WO2005040229A2 - Ldl receptor class a and egf domain monomers and multimers - Google Patents
Ldl receptor class a and egf domain monomers and multimers Download PDFInfo
- Publication number
- WO2005040229A2 WO2005040229A2 PCT/US2004/035301 US2004035301W WO2005040229A2 WO 2005040229 A2 WO2005040229 A2 WO 2005040229A2 US 2004035301 W US2004035301 W US 2004035301W WO 2005040229 A2 WO2005040229 A2 WO 2005040229A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- monomer
- domain
- domains
- protein
- xxxx
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
- C07H21/00—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids
- C07H21/04—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids with deoxyribosyl as saccharide radical
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/485—Epidermal growth factor [EGF], i.e. urogastrone
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- Proteins that contain these domains are involved in a variety of processes, such as cellular transporters, cholesterol movement, signal transduction and signaling functions which are involved in development and neurotransmission. See Herz, Lipoprotein receptors: beacons to neurons?, (2001) Trends in Neurosciences 24(4): 193-195; Goldstein and Brown, The Cholesterol Pair, (2001) Science 292: 1310-1312.
- LDL-receptor class A domain also referred to as a class A module, a complement type repeat or an A-domain
- Ga ga ma-carboxyglumatic acid
- discrete monomer domains include, e.g., the epidermal growth factor (EGF)-like domain in tissue-type plasminogen activator which mediates binding to liver cells and thereby regulates the clearance of this fibnnolytic enzyme from the circulation and the cytoplasmic tail of the LDL-receptor which is involved in receptor- mediated endocytosis.
- EGF epidermal growth factor
- Individual proteins can possess one or more discrete monomer domains. These proteins are often called mosaic proteins.
- members of the LDL-receptor family contain four major structural domains: the cysteine rich A-domain repeats, epidermal growth factor precursor-like repeats, a transmembrane domain and a cytoplasmic domain.
- the LDL-receptor family includes members that: 1) are cell-surface receptors; 2) recognize extracellular ligands; and 3) internalize them for degradation by lysosomes. See Hussain et al., The Mammalian Low-Density Lipoprotein Receptor Family, (1999) Annu. Rev. Nutr. 19:141-72.
- some members include very-low-density lipoprotein receptors (VLDL-R), apolipoprotein E receptor 2, LDLR-related protein (LRP) and megalin.
- Family members have the following characteristics: 1) cell-surface expression; 2) extracellular ligand binding consisting of A-domain repeats; 3) requirement of calcium for ligand binding; 4) recognition of receptor-associated protein and apolipoprotein (apo) E; 5) epidermal growth factor (EGF) precursor homology domain containing YWTD repeats (SEQ ID NO. 198); 6) single membrane-spanning region; and 7) receptor-mediated endocytosis of various ligands. See Hussain, supra. Yet, the members bind several structurally dissimilar ligands. [06] It is advantageous to develop methods for generating and optimizing the desired properties of these discrete monomer domains.
- the discrete monomer domains while often being structurally conserved, are not conserved at the nucleotide or amino acid level, except for certain amino acids, e.g., the cysteine residues in the A-domain.
- existing nucleotide recombination methods fall short in generating and optimizing the desired properties of these discrete monomer domains.
- the present invention provides non-naturally occurring proteins comprising a monomer domain that specifically binds to a target molecule, wherein the monomer domain is selected from the group consisting of an LDL receptor class A monomer domain and an EGF monomer domain, wherein the LDL receptor class A monomer domain comprises the following sequence: C 1 xxxx([ekq])FxC 2 xxxx(x)C 3 [ilv][ps]xx[lw]xC 4 DG[dev]xdC 5 xDxSDExx(xx)C 6 wherein C 1-3 , C 2-5 and C 4-6 form disulfide bonds, and "x" is selected from any amino acid; and wherein the EGF monomer domain comprises the following sequence: C ⁇ xxxx(xx)xC 2 x[nhgk]x[Ga]xC 3 xxxx(xxx)[yfpha]xC xC 5 xx[Gpnte](xxxx)
- the LDL receptor class A domain monomers comprises the following sequence: C a X 6 - 7 C b 4-5 C c X 6 C d X 5 C e X 8 -iQC f wherein C is cysteine, X n-m represents between n and m number of independently selected amino acids, and wherein X is selected from the amino acids designated at the positions below:
- the EGF monomer domain comprises the following sequence:
- the monomer domain is fused to a heterologous amino acid sequence.
- the monomer domain is linked to a second monomer domain by a heterologous linker.
- each monomer domain is a non-naturally occurring protein monomer domain.
- the protein comprises a first monomer domain that binds a first target molecule and a second monomer domain that binds a second target molecule.
- the protein comprises two monomer domains, each monomer domain having a binding specificity for a different site on a first target molecule, hi some embodiments, the protein comprises three monomer domains. In some embodiments, the protein comprises four monomer domains. [14] In some embodiments, the protein has an improved avidity for a target molecule compared to the avidity of a monomer domain alone. [15] hi some embodiments, the monomer domains are linked by a polypeptide linker. In some embodiments, the linker is between 1-20 amino acids.
- the linker comprises the following sequence, A 1 A 2 A 3 A 4 A 5 A 6 , wherein Ai is selected from the amino acids A, P, T, Q, E and K; A 2 and A 3 are any amino acid except C, F, Y, W, or M; A 4 is selected from the amino acids S, G and R; A 5 is selected from the amino acids H, P, and R A 6 is the amino acid, T.
- the protein consists of fewer than 200 amino acids.
- the present invention also provides isolated polynucleotides encoding a non-naturally occurring polypeptide comprising a monomer domain that specifically binds to a target molecule, wherein the monomer domain is selected from the group consisting of an LDL receptor class A monomer domain and an EGF monomer domain, wherein the LDL receptor class A monomer domain comprises the following sequence: C 1 xxxx([ekq])FxC 2 xxxx(x)C 3 [ilv][ ⁇ s]xx[lw]xC 4 DG[dev]xdC 5 xDxSDExx(xx)C 6 wherein C 1-3 , C2-5 and C 4-6 form disulfide bonds, and "x" is selected from any amino acid; and wherein the EGF monomer domain comprises the following sequence: C ⁇ Xxxx(xx)xC 2 x[nhgk]x[Ga]xC 3 xxxx(xxx)[yfpha]xC xC 5 xx[Gpnte
- the EGF monomer domain comprises the following sequence: C ⁇ xxxx(xx)xC 2 x[nhgk]x[Ga]xC 3 xxxx(xxx)[yfpha]xC 4 xC 5 xx[Gpnte](xxxx)xx[Gqde]xxC 6 .
- the present invention also provides cells comprising a polynucleotide as described above.
- the present invention also provides methods comprising recombinantly expressing a protein as described above.
- the present invention also provides methods for identifying a monomer domain that binds to a target molecule, the method comprising, a) providing a library of non-naturally-occurring monomer domains, wherein the monomer domains are selected from the group consisting of an LDL receptor class A monomer domain and an EGF monomer domain, wherein the LDL receptor class A monomer domain comprises the following sequence: C ⁇ xxxx([ekq])FxC 2 xxxx(x)C 3 [ilv][ps]xx[lw]xC 4 DG[dev]xdC5xDxSDExx(xx)C 6 wherein C ⁇ -3 , C 2-5 and C 4-6 form disulfide bonds, and "x" is selected from any amino acid; and wherein the EGF monomer domain comprises the following sequence: C ⁇ Xxxx(xx)xC 2 x[nhgk]x[Ga]xC xxxx(xxx)[yfpha]xC 4 xC 5 xx
- the LDL receptor class A domain monomer comprises the following sequence:
- the EGF monomer domain comprises the following sequence: C ⁇ xxxx(xx)xC 2 x[nhgk]x[Ga]xC 3 xxxx(xxx)[yfpha]xC 4 xC 5 xx[Gpnte](xxxx)xx[Gqde]xxC6.
- the methods further comprise linking the identified monomer domains to a second monomer domain to form a library of multimers, each multimer comprising at least two monomer domains; screening the library of multimers for the ability to bind to the first target molecule; and identifying a multimer that binds to the first target molecule.
- each monomer domain of the selected multimer binds to the same target molecule.
- the selected multimer comprises three monomer domains.
- the selected multimer comprises four monomer domains.
- the methods further comprise a step of mutating at least one monomer domain, thereby providing a library comprising mutated monomer domains, h some embodiments, the mutating step comprises recombining a plurality of polynucleotide fragments of at least one polynucleotide encoding a polypeptide domain.
- the method further comprises screening the library of monomer domains for affinity to a second target molecule; identifying a monomer domain that binds to a second target molecule; llinking at least one monomer domain with affinity for the first target molecule with at least one monomer domain with affinity for the second target molecule, thereby forming a multimer with affinity for the first and the second target molecule.
- the library of monomer domains is expressed as a phage display, ribosome display or cell surface display.
- the library of monomer domains is presented on a microarray.
- the present invention also provides libraries of proteins comprising non-naturally-occurring monomer domains, wherein the monomer domains are selected from the group consisting of an LDL receptor class A monomer domain and an EGF monomer domain, wherein the LDL receptor class A monomer domain comprises the following sequence: C ⁇ xxxx([ekq])FxC 2 xxxx(x)C 3 [ilv][ps]xx[lw]xC DG[dev]xdC 5 xDxSDExx(xx)C 6 wherein C ⁇ -3 , C 2-5 and C 4-6 form disulfide bonds, and "x" is selected from any amino acid; and wherein the EGF monomer domain comprises the following sequence: C ⁇ xxxx(xx)xC 2 x[nhgk]x[Ga]xC 3 xxxx(xxx)[yfpha]xC 4 xC5Xx[Gpnte](xxxx)xx[Gqde]xxC 6 , wherein C ⁇ -3
- each monomer domain of the multimers is a non-naturally occurring monomer domain.
- the library comprises a plurality of multimers, wherein the multimers comprise at least two monomer domains linked by a linker, hi some embodiments, the library comprises at least 100 different proteins comprising different monomer domains.
- monomer domain or “monomer” is used interchangeably herein refer to a discrete region found in a protein or polypeptide.
- a monomer domain forms a native three-dimensional structure in solution in the absence of flanking native amino acid sequences.
- Monomer domains of the invention will specifically bind to a target molecule.
- a polypeptide that forms a three-dimensional structure that binds to a target molecule is a monomer domain.
- the term “monomer domain” does not encompass the complementarity determining region (CDR) of an antibody.
- the term "monomer domain variant” refers to a domain resulting from human-manipulation of a monomer domain sequence. Examples of man-manipulated changes include, e.g., random mutagenesis, site-specific mutagenesis, shuffling, directed evolution, oligo-directed forced crossover events, direct gene synthesis incoorperation of mutation, etc.
- the term "monomer domain variant” does not embrace a mutagenized complementarity deteraiining region (CDR) of an antibody.
- the term “loop” refers to that portion of a monomer domain that is typically exposed to the environment by the assembly of the scaffold structure of the monomer domain protein, and which is involved in target binding.
- the present invention provides three types of loops that are identified by specific features, such as, potential for disulfide bonding, bridging between secondary protein structures, and molecular dynamics (i.e., flexibility).
- the three types of loop sequences are a cysteine-defined loop sequence, a structure-defined loop sequence, and a B-factor-defined loop sequence.
- cysteine-defined loop sequence refers to a subsequence of a naturally occurring monomer domain-encoding sequence that is bound at each end by a cysteine residue that is conserved with respect to at least one other naturally occurring monomer domain of the same family.
- Cysteine-defined loop sequences are identified by multiple sequence alignment of the naturally occurring monomer domains, followed by sequence analysis to identify conserved cysteine residues. The sequence between each consecutive pair of conserved cysteine residues is a cysteine-defined loop sequence. The cysteine-defined loop sequence does not include the cysteine residues adjacent to each terminus. Monomer domains having cysteine-defined loop sequences include the LDL receptor A-domains, EGF-like domains, sushi domains, Fibronectin type 1 domains, and the like.
- X 6 , X 4 , X 5 , and X 8 each represent a cysteine-defined loop sequence.
- the term "multimer” is used herein to indicate a polypeptide comprising at least two monomer domains. The separate monomer domains in a multimer can be joined together by a linker.
- the term "family” and "family class” are used interchangably to indicate proteins that are grouped together based on similarities in their amino acid sequences. These similar sequences are generally conserved because they are important for the function of the protein and/or the maintenance of the three dimensional structure of the protein.
- Target molecules encompasses a wide variety of substances and molecules, which range from simple molecules to complex targets.
- Target molecules can be proteins, nucleic acids, lipids, carbohydrates or any other molecule capable of recognition by a polypeptide domain.
- a target molecule can include a chemical compound (i.e., non-biological compound such as, e.g., an organic molecule, an inorganic molecule, or a molecule having both organic and inorganic atoms, but excluding polynucleotides and proteins), a mixture of chemical compounds, an array of spatially localized compounds, a biological macromolecule, a bacteriophage peptide display library, a polysome peptide display library, an extract made from a biological materials such as bacteria, plants, fungi, or animal (e.g., mammalian) cells or tissue, a protein, a toxin, a peptide hormone, a cell, a virus, or the like.
- a chemical compound i.e., non-biological compound such as, e.g., an organic molecule, an inorganic molecule, or a molecule having both organic and inorganic atoms, but excluding polynucleotides and proteins
- target molecules include, e.g., a whole cell, a whole tissue, a mixture of related or unrelated proteins, a mixture of viruses or bacterial strains or the like.
- Target molecules can also be defined by inclusion in screening assays described herein or by enhancing or inhibiting a specific protein interaction (i.e., an agent that selectively inhibits a binding interaction between two predetermined polypeptides).
- a specific protein interaction i.e., an agent that selectively inhibits a binding interaction between two predetermined polypeptides.
- the term "immuno-domains” refers to protein binding domains that contain at least one complementarity determining region (CDR) of an antibody. Immuno-domains can be naturally occurring immunological domains (i.e.
- immunological domains that have been altered by human-manipulation (e.g., via mutagenesis methods, such as, for example, random mutagenesis, site-specific mutagenesis, and the like, as well as by directed evolution methods, such as, for example, recursive error-prone PCR, recursive recombination, and the like.).
- mutagenesis methods such as, for example, random mutagenesis, site-specific mutagenesis, and the like
- directed evolution methods such as, for example, recursive error-prone PCR, recursive recombination, and the like.
- minibody refers herein to a polypeptide that encodes only 2 complementarity determining regions (CDRs) of a naturally or non-naturally (e.g., mutagenized) occurring heavy chain variable domain or light chain variable domain, or combination thereof.
- CDRs complementarity determining regions
- An example of a minibody is described by Pessi et al., A designed metal-binding protein with a novel fold, (1993) Nature 362:367-369.
- a multimer of minibodies is schematically illustrated in Figure 11 A. The circles depict minibodies, and the solid lines depict the linker moieties joining the immuno-domains to each other.
- single-domain antibody refers to the heavy chain variable domain ("V H ") of an antibody, i.e., a heavy chain variable domain without a light chain variable domain.
- V H heavy chain variable domain
- Exemplary single-domain antibodies employed in the practice of the present invention include, for example, the Camelid heavy chain variable domain (about 118 to 136 amino acid residues) as described in Hamers-Casterman, C. et al, Naturally occurring antibodies devoid of light chains (1993) Nature 363:446-448, and Dumoulin, et al, Single-domain antibody fragments with high conformational stability (2002) Protein Science 11:500-515.
- Single chain variable fragment or “ScFv” are used interchangeably herein to refer to antibody heavy and light chain variable domains that are joined by a peptide linker having at least 12 amino acid residues.
- Single chain variable fragments contemplated for use in the practice of the present invention include those described in Bird, et al., Single-chain antigen-binding proteins (1988) Science 242(4877) :423 -426 and Huston et al., Protein engineering of antibody binding sites: recovery of specific activity in an anti-digoxin single-chain Fv analogue produced in Escherichia coli (1988) Proc Natl Acad Sci U S A 85(16):5879-83.
- Fab fragment refers to an immuno-domain that has two protein chains, one of which is a light chain consisting of two light chain domains (V L variable domain and C L constant domain) and a heavy chain consisting of two heavy domains (i.e., a V H variable and a C H constant domain).
- Fab fragments employed in the practice of the present invention include those that have an interchain disulfide bond at the C-terminus of each heavy and light component, as well as those that do not have such a C-terminal disulfide bond. Each fragment is about 47 kD.
- Fab fragments are described by Pluckthun and Skerra, Expression of functional antibody Fv and Fab fragments in Escherichia col (1989) Methods Enzymol 178:497-515.
- a multimer of Fab fragments is depicted in Figure 1 ID.
- the white ellipses represent the heavy chain component of the Fab fragment, the filled ellipses represent the light chain component of the Fab.
- the term "linker” is used herein to indicate a moiety or group of moieties that joins or connects two or more discrete separate monomer domains. The linker allows the discrete separate monomer domains to remain separate when joined together in a multimer.
- the linker moiety is typically a substantially linear moiety.
- Suitable linkers include polypeptides, polynucleic acids, peptide nucleic acids and the like. Suitable linkers also include optionally substituted alkylene moieties that have one or more oxygen atoms incorporated in the carbon backbone. Typically, the molecular weight of the linker is less than about 2000 daltons. More typically, the molecular weight of the linker is less than about 1500 daltons and usually is less than about 1000 daltons. The linker can be small enough to allow the discrete separate monomer domains to cooperate, e.g., where each of the discrete separate monomer domains in a multimer binds to the same target molecule via separate binding sites.
- Exemplary linkers include a polynucleotide encoding a polypeptide, or a polypeptide of amino acids or other non-naturally occurring moieties.
- the linker can be a portion of a native sequence, a variant thereof, or a synthetic sequence.
- Linkers can comprise, e.g., naturally occurring, non-naturally occurring amino acids, or a combination of both.
- the term "separate" is used herein to indicate a property of a moiety that is independent and remains independent even when complexed with other moieties, including for example, other monomer domains.
- a monomer domain is a separate domain in a protein because it has an independent property that can be recognized and separated from the protein.
- the ligand binding ability of the A-domain in the LDLR is an independent property.
- Other examples of separate include the separate monomer domains in a multimer that remain separate independent domains even when complexed or joined together in the multimer by a linker.
- Another example of a separate property is the separate binding sites in a multimer for a ligand.
- directed evolution refers to a process by which polynucleotide variants are generated, expressed, and screened for an activity (e.g., a polypeptide with binding activity) in a recursive process. One or more candidates in the screen are selected and the process is then repeated using polynucleotides that encode the selected candidates to generate new variants.
- Directed evolution involves at least two rounds of variation generation and can include 3, 4, 5, 10, 20 or more rounds of variation generation and selection.
- Variation can be generated by any method known to those of skill in the art, including, e.g., by error-prone PCR, gene shuffling, chemical mutagenesis and the like.
- shuffling is used herein to indicate recombination between non-identical sequences.
- shuffling can include crossover via homologous recombination or via non-homologous recombination, such as via cre/lox and/or flp/frt systems.
- Shuffling can be carried out by employing a variety of different formats, including for example, in vitro and in vivo shuffling formats, in silico shuffling formats, shuffling formats that utilize either double-stranded or single-stranded templates, primer based shuffling formats, nucleic acid fragmentation-based shuffling formats, and oligonucleotide-mediated shuffling formats, all of which are based on recombination events between non-identical sequences and are described in more detail or referenced herein below, as well as other similar recombination-based formats.
- random refers to a polynucleotide sequence or an amino acid sequence composed of two or more amino acids and constructed by a stochastic or random process.
- the random polynucleotide sequence or amino acid sequence can include framework or scaffolding motifs, which can comprise invariant sequences.
- pseudorandom refers to a set of sequences, polynucleotide or polypeptide, that have limited variability, so that the degree of residue variability at some positions is limited, but any pseudorandom position is allowed at least some degree of residue variation.
- polypeptide polypeptide
- peptide protein
- protein protein
- Constant amino acid substitution refers to the interchangeability of residues having similar side chains.
- a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having alipliatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide- containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulfur- containing side chains is cysteine and methionine.
- nucleic acid sequence refers to a single or double- stranded polymer of deoxyribonucleotide or ribonucleotide bases read from the 5' to the 3' end. It includes chromosomal DNA, self-replicating plasmids and DNA or RNA that performs a primarily structural role.
- encoding refers to a polynucleotide sequence encoding one or more amino acids.
- a "vector” refers to a polynucleotide, which when independent of the host chromosome, is capable of replication in a host organism. Examples of vectors include plasmids. Vectors typically have an origin of replication.
- Vectors can comprise, e.g., transcription and translation terminators, transcription and translation initiation sequences, and promoters useful for regulation of the expression of the particular nucleic acid.
- recombinant cells express genes that are not found within the native (nonrecombinant) form of the cell or express native genes that are otherwise abnormally expressed, under-expressed or not expressed at all.
- the phrase "specifically (or selectively) binds" to a polypeptide when referring to a monomer or multimer, refers to a binding reaction that can be determinative of the presence of the polypeptide in a heterogeneous population of proteins and other biologies.
- the specified monomer or multimer binds to a particular target molecule above background (e.g., 2X, 5X, 10X or more above background) and does not bind in a significant amount to other molecules present in the sample.
- a particular target molecule above background e.g., 2X, 5X, 10X or more above background
- percent identity in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same.
- Substantially identical refers to two or more nucleic acids or polypeptide sequences having a specified percentage of amino acid residues or nucleotides that are the same (i.e., 60% identity, optionally 65%, 70%, 75%, 80%, 85%, 90%, or 95% identity over a specified region, or, when not specified, over the entire sequence), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection.
- the identity or substantial identity exists over a region that is at least about 50 nucleotides in length, or more preferably over a region that is 100 to 500 or 1000 or more nucleotides or amino acids in length.
- a polynucleotide or amino acid sequence is "heterologous to" a second sequence if the the two sequences are not linked in the same manner as found in naturally- occurring sequences.
- a promoter operably linked to a heterologous coding sequence refers to a coding sequence which is different from any naturally-occurring allelic variants.
- heterologous linker when used in reference to a multimer, indicates that the multimer comprises a linker and a monomer that are not found in the same relationship to each other in nature (e.g., they form a fusion protein).
- a "non-naturally-occurring amino acid” in a protein sequence refers to any amino acid other than the amino acid that occurs in the corresponding position in an alignment with a naturally-occurring polypeptide with the lowest smallest sum probability where the comparison window is the length of the monomer domain queried and when compared to the non-redundant ("nr") database of Genbank using BLAST 2.0 as described herein.
- a "non-naturally-occurring polypeptide” comprises at leats on enon-naturally- occurring amino acid. Non-naturally-occurring polypeptides may also occur when two or more domains are linked in a way that does not occur in a naturally-occurring protein.
- Figure 1 schematically illustrates the type, number and order of monomer domains found in members of the LDL-receptor family. These monomer domains include ⁇ -Propeller domains, EGF-like domains and LDL receptor class A-domains. The members shown include low-density lipoprotein receptor (LDLR), ApoE Receptor 2 (ApoER2), very-low-density lipoprotein receptor (VLDLR), LDLR-related protein 2 (LRP2) and LDLR-related roteinl (LRPl).
- LDLR low-density lipoprotein receptor
- ApoER2 ApoE Receptor 2
- VLDLR very-low-density lipoprotein receptor
- LRP2 LDLR-related protein 2
- LRPl LDLR-related roteinl
- Figure 2 schematically illustrates the alignment of partial amino acid sequence from a variety of the LDL-receptor class A-domains (SEQ ID NOS: 103, 100, 65, 117, 128, 21, 29, 39, 30, 77, 58, 50, and 14, respectively in order of appearance) that include two human LRPl sequences, two human LRP2 sequences, two human LDLR sequences, two human LDVR sequences, one human LRP3 sequence, one human MAT sequence, a human CO6 sequence, and a human SORL sequence, to demonstrate the conserved cysteines.
- Figure 3 schematically illustrates an example of an A-domain. Panel A schematically illustrates conserved amino acids in an A-domain of about 40 amino acids long.
- FIG. 1 The conserved cysteine residues are indicated by C, and the negatively charged amino acids are indicated by a circle with a minus ("-") sign. Circles with an "H” indicate hydrophobic residues.
- Panel B schematically illustrates two folded A-domains connected via a linker. Panel B also indicates two calcium binding sites, dark circles with Ca +2 , and three disulfide bonds within each folded A-domain for a total of 6 disulfide bonds.
- Figure 4 indicates some of the ligands recognized by the LDL-receptor family, which include inhibitors, proteases, protease complexes, vitamin-carrier complexes, proteins involved in lipoprotein metabolism, non-human ligands, antibiotics, viruses, and others.
- Figure 5 schematically illustrates a general scheme for identifying monomer domains that bind to a ligand, isolating the selected monomer domains, creating multimers of the selected monomer domains by joining the selected monomer domains in various combinations and screening the multimers to identify multimers comprising more than one monomer that binds to a ligand.
- Figure 6 is a schematic representation of another selection strategy (guided selection). A monomer domain with appropriate binding properties is identified from a library of monomer domains. The identified monomer domain is then linked to monomer domains from another library of monomer domains to form a library of multimers. The multimer library is screened to identify a pair of monomer domains that bind simultaneously to the target.
- FIG. 7 shows the multimerization process of monomer domains.
- the target-binding monomer hits are amplified from a vector.
- This mixture of target-binding monomer domains and/or immuno-domains is then cleaved and mixed with an optimal combination of linker and stopper oligonucleotides.
- the multimers that are generated are then cloned into a suitable vector for the second selection step for identification of target- binding multimers.
- Figure 8 depicts common amino acids in each position of the A domain. The percentages above the amino acid positions refer to the percentage of naturally- occurring A domains with the inter-cysteine spacing displayed.
- amino acid residues in bold depicted under each amino acid position represent common residues at that position.
- the final six amino acids, depicted as lighter-colored circles, represent linker sequences.
- the two columns of italicized amino acid residues at positions 2 and 3 of the linker represent amino acid residues that do not occur at that position. Any other amino acid (e.g., A, D, E, G, H, I, K, L, N, P, Q, R, S, T, and V) maybe included at these positions.
- Figures 9A and 9B display the frequency of occurrence of amino acid residues in naturally-occurring A domains for A domains with the following spacing between cysteines: CX 6 CX 4 CX 6 CX 5 CX 8 C (SEQ ID NO: 199).
- Figure 10 depicts an alignment of A domains (SEQ ID NO: 1-197). At the top and the bottom of the figure, small letters (a-q) indicate conserved residues. The predominant amino acids at these positions and the frequency they were observed in native A domains is illustrated at the bottom of the figure.
- Figure 11 depicts linkage of domains via partial linkers.
- Figure 12 illustrates cell killing induced by CD20-specific A domain monomers.
- Figure 13 illustrates binding of A domain monomer-expressing phage to recombinant TPO-R abd TF1 cells.
- Figure 14 illustrates TF1 cell proliferation in response to TPO-R- specific A domain monomers and multimers.
- Figure 15 illustrates IgE-specific A domain monomer and multimer- expressing phage binding to (a) IgE directly immobilized on a plate, or (b) IgE immobilized on the plate by binding to an immobilized antibody to IgE's CE2 domain, or (c) IgE immobilized on the plate by binding to an immobilized antibody to IgE's CE3 domain, or (d) immobilized by binding to immobilized IgE receptor Rl .
- Figure 16 illustrates ELISA binding data of selected A-domain monomers that bind to CD28.
- Figure 17 illustrates results from a competition ELISA experiment where soluble IL6 receptor and monomer Mb9 are competed against immobilized IL6.
- Figure 18 illustrates cell proliferation inhibition of by a IL6-specific monomer.
