication number Publication date
US8697031B2 (en) 2014-04-15
US20070253899A1 (en) 2007-11-01

Similar Documents

Publication Publication Date Title
US8697031B2 (en) Dual function polymer micelles
Liu et al. Gadolinium-loaded polymeric nanoparticles modified with Anti-VEGF as multifunctional MRI contrast agents for the diagnosis of liver cancer
EP2305214B1 (en) Novel molecular assembly, molecular probe for molecular imaging and molecular probe for drug delivery system using the same, and molecular imaging system and drug delivery system
Yang et al. A positron emission tomography image-guidable unimolecular micelle nanoplatform for cancer theranostic applications
CN102159189B (en) Nanocarriers for drug delivery
Mekuria et al. PAMAM dendrimer based targeted nano-carrier for bio-imaging and therapeutic agents
EP2725053B1 (en) Branched amphipathic block polymer and molecular aggregate and drug delivery system using same
Li et al. MRI-visible and pH-sensitive micelles loaded with doxorubicin for hepatoma treatment
Liu et al. Theranostic polymeric micelles for the diagnosis and treatment of hepatocellular carcinoma
Cao et al. Poly (glycerol) used for constructing mixed polymeric micelles as T 1 MRI contrast agent for tumor-targeted imaging
Yang et al. Cross-linked magnetic nanoparticles with a biocompatible amide bond for cancer-targeted dual optical/magnetic resonance imaging
Huang et al. Sericin-based gadolinium nanoparticles as synergistically enhancing contrast agents for pH-responsive and tumor targeting magnetic resonance imaging
Zhou et al. Dendritic nanoglobules with polyhedral oligomeric silsesquioxane core and their biomedical applications
Long et al. Synthesis of star-branched PLA-b-PMPC copolymer micelles as long blood circulation vectors to enhance tumor-targeted delivery of hydrophobic drugs in vivo
Guo et al. Pepetide dendron-functionalized mesoporous silica nanoparticle-based nanohybrid: biocompatibility and its potential as imaging probe
EP3553074A1 (en) Vap polypeptide and use thereof in preparation of drug for targeted diagnosis and treatment of tumor
CN101444630A (en) Method for preparing high magnetic resonance sensitivity ferroferric oxide nano-particle with tumor-targeting function
Fu et al. Dual activatable self-assembled nanotheranostics for bioimaging and photodynamic therapy
Gallo et al. Systematic overview of soft materials as a novel frontier for MRI contrast agents
CN101390826A (en) A magnetic tumor targeting polymer nanovesicle and its preparation method
EP2893924B1 (en) Molecular assembly using branched amphiphilic block polymer, and drug transportation system
Nazemi et al. Dendritic surface functionalization of nanomaterials: controlling properties and functions for biomedical applications
Lee et al. A nanosized delivery system of superparamagnetic iron oxide for tumor MR imaging
Fu et al. PEGylated amphiphilic Gd-DOTA backboned-bound branched polymers as magnetic resonance imaging contrast agents
CN104815341A (en) Targeted polymer micelle magnetic nanoparticle, and preparation method and application thereof

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A1

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KM KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NG NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SM SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A1

Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
WWE Wipo information: entry into national phase

Ref document number: 11569989

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

WWW Wipo information: withdrawn in national office

Country of ref document: DE

122 Ep: pct application non-entry in european phase
WWP Wipo information: published in national office

Ref document number: 11569989

Country of ref document: US