- Figure 19 illustrates the effect of an IL6-specific monomer on isolated peripheral blood lymphocytes (PBMC).
- Figure 20 illustrates screening a library of monomer domains against multiple ligands displayed on a cell.
- Figure 21 illustrates identification of monomers that were selected to bind to one of a plurality of ligands.
- Figure 22 illustrates an embodiment for identifying polynucleotides encoding ligands and monomer domains.
- Figure 23 illustrates monomer domain and multimer embodiments for increased avidity. While the figure illustrates specific gene products and binding affinities, it is appreciated that these are merely examples and that other binding targets can be used with the same or similar conformations.
- Figure 24 illustrates monomer domain and multimer embodiments for increased avidity. While the figure illustrates specific gene products and binding affinities, it is appreciated that these are merely examples and that other binding targets can be used with the same or similar conformations.
- the invention provides affinity agents comprising monomer domains, as well as multimers comprising the monomer domains.
- the affinity agents can be selected for the ability to bind to a desired ligand or mixture of ligands.
- the monomer domains and multimers can be screened to identify those that have an improved characteristic such as improved avidity or affinity or altered specificity for the ligand or the mixture of ligands, compared to the discrete monomer domain.
- the monomer domains of the present invention include specific variants of the LDL-receptor class A domains and EGF-like domains.
- Monomer domains can generally be polypeptide chains of any size. In some embodiments, monomer domains have about 25 to about 500, about 30 to about 200, about 30 to about 100, about 90 to about 200, about 30 to about 250, about 30 to about 60, about 9 to about 150, about 100 to about 150, about 25 to about 50, or about 30 to about 150 amino acids. Similarly, a monomer domain of the present invention can comprise, e.g., from about 30 to about 200 amino acids; from about 25 to about 180 amino acids; from about 40 to about 150 amino acids; from about 50 to about 130 amino acids; or from about 75 to about 125 amino acids.
- Monomer domains can typically maintain a stable conformation in solution,and are often heat stable, e.g., stable at 95° C for at least 10 minutes without losing binding affinity when removed back to room temperture.
- monomer domains of the invention can fold independently into a stable conformation.
- the stable conformation is stabilized by metal ions.
- the stable conformation is created in part by disulfide bonds (e.g., at least one, two, or three or more disulfide bonds) formed between two cysteine residues within the monomer domain.
- monomer domains, or monomer domain variants are substantially identical to the sequences exemplified (e.g., A, EGF) or otherwise referenced herein.
- At least 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60% or more of the amino acids of the monomer domains of the invention are non-naturally-occurring amino acids.
- Publications describing monomer domains and mosaic proteins generally and references cited within include the following: Hegyi, H and Bork, P., On the classification and evolution of protein modules, (1997) J. Protein Chem., 16(5):545-551; Baron et al., Protein modules (1991) Trends Biochem. Sci., 16(1): 13-7; Ponting et al., Evolution of domain families, (2000), Adv.
- Monomer domains of the present invention also include those domains found in Pfam database and the SMART database. See Schultz, et al., SMART: a web-based tool for the study of genetically mobile domains, (2000) Nucleic Acid Res. 28(l):231-34. U.S.
- the domains have low or no immunogenicity in an animal (e.g., a human). Domains can have a small size. In some embodiments, the domains are small enough to penetrate skin or other tissues. Domains can have a range of in vivo half-lives or stabilities. [89] Other features of monomer domains can include the ability to bind ligands, the ability to participate in endocytosis or internalization, the ability to bind an ion (e.g., Ca 2+ ), and/or the ability to be involved in cell adhesion.
- an ion e.g., Ca 2+
- Characteristics of a monomer domain include the ability to fold independently and the ability to form a stable structure.
- the structure of the monomer domain is often conserved, although the polynucleotide sequence encoding the monomer need not be conserved.
- the A-domain structure is conserved among the members of the A-domain family, while the A-domain nucleic acid sequence is not.
- a monomer domain is classified as an A-domain by its cysteine residues and its affinity for calcium, not necessarily by its nucleic acid sequence. See, Figure 2.
- Polynucleotides (also referred to as nucleic acids) encoding the monomer domains are typically employed to make monomer domains via expression.
- Nucleic acids that encode monomer domains can be derived from a variety of different sources. Libraries of monomer domains can be prepared by expressing a plurality of different nucleic acids encoding naturally occurring monomer domains, altered monomer domains (i.e., monomer domain variants), or a combinations thereof.
- a domains can be set forth as follows: C ⁇ x(xx)xxxxxC 2 xxxx(xx)C 3 xxxxxxC 4 xxxxxC 5 x(x)xxxxx(x)xxxC 6 .
- the present invention provides a consensus motif representing a summary of over 200 A domain monomers that have been identified having affinity for specific target molecules.
- This consensus motif therefore represents structural components of A domain monomers involved in forming structures that bind to target molecules and therefore indicates conserved residues that play a role in A domain basic structure. For example, six cysteine residues are maintained which form three disulfide bonds (formed as follows: C ⁇ - 3 , C 2 -C 5 and C 4 -C 6 ) to stabilize the domain.
- An exemplary conserved A domain motif is represented as follows: C ⁇ x(xx)xxxFxC 2 xxxx(xx)C 3 ixxxxxC 4 dxxxDC5x(x)dxsDE(x)xxxC6, where capital letters are completely conserved, lower case letters are generally conserved, and letters in parentheses represent optional length variations (e.g., "(x)” indicates that zero or one amino acids may be at that position and "(xx)” indicates that zero, one or two amino acids may be at that position).
- a domain motif is: C 1 XXXXFX(X)C 2 XXXX(X)C 3 XXXXXC 4 DGXXDC 5 XXXSDXXX(XX)C 6 .
- Less conserved amino acid positions are also provided in the A domains of the invention (e.g., positions marked as "X" above, indicating any amino acid). These positions can include a number of different amino acid possibilities, thereby allowing for sequence diversity and thus affinity for different target molecules. Examples of A domain motifs including such diversity include, e.g.:
- brackets in motifs indicate alternate possible amino acids within a position (e.g., "[ekq]” indicates that either E, K or Q may be at that position).
- Use of parentheses in a motif indicates that that the positions within the parentheses may be present or absent (e.g., "([ekq])” indicates that the position is absent or either E, K, or Q may be at that position).
- each x represents a possible position.
- “(xx)” indicates that zero, one or two amino acids may be at that position(s), where each amino acid is independently selected from any amino acid.
- Exemplary A domain monomers of the invention comprise any of the following: Ligand Monomer domain
- IgG- 03 CP A -DEFTCG-NGRCISPAWVCDGEPDC ⁇ D
- Exemplary proteins containing A- domains include, e.g., complement components (e.g., C6, C7, C8, C9, and Factor I), serine proteases (e.g., enteropeptidase, matriptase, and corin), transmembrane proteins (e.g., ST7, LRP3, LRP5 and LRP6) and endocytic receptors (e.g., Sortilin-related receptor, LDL- receptor, VLDLR, LRPl, LRP2, and ApoER2).
- complement components e.g., C6, C7, C8, C9, and Factor I
- serine proteases e.g., enteropeptidase, matriptase, and corin
- transmembrane proteins e.g., ST7, LRP3, LRP5 and LRP6
- endocytic receptors e.g., Sortilin-related receptor, LDL- receptor, VLDLR, LRPl, LRP
- A-domains typically contain about 30-65 amino acids, however, isolated monomer domains will sometimes have fewer than 50, 55, 60, 65, 70, 75 , 80, 85, 90, 95, 100, 110, 120, 130, 140, or 150 amino acids. In some embodiments, the domains comprise about 35-45 amino acids and in some cases about 40 amino acids. Within the 30-65 amino acids, there are about 6 cysteine residues. Of the six cysteines, disulfide bonds typically are found between the following cysteines: Ci and C 3 , C 2 and C 5 , C 4 and C 6 .
- Exemplary EGF domains of the invention comprise the following motif: C ⁇ xxxx(xx)xC 2 xxxxxC 3 xxxx(xxx)xxC 4 xC 5 xxx(xxxx)xxxxxC 6 .
- the EGF motif comprises: C ⁇ xxxx(xx)xC 2 xxxgxC 3 xxxx(xxx)xxC 4 xC 5 xxg(xxxx)xxgxxC 6 .
- the EGF motif comprises: C ⁇ xxxx(xx)xC 2 xxx[ga]xC 3 xxxx(xxx)[yfp]xC xC 5 xxg(xxxx)xxgxxC 6 . [102] In another embodiment, the EGF motif comprises: C ⁇ xxxx(xx)xC 2 x[nhgk]x[Ga]xC 3 xxxx(xxx)[yfpha]xC4xC 5 xx[Gpnte](xxxx)xx[Gqde]xxC6.
- the EGF motif comprises: C ⁇ xxxx(xxx)C 2 xxx(x)xC 3 xxxxxxxx(x)C 4 xC 5 xxxxxxxx(xxxx)C 6 .
- the EGF domains will form disulfide bonds as follows: C ⁇ - , C 2 -C 4 and C 5 -C 6 . hi some embodiments, the EGF domains bind and ion (e.g., calcium).
- IDENTIFYING MONOMERS OR MULTIMERS WITH AFFINITY FOR A TARGET MOLECULE Those of skill in the art can readily identify monomer domains with a desired property (e.g., binding affinity). For those embodiments, any method resulting in selection of domains with a desired property (e.g., a specific binding property) can be used.
- the methods can comprise providing a plurality of different nucleic acids, each nucleic acid encoding a monomer domain; translating the plurality of different nucleic acids, thereby providing a plurality of different monomer domains; screening the plurality of different monomer domains for binding of the desired ligand or a mixture of ligands; and, identifying members of the plurality of different monomer domains that bind the desired ligand or mixture of ligands.
- any method of mutagenesis such as site-directed mutagenesis and random mutagenesis (e.g., chemical mutagenesis) can be used to produce monomer domains, e.g., for a monomer domain library.
- error-prone PCR is employed to create variants. Additional methods include aligning a plurality of naturally occurring monomer domains by aligning conserved amino acids in the plurality of naturally occurring monomer domains; and, designing the non-naturally occurring monomer domain by maintaining the conserved amino acids and inserting, deleting or altering amino acids around the conserved amino acids to generate the non-naturally occurring monomer domain.
- the conserved amino acids comprise cysteines.
- the inserting step uses random amino acids, or optionally, the inserting step uses portions of the naturally occurring monomer domains. The portions could ideally encode loops from domains from the same family.
- Human chimeric domains of the present invention are useful for therapeutic applications where minimal immunogenicity is desired.
- the present invention provides methods for generating libraries of human chimeric domains.
- Human chimeric monomer domain libraries can be constructed by combining loop sequences from different variants of a human monomer domain, as described above.
- the loop sequences that are combined may be sequence-defined loops, structure-defined loops, B-factor-defined loops, or a combination of any two or more thereof.
- a human chimeric domain library can be generated by modifying naturally-occurring human monomer domains at the amino acid level, as compared to the loop level. To minimize the potential for immunogenicity, only those residues that naturally occur in protein sequences from the same family of human monomer domains are utilized to create the chimeric sequences.
- Libraries of human chimeric monomer domains can be employed to identify human chimeric monomer domains that bind to a target of interest by: screening the library of human chimeric monomer domains for binding to a target molecule, and identifying a human chimeric monomer domain that binds to the target molecule.
- Suitable naturally-occurring human monomer domain sequences employed in the initial sequence alignment step include those corresponding to any of the naturally-occurring monomer domains described herein.
- Domains of human monomer variant libraries of the present invention can be prepared by methods known to those having ordinary skill in the art.
- monomer domains of the invention are screened for potential immunogenicity by: providing a candidate protein sequence; comparing the candidate protein sequence to a database of human protein sequences; identifying portions of the candidate protein sequence that correspond to portions of human protein sequences from the database; and determining the extent of correspondence between the candidate protein sequence and the human protein sequences from the database.
- the greater the extent of correspondence between the candidate protein sequence and one or more of the human protein sequences from the database the lower the potential for immunogenicity is predicted as compared to a candidate protein having little correspondence with any of the human protein sequences from the database.
- a removal or limitation of the number of hydrophobic amino acids may also be used to reduce immunogenicity of the monomer domains.
- the method is particularly useful in determining whether a crossover sequence in a chimeric protein, such as, for example, a chimeric monomer domain, is likely to cause an immunogenic event. If the crossover sequence corresponds to a portion of a sequence found in the database of human protein sequences, it is believed that the crossover sequence is less likely to cause an immunogenic event.
- Information pertaining to portions of human protein sequences from the database can be used to design a protein library of human-like chimeric proteins. Such library can be generated by using information pertaining to "crossover sequences" that exist in naturally occurring human proteins.
- the term "crossover sequence" refers herein to a sequence that is found in its entirety in at least one naturally occurring human protein, in which portions of the sequence are found in two or more naturally occurring proteins.
- the crossover sequence contains a chimeric junction of two consecutive amino acid residue positions in which the first amino acid position is occupied by an amino acid residue identical in type and position found in a first and second naturally occurring human protein sequence, but not a third naturally occurring human protein sequence.
- the second amino acid position is occupied by an amino acid residue identical in type and position found in a second and third naturally occurring human protein sequence, but not the first naturally occurring human protein sequence.
- the "second" naturally occurring human protein sequence corresponds to the naturally occurring human protein in which the crossover sequence appears in its entirety, as described above.
- a library of human-like chimeric proteins is generated by: identifying human protein sequences from a database that correspond to proteins from the same family of proteins; aligning the human protein sequences from the same family of proteins to a reference protein sequence; identifying a set of subsequences derived from different human protein sequences of the same family, wherein each subsequence shares a region of identity with at least one other subsequence derived from a different naturally occurring human protein sequence; identifying a chimeric junction from a first, a second, and a third subsequence, wherein each subsequence is derived from a different naturally occurring human protein sequence, and wherein the chimeric junction comprises two consecutive amino acid residue positions in which the first amino acid position is occupied by an amino acid residue common to the first and second naturally occurring human protein sequence, but not the third naturally occurring human protein sequence, and the second amino acid position is occupied by an amino acid residue common to the second and third naturally occurring human protein sequence, and generating
- the chimeric junction is C-D.
- the first naturally-occurring human protein sequence is D- E-F-G, and the second is B-C-D-E-F, and the third is A-B-C-D, then the chimaeric junction is D-E.
- Human-like chimeric protein molecules can be generated in a variety of ways.
- oligonucleotides comprising sequences encoding the chimeric junctions can be recombined with oligonucleotides corresponding in sequence to two or more subsequences from the above-described set of subsequences to generate a human-like chimeric protein, and libraries thereof.
- the reference sequence used to align the naturally occurring human proteins is a sequence from the same family of naturally occurring human proteins, or a chimera or other variant of proteins in the family.
- Nucleic acids encoding fragments of naturally-occurring monomer domains can also be mixed and/or recombined (e.g., by using chemically or enzymatically- produced fragments) to generate full-length, modified monomer domains.
- the fragments and the monomer domain can also be recombined by manipulating nucleic acids encoding domains or fragments thereof. For example, ligating a nucleic acid construct encoding fragments of the monomer domain can be used to generate an altered monomer domain.
- Altered monomer domains can also be generated by providing a collection of synthetic oligonucleotides (e.g., overlapping oligonucleotides) encoding conserved, random, pseudorandom, or a defined sequence of peptide sequences that are then inserted by ligation into a predetermined site in a polynucleotide encoding a monomer domain.
- synthetic oligonucleotides e.g., overlapping oligonucleotides
- sequence diversity of one or more monomer domains can be expanded by mutating the monomer domain(s) with site-directed mutagenesis, random mutation, pseudorandom mutation, defined kernal mutation, codon-based mutation, and the like.
- the resultant nucleic acid molecules can be propagated in a host for cloning and amplification.
- the nucleic acids are shuffled.
- the present invention also provides a method for recombining a plurality of nucleic acids encoding monomer domains and screening the resulting library for monomer domains that bind to the desired ligand or mixture of ligands or the like.
- Selected monomer domain nucleic acids can also be back-crossed by shuffling with polynucleotide sequences encoding neutral sequences (i.e., having insubstantial functional effect on binding), such as for example, by back-crossing with a wild-type or naturally-occurring sequence substantially identical to a selected sequence to produce native-like functional monomer domains. Generally, during back-crossing, subsequent selection is applied to retain the property, e.g., binding to the ligand. [117] In some embodiments, the monomer library is prepared by shuffling.
- monomer domains are isolated and shuffled to combinatorially recombine the nucleic acid sequences that encode the monomer domains (recombination can occur between or within monomer domains, or both).
- the first step involves identifying a monomer domain having the desired property, e.g., affinity for a certain ligand. While maintaining the conserved amino acids during the recombination, the nucleic acid sequences encoding the monomer domains can be recombined, or recombined and joined into multimers.
- a significant advantage of the present invention is that known ligands, or unknown ligands can be used to select the monomer domains and/or multimers.
- the monomer domains, immuno-domains and/or multimers identified can have biological activity, which is meant to include at least specific binding affinity for a selected or desired ligand, and, in some instances, will further include the ability to block the binding of other compounds, to stimulate or inhibit metabolic pathways, to act as a signal or messenger, to stimulate or inhibit cellular activity, and the like.
- Monomer domains can be generated to function as ligands for receptors where the natural ligand for the receptor has not yet been identified (orphan receptors). These orphan ligands can be created to either block or activate the receptor top which they bind.
- a single ligand can be used, or optionally a variety of ligands can be used to select the monomer domains, immuno-domains and/or multimers.
- a monomer domain and/or immuno-domain of the present invention can bind a single ligand or a variety of ligands.
- a multimer of the present invention can have multiple discrete binding sites for a single ligand, or optionally, can have multiple binding sites for a variety of ligands.
- SELECTION OF MONOMER DOMAINS Selection of monomer domains from a library of domains can be accomplished by a variety of procedures. For example, one method of identifying monomer domains which have a desired property involves translating a plurality of nucleic acids, where each nucleic acid encodes a monomer domain, screening the polypeptides encoded by the plurality of nucleic acids, and identifying those monomer domains that, e.g., bind to a desired ligand or mixture of ligands, thereby producing a selected monomer domain. The monomer domains expressed by each of the nucleic acids can be tested for their ability to bind to the ligand by methods known in the art (i.e.
- selection of monomer domains can be based on binding to a ligand such as a target protein or other target molecule (e.g., lipid, carbohydrate, nucleic acid and the like).
- a ligand such as a target protein or other target molecule (e.g., lipid, carbohydrate, nucleic acid and the like).
- Other molecules can optionally be included in the methods along with the target, e.g., ions such as Ca +2 .
- the ligand can be a known ligand, e.g., a ligand known to bind one of the plurality of monomer domains (see, e.g., Figure 4, which illustrates some of the ligands that bind to naturally-occurring A-domains), or e.g., the desired ligand can be an unknown monomer domain ligand.
- Other selections of monomer domains and/or immuno-domains can be based, e.g., on inhibiting or enhancing a specific function of a target protein or an activity.
- Target protein activity can include, e.g., endocytosis or internalization, induction of second messenger system, up-regulation or down-regulation of a gene, binding to an extracellular matrix, release of a molecule(s), or a change in conformation, hi this case, the ligand does not need to be known.
- the selection can also include using high-throughput assays.
- the selection basis can include selection based on a slow dissociation rate, which is usually predictive of high affinity.
- the valency of the ligand can also be varied to control the average binding affinity of selected monomer domains.
- the ligand can be bound to a surface or substrate at varying densities, such as by including a competitor compound, by dilution, or by other method known to those in the art.
- High density (valency) of predetermined ligand can be used to enrich for monomer domains that have relatively low affinity, whereas a low density (valency) can preferentially enrich for higher affinity monomer domains.
- a variety of reporting display vectors or systems can be used to express nucleic acids encoding the monomer domains and/or multimers of the present invention and to test for a desired activity.
- a phage display system is a system in which monomer domains are expressed as fusion proteins on the phage surface (Pharmacia, Milwaukee Wis.).
- Phage display can involve the presentation of a polypeptide sequence encoding monomer domains on the surface of a filamentous bacteriophage, typically as a fusion with a bacteriophage coat protein.
- each phage particle or cell serves as an individual library member displaying a single species of displayed polypeptide in addition to the natural phage or cell protein sequences.
- the nucleic acids are cloned into the phage DNA at a site which results in the transcription of a fusion protein, a portion of which is encoded by the plurality of the nucleic acids.
- the phage contaimng a nucleic acid molecule undergoes replication and transcription in the cell.
- the leader sequence of the fusion protein directs the transport of the fusion protein to the tip of the phage particle.
- the fusion protein that is partially encoded by the nucleic acid is displayed on the phage particle for detection and selection by the methods described above and below.
- the phage library can be incubated with a predetermined (desired) ligand, so that phage particles which present a fusion protein sequence that binds to the ligand can be differentially partitioned from those that do not present polypeptide sequences that bind to the predetermined ligand.
- the separation can be provided by immobilizing the predetermined ligand.
- the phage particles i.e., library members
- the phage particles which are bound to the immobilized ligand are then recovered and replicated to amplify the selected phage subpopulation for a subsequent round of affinity enrichment and phage replication.
- the phage library members that are thus selected are isolated and the nucleotide sequence encoding the displayed polypeptide sequence is determined, thereby identifying the sequence(s) of polypeptides that bind to the predetermined ligand.
- Such methods are further described in PCT patent publication Nos. 91/17271, 91/18980, and 91/19818 and 93/08278.
- Examples of other display systems include ribosome displays, a nucleotide-linked display (see, e.g., U.S. Patent Nos. 6,281,344; 6,194,550, 6,207,446, 6,214,553, and 6,258,558), polysome display, cell surface displays and the like.
- the cell surface displays include a variety of cells, e.g., E. coli, yeast and or mammalian cells.
- the nucleic acids e.g., obtained by PCR amplification followed by digestion, are introduced into the cell and translated.
- polypeptides encoding the monomer domains or the multimers of the present invention can be introduced, e.g., by injection, into the cell.
- the monomer and multimer libraries of the invention can be screened for a desired property such as binding of a desired ligand or mixture of ligands.
- members of the library of monomer domains can be displayed and prescreened for binding to a known or unknown ligand or a mixture of ligands.
- the monomer domain sequences can then be mutagenized (e.g., recombined, chemically altered, etc.) or otherwise altered and the new monomer domains can be screened again for binding to the ligand or the mixture of ligands with an improved affinity.
- the selected monomer domains can be combined or joined to form multimers, which can then be screened for an improved affinity or avidity or altered specificity for the ligand or the mixture of ligands.
- Altered specificity can mean that the specificity is broadened, e.g., binding of multiple related viruses, or optionally, altered specificity can mean that the specificity is narrowed, e.g., binding within a specific region of a ligand.
- Those of skill in the art will recognize that there are a number of methods available to calculate avidity. See, e.g., Mammen et al, Angew Chem Int. Ed. 37:2754-2794 (1998); Muller et al, Anal Biochem. 261:149-158 (1998).
- a first screening of a library can be performed at relatively lower stringency, thereby selected as many particles associated with a target molecule as possible.
- the selected particles can then be isolated and the polynucleotides encoding the monomer or multimer can be isolated from the particles. Additional variations can then be generated from these sequences and subsequently screened at higher affinity.
- Figure 7 illustrates a generic cycle of selection and generation of variation.
- compositions of the present invention can be optionally bound to a matrix of an affinity material.
- affinity material include beads, a column, a solid support, a microarray, other pools of reagent-supports, and the like.
- Monomer domains may be selected to bind to any type of target molecule, including protein targets.
- Exemplary targets include, but are not limited to IgE, IgG, HSA, IL-6, ILR1, BAFF, CD40L, CD28, Her2, TRATL-R, VEGF, c-Met, TPO-R, TNF ⁇ , LFA-1, VLA-4, ⁇ 4, TACI, IL-lb, B7.2, ICOS, or OX40.
- Multimers comprising the above-described A domain or EGF domain monomers are also a feature of the present invention.
- Multimers comprise at least two monomer domains.
- multimers of the invention can comprise from 2 to about 10 monomer domains and/or immuno-domains, from 2 and about 8 monomer domains and/or immuno-domains, from about 3 and about 10 monomer domains and/or immuno-domains, about 7 monomer domains and/or immuno-domains, about 6 monomer domains and/or immuno-domains, about 5 monomer domains and/or immuno-domains, or about 4 monomer domains and/or immuno-domains.
- the multimer comprises at least 3 monomer domains and/or immuno-domains.
- the multimers of the invention may be, e.g., less than lOOkD, 90kD, 80kD,
- the multimers of the invention comprise at least one monomer comprising at least one of the following motifs:
- Multimers of the invention can also comprise a monomer domain comprising a at least one motif as follows:
- the monomers of the invention are defined in the following table, which indicates precisely which amino acids occur in which positions of the A domain: X3 X4 X5 X6 X7 X8
- the multimers comprise at least one EGF-like monomer domain comprising at least one of the following motifs: C ⁇ xxxx(xx)xC 2 xxxxxC 3 xxxx(xxx)xxC 4 xC 5 xxx(xxxx)xxxxxC6; C ⁇ xxxx(xx)xC 2 xxxgxC 3 xxxx(xxx)xxC 4 xC 5 xxg(xxxx)xxgxxC6; C ⁇ xxxx(xx)xC 2 xxx[ga]xC 3 xxxx(xxx)[yfp]xC 4 xC 5 xxg(xxxx)xxgxxC 6 ; C ⁇ xxxx(xx)xC2x[nhgk]x[Ga]xC 3 xxxx(xxx)[yfpha]xC xC 5 xx[Gpnte](xxxx)xx[Gqde]xxC6; or C ⁇ xxxx(xxx)C 2 xxx(x)
- each monomer domain specifically binds to one target molecule. In some of these embodiments, each monomer binds to a different position (analogous to an epitope) on a target molecule. Multiple monomer domains and/or immuno- domains that bind to the same target molecule in this way result in an avidity effect resulting in improved avidity of the multimer for the target molecule compared to each individual monomer. In some embodiments, the multimer has an avidity of at least about 1.5, 2, 3, 4, 5, 10, 20, 50 or 100 times the avidity of a monomer domain alone. [135] h another embodiment, the multimer comprises monomer domains with specificities for different target molecules.
- multimers of such diverse monomer domains can specifically bind different components of a viral replication system or different serotypes of a virus.
- at least one monomer domain binds to a toxin and at least one monomer domain binds to a cell surface molecule, thereby acting as a mechanism to target the toxin.
- at least two monomer domains and/or immuno-domains of the multimer bind to different target molecules in a target cell or tissue.
- therapeutic molecules can be targeted to the cell or tissue by binding a therapeutic agent to a monomer of the multimer that also contains other monomer domains and/or immuno-domains having cell or tissue binding specificity.
- the different target molecules can be related or unrelated.
- a multimer examples include members of a protein family or different serotypes of a virus.
- the monomer domains and/or iimnuno-domains of a multimer can target different molecules in a physiological pathway (e.g., different blood coagulation proteins).
- monomer domains and/or immuno-domains bind to proteins in unrelated pathways (e.g., two domains bind to blood factors, two other domains and/or immuno-domains bind to inflammation-related proteins and a fifth binds to serum albumin).
- a multimer is comprised of monomer domains that bind to different pathogens or contaminants of interest.
- Multimers are useful to as a single detection agent capable of detecting for the possibility of any of a number of pathogens or contaminants.
- Multimers can comprise a variety of combinations of monomer domains.
- the selected monomer domains can be the same or identical, optionally, different or non-identical.
- the selected monomer domains can comprise various different monomer domains from the same monomer domain family, or various monomer domains from different domain families, or optionally, a combination of both.
- Multimers that are generated in the practice of the present invention may be any of the following:
- a homo-multimer (a multimer of the same domain, i.e., A1-A1-A1-A1);
- hetero-multimer include multimers where Al, A2, A3 and A4 are different non-naturally occurring variants of a particular LDL-receptor class A domains, or where some of Al, A2, A3, and A4 are naturally-occurring variants of a LDL-receptor class A domain (see, e.g., Figure 10).
- Multimer libraries employed in the practice of the present invention may contain homo-multimers, hetero-multimers of different monomer domains (natural or non-natural) of the same monomer class, or hetero-multimers of monomer domains (natural or non-natural) from different monomer classes, or combinations thereof.
- Exemplary heteromultimers comprising immuno-domains include dimers of, e.g., minibodies, single domain antibodies and Fabs, wherein the dimers are linked by a covalent linker.
- Other exemplary multimers include, e.g., trimers and higher level (e.g., tetramers) multimers of minibodies, single domain antibodies and Fabs.
- Yet more exemplary multimers include, e.g., dimers, trimers and higher level multimers of single chain antibody fragments, wherein the single chain antibodies are not linked covalently.
- Monomer domains, as described herein, are also readily employed in a immuno-domain-containing heteromultimer (i.e., a multimer that has at least one immuno- domain variant and one monomer domain variant).
- multimers of the present invention may have at least one immuno-domain such as a minibody, a single-domain antibody, a single chain variable fragment (ScFv), or a Fab fragment; and at least one A domain or EGF- like domainas described herein.
- Domains need not be selected before the domains are linked to form multimers.
- the domains can be selected for the ability to bind to a target molecule before being linked into multimers.
- a multimer can comprise two domains that bind to one target molecule and a third domain that binds to a second target molecule.
- they can be generated by a "walking" selection method.
- This method is carried out by providing a library of monomer domains and screening the library of monomer domains for affinity to a first target molecule. Once at least one monomer that binds to the target is identified, that monomer is covalently linked to a new library or each remaining member of the original library of monomer domains. This new library of multimers (dimers) is then screened for multimers that bind to the target with an increased affinity, and a multimer that binds to the target with an increased affinity can be identified.
- the "walking" monomer selection method provides a way to assemble a multimer that is composed of monomers that can act synergistically with each other given the restraints of linker length.
- the walking technique is particularly useful when selecting for and assembling multimers that are able to bind large target proteins with high affinity.
- the walking method can be repeated to add more monomers thereby resulting in a multimer comprising 2, 3, 4, 5, 6, 7, 8 or more monomers linked together.
- the selected multimer comprises more than two domains.
- Such multimers can be generated in a step fashion, e.g., where the addition of each new domain is tested individually and the effect of the domains is tested in a sequential fashion. See, e.g., Figure 6.
- domains are linked to form multimers comprising more than two domains and selected for binding without prior knowledge of how smaller multimers, or alternatively, how each domain, bind.
- the methods of the present invention also include methods of evolving multimers.
- the methods can comprise, e.g., any or all of the following steps: providing a plurality of different nucleic acids, where each nucleic acid encoding a monomer domain; translating the plurality of different nucleic acids, which provides a plurality of different monomer domains; screening the plurality of different monomer domains for binding of the desired ligand or mixture of ligands; identifying members of the plurality of different monomer domains that bind the desired ligand or mixture of ligands, which provides selected monomer domains; joining the selected monomer domains with at least one linker to generate at least one multimer, wherein the at least one multimer comprises at least two of the selected monomer domains and the at least one linker; and, screening the at least one multimer for an improved affinity or avidity or altered specificity for the desired ligand or mixture of ligands as compared to the selected monomer domains.
- Additional variation can be introduced by inserting linkers of different length and composition between domains. This allows for the selection of optimal linkers between domains.
- optimal length and composition of linkers will allow for optimal binding of domains.
- the domains with a particular binding affinity(s) are linked via different linkers and optimal linkers are selected in a binding assay. For example, domains are selected for desired binding properties and then formed into a library comprising a variety of linkers. The library can then be screened to identify optimal linkers. Alternatively, multimer libraries can be formed where the effect of domain or linker on target molecule binding is not known.
- Methods of the present invention also include generating one or more selected multimers by providing a plurality of monomer domains and/or immuno-domains.
- the monomer domains and/or immuno-domains are screened for binding of a desired ligand or mixture of ligands.
- Members of the plurality of domains that bind the desired ligand or mixture of ligands are identified, thereby providing domains with a desired affinity.
- the identified domains are joined with at least one linker to generate the multimers, wherein each multimer comprises at least two of the selected domains and the at least one linker; and, the multimers are screened for an improved affinity or avidity or altered specificity for the desired ligand or mixture of ligands as compared to the selected domains, thereby identifying the one or more selected multimers.
- Selection of multimers can be accomplished using a variety of techniques including those mentioned above for identifying monomer domains. Other selection methods include, e.g., a selection based on an improved affinity or avidity or altered specificity for the ligand compared to selected monomer domains.
- a selection can be based on selective binding to specific cell types, or to a set of related cells or protein types (e.g., different virus serotypes). Optimization of the property selected for, e.g., avidity of a ligand, can then be achieved by recombining the domains, as well as manipulating amino acid sequence of the individual monomer domains or the linker domain or the nucleotide sequence encoding such domains, as mentioned in the present invention.
- One method for identifying multimers can be accomplished by displaying the multimers.
- the multimers are optionally expressed or displayed on a variety of display systems, e.g., phage display, ribosome display, polysome display, nucleotide-linked display (see, e.g., U.S. Patent Nos. 6,281,344; 6,194,550, 6,207,446, 6,214,553, and 6,258,558) and/or cell surface display, as described above.
- Cell surface displays can include but are not limited to E. coli, yeast or mammalian cells.
- display libraries of multimers with multiple binding sites can be panned for avidity or affinity or altered specificity for a ligand or for multiple ligands.
- Monomers or multimers can be screened for target binding activity in yeast cells using a two-hybrid screening assay.
- the monomer or multimer library to be screened is cloned into a vector that directs the formation of a fusion protein between each monomer or multimer of the library and a yeast transcriptional activator fragment (i.e., Gal4).
- Sequences encoding the "target" protein are cloned into a vector that results in the production of a fusion protein between the target and the remainder of the Gal4 protein (the DNA binding domain).
- a third plasmid contains a reporter gene downstream of the DNA sequence of the Gal4 binding site.
- a monomer that can bind to the target protein brings with it the Gal4 activation domain, thus reconstituting a functional Gal4 protein.
- This functional Gal4 protein bound to the binding site upstream of the reporter gene results in the expression of the reporter gene and selection of the monomer or multimer as a target binding protein, (see Chien et.al. (1991) Proc. Natl. Acad. Sci. (USA) 88:9578; Fields S. and Song O. (1989) Nature 340: 245)
- Using a two-hybrid system for library screening is further described in U.S. Patent No. 5,811,238 (see also Silver S.C. and Hunt S.W. (1993) Mol. Biol. Rep. 17:155; Durfee et al.
- Another useful screening system for carrying out the present invention is the E.coli/BCCP interactive screening system (Germino et al. (1993) Proc. Nat. Acad. Sci. (U.S.A.) 90:993; Guarente L. (1993) Proc. Nat. Acad. Sci. (U.S.A.) 90:1639).
- Other variations include the use of multiple binding compounds, such that monomer domains, multimers or libraries of these molecules can be simultaneously screened for a multiplicity of ligands or compounds that have different binding specificity. Multiple predetermined ligands or compounds can be concomitantly screened in a single library, or sequential screening against a number of monomer domains or multimers. In one variation, multiple ligands or compounds, each encoded on a separate bead (or subset of beads), can be mixed and incubated with monomer domains, multimers or libraries of these molecules under suitable binding conditions. The collection of beads, comprising multiple ligands or compounds, can then be used to isolate, by affinity selection, selected monomer domains, selected multimers or library members.
- subsequent affinity screening rounds can include the same mixture of beads, subsets thereof, or beads containing only one or two individual ligands or compounds.
- This approach affords efficient screening, and is compatible with laboratory automation, batch processing, and high throughput screening methods.
- multimers can be simultaneously screened for the ability to bind multiple ligands, wherein each ligand comprises a different label.
- each ligand can be labeled with a different fluorescent label, contacted simultaneously with a multimer or multimer library.
- Multimers with the desired affinity are then identified (e.g., by FACS sorting) based on the presence of the labels linked to the desired labels.
- the selected multimers of the above methods can be further manipulated, e.g., by recombining or shuffling the selected multimers (recombination can occur between or within multimers or both), mutating the selected multimers, and the like. This results in altered multimers which then can be screened and selected for members that have an enhanced property compared to the selected multimer, thereby producing selected altered multimers.
- Linkers, multimers or selected multimers produced by the methods indicated above and below are features of the present invention. Libraries comprising multimers, e.g, a library comprising about 100, 250, 500 or more members produced by the methods of the present invention or selected by the methods of the present invention are provided. In some embodiments, one or more cell comprising members of the libraries, are also included.
- Libraries of the recombinant polypeptides are also a feature of the present invention, e.g., a library comprising about 100, 250, 500 or more different recombinant polypetides.
- the final conformation of the multimers containing immuno-domains can be a ring structure which would offer enhanced stability and other desired characteristics.
- These cyclic multimers can be expressed as a single polypeptide chain or may be assembled from multiple discrete polypeptide chains. Cyclic multimers assembled from discrete polypeptide chains are typically an assembly of two polypeptide chains. The formation of cyclic multimer structures can be vastly effected by the spatial arrangement (i.e., distance and order) and dimerization specificity of the individual domains.
- Parameters such as, for example, linker length, linker composition and order of immuno-domains, can be varied to generate a library of cyclic multimers having diverse structures.
- Libraries of cyclic multimers can be readily screened in accordance with the invention methods described herein, to identify cyclic multimers that bind to desired target molecules.
- a cychzation step can be carried out to generate a library of cyclized multimers that can be further screened for desired binding activity.
- cyclic ring structures can be, for example, composed of a multimer of ScFv immuno-domains wherein the immuno-domains are split such that a coiling of the polypeptide multimer chain is required for the immuno-domains to form their proper dimeric structures (e.g., N-terminus- V L 1-V L 2-V 3-V L 4-V 5-V L 6-V 7-VL8-V H 1-V H 2- V H 3-V H 4-V H 5-V H 6-V H 7-V H 8-C-terminus, orN-terminus-V L l-V H 2-V L 3-VH4-VHl-V L 2-V H 3- V L 4-C-terminus, and the like).
- N-terminus- V L 1-V L 2-V 3-V L 4-V 5-V L 6-V 7-VL8-V H 1-V H 2- V H 3-V H 4-V H 5-V H 6-V H 7-V H 8-C-terminus orN-terminus-V L l-V H 2-V L 3-VH4-V
- the ring could also be formed by the mixing of two polypeptide chains wherein each chain contained half of the immuno-domains.
- one chain contains the V L domains and the other chain contains the V H domains such that the correct pairs of VTW H domains are brought together upon the two strands binding.
- the circularization of the chains can be mandated by changing the frame of the domain order (i.e., polypeptide one: N-terminus-V L l-V L 2-V 3-V L 4-V L 5-V L 6-V L 7-V 8-C-terminus and polypeptide two: N-terminus- V H 4-V H 5-V H 6-V H 7-V H 8-V H 1-V H 2-V H 3 -C-terminus).
- Cyclic multimers can also be formed by encoding or attaching or linking at least one dimerizing domain at or near the N- terminus of a multimer protein and encoding or attaching or linking at least one second dimerizing domain at or near the C- terminus of the multimer protein wherein the first and second dimerization domain have a strong affinity for each other.
- dimerization domain refers to a protein binding domain (of either immunological or non-immunological origin) that has the ability to bind to another protein binding domain with great strength and specificity such as to form a dimer.
- the dimerization domain can form a homodimer in that the domain binds to a protein that is identical to itself.
- the dimerization domain may form a heterodimer in that the domain binds to a protein binding domain that is different from itself.
- Aggregation can be mediated, for example, by the presence of hydrophobic domains on two monomer domains and/or immuno-domains, resulting in the formation of non-covalent interactions between two monomer domains and/or immuno-domains.
- aggregation may be facilitated by one or more monomer domains in a multimer having binding specificity for a monomer domain in another multimer.
- Aggregates can also form due to the presence of affinity peptides on the monomer domains or multimers. Aggregates can contain more target molecule binding domains than a single multimer.
- membrane fluidity can be more flexible than protein linkers in optimizing (by self-assembly) the spacing and valency of the interactions.
- multimers will bind to two different targets, each on a different cell or one on a cell and another on a molecule with multiple binding sites. See. e.g., Figures 27 and 28.
- the monomers or multimers of the present invention are linked to another polypeptide to form a fusion protein. Any polypeptide in the art may be used as a fusion partner, though it can be useful if the fusion partner forms multimers.
- monomers or multimers of the invention may, for example, be fused to the following locations or combinations of locations of an antibody: 1.
- VH1 and/or VL1 domains optionally just after the leader peptide and before the domain starts (framework region 1); 2. At the N-terminus of the CHI or CL1 domain, replacing the VH1 or VL1 domain; 3. At the N-terminus of the heavy chain, optionally after the CHI domain and before the cysteine residues in the hinge (Fc-fusion); 4. At the N-terminus of the CH3 domain; 5. At the C-terminus of the CH3 domain, optionally attached to the last amino acid residue via a short linker; 6. At the C-terminus of the CH2 domain, replacing the CH3 domain; 7.
- the monomer or multimer domain is linked to a molecule (e.g., a protein, nucleic acid, organic small molecule, etc.) useful as a pharmaceutical.
- a molecule e.g., a protein, nucleic acid, organic small molecule, etc.
- pharmaceutical proteins include, e.g., cytokines, antibodies, chemokines, growth factors, interleukins, cell-surface proteins, extracellular domains, cell surface receptors, cytotoxins, etc.
- Exemplary small molecule pharmaceuticals include small molecule toxins or therapeutic agents.
- the monomer or multimers are selected to bind to a tissue- or disease-specific target protein.
- Tissue-specific proteins are proteins that are expressed exclusively, or at a significantly higher level, in one or several particular tissue(s) compared to other tissues in an animal.
- disease-specific proteins are proteins that are expressed exclusively, or at a significantly higher level, in one or several diseased cells or tissues compared to other non-diseased cells or tissues in an animal.
- diseases include, but are not limited to, a cell proliferative disorder such as actinic keratosis, arteriosclerosis, atherosclerosis, bursitis, cirrhosis, hepatitis, mixed connective tissue disease (MCTD), myelofibrosis, paroxysmal nocturnal hemoglobinuria, polycythemia vera, psoriasis, primary thrombocythemia, and cancers including adenocarcinoma, leukemia, lymphoma, melanoma, myeloma, sarcoma, teratocarcinorna, and, in particular, a cancer of the adrenal gland, bladder, bone, bone marrow, brain, breast, cervix, gall bladder, ganglia, gastrointestinal tract, heart, kidney, liver, lung, muscle, ovary, pancreas, parathyroid, penis, prostate, salivary glands, skin, spleen, testis, thy
- Exemplary disease or conditions include, e.g., MS, SLE, ITP, IDDM, MG, CLL, CD, RA, Factor VIII Hemophilia, transplantation, arteriosclerosis, Sjogren's Syndrome, Kawasaki Disease, anti-phospholipid Ab, AHA, ulcerative colitis, multiple myeloma, Glomeralonephritis, seasonal allergies, and IgA Nephropathy.
- the monomers or multimers that bind to the target protein are linked to the pharmaceutical protein or small molecule such that the resulting complex or fusion is targeted to the specific tissue or disease-related cell(s) where the target protein is expressed.
- Monomers or multimers for use in such complexes or fusions can be initially selected for binding to the target protein and may be subsequently selected by negative selection against other cells or tissue (e.g., to avoid targeting bone marrow or other tissues that set the lower limit of drug toxicity) where it is desired that binding be reduced or eliminated in other non-target cells or tissues.
- negative selection against other cells or tissue e.g., to avoid targeting bone marrow or other tissues that set the lower limit of drug toxicity
- the therapeutic window is increased so that a higher dose may be administered safely.
- in vivo panning can be performed in animals by injecting a library of monomers or multimers into an animal and then isolating the monomers or multimers that bind to a particular tissue or cell of interest.
- the fusion proteins described above may also include a linker peptide between the pharmaceutical protein and the monomer or multimers.
- a peptide linker sequence may be employed to separate, for example, the polypeptide components by a distance sufficient to ensure that each polypeptide folds into its secondary and tertiary structures.
- Fusion proteins may generally be prepared using standard techniques, including chemical conjugation. Fusion proteins can also be expressed as recombinant proteins in an expression system by standard techniques.
- Exemplary tissue-specific or disease-specific proteins can be found in, e.g., Tables I and II of U.S. Patent Publication No 2002/0107215.
- Exemplary tissues where target proteins may be specifically expressed include, e.g., liver, pancreas, adrenal gland, thyroid, salivary gland, pituitary gland, brain, spinal cord, lung, heart, breast, skeletal muscle, bone marrow, thymus, spleen, lymph node, colorectal, stomach, ovarian, small intestine, uterus, placenta, prostate, testis, colon, colon, gastric, bladder, trachea, kidney, or adipose tissue.
- Multimers or monomer domains of the invention can be produced according to any methods known in the art. In some embodiments, E.
- polypeptides comprising a pET- derived plasmid encoding the polypeptides are induced to express the protein. After harvesting the bacteria, they may be lysed and clarified by centrifugation. The polypeptides may be purified using Ni-NTA agarose elution and refolded by dialysis. Misfolded proteins may be neutralized by capping free sulfhydrils with iodoacetic acid. Q sepharose elution, butyl sepharose FT, SP sepharose elution, Q sepharose elution, and or SP sepharose elution may be used to purify the polypeptides.
- Monomer domains can be joined by a linker to form a multimer.
- a linker is positioned between each separate discrete monomer domain in a multimer.
- immuno-domains are also linked to each other or to monomer domains via a linker moiety.
- Joining the selected monomer domains via a linker can be accomplished using a variety of techniques known in the art. For example, combinatorial assembly of polynucleotides encoding selected monomer domains can be achieved by restriction digestion and re-ligation, by PCR-based, self-priming overlap reactions, or other recombinant methods.
- the linker can be attached to a monomer before the monomer is identified for its ability to bind to a target multimer or after the monomer has been selected for the ability to bind to a target multimer.
- the linker can be naturally-occurring, synthetic or a combination of both.
- the synthetic linker can be a randomized linker, e.g., both in sequence and size, h one aspect, the randomized linker can comprise a fully randomized sequence, or optionally, the randomized linker can be based on natural linker sequences.
- the linker can comprise, e.g,. a non-polypeptide moiety, a polynucleotide, a polypeptide or the like.
- a linker can be rigid, or flexible, or a combination of both. Linker flexibility can be a function of the composition of both the linker and the monomer domains that the linker interacts with.
- the linker joins two selected monomer domain, and maintains the monomer domains as separate discrete monomer domains.
- the linker can allow the separate discrete monomer domains to cooperate yet maintain separate properties such as multiple separate binding sites for the same ligand in a multimer, or e.g., multiple separate binding sites for different ligands in a multimer.
- Choosing a suitable linker for a specific case where two or more monomer domains (i.e. polypeptide chains) are to be connected may depend on a variety of parameters including, e.g.
- the present invention provides methods for optimizing the choice of linker once the desired monomer domains/variants have been identified.
- libraries of multimers having a composition that is fixed with regard to monomer domain composition, but variable in linker composition and length can be readily prepared and screened as described above.
- the linker polypeptide may predominantly include amino acid residues selected from the group consisting of Gly, Ser, Ala and Thr.
- the peptide linker may contain at least 75% (calculated on the basis of the total number of residues present in the peptide linker), such as at least 80%, e.g. at least 85% or at least 90% of amino acid residues selected from the group consisting of Gly, Ser, Ala and Thr.
- the peptide linker may also consist of Gly, Ser, Ala and/or Thr residues only.
- the linker polypeptide should have a length, which is adequate to link two monomer domains in such a way that they assume the correct conformation relative to one another so that they retain the desired activity, for example as antagonists of a given receptor.
- a suitable length for this purpose is a length of at least one and typically fewer than about 50 amino acid residues, such as 2-25 amino acid residues, 5-20 amino acid residues, 5-15 amino acid residues, 8-12 amino acid residues or 11 residues.
- the polypeptide encoding a linker can range in size, e.g., from about 2 to about 15 amino acids, from about 3 to about 15, from about 4 to about 12, about 10, about 8, or about 6 amino acids.
- the polynucleotide containing the linker sequence can be, e.g., between about 6 nucleotides and about 45 nucleotides, between about 9 nucleotides and about 45 nucleotides, between about 12 nucleotides and about 36 nucleotides, about 30 nucleotides, about 24 nucleotides, or about 18 nucleotides.
- the amino acid residues selected for inclusion in the linker polypeptide should exhibit properties that do not interfere significantly with the activity or function of the polypeptide multimer.
- the peptide linker should on the whole not exhibit a charge which would be inconsistent with the activity or function of the polypeptide multimer, or interfere with internal folding, or form bonds or other interactions with amino acid residues in one or more of the monomer domains which would seriously impede the binding of the polypeptide multimer to the target in question.
- the peptide linker is selected from a library where the amino acid residues in the peptide linker are randomized for a specific set of monomer domains in a particular polypeptide multimer.
- a flexible linker could be used to find suitable combinations of monomer domains, which is then optimized using this random library of variable linkers to obtain linkers with optimal length and geometry.
- the optimal linkers may contain the minimal number of amino acid residues of the right type that participate in the binding to the target and restrict the movement of the monomer domains relative to each other in the polypeptide multimer when not bound to the target.
- peptide linkers are widely used for production of single-chain antibodies where the variable regions of a light chain (V L ) and a heavy chain (V H ) are joined through an artificial linker, and a large number of publications exist within this particular field.
- a widely used peptide linker is a 15mer consisting of tliree repeats of a Gly-Gly-Gly-Gly-Ser (SEQ ID NO: 240) amino acid sequence ((Gly 4 Ser) 3 ).
- linkers have been used, and phage display technology, as well as, selective infective phage technology has been used to diversify and select appropriate linker sequences (Tang et al. (1996), J. Biol Chem. 271, 15682-15686; Hennecke et al. (1998), Protein Eng. 11, 405- 410).
- Peptide linkers have been used to connect individual chains in hetero- and homo- dimeric proteins such as the T-cell receptor, the lambda Cro repressor, the P22 phage Arc repressor, IL-12, TSH, FSH, IL-5, and interferon- ⁇ . Peptide linkers have also been used to create fusion polypeptides.
- linker length and composition for increased stability of the single-chain protein
- Robotson and Sauer 1998, Proc. Natl. Acad. Sci. USA 95, 5929-5934.
- Another type of linker is an intein, i.e. a peptide stretch which is expressed with the single-chain polypeptide, but removed post-translationally by protein splicing. The use of inteins is reviewed by F.S. Gimble in Chemistry and Biology, 1998, Vol 5, No. 10 pp. 251-256.
- Still another way of obtaining a suitable linker is by optimizing a simple linker, e.g.
- the peptide linker possess at least some flexibility. Accordingly, in some embodiments, the peptide linker contains 1-25 glycine residues, 5-20 glycine residues, 5-15 glycine residues or 8-12 glycine residues. The peptide linker will typically contain at least 50% glycine residues, such as at least 75% glycine residues. In some embodiments of the invention, the peptide linker comprises glycine residues only.
- the peptide linker may, in addition to the glycine residues, comprise other residues, in particular residues selected from the group consisting of Ser, Ala and Thr, in particular Ser.
- a specific peptide linker includes a peptide linker having the amino acid sequence Gly x -Xaa-Gly y -Xaa-Gly z (SEQ ID NO: 203), wherein each Xaa is independently selected from the group consisting Ala, Val, Leu, He, Met, Phe, Trp, Pro, Gly, Ser, Thr, Cys, Tyr, Asn, Gin, Lys, Arg, His, Asp and Glu, and wherein x, y and z are each integers in the range from 1-5.
- each Xaa is independently selected from the group consisting of Ser, Ala and Thr, in particular Ser. More particularly, the peptide linker has the amino acid sequence Gly-Gly-Gly-Xaa-Gly-Gly-Gly-Xaa-Gly-Gly-Gly- Gly- Gly (SEQ ID NO: 204), wherein each Xaa is independently selected from the group consisting Ala, Val, Leu, He, Met, Phe, T ⁇ , Pro, Gly, Ser, Thr, Cys, Tyr, Asn, Gin, Lys, Arg, His, Asp and Glu. In some embodiments, each Xaa is independently selected from the group consisting of Ser, Ala and Thr, in particular Ser.
- the peptide linker comprises at least one proline residue in the amino acid sequence of the peptide linker.
- the peptide linker has an amino acid sequence, wherein at least 25%), such as at least 50%, e.g. at least 75%, of the amino acid residues are proline residues, hi one particular embodiment of the invention, the peptide linker comprises proline residues only.
- the peptide linker is modified in such a way that an amino acid residue comprising an attachment group for a non- polypeptide moiety is introduced.
- amino acid residues may be a cysteine residue (to which the non-polypeptide moiety is then subsequently attached) or the amino acid sequence may include an in vivo N-glycosylation site (thereby attaching a sugar moiety (in vivo) to the peptide linker).
- the peptide linker comprises at least one cysteine residue, such as one cysteine residue.
- the peptide linker comprises amino acid residues selected from the group consisting of Gly, Ser, Ala, Thr and Cys. In some embodiments, such a peptide linker comprises one cysteine residue only. [185] In a further embodiment, the peptide linker comprises glycine residues and cysteine residue, such as glycine residues and cysteine residues only. Typically, only one cysteine residue will be included per peptide linker.
- a specific peptide linker comprising a cysteine residue includes a peptide linker having the amino acid sequence Gly n -Cys-Gly m (SEQ ID NO: 205), wherein n and m are each integers from 1-12, e.g., from 3-9, from 4-8, or from 4-7. More particularly, the peptide linker may have the amino acid sequence GGGGG-C-GGGGG (SEQ ID NO: 206). [186] This approach (i.e. introduction of an amino acid residue comprising an attachment group for a non-polypeptide moiety) may also be used for the more rigid proline-containing linkers.
- the peptide linker may comprise proline and cysteine residues, such as proline and cysteine residues only.
- An example of a specific proline-containing peptide linker comprising a cysteine residue includes a peptide linker having the amino acid sequence Pro n -Cys-Pro m (SEQ ID NO: 207), wherein n and m are each integers from 1-12, preferably from 3-9, such as from 4-8 or from 4-7. More particularly, the peptide linker may have the amino acid sequence PPPPP-C-PPPPP (SEQ ID NO: 208).
- the pu ⁇ ose of introducing an amino acid residue, such as a cysteine residue, comprising an attachment group for a non-polypeptide moiety is to subsequently attach a non-polypeptide moiety to said residue.
- non-polypeptide moieties can improve the serum half-life of the polypeptide multimer.
- the cysteine residue can be covalently attached to a non-polypeptide moiety.
- Preferred examples of non-polypeptide moieties include polymer molecules, such as PEG or mPEG, in particular mPEG as well as non-polypeptide therapeutic agents.
- amino acid residues other than cysteine may be used for attaching a non-polypeptide to the peptide linker.
- One particular example of such other residue includes coupling the non-polypeptide moiety to a lysine residue.
- Another possibility of introducing a site-specific attachment group for a non-polypeptide moiety in the peptide linker is to introduce an in vivo N-glycosylation site, such as one in vivo N-glycosylation site, in the peptide linker.
- an in vivo N- glycosylation site may be introduced in a peptide linker comprising amino acid residues selected from the group consisting of Gly, Ser, Ala and Thr.
- nucleotide sequence encoding the polypeptide multimer must be inserted in a glycosylating, eukaryotic expression host.
- a specific example of a peptide linker comprising an in vivo N- glycosylation site is a peptide linker having the amino acid sequence Gly n -Asn-Xaa-Ser/Thr- Gly m (SEQ ID NO: 209), preferably Gly n -Asn-Xaa-Thr-Gly m (SEQ ID NO: 210), wherein Xaa is any amino acid residue except proline, and wherein n and m are each integers in the range from 1-8, preferably in the range from 2-5. [191] Often, the amino acid sequences of all peptide linkers present in the polypeptide multimer will be identical.
- the amino acid sequences of all peptide linkers present in the polypeptide multimer may be different.
- the latter is believed to be particular relevant in case the polypeptide multimer is a polypeptide tri-mer or tetra-mer and particularly in such cases where an amino acid residue comprising an attachment group for a non-polypeptide moiety is included in the peptide linker.
- the amino acid sequences of all peptide linkers present in the polypeptide multimer are identical except for one, two or three peptide linkers, such as except for one or two peptide linkers, in particular except for one peptide linker, which has/have an amino acid sequence comprising an amino acid residue comprising an attachment group for a non-polypeptide moiety.
- Preferred examples of such amino acid residues include cysteine residues of in vivo N-glycosylation sites.
- a linker can be a native or synthetic linker sequence.
- An exemplary native linker includes, e.g., the sequence between the last cysteine of a first LDL receptor A domain and the first cysteine of a second LDL receptor A domain can be used as a linker sequence.
- Analysis of various A domain linkages reveals that native linkers range from at least 3 amino acids to fewer than 20 amino acids, e.g., 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or 18 amino acids long. However, those of skill in the art will recognize that longer or shorter linker sequences can be used.
- An exemplary A domain linker sequence is depicted in Figure 8.
- the linker is a 6-mer of the following sequence A ⁇ A 2 A 3 A 4 A 5 A 6 (SEQ ID NO: 244), wherein Ai is selected from the amino acids A, P, T, Q, E and K; A 2 and A 3 are any amino acid except C, F, Y, W, or M; ⁇ is selected from the amino acids S, G and R; A 5 is selected from the amino acids Hj P, and R; and A 6 is the amino acid, T.
- Ai is selected from the amino acids A, P, T, Q, E and K
- a 2 and A 3 are any amino acid except C, F, Y, W, or M
- ⁇ is selected from the amino acids S, G and R
- a 5 is selected from the amino acids Hj P, and R
- a 6 is the amino acid, T.
- Methods for generating multimers from monomer domains and/or immuno-domains can include joining the selected domains with at least one linker to generate at least one multimer, e.g., the multimer can comprise at least two of the monomer domains and/or immuno-domains and the linker.
- the multimer(s) is then screened for an improved avidity or affinity or altered specificity for the desired ligand or mixture of ligands as compared to the selected monomer domains.
- a composition of the multimer produced by the method is included in the present invention.
- the selected multimer domains are joined with at least one linker to generate at least two multimers, wherein the two multimers comprise two or more of the selected monomer domains and the linker.
- multimers of the present invention are a single discrete polypeptide.
- Multimers of partial linker-domain-partial linker moieties are an association of multiple polypeptides, each corresponding to a partial linker-domain-partial linker moiety.
- Suitable linkers employed in the practice of the present invention include an obligate heterodimer of partial linker moieties.
- obligate heterodimer refers herein to a dimer of two partial linker moieties that differ from each other in composition, and which associate with each other in a non- covalent, specific manner to join two domains together.
- the specific association is such that the two partial linkers associate substantially with each other as compared to associating with other partial linkers.
- multimers of the present invention that are expressed as a single polypeptide, multimers of domains that are linked together via heterodimers are assembled from discrete partial linker-monomer-partial linker units. Assembly of the heterodimers can be achieved by, for example, mixing.
- each partial linker-monomer-partial linker unit may be expressed as a discrete peptide prior to multimer assembly.
- a disulfide bond can be added to covalently lock the peptides together following the correct non-covalent pairing.
- a multimer containing such obligate heterodimers is depicted in Figure 11.
- Partial linker moieties that are appropriate for forming obligate heterodimers include, for example, polynucleotides, polypeptides, and the like.
- binding domains are produced individually along with their unique linking peptide (i.e., a partial linker) and later combined to form multimers.
- Partial linkers can contain terminal amino acid sequences that specifically bind to a defined heterologous amino acid sequence.
- An example of such an amino acid sequence is the Hydra neuropeptide head activator as described in Bodenmuller et al., The neuropeptide head activator loses its biological activity by dimerization, (1986) EMBO J 5(8):1825-1829. See, e.g., U.S. Patent No. 5,491,074 and WO 94/28173.
- partial linkers allow the multimer to be produced first as monomer-partial linker units or partial linker-monomer-partial linker units that are then mixed together and allowed to assemble into the ideal order based on the binding specificities of each partial linker.
- monomers linked to partial linkers can be contacted to a surface, such as a cell, in which multiple monomers can associate to form higher avidity complexes via partial linkers, hi some cases, the association will form via random Brownian motion.
- each monomer domain has an upstream and a downstream partial linker (i.e., Lp-domain-Lp, where "Lp" is a representation of a partial linker) that contains a DNA binding protein with exclusively unique DNA binding specificity.
- Lp-domain-Lp a partial linker
- Lp is a representation of a partial linker
- These domains can be produced individually and then assembled into a specific multimer by the mixing of the domains with DNA fragments containing the proper nucleotide sequences (i.e., the specific recognition sites for the DNA binding proteins of the partial linkers of the two desired domains) so as to join the domains in the desired order. Additionally, the same domains may be assembled into many different multimers by the addition of DNA sequences containing various combinations of DNA binding protein recognition sites.
- the present invention also includes methods of therapeutically or prophylactically treating a disease or disorder by administering in vivo or ex vivo one or more nucleic acids or polypeptides of the invention described above (or compositions comprising a pharmaceutically acceptable excipient and one or more such nucleic acids or polypeptides) to a subject, including, e.g., a mammal, including a human, primate, mouse, pig, cow, goat, rabbit, rat, guinea pig, hamster, horse, sheep; or a non-mammalian vertebrate such as a bird (e.g., a chicken or duck), fish, or invertebrate.
- a mammal including a human, primate, mouse, pig, cow, goat, rabbit, rat, guinea pig, hamster, horse, sheep; or a non-mammalian vertebrate such as a bird (e.g., a chicken or duck), fish, or inverteb
- one or more cells or a population of cells of interest of the subject e.g., tumor cells, tumor tissue sample, organ cells, blood cells, cells of the skin, lung, heart, muscle, brain, mucosae, liver, intestine, spleen, stomach, lymphatic system, cervix, vagina, prostate, mouth, tongue, etc.
- a selected monomer domain and/or multimer of the invention that is effective in prophylactically or therapeutically treating the disease, disorder, or other condition.
- the contacted cells are then returned or delivered to the subject to the site from which they were obtained or to another site (e.g., including those defined above) of interest in the subject to be treated.
- the contacted cells can be grafted onto a tissue, organ, or system site (including all described above) of interest in the subject using standard and well-known grafting techniques or, e.g., delivered to the blood or lymph system using standard delivery or transfusion techniques.
- the invention also provides in vivo methods in which one or more cells or a population of cells of interest of the subject are contacted directly or indirectly with an amount of a selected monomer domain and/or multimer of the invention effective in prophylactically or therapeutically treating the disease, disorder, or other condition.
- the selected monomer domain and/or multimer is typically administered or transfened directly to the cells to be treated or to the tissue site of interest (e.g., tumor cells, tumor tissue sample, organ cells, blood cells, cells of the skin, lung, heart, muscle, brain, mucosae, liver, intestine, spleen, stomach, lymphatic system, cervix, vagina, prostate, mouth, tongue, etc.) by any of a variety of formats, including topical administration, injection (e.g., by using a needle or syringe), or vaccine or gene gun delivery, pushing into a tissue, organ, or skin site.
- the tissue site of interest e.g., tumor cells, tumor tissue sample, organ cells, blood cells, cells of the skin, lung, heart, muscle, brain, mucosae, liver, intestine, spleen, stomach, lymphatic system, cervix, vagina, prostate, mouth, tongue, etc.
- the selected monomer domain and/or multimer can be delivered, for example, intramuscularly, intradermally, subdermally, subcutaneously, orally, intraperitoneally, intrathecally, intravenously, or placed within a cavity of the body (including, e.g., during surgery), or by inhalation or vaginal or rectal administration.
- the proteins of the invention are prepared at concentrations of at least 25 mg/ml, 50 mg/ml, 75 mg/ml, 100 mg/ml, 150 mg/ml or more. Such concentratiuons are useful, for example, for subcutaneous formulations.
- the selected monomer domain and/or multimer is typically administered or transferred indirectly to the cells to be treated or to the tissue site of interest, including those described above (such as, e.g., skin cells, organ systems, lymphatic system, or blood cell system, etc.), by contacting or administering the polypeptide of the invention directly to one or more cells or population of cells from which treatment can be facilitated.
- tumor cells within the body of the subject can be treated by contacting cells of the blood or lymphatic system, skin, or an organ with a sufficient amount of the selected monomer domain and/or multimer such that delivery of the selected monomer domain and/or multimer to the site of interest (e.g., tissue, organ, or cells of interest or blood or lymphatic system within the body) occurs and effective prophylactic or therapeutic treatment results.
- site of interest e.g., tissue, organ, or cells of interest or blood or lymphatic system within the body
- Such contact, administration, or transfer is typically made by using one or more of the routes or modes of administration described above.
- the invention provides ex vivo methods in which one or more cells of interest or a population of cells of interest of the subject (e.g., tumor cells, tumor tissue sample, organ cells, blood cells, cells of the skin, lung, heart, muscle, brain, mucosae, liver, intestine, spleen, stomach, lymphatic system, cervix, vagina, prostate, mouth, tongue, etc.) are obtained or removed from the subject and transformed by contacting said one or more cells or population of cells with a polynucleotide construct comprising a nucleic acid sequence of the invention that encodes a biologically active polypeptide of interest (e.g., a selected monomer domain and/or multimer) that is effective in prophylactically or therapeutically treating the disease, disorder, or other condition.
- a polynucleotide construct comprising a nucleic acid sequence of the invention that encodes a biologically active polypeptide of interest (e.g., a selected monomer domain and/or multimer) that is effective in
- the one or more cells or population of cells is contacted with a sufficient amount of the polynucleotide construct and a promoter controlling expression of said nucleic acid sequence such that uptake of the polynucleotide construct (and promoter) into the cell(s) occurs and sufficient expression of the target nucleic acid sequence of the invention results to produce an amount of the biologically active polypeptide, encoding a selected monomer domain and/or multimer, effective to prophylactically or therapeutically treat the disease, disorder, or condition.
- the polynucleotide construct can include a promoter sequence (e.g., CMV promoter sequence) that controls expression of the nucleic acid sequence of the invention and/or, if desired, one or more additional nucleotide sequences encoding at least one or more of another polypeptide of the invention, a cytokine, adjuvant, or co-stimulatory molecule, or other polypeptide of interest.
- a promoter sequence e.g., CMV promoter sequence
- additional nucleotide sequences encoding at least one or more of another polypeptide of the invention, a cytokine, adjuvant, or co-stimulatory molecule, or other polypeptide of interest.
- the transformed cells are returned, delivered, or transferred to the subject to the tissue site or system from which they were obtained or to another site (e.g., tumor cells, tumor tissue sample, organ cells, blood cells, cells of the skin, lung, heart, muscle, brain, mucosae, liver, intestine, spleen, stomach, lymphatic system, cervix, vagina, prostate, mouth, tongue, etc.) to be treated in the subject.
- the cells can be grafted onto a tissue, skin, organ, or body system of interest in the subject using standard and well-known grafting techniques or delivered to the blood or lymphatic system using standard delivery or transfusion techniques.
- transfonned cells are typically made by using one or more of the routes or modes of administration described above.
- Expression of the target nucleic acid occurs naturally or can be induced (as described in greater detail below) and an amount of the encoded polypeptide is expressed sufficient and effective to treat the disease or condition at the site or tissue system.
- the invention provides in vivo methods in which one or more cells of interest or a population of cells of the subject (e.g., including those cells and cells systems and subjects described above) are transformed in the body of the subject by contacting the cell(s) or population of cells with (or administering or transferring to the cell(s) or population of cells using one or more of the routes or modes of administration described above) a polynucleotide construct comprising a nucleic acid sequence of the invention that encodes a biologically active polypeptide of interest (e.g., a selected monomer domain and/or multimer) that is effective in prophylactically or therapeutically treating the disease, disorder, or other condition.
- a biologically active polypeptide of interest e.g., a selected monomer domain and/or multimer
- the polynucleotide construct can be directly administered or transferred to cell(s) suffering from the disease or disorder (e.g., by direct contact using one or more of the routes or modes of administration described above).
- the polynucleotide construct can be indirectly administered or transferred to cell(s) suffering from the disease or disorder by first directly contacting non-diseased cell(s) or other diseased cells using one or more of the routes or modes of administration described above with a sufficient amount of the polynucleotide construct comprising the nucleic acid sequence encoding the biologically active polypeptide, and a promoter controlling expression of the nucleic acid sequence, such that uptake of the polynucleotide construct (and promoter) into the cell(s) occurs and sufficient expression of the nucleic acid sequence of the invention results to produce an amount of the biologically active polypeptide effective to prophylactically or therapeutically treat the disease or disorder, and whereby the polynucleotide construct or the resulting expressed polypeptide is transferred naturally or automatically
- the polynucleotide construct can include a promoter sequence (e.g., CMV promoter sequence) that controls expression of the nucleic acid sequence and/or, if desired, one or more additional nucleotide sequences encoding at least one or more of another polypeptide of the invention, a cytokine, adjuvant, or co-stimulatory molecule, or other polypeptide of interest.
- a promoter sequence e.g., CMV promoter sequence
- additional nucleotide sequences encoding at least one or more of another polypeptide of the invention, a cytokine, adjuvant, or co-stimulatory molecule, or other polypeptide of interest.
- compositions comprising an excipient and the polypeptide or nucleic acid of the invention can be administered or delivered.
- a composition comprising a pharmaceutically acceptable excipient and a polypeptide or nucleic acid of the invention is administered or delivered to the subject as described above in an amount effective to treat the disease or disorder.
- the amount of polynucleotide administered to the cell(s) or subject can be an amount such that uptake of said polynucleotide into one or more cells of the subject occurs and sufficient expression of said nucleic acid sequence results to produce an amount of a biologically active polypeptide effective to enhance an immune response in the subject, including an immune response induced by an immunogen (e.g., antigen).
- an immunogen e.g., antigen
- the amount of polypeptide administered to cell(s) or subject can be an amount sufficient to enhance an immune response in the subject, including that induced by an immunogen (e.g., antigen).
- the expression of the polynucleotide construct can be induced by using an inducible on- and off-gene expression system.
- on- and off-gene expression systems include the Tet-OnTM Gene Expression System and Tet-OffTM Gene Expression System (see, e.g., Clontech Catalog 2000, pg. 110-111 for a detailed description of each such system), respectively.
- Tet-OnTM Gene Expression System and Tet-OffTM Gene Expression System
- expression of the target nucleic of the polynucleotide construct can be regulated in a precise, reversible, and quantitative manner.
- Gene expression of the target nucleic acid can be induced, for example, after the stable transfected cells containing the polynucleotide construct comprising the target nucleic acid are delivered or transferred to or made to contact the tissue site, organ or system of interest.
- Such systems are of particular benefit in treatment methods and formats in which it is advantageous to delay or precisely control expression of the target nucleic acid (e.g., to allow time for completion of surgery and/or healing following surgery; to allow time for the polynucleotide construct comprising the target nucleic acid to reach the site, cells, system, or tissue to be treated; to allow time for the graft containing cells transformed with the construct to become inco ⁇ orated into the tissue or organ onto or into which it has been spliced or attached, etc.).
- the target nucleic acid e.g., to allow time for completion of surgery and/or healing following surgery; to allow time for the polynucleotide construct comprising the target nucleic acid to reach the site, cells, system, or tissue to be treated; to allow time for the graft containing cells transformed with the construct to become inco ⁇ orated into the tissue or organ onto or into which it has been spliced or attached, etc.
- the potential applications of multimers of the present invention are diverse and include any use where an affinity agent is desired.
- the invention can be used in the application for creating antagonists, where the selected monomer domains or multimers block the interaction between two proteins.
- the invention can generate agonists.
- multimers binding two different proteins, e.g., enzyme and substrate can enhance protein function, including, for example, enzymatic activity and/or substrate conversion.
- Other applications include cell targeting. For example, multimers consisting of monomer domains and/or immuno-domains that recognize specific cell surface proteins can bind selectively to certain cell types. Applications involving monomer domains and/or immuno-domains as antiviral agents are also included.
- the present invention further provides a method for extending the half- life of a protein of interest in an animal.
- the protein of interest can be any protein with therapeutic, prophylactic, or otherwise desirable functionality (including another monomer domain or multimer of the present invention).
- This method comprises first providing a monomer domain that has been identified as a binding protein that specifically binds to a half-life extender such as a blood-carried molecule or cell, such as serum albumin (e.g., human serum albumin), IgG, red blood cells, etc.
- a half-life extender such as a blood-carried molecule or cell, such as serum albumin (e.g., human serum albumin), IgG, red blood cells, etc.
- the half-life extender-binding monomer can be covalently linked to another monomer domain that has a binding affinity for the protein of interest.
- This multimer, optionally binding the protein of interest can be administered to a mammal where they will associate with the half-life extender(e.g., HSA, IgG, red blood cells, etc.) to form a complex.
- the half-life extender-binding monomer being covalently linked to the protein of interest.
- the protein of interest may include a monomer domain, a multimer of monomer domains, or a synthetic drug.
- the half-life extender-binding multimers are typically multimers of at least two domains, chimeric domains, or mutagenized domains and can comprise,or consist of, 2, 3, 4, or more domains.
- Suitable domains can be further screened and selected for binding to a half-life extender.
- the half-life extender-binding multimers are generated in accordance with the methods for making multimers described herein, using, for example, monomer domains pre-screened for half-life extender -binding activity.
- the multimers comprise at least one domain that binds to HSA, IgG, a red blood cell or other half-life extender wherein the domain comprises an A domain or EGF domain motif as provided herein, and the multimer comprises at least a second domain that binds a target molecule, wherein the second domain comprises an A domain or EGF domain motif as provided herein.
- the present invention also provides a method for the suppression of or lowering of an immune response in a mammal. This method comprises first selecting a monomer domain that binds to an immunosuppressive target.
- immunosuppressive target is defined as any protein that when bound by another protein produces an immunosuppressive result in a mammal.
- the immunosuppressive monomer domain can then be either administered directly or can be covalently linked to another monomer domain or to another protein that will provide the desired targeting of the immunosuppressive monomer.
- the immunosuppressive multimers are typically multimers of at least two domains, chimeric domains, or mutangenized domains. Suitable domains include all of those described herein and are further screened and selected for binding to an immunosuppressive target. Immunosuppressive multimers are generated in accordance with the methods for making multimers described herein, using, for example, monomer domains pre-screened for CD40L- binding activity.
- the monomer domains are used for ligand inhibition, ligand clearance or ligand stimulation. Possible ligands in these methods, include, e.g., cytokines or chemokines. [217] If inhibition of ligand binding to a receptor is desired, a monomer domain is selected that binds to the ligand at a portion of the ligand that contacts the ligand's receptor, or that binds to the receptor at a portion of the receptor that binds contacts the ligand, thereby preventing the ligand-receptor interaction.
- the monomer domains can optionally be linked to a half-life extender, if desired.
- Ligand clearance refers to modulating the half-life of a soluble ligand in bodily fluid. For example, most monomer domains, absent a half-life extender, have a short half-life. Thus, binding of a monomer domain to the ligand will reduce the half-life of the ligand, thereby reducing ligand concentration. The portion of the ligand bound by the monomer domain will generally not matter, though it may be beneficial to bind the ligand at the portion of the ligand that binds to its receptor, thereby further inhibiting the ligand's effect. This method is useful for reducing the concentration of any molecule in the bloodstream.
- a multimer comprising a first monomer domain that binds to a half-life extender and a second monomer domain that binds to a portion of the ligand that does not bind to the ligand's receptor can be used to increase the half-life of the ligand.
- a multimer comprising a first monomer domain that binds to the ligand and a second monomer domain that binds to the receptor can be used to increase the effective affinity of the ligand for the receptor.
- multimers comprising at least two monomers that bind to receptors are used to bring two receptors into proximity by both binding the multimer, thereby activating the receptors.
- multimers with two different monomers can be used to employ a target-driven avidity increase.
- a first monomer can be targeted to a cell surface molecule on a first cell type and a second monomer can be targeted to a surface molecule on a second cell type.
- binding will occur between the cells once an initial binding event occurs between one multimer and two cells, other multimers will also bind both cells.
- Further examples of potential uses of the invention include monomer domains, and multimers thereof, that are capable of drug binding (e.g., binding radionuclides for targeting, pharmaceutical binding for half-life extension of drugs, controlled substance binding for overdose treatment and addiction therapy), immune function modulating (e.g., immunogenicity blocking by binding such receptors as CTLA-4, immunogenicity enhancing by binding such receptors as CD80,or complement activation by Fc type binding), and specialized delivery (e.g., slow release by linker cleavage, electrotransport domains, dimerization domains, or specific binding to: cell entry domains, clearance receptors such as FcR, oral delivery receptors such as plgR for trans-mucosal transport, and blood-brain transfer receptors such as transferrinR).
- drug binding e.g., binding radionuclides for targeting, pharmaceutical binding for half-life extension of drugs, controlled substance binding for overdose treatment and addiction therapy
- immune function modulating e.g., immunogenicity blocking by binding such receptors as
- monomers or multimers with different functionality may be combined to form multimers with combined functions.
- the described HSA- binding monomer and the described CD40L-binding monomer can both be added to another multimer to both lower the immunogenicity and increase the half-life of the multimer.
- monomers or multimers can be linked to a detectable label (e.g., Cy3, Cy5, etc.) or linked to a reporter gene product (e.g., CAT, luciferase, horseradish peroxidase, alkaline phosphotase, GFP, etc.).
- a detectable label e.g., Cy3, Cy5, etc.
- a reporter gene product e.g., CAT, luciferase, horseradish peroxidase, alkaline phosphotase, GFP, etc.
- the monomers of the invention are selected for the ability to bind antibodies from specific animals, e.g., goat, rabbit, mouse, etc., for use as a secondary reagent in detection assays.
- a pair of monomers or multimers are selected to bind to the same target (i.e., for use in sandwich-based assays).
- sandwich-based assays two different proteins comprising different monomer domains typically are able to bind the target protein simultaneously.
- One approach to identify such pairs involves the following:
- One use of the multimers or monomer domains of the invention is use to replace antibodies or other affinity agents in detection or other affinity-based assays.
- monomer domains or multimers are selected against the ability to bind components other than a target in a mixture.
- the general approach can include performing the affinity selection under conditions that closely resemble the conditions of the assay, including mimicking the composition of a sample during the assay.
- a step of selection could include contacting a monomer domain or multimer to a mixture not including the target ligand and selecting against any monomer domains or multimers that bind to the mixture.
- the mixtures abent the target ligand, which could be depleted using an antibody, monomer domain or multimer
- an assay serum, blood, tissue, cells, urine, semen, etc
- polypeptide of the present invention can be altered. Descriptions of a variety of diversity generating procedures for generating modified or altered nucleic acid sequences encoding these polypeptides are described above and below in the following publications and the references cited therein: Soong, N. et al., Molecular breeding of viruses, (2000) Nat Genet 25(4):436-439; Stemmer, et al., Molecular breeding of viruses for targeting and other clinical properties, (1999) Tumor Targeting 4:1-4; Ness et al.,
- Mutational methods of generating diversity include, for example, site- directed mutagenesis (Ling et al., Approaches to DNA mutagenesis: an overview, (1997) Anal Biochem.
- Additional suitable methods include point mismatch repair (Kramer et al., Point Mismatch Repair, (1984) Cell 38:879-887), mutagenesis using repair-deficient host strains (Carter et al., Improved oligonucleotide site-directed mutagenesis using Ml 3 vectors,
- Another aspect of the present invention includes the cloning and expression of monomer domains, selected monomer domains, multimers and/or selected multimers coding nucleic acids.
- multimer domains can be synthesized as a single protein using expression systems well known in the art.
- RNA can be converted into a double stranded DNA suitable for restriction digestion, PCR expansion and sequencing using reverse transcriptase and a polymerase. See, Ausubel, Sambrook and Berger, all supra.
- the present invention also relates to the introduction of vectors of the invention into host cells, and the production of monomer domains, selected monomer domains immuno-domains, multimers and/or selected multimers of the invention by recombinant techniques.
- Host cells are genetically engineered (i.e., transduced, transformed or transfected) with the vectors of this invention, which can be, for example, a cloning vector or an expression vector.
- the vector can be, for example, in the form of a plasmid, a viral particle, a phage, etc.
- the engineered host cells can be cultured in conventional nutrient media modified as appropriate for activating promoters, selecting transformants, or amplifying the monomer domain, selected monomer domain, multimer and/or selected multimer gene(s) of interest.
- the culture conditions such as temperature, pH and the like, are those previously used with the host cell selected for expression, and will be apparent to those skilled in the art and in the references cited herein, including, e.g., Freshney (1994) Culture of Animal Cells, a Manual of Basic Technique, third edition, Wiley- Liss, New York and the references cited therein.
- polypeptides of the invention can also be produced in non-animal cells such as plants, yeast, fungi, bacteria and the like. Indeed, as noted throughout, phage display is an especially relevant technique for producing such polypeptides. In addition to Sambrook, Berger and Ausubel, details regarding cell culture can be found in Payne et al. (1992) Plant Cell and Tissue Culture in Liquid Systems John Wiley & Sons, Inc.
- the present invention also includes alterations of monomer domains, immuno-domains and/or multimers to improve pharmacological properties, to reduce immunogenicity, or to facilitate the transport of the multimer and/or monomer domain into a cell or tissue (e.g., through the blood-brain barrier, or through the skin).
- alterations include a variety of modifications (e.g., the addition of sugar-groups or glycosylation), the addition of PEG, the addition of protein domains that bind a certain protein (e.g., HSA or other serum protein), the addition of proteins fragments or sequences that signal movement or transport into, out of and tlirough a cell. Additional components can also be added to a multimer and/or monomer domain to manipulate the properties of the multimer and/or monomer domain.
- a variety of components can also be added including, e.g., a domain that binds a known receptor (e.g., a Fc-region protein domain that binds a Fc receptor), a toxin(s) or part of a toxin, a prodomain that can be optionally cleaved off to activate the multimer or monomer domain, a reporter molecule (e.g., green fluorescent protein), a component that bind a reporter molecule (such as a radionuclide for radiotherapy, biotin or avidin) or a combination of modifications.
- a domain that binds a known receptor e.g., a Fc-region protein domain that binds a Fc receptor
- a prodomain that can be optionally cleaved off to activate the multimer or monomer domain
- a reporter molecule e.g., green fluorescent protein
- a component that bind a reporter molecule such as a radionuclide for radiotherapy, biotin
- Another aspect of the invention is the development of specific non- human animal models in which to test the immunogenicity of the monomer or multimer domains.
- the method of producing such non-human animal model comprises: introducing into at least some cells of a recipient non-human animal, vectors comprising genes encoding a plurality of human proteins from the same family of proteins, wherein the genes are each operably linked to a promoter that is functional in at least some of the cells into which the vectors are introduced such that a genetically modified non-human animal is obtained that can express the plurality of human proteins from the same family of proteins.
- Suitable non-human animals employed in the practice of the present invention include all vertebrate animals, except humans (e.g., mouse, rat, rabbit, sheep, and the like).
- the plurality of members of a family of proteins includes at least two members of that family, and usually at least ten family members.
- the plurality includes all known members of the family of proteins.
- Exemplary genes that can be used include those encoding monomer domains, such as, for example, members of the LDL receptor class A-domain family, the EGF-like domain family, as well as the other domain families described herein.
- the non-human animal models of the present invention can be used to screen for immunogenicity of a monomer or multimer domain that is derived from the same family of proteins expressed by the non-human animal model.
- the present invention includes the non-human animal model made in accordance with the method described above, as well as transgenic non-human animals whose somatic and germ cells contain and express DNA molecules encoding a plurality of human proteins from the same family of proteins (such as the monomer domains described herein), wherein the DNA molecules have been introduced into the transgenic non-human animal at an embryonic stage, and wherein the DNA molecules are each operably linked to a promoter in at least some of the cells in which the DNA molecules have been introduced.
- FIG. 24 An example of a mouse model useful for screening LDL receptor class A-domain derived binding proteins is described as follows. Gene clusters encoding the wild type human LDL receptor class A-domain monomers are amplified from human cells using PCR. Almost all of the 200 different A-domains can be amplified with only three separate PCR amplification reactions of about 7kb each. These fragments are then used to generate transgenic mice according to the method described above. The transgenic mice will recognize the human A-domains as "self, thus mimicking the "selfhess" of a human with regard to A-domains.
- A-domain-derived monomers or multimers are tested in these mice by injecting the A-domain-derived monomers or multimers into the mice, then analyzing the immune response (or lack of response) generated. The mice are tested to determine if they have developed a mouse anti-human response (MAHR). Monomers and multimers that do not result in the generation of a MAHR are likely to be non-immunogenic when administered to humans. [241] Historically, MAHR test in transgenic mice is used to test individual proteins in mice that are transgenic for that single protein. In contrast, the above described method provides a non-human animal model that recognizes an entire family of human proteins as "self," and that can be used to evaluate a huge number of variant proteins that each are capable of vastly varied binding activities and uses. 10.
- Kits comprising the components needed in the methods (typically in an unmixed form) and kit components (packaging materials, instructions for using the components and/or the methods, one or more containers (reaction tubes, columns, etc.)) for holding the components are a feature of the present invention.
- Kits of the present invention may contain a multimer library, or a single type of multimer. Kits can also include reagents suitable for promoting target molecule binding, such as buffers or reagents that facilitate detection, including detectably-labeled molecules. Standards for calibrating a ligand binding to a monomer domain or the like, can also be included in the kits of the invention.
- the present invention also provides commercially valuable binding assays and kits to practice the assays.
- one or more ligand is employed to detect binding of a monomer domain, immuno-domains and/or multimer.
- Such assays are based on any known method in the art, e.g., flow cytometry, fluorescent microscopy, plasmon resonance, and the like, to detect binding of a ligand(s) to the monomer domain and/or multimer.
- Kits based on the assay are also provided.
- the kits typically include a container, and one or more ligand.
- the kits optionally comprise directions for performing the assays, additional detection reagents, buffers, or instructions for the use of any of these components, or the like.
- kits can include cells, vectors, (e.g., expression vectors, secretion vectors comprising a polypeptide of the invention), for the expression of a monomer domain and/or a multimer of the invention.
- the present invention provides for the use of any composition, monomer domain, immuno-domain, multimer, cell, cell culture, apparatus, apparatus component or kit herein, for the practice of any method or assay herein, and/or for the use of any apparatus or kit to practice any assay or method herein and/or for the use of cells, cell cultures, compositions or other features herein as a therapeutic formulation.
- the manufacture of all components herein as therapeutic formulations for the treatments described herein is also provided.
- the present invention provides computers, computer readable media and integrated systems comprising character strings corresponding to monomer domains, selected monomer domains, multimers and/or selected multimers and nucleic acids encoding such polypeptides. These sequences can be manipulated by in silico shuffling methods, or by standard sequence alignment or word processing software. [247] For example, different types of similarity and considerations of various stringency and character string length can be detected and recognized in the integrated systems herein. For example, many homology determination methods have been designed for comparative analysis of sequences of biopolymers, for spell checking in word processing, and for data retrieval from various databases.
- models that simulate annealing of complementary homologous polynucleotide strings can also be used as a foundation of sequence alignment or other operations typically performed on the character strings corresponding to the sequences herein (e.g., word-processing manipulations, construction of figures comprising sequence or subsequence character strings, output tables, etc.).
- An example of a software package with GOs for calculating sequence similarity is BLAST, which can be adapted to the present invention by inputting character strings corresponding to the sequences herein. [248] BLAST is described in Altschul et al, (1990) J. Mol. Biol.
- HSPs high scoring sequence pairs
- Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always ⁇ 0).
- M forward score for a pair of matching residues; always > 0
- N penalty score for mismatching residues; always ⁇ 0.
- a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
- the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
- W wordlength
- E expectation
- W wordlength
- E expectation
- BLOSUM62 scoring matrix see Henikoff & Henikoff (1989) Proc. Natl. Acad. Sci. USA 89:10915.
- PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments.
- PILEUP uses a simplification of the progressive alignment method of Feng & Doolittle, (1987) J. Mol. Evol. 35:351-360. The method used is similar to the method described by Higgins & Sha ⁇ , (1989) CABIOS 5:151-153.
- the program can align, e.g., up to 300 sequences of a maximum length of 5,000 letters.
- the multiple alignment procedure begins with the pairwise alignment of the two most similar sequences, producing a cluster of two aligned sequences. This cluster can then be aligned to the next most related sequence or cluster of aligned sequences. Two clusters of sequences can be aligned by a simple extension of the pairwise alignment of two individual sequences.
- the final alignment is achieved by a series of progressive, pairwise alignments.
- the program can also be used to plot a dendogram or tree representation of clustering relationships.
- the program is run by designating specific sequences and their amino acid or nucleotide coordinates for regions of sequence comparison. For example, in order to determine conserved amino acids in a monomer domain family or to compare the sequences of monomer domains in a family, the sequence of the invention, or coding nucleic acids, are aligned to provide stnictxxre-function information.
- the computer system is used to perform "in silico" sequence recombination or shuffling of character strings corresponding to the monomer domains.
- Multi-dimensional analysis to optimize sequences can be also be performed in the computer system, e.g., as described in the '375 application.
- a digital system can also instruct an oligonucleotide synthesizer to synthesize oligonucleotides, e.g., used for gene reconstruction or recombination, or to order oligonucleotides from commercial sources (e.g., by printing appropriate order forms or by linking to an order form on the Internet).
- the digital system can also include output elements for controlling nucleic acid synthesis (e.g., based upon a sequence or an alignment of a recombinant, e.g., shuffled, monomer domain as herein), i.e., an integrated system of the invention optionally includes an oligonucleotide synthesizer or an oligonucleotide synthesis controller.
- the system can include other operations that occur downstream from an alignment or other operation performed using a character string corresponding to a sequence herein, e.g., as noted above with reference to assays.
- This example describes selection of monomer domains and the creation of multimers.
- Starting materials for identifying monomer domains and creating multimers from the selected monomer domains and procedures can be derived from any of a variety of human and/or non-human sequences.
- one or more monomer domain gene(s) are selected from a family of monomer domains that bind to a certain ligand.
- the nucleic acid sequences encoding the one or more monomer domain gene can be obtained by PCR amplification of genomic DNA or cDNA, or optionally, can be produced synthetically using overlapping oligonucleotides.
- sequences are then cloned into a cell surface display format (i.e., bacterial, yeast, or mammalian (COS) cell surface display; phage display) for expression and screening.
- a cell surface display format i.e., bacterial, yeast, or mammalian (COS) cell surface display; phage display
- the recombinant sequences are transfected (transduced or transformed) into the appropriate host cell where they are expressed and displayed on the cell surface.
- the cells can be stained with a labeled (e.g., fluorescently labeled), desired ligand.
- the stained cells are sorted by flow cytometry, and the selected monomer domains encoding genes are recovered (e.g., by plasmid isolation, PCR or expansion and cloning) from the positive cells.
- the process of staining and sorting can be repeated multiple times (e.g., using progressively decreasing concentrations of the desired ligand until a desired level of enrichment is obtained).
- any screening or detection method known in the art that can be used to identify cells that bind the desired ligand or mixture of ligands can be employed.
- the selected monomer domain encoding genes recovered from the desired ligand or mixture of ligands binding cells can be optionally recombined according to any of the methods described herein or in the cited references. The recombinant sequences produced in this round of diversification are then screened by the same or a different method to identify recombinant genes with improved affinity for the desired or target ligand.
- the diversification and selection process is optionally repeated until a desired affinity is obtained.
- the selected monomer domain nucleic acids selected by the methods can be joined together via a linker sequence to create multimers, e.g., by the combinatorial assembly of nucleic acid sequences encoding selected monomer domains by DNA ligation, or optionally, PCR-based, self-priming overlap reactions.
- the nucleic acid sequences encoding the multimers are then cloned into a cell surface display format (i.e., bacterial, yeast, or mammalian (COS) cell surface display; phage display) for expression and screening.
- a cell surface display format i.e., bacterial, yeast, or mammalian (COS) cell surface display; phage display
- the recombinant sequences are transfected (transduced or transfonned) into the appropriate host cell where they are expressed and displayed on the cell surface.
- the cells can be stained with a labeled, e.g., fluorescently labeled, desired ligand or mixture of ligands.
- the stained cells are sorted by flow cytometry, and the selected multimers encoding genes are recovered (e.g., by PCR or expansion and cloning) from the positive cells.
- Positive cells include multimers with an improved avidity or affinity or altered specificity to the desired ligand or mixture of ligands compared to the selected monomer domain(s).
- the process of staining and sorting can be repeated multiple times (e.g., using progressively decreasing concentrations of the desired ligand or mixture of ligands until a desired level of enrichment is obtained).
- any screening or detection method known in the art that can be used to identify cells that bind the desired ligand or mixture of ligands can be employed.
- the selected multimer encoding genes recovered from the desired ligand or mixture of ligands binding cells can be optionally recombined according to any of the methods described herein or in the cited references.
- the recombinant sequences produced in this round of diversification are then screened by the same or a different method to identify recombinant genes with improved avidity or affinity or altered specificity for the desired or target ligand.
- the diversification and selection process is optionally repeated until a desired avidity or affinity or altered specificity is obtained.
- Example 2 This example describes the selection of monomer domains that are capable of binding to Human Serum Albumin (HSA).
- HSA Human Serum Albumin
- the precipitated phage particles were dissolved in 2 ml of cold TBS (50 mM Tris, 100 mM NaCl, pH 8.0) containing 2 mM CaCl .
- the solution was incubated on ice for 30 minutes and was distributed into two 1.5 ml reaction vessels.
- the supematants were transferred to a new reaction vessel. Phages were reprecipitated by adding 1/5 volumes 20 % w/v PEG 8000, 15 % w/v NaCl and incubation for 60 minutes on ice.
- the precipitated phage particles were dissolved in a total of 1 ml TBS containing 2 mM CaCl 2 . After incubation for 30 minutes on ice the solution was centrifuged as described above. The supernatant containing the phage particles was used directly for the affinity enrichment.
- Affinity enrichment of phage was performed using 96 well plates (Maxiso ⁇ , NUNC, Denmark). Single wells were coated for 12 h at RT by incubation with 150 ⁇ l of a solution of 100 ⁇ g/ml human serum albumin (HSA, Sigma) in TBS.
- Binding sites remaining after HSA incubation were saturated by incubation with 250 ⁇ l 2% w/v bovine serum albumin (BSA) in TBST (TBS with 0.1 % v/v Tween 20) for 2 hours at RT. Afterwards, 40 ⁇ l of the phage solution, containing approximately 5xlO ⁇ phage particles, were mixed with 80 ⁇ l TBST containing 3 % BSA and 2 mM CaCl 2 for 1 hour at RT. In order to remove non binding phage particles, the wells were washed 5 times for 1 min using 130 ⁇ l TBST containing 2 mM CaCl 2 .
- BSA bovine serum albumin
- Phage bound to the well surface were eluted either by incubation for 15 minutes with 130 ⁇ l 0.1 M glycine/HCl pH 2.2 or in a competitive manner by adding 130 ⁇ l of 500 ⁇ g/ml HSA in TBS. hi the first case, the pH of the elution fraction was immediately neutralized after removal from the well by mixing the eluate with 30 ⁇ l 1 M Tris/HCl pH 8.0.
- the eluate was used to infect E. coli K91BluKan cells (F + ). 50 ⁇ l of the eluted phage solution were mixed with 50 ⁇ l of a preparation of cells and incubated for 10 minutes at RT.
- wells of a maxiso ⁇ 96 well microtiter plate (NUNC, Denmark) were coated with each 1 ⁇ g anti-His 6 - antibody in TBS containing 2 mM CaCl 2 for 1 h at 4 C. After blocking remaining binding sites with casein (Sigma) solution for 1 h, wells were washed three times with TBS containing 0.1 % Tween and 2 mM CaCl 2 . Serial concentration dilutions of the serum samples were prepared and incubated in the wells for 2 h in order to capture the a-domain proteins.
- HRP horse radish peroxidase
- the trimer of A-domains which contained the HSA binding A-domain, exhibited a serum half life of 6.3 minutes without the presence of HSA but a significantly increased half life of 38 minutes when HSA was present in the animal. This clearly indicates that the HSA binding A-domain can be used as a fusion partner to increase the serum half life of any protein, including protein therapeuticals.
- Anti-6xHis antibody was immobilized by hydrophobic interaction to a 96-well plate (Nunc). Serial dilutions of serum from each blood sample were incubated with the immobilized antibody for 3 hours. Plates were washed to remove unbound protein and probed with ⁇ -HA-HRP to detect Maxybody. [276] Monomers or multimers identified as having long half-lives in dialysis experiments were constructed to contain either an HA, FLAG, E-Tag, or myc epitope tag. Four maxybodies were pooled, containing one protein for each tag, to make two pools.
- Example 5 This example describes the determination of biological activity of monomer domains that are capable of binding to CD40L.
- An LDL receptor class A-domain library was screened for monomers capable of binding CD40L using the same screening methods as described above in Example 2, except that recombinant CD40L was used as the target and no competitive elution steps were performed.
- proteins were produced in E. coli as inclusion bodies or soluble protein.
- Biological activity of affinity-tag purified A-domain proteins with binding affinity to CD40L was measured by inhibition of rsCD40L stimulated B cell proliferation.
- B cells were stimulated with Interleukin 4 (IL-4, R&D systems, Minneapolis, MN) and recombinant soluble CD40L (rsCD40L, Peprotech, Rocky Hill, NJ), and inco ⁇ oration of Tritium-labelled thymidine was measured.
- IL-4 Interleukin 4
- rsCD40L recombinant soluble CD40L
- FACS FACS-activated Cell Sorting
- PCR fragments are digested with BamHI and Xhol. Digestion products are separated on 1.5% agarose gel and C2 domain fragments are purified from the gel. The DNA fragments are ligated nto the corresponding restriction sites of yeast surface display vector p YD 1 (Invitrogen) [285] The ligation mixture is used for transformation of yeast strain EBY100. Transformants are selected by growing the cells in glucose-containing selective medium (-T ⁇ ) at 30°C. [286] Surface display of the C2 domain library is induced by growing the cells in galactose-containing selective medium at 20°C. Cells are rinsed with PBS and then incubated with fluorescently-labeled target protein and rinsed again in PBS.
- Cells are then sorted by FACS and positive cells are regrown in glucose-containing selective medium.
- the cell culture may be used for a second round of sorting or may be used for isolation of plasmid DNA.
- Purified plasmid DNA is used as a template to PCR amplify C2 domain encoding DNA sequences.
- the oligonucleotides used in this PCR reaction are (SEQ ID NOS : 224-225, respectively, in order of appearance): 5 ' -acactgcaatcgcgccttacggctCAGgtgCTGgtggttcccataagttcactgta 5 ' -gaccgatagcttgccgattgcagtCAGcacCTGaaccaccaccaccaccaccagaaccaccaccaccaccaccaccaccaacttcaa gggacatctcta (linker sequence is underlined).
- PCR fragments are then digested with AlwNI, digestion products are separated on 1.5% agarose gel and C2 domain fragments are purified from the gel. Subsequently, PCR fragments are multimerized by DNA ligation in the presence of stop fragments.
- the stop fragments are listed below:
- the polynucleotides encoding the multimers can be put through a further round of affinity screening (e.g., FACS analysis as described above).
- affinity screening e.g., FACS analysis as described above.
- high affinity binders are isolated and sequenced. DNA encoding the high binders is cloned into expression vector and replicated in a suitable host. Expressed proteins are purified and characterized.
- PCR fragments are digested with Xmal and Sfil. Digestion products are separated on 3% agarose gel and A domain fragments are purified from the gel. The DNA fragments are then ligated into the conesponding restriction sites of phage display vector fuse5-HA, a derivative of fuse5. The ligation mixture is electroporated into electrocompetent E.
- E. coli cells F- strain e.g. ToplO or MC1061. Transformed E. coli cells are grown overnight in 2xYT medium containing 20 ⁇ g/ml texracycline.
- Virions are purified from this culture by P ⁇ G-precipitation. Target protein is immobilized on solid surface (e.g. petridish or microtiter plate) directly by incubating in 0.1 M NaHCO 3 or indirectly via a biotin-streptavidin linkage. Purified virions are added at a typical number of ⁇ l-3 x 10 11 TU.
- the petridish or microtiter plate is incubated at 4°C, washed several times with washing buffer (TBS/Tween) and bound phages are eluted by adding glycine.HCl buffer.
- the eluate is neutralized by adding 1 M Tris-HCl (pH 9.1) [297]
- the phages are amplified and subsequently used as input to a second round of affinity selection.
- ssDNA is extracted from the final eluate using QIAprep Ml 3 kit. ssDNA is used as a template to PCR amplify A domains encoding DNA sequences.
- PCR fragments are digested with AlwNI and Bgll. Digestion products are separated on 3% agarose gel and A domain fragments are purified from the gel. PCR fragments are multimerized by DNA ligation in the presence of the following stop fragments:
- Multimers are separated on 1% agarose gel and DNA fragments conesponding to stopl-A-A-A-stop2 are purified from the gel.
- Stopl-A-A-A-stop2 fragments are subsequently PCR amplified using primers 5'-agcttcattacccaaatcaac-3' and 5' aattcaacgctactaccat-3 ' and subsequently digested with Xmal and Sfil.
- Selected polynucleotides are then cloned into a phage expression system and tested for affinity for the target protein.
- High affinity binders are subsequently isolated and sequenced. DNA encoding the high binders is cloned into expression vector and subsequently expressed in a suitable host. The expressed protein is then purified and characterized.
- This example describes the development of CD20-specific LDL receptor-based A domains.
- 10 11 phage displaying a library of 10 9 A-domains were added to 10 6 Raji or Daudi cells which had been pre-blocked with 5 mg/mL casein. The mixture was incubated at 4°C for 2 hours to allow phage to bind. Cells were washed 5 times with 1 mg/mL casein in TBS. Cells were incubated with 1 mg/mL Rituxan in TBS at 4°C for 2 hours to elute phage specific for CD20. Cells were spun down and the supernatant used to infect E. coli BluKan cells.
- Example 9 This example describes the development of TPO-R-specific LDL receptor-based A domains.
- 10 11 phage displaying a library of 10 9 A-domains were added to recombinant TPO-R, which had been coated to hnmunoso ⁇ plates (Nunc) and blocked with casein. Phage were incubated with the target for 3 hours at 4°C, washed 3 times with TBS buffer, and eluted with 100 mM Glycine pH 2.2. The eluate was neutralized by addition of 2M Na HPO and used to infect E. coli BluKan cells. [310] Phage were propagated at 37°C overnight, purified by standard methods, and the selection repeated one time.
- phage were added to a suspension of TFl cells, which had been blocked previously with casein. Cells were incubated 2 hours at 4°C, then washed 5 times with TBS. [311] Phage were eluted by direct addition of E. coli to the cell suspension, followed by propagation of the phage at 23°C for 2 days. The phage were purified by standard methods, and the selection on TFl cells was repeated one time.
- Example 10 This example describes the development of IgE-specific LDL receptor- based A domains and multimers.
- 10 1 l phage displaying a library of 10 9 A-domains were added to human IgE, which had been immobilized on hnmunoso ⁇ plates (Nunc) and blocked with casein.
- Soluble human IgG was added with the phage to a concentration of 5 mg/mL. Plates were incubated at 4°C for 3 hours, then washed 3 times to remove unbound phage. Phage were eluted with a mixture of 50 mM EDTA, 20 mM DTT and used to infect E. coli.
- a new library was created by ligating a random domain to either the 5 ' or 3' end of the IgE binding sequence and ligating this construct into the fuse5 phage DNA. Phage were produced and purified by standard methods. Dimer phage were incubated with human IgE, which had been immobilized in 10-fold serial dilutions (from 1 ⁇ g to 10 ag per well) to an hnmunoso ⁇ plate (Nunc) and blocked with casein. Soluble human IgG at 5 mg/mL was added with the phage. Wells were washed 10 times with 100 mM sodium acetate pH 5, and phage were eluted by direct addition of E. coli cells.
- Example 11 This example describes the development of CD28-specific LDL receptor-based A domains and dimers by "walking.” [323] A library of DNA sequences encoding monomeric A domains was created by assembly PCR as described in Stemmer et al, Gene 164:49-53 (1995).
- the oligonucleotides used in this PCR reaction are: 5 ' -ATTCTCACTCGGCCGACGGTGCCTACCCGT- 3 ' 5 ' -ACGGTGCCTACCCGTATGATGTTCCGGATTATGCCCCGGGTCTGGAGGCGTCTGGTGGTTCGTGT-3 ' 5'-CGCCGTCGCAAMSCMASBBCNSTGRAABGCATNTKYYGK AYYSYKGCATYYAAATTBGBYGRDAGVKTBACACGAACC ACCAGA-3' -CGCCGTCGCAAMSCMASBBCNSTGRAABGCA YKGCCGYTKYYGCATYYAAATTBGBYGRDAGVKTBACACGAACCACCAGA-3 ' -CGCCGTCGCAAMSCMASBBCNSTGRAABGCATNTKYYGKWAYYSYKGCACBKGAACTSGYYCGVCNSACA CGAACCACCAGA-3 ' -CGCCGTCGCAAMSCMASBBCNSTGRAABGCAKY GC
- Digestion products were separated on 3% agarose gel and A domain fragments are purified from the gel.
- the DNA fragments were ligated into the conesponding restriction sites of phage display vector fuse5-HA, a derivative of fuse5 canying an in-frame HA-epitope.
- the ligation mixture was electroporated into TransforMaxTM EC 100TM electrocompetent E. coli cells.
- Transformed E. coli cells were grown overnight at 37°C in 2xYT medium containing 20 ⁇ g/ml tetracycline and 2 mM CaCl 2 .
- Phage particles were purified from the culture medium by PEG- precipitation.
- the digested monomer fragments were 'walked' to dimers by attaching a library of naive A domain fragments using DNA ligation.
- Naive A domain sequences were obtained by PCR amplification of the initial A domain library (resulting from the PEG purification described above) using the A domain primers described above.
- the PCR fragments were purified, split into 2 equal amounts and then digested with either Bpml or BsrDI.
- Digestion products were separated on a 2% agarose gel and A domain fragments were purified from the gel.
- the purified fragments were combined into 2 separate pools (na ⁇ ve/Bpml + selected/BsrDI & na ⁇ ve/BsrDI + selected/Bpml) and then ligated overnight at 16°C.
- the dimeric A domain fragments were PCR amplified (5 cycles), digested with Xmal and Sfil and purified from a 2% agarose gel. Screening steps were repeated as described above except for the washing, which was done more stringently to obtain high-affinity binders. After infection, the K91BlueKan cells were plated on 2xYT agar plates containing 40 ⁇ g/ml tetracycline and grown overnight.
- Biacore Two hundred fifty RU CD28 were immobilized by NHS/EDC coupling to a CM5 chip (Biacore). 0.5 and 5 ⁇ M solutions of monomer protein were flowed over the derivatized chip, and the data were analyzed using the standard Biacore software package. See, Table 4.
- PBMC Assays [335] Efficacy assays were performed using human and monkey PBMC as described above. CD28 results in PBMC assays: On human cells:
- CD28 monomer clone 18 IC50 >1 ,000 nM (low activity)
- Example 12 This example describes the development of IL6-specific LDL receptor- based A domains and dimers. [337] A library of DNA sequences encoding monomeric A domains was created by assembly PCR as described in Steimner et al, Gene 164:49-53 (1995).
- oligonucleotides used in this PCR reaction are: -ATTCTCACTCGGCCGACGGTGCCTACCCGT-3 ' -ACGGTGCCTACCCGTATGATGTTCCGGATTATGCCCCGGGTCTGGAGGCGTCTGGTGGTTCGTGT-3' -CGCCGTCGCAAMSC ASBBCNSTGRAABGCATNTKYYGKWAYYSYKGCATYYAAATTBGBYGRDAGVKTBACACGAACC ACCAGA-3 ' -CGCCGTCGCAMSCMASBBCNSTGRAABGCAKYKGCCG TKYYGCA YA ATTBGBYGRDAGVK BACACGAACCACCAGA-3 , -CGCCGTCGCAAMSC ASBBCNSTGRAABGCATNTKYYGK AYYSY GCACBKGAACTSGYYCGVCNSACA CGAACCACCAGA-3 ' -CGCCGTCGCAA SCMASBBCNSTGRAABGCAKYKGCCGYTKYYGCACBKGA
- Digestion products were separated on 3% agarose gel and A domain fragments are purified from the gel.
- the DNA fragments were ligated into the conesponding restriction sites of phage display vector fuse5-HA, a derivative of fuse5 canying an in-frame HA-epitope.
- the ligation mixture was electroporated into TransforMaxTM EC100TM electrocompetent E. coli cells.
- Transformed E. coli cells were grown overnight at 37°C in 2xYT medium containing 20 ⁇ g/ml tetracycline and 2 mM CaCl 2 .
- Phage particles were purified from the culture medium by PEG- precipitation.
- Clones were identified by the same methods as those described above for CD28. Identified clones included the following: >Il6#4 CLSSQFQCKNGQCIPQTWVCDGDNDCEDDSDETGCGDSHILPFSTPGPSTCPPSQFTCRSTNTCIPAPWRCDGD DDCEDDSDEEGCSAPASEPPGSL >IL6#7 CLSSQFQCKNGQCIPQTWVCDGDNDC ⁇ DDSDETGCGDSHI PFSTPGPSTCRSNEFQCRSSGICIPRT VCDGD DDCLDNSDEKDCAART >IL6#9 CRSDQFQCGSGHCIPQD VCDGENDCEDGSD ⁇ TDCSAPAS ⁇ PPGS CLSSQFQCKNGQCIPQTWVCDGDNDCED DSDETGCGDSHILPFSTPGPST >IL6#P8 CRSDQFQCGSGHCIPQD VCDGENDCEDGSDE
- Biacore [344] One hundred eighty RU IL6 were immobilized by NHS/EDC coupling to a CM5 chip (Biacore). 0.1, 0.5, 1, and 5 ⁇ M solutions of monomer protein were flowed over the derivatized chip, and the data were analyzed using the standard Biacore software package. See, Table 6.
- IL6 receptor was biotinylated with biotin-S-S-NHS (Pierce). 2x10 "15 mol of IL6 were immobilized by hydrophobic interaction to 96-well plates (Nunc). Plates were blocked with 5 mg/mL casein. 8xl0 "15 mol of biotinylated IL6 receptor was added to each well. Serial dilutions of monomer protein were added to each well in duplicate and incubated for 3 hours. Plates were washed to remove unbound protein and probed with either ⁇ -HA-HRP (to detect monomers) or streptavidin-HRP (to detect IL6 receptor). See, Figure
- TFl cells were incubated for three days with 5 ng/niL IL6 and serial dilutions of monomer protein. Proliferation was measured by tritiated thymidine inco ⁇ oration. See, Figure 18.
- PBMC Assays [347] In order to assay the ex-vivo efficacy of monomers, they were tested on isolated peripheral blood lymphocytes (PBMC). These were obtained from freshly drawn, sodium-heparinized blood of healthy volunteers or cynomolgus monkeys by centrifugation on PBMC. These were obtained from freshly drawn, sodium-heparinized blood of healthy volunteers or cynomolgus monkeys by centrifugation on PBMC.
- Ficoll-Hypaque (Sigma, St. Louis, MO) according to standard procedures, lxl 0 5 PBMC per well were stimulated either with 0.2 ug/ml of a monoclonal antibody against human CD3
- Dulbecco's Modified Eagle medium (Invitrogen) containing 10 % fetal calf serum and 100 units of each penicillin and streptomycin. Monomer protein was added in varying concentrations to each culture and incubation occuned for 3 days at 37 °C in a CO 2 containing atmosphere. During the last 9 hours, cultures were pulsed with 1 uCi per well of
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Gastroenterology & Hepatology (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Urology & Nephrology (AREA)
- Biomedical Technology (AREA)
- Cell Biology (AREA)
- Hematology (AREA)
- Biotechnology (AREA)
- Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Microbiology (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Peptides Or Proteins (AREA)
- Epoxy Compounds (AREA)
- Other Resins Obtained By Reactions Not Involving Carbon-To-Carbon Unsaturated Bonds (AREA)
Abstract
Description
Claims
Priority Applications (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP04796312A EP1675878A2 (en) | 2003-10-24 | 2004-10-22 | Ldl receptor class a and egf domain monomers and multimers |
| AU2004284090A AU2004284090A1 (en) | 2003-10-24 | 2004-10-22 | LDL receptor class A and EGF domain monomers and multimers |
| CA002543360A CA2543360A1 (en) | 2003-10-24 | 2004-10-22 | Ldl receptor class a and egf domain monomers and multimers |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US51439103P | 2003-10-24 | 2003-10-24 | |
| US60/514,391 | 2003-10-24 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2005040229A2 true WO2005040229A2 (en) | 2005-05-06 |
| WO2005040229A3 WO2005040229A3 (en) | 2009-12-30 |
Family
ID=34520204
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2004/035301 Ceased WO2005040229A2 (en) | 2003-10-24 | 2004-10-22 | Ldl receptor class a and egf domain monomers and multimers |
Country Status (5)
| Country | Link |
|---|---|
| US (1) | US20050164301A1 (en) |
| EP (1) | EP1675878A2 (en) |
| AU (1) | AU2004284090A1 (en) |
| CA (1) | CA2543360A1 (en) |
| WO (1) | WO2005040229A2 (en) |
Cited By (130)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1902066A4 (en) * | 2005-07-13 | 2009-01-07 | Amgen Mountain View Inc | Il-6 binding proteins |
| US7563443B2 (en) | 2004-09-17 | 2009-07-21 | Domantis Limited | Monovalent anti-CD40L antibody polypeptides and compositions thereof |
| WO2009125825A1 (en) | 2008-04-11 | 2009-10-15 | 中外製薬株式会社 | Antigen-binding molecule capable of binding to two or more antigen molecules repeatedly |
| US7820790B2 (en) | 2005-07-13 | 2010-10-26 | Amgen Mountain View Inc. | IL-6 binding proteins |
| WO2011122011A2 (en) | 2010-03-30 | 2011-10-06 | Chugai Seiyaku Kabushiki Kaisha | Antibodies with modified affinity to fcrn that promote antigen clearance |
| WO2012067176A1 (en) | 2010-11-17 | 2012-05-24 | 中外製薬株式会社 | Multi-specific antigen-binding molecule having alternative function to function of blood coagulation factor viii |
| WO2012073992A1 (en) | 2010-11-30 | 2012-06-07 | 中外製薬株式会社 | Antigen-binding molecule capable of binding to plurality of antigen molecules repeatedly |
| WO2012093704A1 (en) | 2011-01-07 | 2012-07-12 | 中外製薬株式会社 | Method for improving physical properties of antibody |
| WO2012115241A1 (en) | 2011-02-25 | 2012-08-30 | 中外製薬株式会社 | Fcγriib-specific fc antibody |
| WO2012133782A1 (en) | 2011-03-30 | 2012-10-04 | 中外製薬株式会社 | Retention of antigen-binding molecules in blood plasma and method for modifying immunogenicity |
| WO2013002362A1 (en) | 2011-06-30 | 2013-01-03 | 中外製薬株式会社 | Heterodimerized polypeptide |
| WO2013047752A1 (en) | 2011-09-30 | 2013-04-04 | 中外製薬株式会社 | Antigen-binding molecule for promoting loss of antigens |
| WO2013047729A1 (en) | 2011-09-30 | 2013-04-04 | 中外製薬株式会社 | Antigen-binding molecule inducing immune response to target antigen |
| WO2013047748A1 (en) | 2011-09-30 | 2013-04-04 | 中外製薬株式会社 | Antigen-binding molecule promoting disappearance of antigens having plurality of biological activities |
| WO2013046722A1 (en) | 2011-09-30 | 2013-04-04 | 中外製薬株式会社 | Ion concentration-dependent binding molecule library |
| WO2013046704A2 (en) | 2011-09-30 | 2013-04-04 | Chugai Seiyaku Kabushiki Kaisha | THERAPEUTIC ANTIGEN-BINDING MOLECULE WITH A FcRn-BINDING DOMAIN THAT PROMOTES ANTIGEN CLEARANCE |
| WO2013051294A1 (en) | 2011-10-05 | 2013-04-11 | 中外製薬株式会社 | Antigen-binding molecule for promoting clearance from plasma of antigen comprising saccharide chain receptor-binding domain |
| EP2594588A1 (en) | 2011-11-16 | 2013-05-22 | AdrenoMed AG | Anti-Adrenomedullin (ADM) antibody or anti-ADM antibody fragment or an anti-ADM non-Ig scaffold for use in therapy |
| EP2594587A1 (en) | 2011-11-16 | 2013-05-22 | AdrenoMed AG | Anti-Adrenomedullin (ADM) antibody or anti-ADM antibody fragment or anti-ADM non-Ig scaffold for reducing the risk of mortality in a patient having a chronic or acute disease or acute condition |
| WO2013072513A1 (en) | 2011-11-16 | 2013-05-23 | Adrenomed Ag | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for use in therapy of an acute disease or acute condition of a patient for stabilizing the circulation |
| WO2013072509A1 (en) | 2011-11-16 | 2013-05-23 | Adrenomed Ag | Adrenomedullin assays and methods for determining mature adrenomedullin |
| WO2013072514A1 (en) | 2011-11-16 | 2013-05-23 | Adrenomed Ag | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for regulating the fluid balance in a patient having a chronic or acute disease |
| WO2013072511A1 (en) | 2011-11-16 | 2013-05-23 | Adrenomed Ag | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for prevention or reduction of organ dysfunction or organ failure in a patient having a chronic or acute disease or acute condition |
| WO2013081143A1 (en) | 2011-11-30 | 2013-06-06 | 中外製薬株式会社 | Drug containing carrier into cell for forming immune complex |
| WO2013118858A1 (en) | 2012-02-09 | 2013-08-15 | 中外製薬株式会社 | Modified fc region of antibody |
| WO2013125667A1 (en) | 2012-02-24 | 2013-08-29 | 中外製薬株式会社 | ANTIGEN-BINDING MOLECULE FOR PROMOTING DISAPPEARANCE OF ANTIGEN VIA FcγRIIB |
| WO2013132088A1 (en) | 2012-03-08 | 2013-09-12 | Sphingotec Gmbh | A method for predicting the risk of getting a cardiovascular event in a female subject |
| WO2013132090A1 (en) | 2012-03-08 | 2013-09-12 | Sphingotec Gmbh | A method for predicting the risk of a subject for contracting diabetes mellitus and/or metabolic syndrome or for diagnosing metabolic syndrome in a subject |
| WO2013132089A2 (en) | 2012-03-08 | 2013-09-12 | Sphingotec Gmbh | A method for predicting the risk of getting cancer or diagnosing cancer in a female subject |
| WO2013180201A1 (en) | 2012-05-30 | 2013-12-05 | 中外製薬株式会社 | Antigen-binding molecule for eliminating aggregated antigens |
| WO2013180200A1 (en) | 2012-05-30 | 2013-12-05 | 中外製薬株式会社 | Target-tissue-specific antigen-binding molecule |
| WO2013187495A1 (en) | 2012-06-14 | 2013-12-19 | 中外製薬株式会社 | ANTIGEN-BINDING MOLECULE CONTAINING MODIFIED Fc REGION |
| EP2700651A1 (en) | 2008-07-18 | 2014-02-26 | Bristol-Myers Squibb Company | Compositions monovalent for CD28 binding and methods of use |
| WO2014030728A1 (en) | 2012-08-24 | 2014-02-27 | 中外製薬株式会社 | Fcγriib-specific fc region variant |
| WO2014030750A1 (en) | 2012-08-24 | 2014-02-27 | 中外製薬株式会社 | MOUSE FcγRII-SPECIFIC Fc ANTIBODY |
| WO2014050926A1 (en) | 2012-09-28 | 2014-04-03 | 中外製薬株式会社 | Method for evaluating blood coagulation reaction |
| WO2014053501A1 (en) | 2012-10-02 | 2014-04-10 | Sphingotec Gmbh | A method for diagnosing or monitoring kidney function or diagnosing kidney dysfunction |
| US8734796B2 (en) | 2009-03-20 | 2014-05-27 | Amgen Inc. | Carrier immunoglobulins |
| WO2014104165A1 (en) | 2012-12-27 | 2014-07-03 | 中外製薬株式会社 | Heterodimerized polypeptide |
| WO2014108396A1 (en) | 2013-01-08 | 2014-07-17 | Sphingotec Gmbh | Fasting levels of growth hormone as a predictive marker of cardiovascular risk |
| WO2014120916A1 (en) | 2013-02-01 | 2014-08-07 | Bristol-Myers Squibb Company | Pegylated domain antibodies monovalent for cd28 binding and methods of use |
| WO2014147153A1 (en) | 2013-03-20 | 2014-09-25 | Sphingotec Gmbh | Adrenomedullin to guide therapy of blood pressure decline |
| WO2014163101A1 (en) | 2013-04-02 | 2014-10-09 | 中外製薬株式会社 | Fc region variant |
| US8993727B2 (en) | 2010-09-22 | 2015-03-31 | Amgen Inc. | Carrier immunoglobulins and uses thereof |
| WO2015083764A1 (en) | 2013-12-04 | 2015-06-11 | 中外製薬株式会社 | Antigen-binding molecules, the antigen-binding activity of which varies according to the concentration of compounds, and libraries of said molecules |
| EP3002589A1 (en) | 2014-10-01 | 2016-04-06 | sphingotec GmbH | A method for stratifying a female subject for hormone replacement therapy |
| WO2016098357A1 (en) | 2014-12-19 | 2016-06-23 | Chugai Seiyaku Kabushiki Kaisha | Anti-myostatin antibodies, polypeptides containing variant fc regions, and methods of use |
| WO2016125495A1 (en) | 2015-02-05 | 2016-08-11 | Chugai Seiyaku Kabushiki Kaisha | Antibodies comprising an ion concentration dependent antigen-binding domain, fc region variants, il-8-binding antibodies, and uses therof |
| WO2016166014A1 (en) | 2015-04-17 | 2016-10-20 | F. Hoffmann-La Roche Ag | Combination therapy with coagulation factors and multispecific antibodies |
| WO2016170023A1 (en) | 2015-04-24 | 2016-10-27 | Sphingotec Gmbh | A method for predicting the risk of incidence of chronic kidney disease |
| WO2017046994A1 (en) | 2015-09-18 | 2017-03-23 | Chugai Seiyaku Kabushiki Kaisha | Il-8-binding antibodies and uses thereof |
| WO2017104783A1 (en) | 2015-12-18 | 2017-06-22 | Chugai Seiyaku Kabushiki Kaisha | Anti-myostatin antibodies, polypeptides containing variant fc regions, and methods of use |
| WO2017182561A1 (en) | 2016-04-21 | 2017-10-26 | Sphingotec Therapeutics Gmbh | Methods for determining dpp3 and therapeutic methods |
| US9829494B2 (en) | 2005-12-01 | 2017-11-28 | Adrenomed Ag | Methods of treatment using ADM antibodies |
| WO2017217525A1 (en) | 2016-06-17 | 2017-12-21 | Chugai Seiyaku Kabushiki Kaisha | Anti-myostatin antibodies and methods of use |
| WO2018002081A1 (en) | 2016-06-27 | 2018-01-04 | Aicuris Anti-Infective Cures Gmbh | Hcmv entry inhibitors |
| WO2018007588A1 (en) | 2016-07-08 | 2018-01-11 | Sphingotec Gmbh | Adrenomedullin for assessing congestion in a subject with acute heart failure |
| WO2018047813A1 (en) | 2016-09-06 | 2018-03-15 | Chugai Seiyaku Kabushiki Kaisha | Methods of using a bispecific antibody that recognizes coagulation factor ix and/or activated coagulation factor ix and coagulation factor x and/or activated coagulation factor x |
| EP3309550A1 (en) | 2016-10-12 | 2018-04-18 | sphingotec GmbH | Method for the detection of apolipoprotein e4 |
| WO2018091724A1 (en) | 2016-11-21 | 2018-05-24 | Cureab Gmbh | Anti-gp73 antibodies and immunoconjugates |
| WO2018097308A1 (en) | 2016-11-28 | 2018-05-31 | 中外製薬株式会社 | Ligand-binding molecule having adjustable ligand binding activity |
| WO2018097307A1 (en) | 2016-11-28 | 2018-05-31 | 中外製薬株式会社 | Antigen-binding domain, and polypeptide including conveying section |
| WO2018109228A1 (en) | 2016-12-16 | 2018-06-21 | Adrenomed Ag | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for use in intervention and therapy of congestion in a patient in need thereof |
| EP3339324A1 (en) | 2016-12-22 | 2018-06-27 | sphingotec GmbH | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for use in intervention and therapy of congestion in a patient in need thereof |
| WO2018181870A1 (en) | 2017-03-31 | 2018-10-04 | 公立大学法人奈良県立医科大学 | Medicinal composition usable for preventing and/or treating blood coagulation factor ix abnormality, comprising multispecific antigen binding molecule replacing function of blood coagulation factor viii |
| WO2018219937A1 (en) | 2017-05-30 | 2018-12-06 | Sphingotec Gmbh | A method for diagnosing or monitoring kidney function or diagnosing kidney dysfunction |
| WO2019057992A2 (en) | 2017-09-25 | 2019-03-28 | Adrenomed Ag | Anti-adrenomedullin (adm) binder for use in therapy or prevention of symptoms of illness |
| WO2019065795A1 (en) | 2017-09-29 | 2019-04-04 | 中外製薬株式会社 | Multispecific antigen-binding molecule having blood coagulation factor viii (fviii) cofactor function-substituting activity, and pharmaceutical formulation containing said molecule as active ingredient |
| WO2019077082A1 (en) | 2017-10-18 | 2019-04-25 | Adrenomed Ag | Therapy monitoring under treatment with an anti-adrenomedullin (adm) binder |
| WO2019081595A2 (en) | 2017-10-25 | 2019-05-02 | Sphingotec Therapeutics Gmbh | Dpp3 binder directed to and binding to specific dpp3-epitopes and its use in the prevention or treatment of diseases / acute conditions that are associated with oxidative stress |
| WO2019081504A1 (en) | 2017-10-24 | 2019-05-02 | Sphingotec Gmbh | Selenoprotein p for prediction of a first cardiovascular event |
| WO2019107380A1 (en) | 2017-11-28 | 2019-06-06 | 中外製薬株式会社 | Polypeptide including antigen-binding domain and carrying section |
| WO2019107384A1 (en) | 2017-11-28 | 2019-06-06 | 中外製薬株式会社 | Ligand-binding molecule having adjustable ligand-binding activity |
| WO2019134981A1 (en) | 2018-01-05 | 2019-07-11 | Ac Immune Sa | Misfolded tdp-43 binding molecules |
| WO2019154900A1 (en) | 2018-02-08 | 2019-08-15 | Sphingotec Gmbh | Adrenomedullin (adm) for diagnosis and/or prediction of dementia and anti-adrenomedullin binder for use in therapy or prevention of dementia |
| WO2019158645A1 (en) | 2018-02-14 | 2019-08-22 | Abba Therapeutics Ag | Anti-human pd-l2 antibodies |
| EP3569614A1 (en) | 2018-05-18 | 2019-11-20 | Julius-Maximilians-Universität Würzburg | Compounds and methods for the immobilization of myostatin-inhibitors on the extracellular matrix by transglutaminase |
| WO2019244973A1 (en) | 2018-06-20 | 2019-12-26 | 中外製薬株式会社 | Method for activating immune response of target cell and composition therefor |
| WO2019243555A1 (en) | 2018-06-21 | 2019-12-26 | Charité - Universitätsmedizin Berlin | Complement anaphylatoxin binders and their use in treatment of a subject having an ocular wound and/or fibrosis |
| WO2020032230A1 (en) | 2018-08-10 | 2020-02-13 | 中外製薬株式会社 | Anti-cd137 antigen-binding molecule and utilization thereof |
| WO2020128073A1 (en) | 2018-12-20 | 2020-06-25 | Sphingotec Gmbh | Selenoprotein p in heart failure |
| WO2020128039A2 (en) | 2018-12-21 | 2020-06-25 | 4TEEN4 Pharmaceuticals GmbH | Therapy guidance and/or therapy monitoring for a treatment with angiotensin-receptor-agonist and/or a precursor thereof |
| WO2020189748A1 (en) | 2019-03-19 | 2020-09-24 | 中外製薬株式会社 | Antigen-binding molecule containing antigen-binding domain of which binding activity to antigen is changed depending on mta, and library for obtaining said antigen-binding domain |
| WO2020204055A1 (en) | 2019-04-02 | 2020-10-08 | 中外製薬株式会社 | Method of introducing target-specific foreign gene |
| WO2020212593A1 (en) | 2019-04-18 | 2020-10-22 | Ac Immune Sa | Novel molecules for therapy and diagnosis |
| WO2020234473A1 (en) | 2019-05-23 | 2020-11-26 | Ac Immune Sa | Anti-tdp-43 binding molecules and uses thereof |
| WO2020246617A1 (en) | 2019-06-07 | 2020-12-10 | 中外製薬株式会社 | Information processing system, information processing method, program, and method for producing antigen-binding molecule or protein. |
| WO2020246563A1 (en) | 2019-06-05 | 2020-12-10 | 中外製薬株式会社 | Antibody cleavage site-binding molecule |
| WO2020246567A1 (en) | 2019-06-05 | 2020-12-10 | 中外製薬株式会社 | Protease substrate, and polypeptide including protease cleavage sequence |
| WO2020254540A1 (en) | 2019-06-18 | 2020-12-24 | MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. | Site-specific, kinetically inert conjugation of labels and/or carriers to target molecules such as his-tagged proteins via metal complex reagents |
| WO2021028582A1 (en) | 2019-08-15 | 2021-02-18 | Sphingotec Gmbh | A method for diagnosing or monitoring kidney function or diagnosing kidney dysfunction in pediatric patients |
| WO2021038078A1 (en) | 2019-08-30 | 2021-03-04 | 4TEEN4 Pharmaceuticals GmbH | Therapy guidance and/or therapy monitoring for treatment of shock |
| WO2021099484A1 (en) | 2019-11-20 | 2021-05-27 | MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. | Archaeal peptide recombinase – a novel peptide ligating enzyme |
| WO2021104511A1 (en) | 2019-11-29 | 2021-06-03 | 苏州诺沃泰医药科技有限公司 | Application of car t-cells in preparing drug for treating cancer |
| WO2021162020A1 (en) | 2020-02-12 | 2021-08-19 | 中外製薬株式会社 | Anti-cd137 antigen-binding molecule for use in cancer treatment |
| EP3871689A1 (en) | 2020-02-26 | 2021-09-01 | sphingotec GmbH | Anti-adm-antibodies binding to the free n-terminus for accelerated transition of adm-gly to bio-adm in patients with adm-gly/ bio-adm ratio above a threshold and combination with vitamin c |
| WO2021170880A2 (en) | 2020-02-27 | 2021-09-02 | Adrenomed Ag | Anti-adrenomedullin (adm) binder for use in therapy of patients in shock |
| WO2021170838A1 (en) | 2020-02-27 | 2021-09-02 | 4TEEN4 Pharmaceuticals GmbH | Dpp3 for therapy guidance, monitoring and stratification of nt-adm antibodies in patients with shock |
| WO2021170876A1 (en) | 2020-02-27 | 2021-09-02 | Adrenomed Ag | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for use in therapy or prevention of shock |
| WO2021185786A1 (en) | 2020-03-16 | 2021-09-23 | 4TEEN4 Pharmaceuticals GmbH | Dpp3 in patients infected with coronavirus |
| WO2021185785A1 (en) | 2020-03-16 | 2021-09-23 | Sphingotec Gmbh | Pro-adrenomedullin or fragment thereof in patients infected with corona virus and treatments with binder against adrenomedullin |
| EP3922993A1 (en) | 2020-06-12 | 2021-12-15 | 4TEEN4 Pharmaceuticals GmbH | Dpp3 in patients infected with coronavirus |
| WO2022025220A1 (en) | 2020-07-31 | 2022-02-03 | 中外製薬株式会社 | Pharmaceutical composition including cell expressing chimeric receptor |
| WO2022029306A1 (en) | 2020-08-07 | 2022-02-10 | F. Hoffmann-La Roche Ag | Method for producing protein compositions |
| WO2022034228A1 (en) | 2020-08-14 | 2022-02-17 | Ac Immune Sa | Humanized anti-tdp-43 binding molecules and uses thereof |
| WO2022043517A2 (en) | 2020-08-27 | 2022-03-03 | Cureab Gmbh | Anti-golph2 antibodies for macrophage and dendritic cell differentiation |
| WO2022079297A1 (en) | 2020-10-16 | 2022-04-21 | Ac Immune Sa | Antibodies binding to alpha-synuclein for therapy and diagnosis |
| WO2022117893A2 (en) | 2020-12-02 | 2022-06-09 | S-Form Pharma | Combination therapy for patients having acute and/or persistent dyspnea |
| WO2022244838A1 (en) | 2021-05-19 | 2022-11-24 | 中外製薬株式会社 | Method for predicting in vivo pharmacokinetics of molecule |
| WO2022263648A1 (en) | 2021-06-18 | 2022-12-22 | Sphingotec Gmbh | A method for predicting sepsis and septic shock |
| WO2023275099A1 (en) | 2021-06-29 | 2023-01-05 | Berysol Gmbh | Composite biomarker for the identification of selenium deficiency in a bodily fluid |
| WO2023088959A1 (en) | 2021-11-16 | 2023-05-25 | Ac Immune Sa | Novel molecules for therapy and diagnosis |
| EP4218816A2 (en) | 2014-06-20 | 2023-08-02 | Chugai Seiyaku Kabushiki Kaisha | Pharmaceutical composition for use in prevention and/or treatment of disease that develops or progresses as a result of decrease or loss of activity of blood coagulation factor viii and/or activated blood coagulation factor viii |
| WO2023156549A1 (en) | 2022-02-16 | 2023-08-24 | Ac Immune Sa | Humanized anti-tdp-43 binding molecules and uses thereof |
| WO2023175035A1 (en) | 2022-03-15 | 2023-09-21 | Adrenomed Ag | Stable aqueous formulation of an anti-adrenomedullin (adm) antibody or anti-adm antibody fragment |
| WO2023194565A1 (en) | 2022-04-08 | 2023-10-12 | Ac Immune Sa | Anti-tdp-43 binding molecules |
| WO2024023369A1 (en) | 2022-07-29 | 2024-02-01 | Adrenomed Ag | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for use in therapy or prevention of shock |
| WO2024023368A1 (en) | 2022-07-29 | 2024-02-01 | 4TEEN4 Pharmaceuticals GmbH | Prediction of an increase of dpp3 in a patient with septic shock |
| WO2024126793A1 (en) | 2022-12-15 | 2024-06-20 | 4TEEN4 Pharmaceuticals GmbH | Dpp3 inhibitor for improvement of pulmonary function in critically ill patients |
| WO2024184494A1 (en) | 2023-03-08 | 2024-09-12 | Ac Immune Sa | Anti-tdp-43 binding molecules and uses thereof |
| WO2024194276A1 (en) | 2023-03-17 | 2024-09-26 | Pam Theragnostics Gmbh | Methods for determining peptidylglycine alpha-amidating monooxygenase (pam) and its use for diagnostic purpose |
| WO2024200862A1 (en) | 2023-03-29 | 2024-10-03 | 4TEEN4 Pharmaceuticals GmbH | Dpp3 inhibitor for myocardial protection and prevention of myocardial injury in critically ill patients with blood pressure decline |
| WO2025033296A1 (en) | 2023-08-10 | 2025-02-13 | 中外製薬株式会社 | Information processing system, information processing method, program, and method for manufacturing molecular compound |
| WO2025068313A1 (en) | 2023-09-25 | 2025-04-03 | Sphingotec Gmbh | A method for early diagnosis, early prediction, monitoring or prediction of severity of reduced graft function in a kidney transplantation patient |
| WO2025229075A1 (en) | 2024-05-03 | 2025-11-06 | Sphingotec Gmbh | A method for the specific determination of proenkephalin fragment 119-159 |
| WO2025248139A1 (en) | 2024-05-31 | 2025-12-04 | 4TEEN4 Pharmaceuticals GmbH | Use of adrenomedullin or fragments thereof in the treatment of a patient in need thereof |
| EP4675277A1 (en) | 2024-07-05 | 2026-01-07 | Predemtec AG | A method for diagnosing alzheimer´s disease or determining the risk of suffering from alzheimer´s disease |
| WO2026013218A1 (en) | 2024-07-10 | 2026-01-15 | Ac Immune Sa | Anti-tdp-43 vectors, binding molecules and uses thereof |
| WO2026046978A1 (en) | 2024-08-26 | 2026-03-05 | Pam Theragnostics Gmbh | Anti-adm antibodies, anti-adm antibody fragment or anti-adm non-ig scaffold for therapy or prevention of immune effector cell therapy side effects |
| WO2026046968A1 (en) | 2024-08-26 | 2026-03-05 | 4TEEN4 Pharmaceuticals GmbH | Dpp3 binders for the treatment of endothelial dysfunction |
Families Citing this family (126)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20040175756A1 (en) * | 2001-04-26 | 2004-09-09 | Avidia Research Institute | Methods for using combinatorial libraries of monomer domains |
| US20050048512A1 (en) * | 2001-04-26 | 2005-03-03 | Avidia Research Institute | Combinatorial libraries of monomer domains |
| US20050089932A1 (en) * | 2001-04-26 | 2005-04-28 | Avidia Research Institute | Novel proteins with targeted binding |
| US20050053973A1 (en) * | 2001-04-26 | 2005-03-10 | Avidia Research Institute | Novel proteins with targeted binding |
| US20080008713A1 (en) * | 2002-06-28 | 2008-01-10 | Domantis Limited | Single domain antibodies against tnfr1 and methods of use therefor |
| US9028822B2 (en) | 2002-06-28 | 2015-05-12 | Domantis Limited | Antagonists against TNFR1 and methods of use therefor |
| US9321832B2 (en) | 2002-06-28 | 2016-04-26 | Domantis Limited | Ligand |
| US20040067532A1 (en) | 2002-08-12 | 2004-04-08 | Genetastix Corporation | High throughput generation and affinity maturation of humanized antibody |
| US20060008844A1 (en) * | 2004-06-17 | 2006-01-12 | Avidia Research Institute | c-Met kinase binding proteins |
| CN101724071A (en) | 2004-10-08 | 2010-06-09 | 杜门蒂斯有限公司 | Single domain antibodies against TNFRl and methods of use therefor |
| EP2422811A2 (en) | 2004-10-27 | 2012-02-29 | MedImmune, LLC | Modulation of antibody specificity by tailoring the affinity to cognate antigens |
| GB2433591A (en) * | 2005-12-20 | 2007-06-27 | Sharp Kk | Method for functionalising a hydrophobic substrate |
| GB2433505A (en) * | 2005-12-20 | 2007-06-27 | Sharp Kk | Capture agents for binding a ligand |
| GB2433506A (en) * | 2005-12-20 | 2007-06-27 | Sharp Kk | A method of producing a multimeric capture agent |
| US20080107597A1 (en) * | 2006-01-12 | 2008-05-08 | Anaptys Biosciences, Inc. | Isolation of antibodies that cross-react and neutralize rankl originating from multiple species |
| EA200970250A1 (en) | 2006-09-05 | 2010-02-26 | Медарекс, Инк. | ANTIBODIES TO BONE MORPHOGENETIC PROTEINS AND THEIR RECEPTORS AND METHODS OF THEIR APPLICATION |
| EP2486941B1 (en) | 2006-10-02 | 2017-03-15 | E. R. Squibb & Sons, L.L.C. | Human antibodies that bind CXCR4 and uses thereof |
| JP2010507099A (en) | 2006-10-16 | 2010-03-04 | ザ アリゾナ ボード オブ リージェンツ ア ボディ コーポレイト オブ ザ ステイト オブ アリゾナ アクティング フォー アンド オン ビハーフ オブ アリゾナ ステイト ユニバーシティー | Synthetic antibody |
| GB0621513D0 (en) * | 2006-10-30 | 2006-12-06 | Domantis Ltd | Novel polypeptides and uses thereof |
| BRPI0717902A2 (en) | 2006-12-01 | 2013-10-29 | Medarex Inc | "HUMAN MONOCLONAL ANTIBODY ISOLATED, COMPOSITION, ASSOCIATED ANTIBODY-MOLLECLE PARTNERSHIP, IMMUNOCOUGHTED, ISOLATED NUCLEIC ACID MOLECULES, EXPRESSION VECTOR, HOSPEDIC CELL FOR PREPARING A CDT FOR THE PREPARATION OF A CD22 AND METHOD FOR TREATING INFLAMMATORY DISEASE OR SELF-IMMUNEING AN INDIVIDUAL " |
| CL2007003622A1 (en) | 2006-12-13 | 2009-08-07 | Medarex Inc | Human anti-cd19 monoclonal antibody; composition comprising it; and tumor cell growth inhibition method. |
| BRPI0807952A2 (en) | 2007-02-20 | 2014-06-10 | Anaptysbio Inc | Somatic Hypermutation Systems |
| AU2008262384B9 (en) | 2007-06-05 | 2014-11-27 | Yale University | Inhibitors of receptor tyrosine kinases and methods of use thereof |
| WO2009018386A1 (en) | 2007-07-31 | 2009-02-05 | Medimmune, Llc | Multispecific epitope binding proteins and uses thereof |
| JP5933894B2 (en) | 2007-09-14 | 2016-06-15 | アディマブ, エルエルシー | Rationally designed synthetic antibody libraries and their use |
| US8877688B2 (en) | 2007-09-14 | 2014-11-04 | Adimab, Llc | Rationally designed, synthetic antibody libraries and uses therefor |
| US12529164B2 (en) | 2007-09-14 | 2026-01-20 | Adimab, Llc | Rationally designed, synthetic antibody libraries and uses therefor |
| EP3629022A1 (en) | 2008-07-25 | 2020-04-01 | Richard W. Wagner | Protein screening methods |
| MX2011004824A (en) * | 2008-11-07 | 2012-01-12 | Triact Therapeutics Inc | USE OF CATHOLIC BUTANE DERIVATIVES IN THERAPY AGAINST CANCER. |
| AU2010207552A1 (en) | 2009-01-21 | 2011-09-01 | Oxford Biotherapeutics Ltd. | PTA089 protein |
| ME02842B (en) | 2009-03-05 | 2018-01-20 | Squibb & Sons Llc | CADM1-SPECIFIC COMPLETE HUMAN ANTIBODIES |
| EA030182B1 (en) | 2009-04-20 | 2018-07-31 | Оксфорд Байотерепьютикс Лтд. | Antibodies specific to cadherin-17 |
| IE20090514A1 (en) | 2009-07-06 | 2011-02-16 | Opsona Therapeutics Ltd | Humanised antibodies and uses therof |
| BR112012001977A2 (en) | 2009-07-29 | 2017-01-31 | Glaxo Group Ltd | immunoglobulin single variable domain, isolated polypeptide, binder, fusion protein, isolated nucleic acid, isolated nucleic acid molecule, vector, host cell, methods for making a polypeptide and for treating and / or preventing a condition, pharmaceutical composition, use of a single variable domain, and pulmonary dispensing device. |
| US8221753B2 (en) | 2009-09-30 | 2012-07-17 | Tracon Pharmaceuticals, Inc. | Endoglin antibodies |
| CA2772240C (en) | 2009-08-17 | 2017-12-05 | Tracon Pharmaceuticals, Inc. | Combination therapy of cancer with anti-endoglin antibodies and anti-vegf agents |
| US20120231004A1 (en) | 2009-10-13 | 2012-09-13 | Oxford Biotherapeutic Ltd. | Antibodies |
| EP2496605A1 (en) | 2009-11-02 | 2012-09-12 | Oxford Biotherapeutics Ltd. | Ror1 as therapeutic and diagnostic target |
| EP2496944A2 (en) | 2009-11-05 | 2012-09-12 | Novartis AG | Biomarkers predictive of progression of fibrosis |
| WO2011075185A1 (en) | 2009-12-18 | 2011-06-23 | Oligasis | Targeted drug phosphorylcholine polymer conjugates |
| BR112012019902A2 (en) | 2010-02-10 | 2019-09-24 | Novartis Ag | "method and compounds for muscle growth" |
| US20110223156A1 (en) * | 2010-03-11 | 2011-09-15 | Raibekas Andrei A | Reversible gel protein formulation |
| CN103443126B (en) | 2011-01-06 | 2016-11-23 | 葛兰素集团有限公司 | Ligands that bind TGF-beta receptor II |
| ES2640960T3 (en) | 2011-06-28 | 2017-11-07 | Oxford Biotherapeutics Ltd. | Antibodies for ADP-ribosyl cyclase 2 |
| ME02632B (en) | 2011-06-28 | 2017-06-20 | Oxford Biotherapeutics Ltd | THERAPEUTIC AND DIAGNOSTIC GOAL |
| EP2776061B1 (en) | 2011-11-07 | 2019-08-14 | MedImmune, LLC | Multispecific and multivalent binding proteins and uses thereof |
| WO2013074840A1 (en) | 2011-11-15 | 2013-05-23 | Allergan, Inc. | Treatment of dry age related macular degeneration |
| GB201213652D0 (en) | 2012-08-01 | 2012-09-12 | Oxford Biotherapeutics Ltd | Therapeutic and diagnostic target |
| EP2888279A1 (en) | 2012-08-22 | 2015-07-01 | Glaxo Group Limited | Anti lrp6 antibodies |
| UA115789C2 (en) | 2012-09-05 | 2017-12-26 | Трейкон Фармасутікалз, Інк. | Antibody formulations and uses thereof |
| WO2014055784A1 (en) | 2012-10-03 | 2014-04-10 | Zymeworks Inc. | Methods of quantitating heavy and light chain polypeptide pairs |
| GB201302447D0 (en) | 2013-02-12 | 2013-03-27 | Oxford Biotherapeutics Ltd | Therapeutic and diagnostic target |
| US9834575B2 (en) | 2013-02-26 | 2017-12-05 | Triact Therapeutics, Inc. | Cancer therapy |
| AU2014223824B2 (en) | 2013-02-28 | 2020-02-27 | Albert Einstein College Of Medicine, Inc. | Tuberculosis biomarkers and uses thereof |
| WO2014141145A1 (en) | 2013-03-14 | 2014-09-18 | Glaxosmithkline Intellectual Property Development Limited | Modified molecules resistant to proteolytic degradation |
| HRP20201113T1 (en) | 2013-03-15 | 2020-10-30 | Glaxosmithkline Intellectual Property Development Limited | Anti-lag-3 binding proteins |
| KR102218494B1 (en) | 2013-03-15 | 2021-02-19 | 인트린식 라이프사이언시스, 엘엘씨 | Anti-hepcidin antibodies and uses thereof |
| AR097102A1 (en) | 2013-08-02 | 2016-02-17 | Pfizer | ANTI-CXCR4 ANTIBODY AND ANTIBODY AND DRUG CONJUGATES |
| CA2923667A1 (en) | 2013-09-09 | 2015-03-12 | Triact Therapeutics, Inc. | Cancer therapy |
| AU2015321462B2 (en) | 2014-09-22 | 2020-04-30 | Intrinsic Lifesciences Llc | Humanized anti-hepcidin antibodies and uses thereof |
| GB201416832D0 (en) | 2014-09-24 | 2014-11-05 | Glaxosmithkline Plc | Methods of treatment |
| WO2016077451A1 (en) | 2014-11-12 | 2016-05-19 | Tracon Pharmaceuticals, Inc. | Anti-endoglin antibodies and uses thereof |
| US9926375B2 (en) | 2014-11-12 | 2018-03-27 | Tracon Pharmaceuticals, Inc. | Anti-endoglin antibodies and uses thereof |
| BR112018002436A2 (en) | 2015-08-04 | 2018-09-18 | Glaxosmithkline Ip Dev Ltd | combination treatment of methods uses of these |
| EP3331917A1 (en) | 2015-08-04 | 2018-06-13 | GlaxoSmithKline Intellectual Property Development Limited | Combination treatments and uses and methods thereof |
| EP3331918A1 (en) | 2015-08-04 | 2018-06-13 | GlaxoSmithKline Intellectual Property Development Limited | Combination treatments and uses and methods thereof |
| TW201716084A (en) | 2015-08-06 | 2017-05-16 | 葛蘭素史克智慧財產發展有限公司 | Combinations and uses and treatments thereof |
| WO2017021912A1 (en) | 2015-08-06 | 2017-02-09 | Glaxosmithkline Intellectual Property Development Limited | Combined tlrs modulators with anti ox40 antibodies |
| BR112018002520A2 (en) | 2015-08-06 | 2018-09-18 | Glaxosmithkline Ip Dev Ltd | TLR4 AGONISTS AND COMPOSITIONS OF THE SAME AND ITS USE IN CANCER TREATMENT |
| RU2021133819A (en) | 2015-09-02 | 2021-12-10 | Иммутеп С.A.С. | ANTI-LAG-3 ANTIBODIES |
| EP4015537A1 (en) | 2015-12-01 | 2022-06-22 | GlaxoSmithKline Intellectual Property Development Limited | Combination treatments and uses and methods thereof |
| AU2017260274A1 (en) * | 2016-05-04 | 2018-11-01 | Navigo Proteins Gmbh | Targeted compounds for the site-specific coupling of chemical moieties comprising a peptide linker |
| WO2018100534A1 (en) | 2016-12-01 | 2018-06-07 | Glaxosmithkline Intellectual Property Development Limited | Combination therapy |
| JP2020511407A (en) | 2016-12-01 | 2020-04-16 | グラクソスミスクライン、インテレクチュアル、プロパティー、ディベロップメント、リミテッドGlaxosmithkline Intellectual Property Development Limited | Combination therapy |
| EP3582855A1 (en) | 2017-02-15 | 2019-12-25 | GlaxoSmithKline Intellectual Property Development Limited | Combination treatment for cancer |
| WO2019106605A1 (en) | 2017-12-01 | 2019-06-06 | Board Of Regents, The University Of Texas System | Combination treatment for cancer |
| CN112469441A (en) | 2018-05-31 | 2021-03-09 | 葛兰素史克知识产权开发有限公司 | Combination therapy with ICOS binding protein and arginine methyltransferase inhibitors |
| CN112469416A (en) | 2018-05-31 | 2021-03-09 | 葛兰素史克知识产权开发有限公司 | Combination of type II protein arginine methyltransferase inhibitors and ICOS binding proteins for the treatment of cancer |
| KR20250151605A (en) | 2018-06-01 | 2025-10-21 | 노파르티스 아게 | Binding molecules against bcma and uses thereof |
| WO2020030570A1 (en) | 2018-08-06 | 2020-02-13 | Glaxosmithkline Intellectual Property Development Limited | Combinations of an ox40 antibody and a tlr4 modulator and uses thereof |
| WO2020030571A1 (en) | 2018-08-06 | 2020-02-13 | Glaxosmithkline Intellectual Property Development Limited | Combinations of a pd-1 antibody and a tlr4 modulator and uses thereof |
| WO2020031087A1 (en) | 2018-08-06 | 2020-02-13 | Glaxosmithkline Intellectual Property Development Limited | Combination therapy |
| CA3117746A1 (en) | 2018-10-22 | 2020-04-30 | Glaxosmithkline Intellectual Property Development Limited | Dosing |
| WO2020160375A1 (en) | 2019-02-01 | 2020-08-06 | Glaxosmithkline Intellectual Property Development Limited | Combination treatments for cancer comprising belantamab mafodotin and an anti ox40 antibody and uses and methods thereof |
| AU2020235455A1 (en) | 2019-03-08 | 2021-10-28 | Oxford Genetics Limited | Method of selecting for antibodies |
| GB201903233D0 (en) | 2019-03-08 | 2019-04-24 | Oxford Genetics Ltd | Method of selecting for antibodies |
| US12037378B2 (en) | 2019-05-21 | 2024-07-16 | Novartis Ag | Variant CD58 domains and uses thereof |
| KR20220010743A (en) | 2019-05-21 | 2022-01-26 | 노파르티스 아게 | Trispecific binding molecules to BCMA and uses thereof |
| TWI905099B (en) | 2019-05-21 | 2025-11-21 | 瑞士商諾華公司 | Cd19 binding molecules and uses thereof |
| WO2021018941A1 (en) | 2019-07-31 | 2021-02-04 | Glaxosmithkline Intellectual Property Development Limited | Methods of treating cancer |
| GB201912437D0 (en) | 2019-08-30 | 2019-10-16 | Glaxosmithkline Ip Dev Ltd | CR2 Binding Proteins and their use in Medical Therapy |
| WO2021046293A1 (en) | 2019-09-06 | 2021-03-11 | Glaxosmithkline Intellectual Property Development Limited | Dosing regimen for the treatment of cancer with an anti icos agonistic antibody and tremelimumab |
| WO2021043961A1 (en) | 2019-09-06 | 2021-03-11 | Glaxosmithkline Intellectual Property Development Limited | Dosing regimen for the treatment of cancer with an anti icos agonistic antibody and chemotherapy |
| EP4034562B1 (en) | 2019-09-27 | 2025-10-29 | GlaxoSmithKline Intellectual Property Development Limited | Antigen binding proteins |
| US11912784B2 (en) | 2019-10-10 | 2024-02-27 | Kodiak Sciences Inc. | Methods of treating an eye disorder |
| US20230067202A1 (en) | 2020-01-28 | 2023-03-02 | Glaxosmithkline Intellectual Property Development Limited | Combination Treatments and Uses and Methods Thereof |
| CN116249549A (en) | 2020-03-27 | 2023-06-09 | 诺华股份有限公司 | Bispecific Combination Therapies for the Treatment of Proliferative Diseases and Autoimmune Disorders |
| WO2021204649A1 (en) | 2020-04-06 | 2021-10-14 | Glaxosmithkline Intellectual Property Development Limited | Gm-csf antagonists for use in the treatment of severe pulmonary covid-19, cytokine release syndrome and/or acute respiratory distress syndrome |
| AU2021256925A1 (en) | 2020-04-14 | 2022-11-03 | Ares Trading S.A. | Combination treatment for cancer based upon an ICOS antibody and a PD-L1 antibody TGF-beta-receptor fusion protein |
| CA3171557A1 (en) | 2020-04-14 | 2021-10-21 | Marc S. BALLAS | Combination treatment for cancer involving anti-icos and anti-pd1 antibodies, optionally further involving anti-tim3 antibodies |
| AU2021257570A1 (en) | 2020-04-14 | 2022-11-03 | Glaxosmithkline Intellectual Property Development Limited | Combination treatment for cancer |
| CA3187690A1 (en) | 2020-07-31 | 2022-02-03 | Jane Elizabeth Clarkson | Antigen binding protein |
| WO2022097061A1 (en) | 2020-11-06 | 2022-05-12 | Novartis Ag | Anti-cd19 agent and b cell targeting agent combination therapy for treating b cell malignancies |
| IL302569A (en) | 2020-11-06 | 2023-07-01 | Novartis Ag | CD19 binding molecules and their uses |
| MX2023006294A (en) | 2020-12-02 | 2023-06-13 | Glaxosmithkline Ip Dev Ltd | Il-7 binding proteins and their use in medical therapy. |
| US20250296988A1 (en) | 2020-12-07 | 2025-09-25 | Viiv Healthcare Company | Combination therapy |
| CN118638226A (en) | 2021-03-19 | 2024-09-13 | 葛兰素史密斯克莱知识产权发展有限公司 | Chimeric antigen receptor targeting claudin 3 and method for treating cancer |
| US20240166747A1 (en) | 2021-03-31 | 2024-05-23 | Glazosmithkline Intellectual Property Development Limited | Antigen binding proteins and combinations thereof |
| JP2024521187A (en) | 2021-05-28 | 2024-05-28 | グラクソスミスクライン、インテレクチュアル、プロパティー、ディベロップメント、リミテッド | Combination Therapy for the Treatment of Cancer |
| EP4412713A1 (en) | 2021-10-05 | 2024-08-14 | GlaxoSmithKline Intellectual Property Development Ltd | Combination therapies for treating cancer |
| CN118475353A (en) | 2021-12-17 | 2024-08-09 | Viiv保健公司 | Combination therapy for HIV infection and uses thereof |
| US20260053939A1 (en) | 2022-01-25 | 2026-02-26 | Glaxosmithkline Intellectual Property Development Limited | Combination Therapy for Cancer |
| JP2025517657A (en) | 2022-05-10 | 2025-06-10 | アンスティチュ ナショナル ドゥ ラ サンテ エ ドゥ ラ ルシェルシュ メディカル | Syncytin-1 fusion proteins and their use for cargo delivery to target cells - Patents.com |
| AR129445A1 (en) | 2022-05-27 | 2024-08-28 | Glaxosmithkline Ip Dev Ltd | USE OF TNF-a BINDING PROTEINS AND IL-7 BINDING PROTEINS IN MEDICAL TREATMENT |
| EP4577569A1 (en) | 2022-08-25 | 2025-07-02 | GlaxoSmithKline Intellectual Property Development Ltd | Antigen binding proteins and uses thereof |
| CR20250219A (en) | 2022-11-02 | 2025-09-18 | Viiv Healthcare Uk No 5 Ltd | Antigen binding proteins |
| CN120303298A (en) | 2022-12-05 | 2025-07-11 | 葛兰素史密斯克莱知识产权发展有限公司 | Treatment approaches using B cell maturation antigen antagonists |
| WO2024127277A1 (en) | 2022-12-16 | 2024-06-20 | Glaxosmithkline Intellectual Property Development Limited | Method of treating pain with an anti-ccl17 antibody |
| CN121311244A (en) | 2023-05-18 | 2026-01-09 | 葛兰素史密斯克莱知识产权管理有限公司 | New Uses of Anti-BLYS Antibodies |
| WO2025068912A1 (en) | 2023-09-27 | 2025-04-03 | ViiV Healthcare UK (No.3) Limited | Pharmaceutical compositions |
| AU2023466962A1 (en) | 2023-09-27 | 2026-03-12 | ViiV Healthcare UK (No.3) Limited | Pharmaceutical composition of cabotegravir |
| AR134489A1 (en) | 2023-11-27 | 2026-01-21 | Glaxosmithkline Ip Dev Ltd | ANTIGEN-BINDING PROTEINS |
| WO2025229018A1 (en) | 2024-04-30 | 2025-11-06 | VIIV Healthcare UK (No.5) Limited | Neutralizing antibody constructs against hiv |
| WO2025229019A1 (en) | 2024-04-30 | 2025-11-06 | VIIV Healthcare UK (No.5) Limited | Neutralizing antibody constructs against hiv |
| WO2025242652A1 (en) | 2024-05-23 | 2025-11-27 | Glaxosmithkline Intellectual Property Development Limited | Pregnancy associated plasma protein-a (pappa) binding proteins |
| US20260008843A1 (en) | 2024-06-21 | 2026-01-08 | Glaxosmithkline Intellectual Property Development Limited | Multispecific antigen binding proteins |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5223409A (en) * | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5663143A (en) * | 1988-09-02 | 1997-09-02 | Dyax Corp. | Engineered human-derived kunitz domains that inhibit human neutrophil elastase |
| US5473039A (en) * | 1989-08-18 | 1995-12-05 | The Scripps Research Institute | Polypeptide analogs of apolipoprotein E, diagnostic systems and methods using the analogs |
| US20020131972A1 (en) * | 1998-05-21 | 2002-09-19 | Daniel Sem | Multi-partite ligands and methods of identifying and using same |
| US6818418B1 (en) * | 1998-12-10 | 2004-11-16 | Compound Therapeutics, Inc. | Protein scaffolds for antibody mimics and other binding proteins |
| AUPQ339899A0 (en) * | 1999-10-13 | 1999-11-04 | University Of Queensland, The | Novel molecules |
| DE10053224A1 (en) * | 2000-10-26 | 2002-05-08 | Univ Goettingen Georg August | Procedure for the exposure of peptides and polypeptides to the cell surface of bacteria |
| US20040171544A1 (en) * | 2001-04-24 | 2004-09-02 | Barker Nicholas P. | Trefoil domain-containing polypeptides and uses thereof |
-
2004
- 2004-10-22 WO PCT/US2004/035301 patent/WO2005040229A2/en not_active Ceased
- 2004-10-22 EP EP04796312A patent/EP1675878A2/en not_active Ceased
- 2004-10-22 US US10/971,679 patent/US20050164301A1/en not_active Abandoned
- 2004-10-22 AU AU2004284090A patent/AU2004284090A1/en not_active Abandoned
- 2004-10-22 CA CA002543360A patent/CA2543360A1/en not_active Abandoned
Non-Patent Citations (4)
| Title |
|---|
| BAJARI ET AL.: 'A Minimal Binding Domain of the Low Density Lipoprotein Receptor Family.' BIOLOGICAL CHEMISTRY. vol. 379, no. 8-9, 1998, pages 1053 - 1062, XP009121242 * |
| ESSER ET AL.: 'Mutational Analysis of the Ligand Binding Domain of the Low Density Lipoprotein Receptor.' JOURNAL OF BIOLOGICAL CHEMISTRY vol. 263, no. 26, 1988, pages 13282 - 13290, XP003025627 * |
| HERZ ET AL.: 'Surface location and high affinity for calcium of a 500-kd liver membrane protein closely related to the LDL-receptor suggest a physiological role as lipoprotein receptor.' EMBO JOURNAL vol. 7, no. 13, 1988, pages 4119 - 4127, XP000004236 * |
| VAN LEUVEN ET AL.: 'Molecular cloning and sequencing of the murine alpha-2- macroglobulin receptor cDNA.' BIOCHIMICA ET BIOPHYSICA ACTA vol. 1173, 1993, pages 71 - 74, XP023468867 * |
Cited By (205)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7563443B2 (en) | 2004-09-17 | 2009-07-21 | Domantis Limited | Monovalent anti-CD40L antibody polypeptides and compositions thereof |
| US8524236B2 (en) | 2004-09-17 | 2013-09-03 | Domantis Limited | Methods of antagonizing the binding of CD40 to CD40L with CD40L-specific monovalent polypeptides in autoimmune individuals |
| US7829096B2 (en) | 2004-09-17 | 2010-11-09 | Domantis Ltd. | CD40L-specific monovalent polypeptides |
| US7927596B2 (en) | 2004-09-17 | 2011-04-19 | Domantis Limited | Methods of antagonizing binding of CD40 to CD40L with CD40L-specific monovalent polypeptides |
| EP2371862A2 (en) | 2004-09-17 | 2011-10-05 | Domantis Limited | Compositions monovalent for CD40L binding and methods of use |
| EP1902066A4 (en) * | 2005-07-13 | 2009-01-07 | Amgen Mountain View Inc | Il-6 binding proteins |
| US7786262B2 (en) | 2005-07-13 | 2010-08-31 | Amgen Mountain View Inc. | IL-6 binding proteins |
| US7820790B2 (en) | 2005-07-13 | 2010-10-26 | Amgen Mountain View Inc. | IL-6 binding proteins |
| US9829494B2 (en) | 2005-12-01 | 2017-11-28 | Adrenomed Ag | Methods of treatment using ADM antibodies |
| EP4238993A2 (en) | 2008-04-11 | 2023-09-06 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule capable of binding to two or more antigen molecules repeatedly |
| EP3521311A1 (en) | 2008-04-11 | 2019-08-07 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule capable of binding to two or more antigen molecules repeatedly |
| EP3056513A1 (en) | 2008-04-11 | 2016-08-17 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule capable of binding to two or more antigen molecules repeatedly |
| EP3514180A1 (en) | 2008-04-11 | 2019-07-24 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule capable of binding to two or more antigen molecules repeatedly |
| EP2708558A2 (en) | 2008-04-11 | 2014-03-19 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule capable of binding to two or more antigen molecules repeatedly |
| EP2708559A2 (en) | 2008-04-11 | 2014-03-19 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule capable of binding to two or more antigen molecules repeatedly |
| WO2009125825A1 (en) | 2008-04-11 | 2009-10-15 | 中外製薬株式会社 | Antigen-binding molecule capable of binding to two or more antigen molecules repeatedly |
| EP2700651A1 (en) | 2008-07-18 | 2014-02-26 | Bristol-Myers Squibb Company | Compositions monovalent for CD28 binding and methods of use |
| US9562107B2 (en) | 2009-03-20 | 2017-02-07 | Amgen Inc. | Carrier immunoglobulins |
| US8734796B2 (en) | 2009-03-20 | 2014-05-27 | Amgen Inc. | Carrier immunoglobulins |
| US9562108B2 (en) | 2009-03-20 | 2017-02-07 | Amgen Inc. | Carrier immunoglobulins |
| US10189912B2 (en) | 2009-03-20 | 2019-01-29 | Amgen Inc. | Carrier immunoglobulins |
| EP3181581A1 (en) | 2010-03-30 | 2017-06-21 | Chugai Seiyaku Kabushiki Kaisha | Antibodies with modified affinity to fcrn that promote antigen clearance |
| EP4501956A2 (en) | 2010-03-30 | 2025-02-05 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecules that promote antigen clearance |
| WO2011122011A2 (en) | 2010-03-30 | 2011-10-06 | Chugai Seiyaku Kabushiki Kaisha | Antibodies with modified affinity to fcrn that promote antigen clearance |
| EP3702368A1 (en) | 2010-03-30 | 2020-09-02 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecules that promote antigen clearance |
| US9803019B2 (en) | 2010-09-22 | 2017-10-31 | Amgen Inc. | Carrier immunoglobulins and uses thereof |
| US8993727B2 (en) | 2010-09-22 | 2015-03-31 | Amgen Inc. | Carrier immunoglobulins and uses thereof |
| WO2012067176A1 (en) | 2010-11-17 | 2012-05-24 | 中外製薬株式会社 | Multi-specific antigen-binding molecule having alternative function to function of blood coagulation factor viii |
| EP3318633A1 (en) | 2010-11-17 | 2018-05-09 | Chugai Seiyaku Kabushiki Kaisha | Multi-specific antigen-binding molecule having alternative function to function of blood coagulation factor viii |
| EP4231014A2 (en) | 2010-11-30 | 2023-08-23 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule capable of binding to plurality of antigen molecules repeatedly |
| WO2012073992A1 (en) | 2010-11-30 | 2012-06-07 | 中外製薬株式会社 | Antigen-binding molecule capable of binding to plurality of antigen molecules repeatedly |
| WO2012093704A1 (en) | 2011-01-07 | 2012-07-12 | 中外製薬株式会社 | Method for improving physical properties of antibody |
| EP3539991A1 (en) | 2011-01-07 | 2019-09-18 | Chugai Seiyaku Kabushiki Kaisha | Method for improving physical properties of antibody |
| WO2012115241A1 (en) | 2011-02-25 | 2012-08-30 | 中外製薬株式会社 | Fcγriib-specific fc antibody |
| EP3604330A1 (en) | 2011-02-25 | 2020-02-05 | Chugai Seiyaku Kabushiki Kaisha | Fcgammariib-specific fc antibody |
| EP3825325A2 (en) | 2011-03-30 | 2021-05-26 | Chugai Seiyaku Kabushiki Kaisha | Retention of antigen-binding molecules in blood plasma and method for modifying immunogenicity |
| WO2012133782A1 (en) | 2011-03-30 | 2012-10-04 | 中外製薬株式会社 | Retention of antigen-binding molecules in blood plasma and method for modifying immunogenicity |
| WO2013002362A1 (en) | 2011-06-30 | 2013-01-03 | 中外製薬株式会社 | Heterodimerized polypeptide |
| EP4011913A1 (en) | 2011-06-30 | 2022-06-15 | Chugai Seiyaku Kabushiki Kaisha | Heterodimerized polypeptide |
| WO2013047748A1 (en) | 2011-09-30 | 2013-04-04 | 中外製薬株式会社 | Antigen-binding molecule promoting disappearance of antigens having plurality of biological activities |
| WO2013047752A1 (en) | 2011-09-30 | 2013-04-04 | 中外製薬株式会社 | Antigen-binding molecule for promoting loss of antigens |
| EP3939996A1 (en) | 2011-09-30 | 2022-01-19 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule promoting disappearance of antigens having plurality of biological activities |
| WO2013047729A1 (en) | 2011-09-30 | 2013-04-04 | 中外製薬株式会社 | Antigen-binding molecule inducing immune response to target antigen |
| WO2013046722A1 (en) | 2011-09-30 | 2013-04-04 | 中外製薬株式会社 | Ion concentration-dependent binding molecule library |
| WO2013046704A2 (en) | 2011-09-30 | 2013-04-04 | Chugai Seiyaku Kabushiki Kaisha | THERAPEUTIC ANTIGEN-BINDING MOLECULE WITH A FcRn-BINDING DOMAIN THAT PROMOTES ANTIGEN CLEARANCE |
| EP3549956A2 (en) | 2011-09-30 | 2019-10-09 | Chugai Seiyaku Kabushiki Kaisha | Therapeutic antigen-binding molecule with a fcrn-binding domain that promotes antigen clearance |
| EP4324850A2 (en) | 2011-09-30 | 2024-02-21 | Chugai Seiyaku Kabushiki Kaisha | Therapeutic antigen-binding molecule with a fcrn-binding domain that promotes antigen clearance |
| EP3680251A1 (en) | 2011-09-30 | 2020-07-15 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecules for promoting elimination of antigens |
| WO2013051294A1 (en) | 2011-10-05 | 2013-04-11 | 中外製薬株式会社 | Antigen-binding molecule for promoting clearance from plasma of antigen comprising saccharide chain receptor-binding domain |
| EP3617313A1 (en) | 2011-10-05 | 2020-03-04 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule for promoting clearance from plasma of antigen comprising saccharide chain receptor-binding domain |
| WO2013072513A1 (en) | 2011-11-16 | 2013-05-23 | Adrenomed Ag | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for use in therapy of an acute disease or acute condition of a patient for stabilizing the circulation |
| US10227405B2 (en) | 2011-11-16 | 2019-03-12 | Adrenomed Ag | Methods of modulating the activity of adrenomedullin in a subject in need of regulation of fluid balance by administering an anti-adrenomedullin (ADM) antibody or an anti-ADM antibody fragment |
| US10800842B2 (en) | 2011-11-16 | 2020-10-13 | Adrenomed Ag | Anti-adrenomedullin (ADM) monoclonal antibodies and anti-ADM monoclonal antibody fragments that bind to adrenomedullin |
| US12338281B2 (en) | 2011-11-16 | 2025-06-24 | Adrenomed Ag | Anti-adrenomedullin antibodies and pharmaceutical compositions thereof |
| US9140696B2 (en) | 2011-11-16 | 2015-09-22 | Adrenomed Ag | Anti-adrenomedullin (ADM) antibody or anti-ADM antibody fragment or anti-ADM non-IG scaffold for reducing the risk of mortality in a patient having a chronic or acute disease or acute condition |
| US9304127B2 (en) | 2011-11-16 | 2016-04-05 | Adrenomed Ag | Anti-adrenomedullin (ADM) antibody or anti-ADM antibody fragment for use in therapy |
| EP2594588A1 (en) | 2011-11-16 | 2013-05-22 | AdrenoMed AG | Anti-Adrenomedullin (ADM) antibody or anti-ADM antibody fragment or an anti-ADM non-Ig scaffold for use in therapy |
| EP2594587A1 (en) | 2011-11-16 | 2013-05-22 | AdrenoMed AG | Anti-Adrenomedullin (ADM) antibody or anti-ADM antibody fragment or anti-ADM non-Ig scaffold for reducing the risk of mortality in a patient having a chronic or acute disease or acute condition |
| US9402900B2 (en) | 2011-11-16 | 2016-08-02 | Adrenomed Ag | Methods of modulating adrenomedullin by administering an anti-adrenomedullin (ADM) antibody |
| WO2013072512A1 (en) | 2011-11-16 | 2013-05-23 | Adrenomed Ag | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or an anti-adm non-ig scaffold for use in therapy |
| EP3553084A1 (en) | 2011-11-16 | 2019-10-16 | AdrenoMed AG | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for prevention or reduction of organ dysfunction or organ failure in a patient having a chronic or acute disease or acute condition |
| WO2013072510A1 (en) | 2011-11-16 | 2013-05-23 | Adrenomed Ag | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for reducing the risk of mortality in a patient having a chronic or acute disease or acute condition |
| US10221238B2 (en) | 2011-11-16 | 2019-03-05 | Adrenomed Ag | Method of modulating the activity of adrenomedullin in a subject in need of therapeutic intervention for organ dysfunction or organ failure associated with adranomedullin (ADM) activity by administering an anti-adrenomedullin (ADM) antibody or an anti-ADM antibody fragment to the subject |
| WO2013072509A1 (en) | 2011-11-16 | 2013-05-23 | Adrenomed Ag | Adrenomedullin assays and methods for determining mature adrenomedullin |
| WO2013072514A1 (en) | 2011-11-16 | 2013-05-23 | Adrenomed Ag | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for regulating the fluid balance in a patient having a chronic or acute disease |
| US11673949B2 (en) | 2011-11-16 | 2023-06-13 | Adrenomed Ag | Method of modulating the adrenomedullin (ADM) activity of a patient by administering to the patient an anti-ADM antibody or fragment thereof that specifically binds to mature human ADM |
| WO2013072511A1 (en) | 2011-11-16 | 2013-05-23 | Adrenomed Ag | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for prevention or reduction of organ dysfunction or organ failure in a patient having a chronic or acute disease or acute condition |
| EP4086283A1 (en) | 2011-11-16 | 2022-11-09 | AdrenoMed AG | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for prevention or reduction of organ dysfunction or organ failure in a patient having a chronic or acute disease or acute condition |
| WO2013081143A1 (en) | 2011-11-30 | 2013-06-06 | 中外製薬株式会社 | Drug containing carrier into cell for forming immune complex |
| EP3517550A1 (en) | 2011-11-30 | 2019-07-31 | Chugai Seiyaku Kabushiki Kaisha | Drug containing carrier into cell for forming immune complex |
| EP4624490A2 (en) | 2012-02-09 | 2025-10-01 | Chugai Seiyaku Kabushiki Kaisha | Modified fc region of antibody |
| WO2013118858A1 (en) | 2012-02-09 | 2013-08-15 | 中外製薬株式会社 | Modified fc region of antibody |
| EP3738980A1 (en) | 2012-02-24 | 2020-11-18 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule for promoting disappearance of antigen via fc gamma riib |
| WO2013125667A1 (en) | 2012-02-24 | 2013-08-29 | 中外製薬株式会社 | ANTIGEN-BINDING MOLECULE FOR PROMOTING DISAPPEARANCE OF ANTIGEN VIA FcγRIIB |
| WO2013132088A1 (en) | 2012-03-08 | 2013-09-12 | Sphingotec Gmbh | A method for predicting the risk of getting a cardiovascular event in a female subject |
| US10520512B2 (en) | 2012-03-08 | 2019-12-31 | Sphingotec Gmbh | Method for predicting the risk of a subject for contracting diabetes mellitus and/or metabolic syndrome or for diagnosing metabolic syndrome in a subject |
| WO2013132090A1 (en) | 2012-03-08 | 2013-09-12 | Sphingotec Gmbh | A method for predicting the risk of a subject for contracting diabetes mellitus and/or metabolic syndrome or for diagnosing metabolic syndrome in a subject |
| WO2013132089A2 (en) | 2012-03-08 | 2013-09-12 | Sphingotec Gmbh | A method for predicting the risk of getting cancer or diagnosing cancer in a female subject |
| EP3892638A1 (en) | 2012-05-30 | 2021-10-13 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule for eliminating aggregated antigens |
| WO2013180201A1 (en) | 2012-05-30 | 2013-12-05 | 中外製薬株式会社 | Antigen-binding molecule for eliminating aggregated antigens |
| WO2013180200A1 (en) | 2012-05-30 | 2013-12-05 | 中外製薬株式会社 | Target-tissue-specific antigen-binding molecule |
| EP3795215A1 (en) | 2012-05-30 | 2021-03-24 | Chugai Seiyaku Kabushiki Kaisha | Target tissue-specific antigen-binding molecule |
| EP4310191A2 (en) | 2012-06-14 | 2024-01-24 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule containing modified fc region |
| WO2013187495A1 (en) | 2012-06-14 | 2013-12-19 | 中外製薬株式会社 | ANTIGEN-BINDING MOLECULE CONTAINING MODIFIED Fc REGION |
| EP3597747A1 (en) | 2012-08-24 | 2020-01-22 | Chugai Seiyaku Kabushiki Kaisha | Mouse fcgammarii-specific fc antibody |
| WO2014030728A1 (en) | 2012-08-24 | 2014-02-27 | 中外製薬株式会社 | Fcγriib-specific fc region variant |
| WO2014030750A1 (en) | 2012-08-24 | 2014-02-27 | 中外製薬株式会社 | MOUSE FcγRII-SPECIFIC Fc ANTIBODY |
| EP3721900A1 (en) | 2012-08-24 | 2020-10-14 | Chugai Seiyaku Kabushiki Kaisha | Fcgammariib-specific fc region variant |
| WO2014050926A1 (en) | 2012-09-28 | 2014-04-03 | 中外製薬株式会社 | Method for evaluating blood coagulation reaction |
| WO2014053501A1 (en) | 2012-10-02 | 2014-04-10 | Sphingotec Gmbh | A method for diagnosing or monitoring kidney function or diagnosing kidney dysfunction |
| WO2014104165A1 (en) | 2012-12-27 | 2014-07-03 | 中外製薬株式会社 | Heterodimerized polypeptide |
| WO2014108396A1 (en) | 2013-01-08 | 2014-07-17 | Sphingotec Gmbh | Fasting levels of growth hormone as a predictive marker of cardiovascular risk |
| WO2014120916A1 (en) | 2013-02-01 | 2014-08-07 | Bristol-Myers Squibb Company | Pegylated domain antibodies monovalent for cd28 binding and methods of use |
| WO2014147153A1 (en) | 2013-03-20 | 2014-09-25 | Sphingotec Gmbh | Adrenomedullin to guide therapy of blood pressure decline |
| EP3783017A1 (en) | 2013-04-02 | 2021-02-24 | Chugai Seiyaku Kabushiki Kaisha | Fc region variant |
| WO2014163101A1 (en) | 2013-04-02 | 2014-10-09 | 中外製薬株式会社 | Fc region variant |
| WO2015083764A1 (en) | 2013-12-04 | 2015-06-11 | 中外製薬株式会社 | Antigen-binding molecules, the antigen-binding activity of which varies according to the concentration of compounds, and libraries of said molecules |
| EP3763813A1 (en) | 2013-12-04 | 2021-01-13 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecules, the antigen-binding activity of which varies according to the concentration of compounds, and libraries of said molecules |
| EP4218816A2 (en) | 2014-06-20 | 2023-08-02 | Chugai Seiyaku Kabushiki Kaisha | Pharmaceutical composition for use in prevention and/or treatment of disease that develops or progresses as a result of decrease or loss of activity of blood coagulation factor viii and/or activated blood coagulation factor viii |
| EP3002589A1 (en) | 2014-10-01 | 2016-04-06 | sphingotec GmbH | A method for stratifying a female subject for hormone replacement therapy |
| EP4600372A2 (en) | 2014-12-19 | 2025-08-13 | Chugai Seiyaku Kabushiki Kaisha | Anti-myostatin antibodies, polypeptides containing variant fc regions, and methods of use |
| WO2016098357A1 (en) | 2014-12-19 | 2016-06-23 | Chugai Seiyaku Kabushiki Kaisha | Anti-myostatin antibodies, polypeptides containing variant fc regions, and methods of use |
| EP3816179A2 (en) | 2015-02-05 | 2021-05-05 | Chugai Seiyaku Kabushiki Kaisha | Fc region variant comprising a modified fcrn-binding domain |
| WO2016125495A1 (en) | 2015-02-05 | 2016-08-11 | Chugai Seiyaku Kabushiki Kaisha | Antibodies comprising an ion concentration dependent antigen-binding domain, fc region variants, il-8-binding antibodies, and uses therof |
| WO2016166014A1 (en) | 2015-04-17 | 2016-10-20 | F. Hoffmann-La Roche Ag | Combination therapy with coagulation factors and multispecific antibodies |
| WO2016170023A1 (en) | 2015-04-24 | 2016-10-27 | Sphingotec Gmbh | A method for predicting the risk of incidence of chronic kidney disease |
| WO2017046994A1 (en) | 2015-09-18 | 2017-03-23 | Chugai Seiyaku Kabushiki Kaisha | Il-8-binding antibodies and uses thereof |
| WO2017104783A1 (en) | 2015-12-18 | 2017-06-22 | Chugai Seiyaku Kabushiki Kaisha | Anti-myostatin antibodies, polypeptides containing variant fc regions, and methods of use |
| EP4417218A2 (en) | 2016-04-21 | 2024-08-21 | 4TEEN4 Pharmaceuticals GmbH | Methods for determining dpp3 and therapeutic methods |
| EP3854817A1 (en) | 2016-04-21 | 2021-07-28 | 4TEEN4 Pharmaceuticals GmbH | Methods for determining dpp3 and therapeutic methods |
| EP4417217A2 (en) | 2016-04-21 | 2024-08-21 | 4TEEN4 Pharmaceuticals GmbH | Methods for determining dpp3 and therapeutic methods |
| WO2017182561A1 (en) | 2016-04-21 | 2017-10-26 | Sphingotec Therapeutics Gmbh | Methods for determining dpp3 and therapeutic methods |
| DE112017002105T5 (en) | 2016-04-21 | 2019-04-25 | Sphingotec Therapeutics Gmbh | Method for the determination of DPP3 and therapeutic methods |
| EP3896450A1 (en) | 2016-04-21 | 2021-10-20 | 4TEEN4 Pharmaceuticals GmbH | Methods for determining dpp3 and therapeutic methods |
| WO2017217525A1 (en) | 2016-06-17 | 2017-12-21 | Chugai Seiyaku Kabushiki Kaisha | Anti-myostatin antibodies and methods of use |
| WO2018002081A1 (en) | 2016-06-27 | 2018-01-04 | Aicuris Anti-Infective Cures Gmbh | Hcmv entry inhibitors |
| WO2018007588A1 (en) | 2016-07-08 | 2018-01-11 | Sphingotec Gmbh | Adrenomedullin for assessing congestion in a subject with acute heart failure |
| EP4231018A2 (en) | 2016-07-08 | 2023-08-23 | SphingoTec GmbH | Adrenomedullin for assessing congestion in a subject with acute heart failure |
| WO2018047813A1 (en) | 2016-09-06 | 2018-03-15 | Chugai Seiyaku Kabushiki Kaisha | Methods of using a bispecific antibody that recognizes coagulation factor ix and/or activated coagulation factor ix and coagulation factor x and/or activated coagulation factor x |
| EP4491224A2 (en) | 2016-09-06 | 2025-01-15 | Chugai Seiyaku Kabushiki Kaisha | Methods of using a bispecific antibody that recognizes coagulation factor ix and/or activated coagulation factor ix and coagulation factor x and/or activated coagulation factor x |
| WO2018069437A1 (en) | 2016-10-12 | 2018-04-19 | Sphingotec Gmbh | Method for the detection of apolipoprotein e4 |
| EP3309550A1 (en) | 2016-10-12 | 2018-04-18 | sphingotec GmbH | Method for the detection of apolipoprotein e4 |
| WO2018091724A1 (en) | 2016-11-21 | 2018-05-24 | Cureab Gmbh | Anti-gp73 antibodies and immunoconjugates |
| EP4015532A1 (en) | 2016-11-21 | 2022-06-22 | cureab GmbH | Anti-gp73 antibodies and immunoconjugates |
| WO2018097307A1 (en) | 2016-11-28 | 2018-05-31 | 中外製薬株式会社 | Antigen-binding domain, and polypeptide including conveying section |
| WO2018097308A1 (en) | 2016-11-28 | 2018-05-31 | 中外製薬株式会社 | Ligand-binding molecule having adjustable ligand binding activity |
| WO2018109228A1 (en) | 2016-12-16 | 2018-06-21 | Adrenomed Ag | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for use in intervention and therapy of congestion in a patient in need thereof |
| EP3339324A1 (en) | 2016-12-22 | 2018-06-27 | sphingotec GmbH | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for use in intervention and therapy of congestion in a patient in need thereof |
| WO2018181870A1 (en) | 2017-03-31 | 2018-10-04 | 公立大学法人奈良県立医科大学 | Medicinal composition usable for preventing and/or treating blood coagulation factor ix abnormality, comprising multispecific antigen binding molecule replacing function of blood coagulation factor viii |
| WO2018219937A1 (en) | 2017-05-30 | 2018-12-06 | Sphingotec Gmbh | A method for diagnosing or monitoring kidney function or diagnosing kidney dysfunction |
| EP4159229A1 (en) | 2017-09-25 | 2023-04-05 | AdrenoMed AG | Anti-adrenomedullin (adm) binder for use in therapy or prevention of symptoms of illness |
| EP3854414A1 (en) | 2017-09-25 | 2021-07-28 | AdrenoMed AG | Anti-adrenomedullin (adm) binder for use in therapy or prevention of symptoms of illness |
| EP4159230A1 (en) | 2017-09-25 | 2023-04-05 | AdrenoMed AG | Anti-adrenomedullin (adm) binder for use in therapy or prevention of symptoms of illness |
| EP4488295A2 (en) | 2017-09-25 | 2025-01-08 | AdrenoMed AG | Anti-adrenomedullin (adm) binder for use in therapy or prevention of symptoms of illness |
| WO2019057992A2 (en) | 2017-09-25 | 2019-03-28 | Adrenomed Ag | Anti-adrenomedullin (adm) binder for use in therapy or prevention of symptoms of illness |
| WO2019065795A1 (en) | 2017-09-29 | 2019-04-04 | 中外製薬株式会社 | Multispecific antigen-binding molecule having blood coagulation factor viii (fviii) cofactor function-substituting activity, and pharmaceutical formulation containing said molecule as active ingredient |
| WO2019077082A1 (en) | 2017-10-18 | 2019-04-25 | Adrenomed Ag | Therapy monitoring under treatment with an anti-adrenomedullin (adm) binder |
| WO2019081504A1 (en) | 2017-10-24 | 2019-05-02 | Sphingotec Gmbh | Selenoprotein p for prediction of a first cardiovascular event |
| WO2019081595A2 (en) | 2017-10-25 | 2019-05-02 | Sphingotec Therapeutics Gmbh | Dpp3 binder directed to and binding to specific dpp3-epitopes and its use in the prevention or treatment of diseases / acute conditions that are associated with oxidative stress |
| EP4527458A2 (en) | 2017-10-25 | 2025-03-26 | 4TEEN4 Pharmaceuticals GmbH | Dpp3 binder directed to and binding to specific dpp3-epitopes and its use in the prevention or treatment of diseases / acute conditions that are associated with oxidative stress |
| WO2019107384A1 (en) | 2017-11-28 | 2019-06-06 | 中外製薬株式会社 | Ligand-binding molecule having adjustable ligand-binding activity |
| WO2019107380A1 (en) | 2017-11-28 | 2019-06-06 | 中外製薬株式会社 | Polypeptide including antigen-binding domain and carrying section |
| WO2019134981A1 (en) | 2018-01-05 | 2019-07-11 | Ac Immune Sa | Misfolded tdp-43 binding molecules |
| WO2019154900A1 (en) | 2018-02-08 | 2019-08-15 | Sphingotec Gmbh | Adrenomedullin (adm) for diagnosis and/or prediction of dementia and anti-adrenomedullin binder for use in therapy or prevention of dementia |
| WO2019158645A1 (en) | 2018-02-14 | 2019-08-22 | Abba Therapeutics Ag | Anti-human pd-l2 antibodies |
| WO2019219923A1 (en) | 2018-05-18 | 2019-11-21 | Julius-Maximilians-Universität Würzburg | Compounds and methods for the immobilization of myostatin-inhibitors on the extracellular matrix by transglutaminase |
| EP3569614A1 (en) | 2018-05-18 | 2019-11-20 | Julius-Maximilians-Universität Würzburg | Compounds and methods for the immobilization of myostatin-inhibitors on the extracellular matrix by transglutaminase |
| WO2019244973A1 (en) | 2018-06-20 | 2019-12-26 | 中外製薬株式会社 | Method for activating immune response of target cell and composition therefor |
| EP3586865A1 (en) | 2018-06-21 | 2020-01-01 | Charité - Universitätsmedizin Berlin | Complement anaphylatoxin binders and their use in treatment of a subject having an ocular wound and/or fibrosis |
| WO2019243555A1 (en) | 2018-06-21 | 2019-12-26 | Charité - Universitätsmedizin Berlin | Complement anaphylatoxin binders and their use in treatment of a subject having an ocular wound and/or fibrosis |
| WO2020032230A1 (en) | 2018-08-10 | 2020-02-13 | 中外製薬株式会社 | Anti-cd137 antigen-binding molecule and utilization thereof |
| WO2020128073A1 (en) | 2018-12-20 | 2020-06-25 | Sphingotec Gmbh | Selenoprotein p in heart failure |
| WO2020128039A2 (en) | 2018-12-21 | 2020-06-25 | 4TEEN4 Pharmaceuticals GmbH | Therapy guidance and/or therapy monitoring for a treatment with angiotensin-receptor-agonist and/or a precursor thereof |
| WO2020189748A1 (en) | 2019-03-19 | 2020-09-24 | 中外製薬株式会社 | Antigen-binding molecule containing antigen-binding domain of which binding activity to antigen is changed depending on mta, and library for obtaining said antigen-binding domain |
| WO2020204055A1 (en) | 2019-04-02 | 2020-10-08 | 中外製薬株式会社 | Method of introducing target-specific foreign gene |
| WO2020212593A1 (en) | 2019-04-18 | 2020-10-22 | Ac Immune Sa | Novel molecules for therapy and diagnosis |
| WO2020234473A1 (en) | 2019-05-23 | 2020-11-26 | Ac Immune Sa | Anti-tdp-43 binding molecules and uses thereof |
| WO2020246563A1 (en) | 2019-06-05 | 2020-12-10 | 中外製薬株式会社 | Antibody cleavage site-binding molecule |
| WO2020246567A1 (en) | 2019-06-05 | 2020-12-10 | 中外製薬株式会社 | Protease substrate, and polypeptide including protease cleavage sequence |
| WO2020246617A1 (en) | 2019-06-07 | 2020-12-10 | 中外製薬株式会社 | Information processing system, information processing method, program, and method for producing antigen-binding molecule or protein. |
| WO2020254539A1 (en) | 2019-06-18 | 2020-12-24 | MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. | Site-specific, kinetically inert conjugation of labels and/or carriers to target molecules such as his-tagged proteins via metal complex reagents |
| WO2020254540A1 (en) | 2019-06-18 | 2020-12-24 | MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. | Site-specific, kinetically inert conjugation of labels and/or carriers to target molecules such as his-tagged proteins via metal complex reagents |
| WO2021028582A1 (en) | 2019-08-15 | 2021-02-18 | Sphingotec Gmbh | A method for diagnosing or monitoring kidney function or diagnosing kidney dysfunction in pediatric patients |
| WO2021038078A1 (en) | 2019-08-30 | 2021-03-04 | 4TEEN4 Pharmaceuticals GmbH | Therapy guidance and/or therapy monitoring for treatment of shock |
| EP4552649A2 (en) | 2019-08-30 | 2025-05-14 | 4TEEN4 Pharmaceuticals GmbH | Therapy guidance and/or therapy monitoring for treatment of shock |
| WO2021099484A1 (en) | 2019-11-20 | 2021-05-27 | MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. | Archaeal peptide recombinase – a novel peptide ligating enzyme |
| WO2021104511A1 (en) | 2019-11-29 | 2021-06-03 | 苏州诺沃泰医药科技有限公司 | Application of car t-cells in preparing drug for treating cancer |
| WO2021162020A1 (en) | 2020-02-12 | 2021-08-19 | 中外製薬株式会社 | Anti-cd137 antigen-binding molecule for use in cancer treatment |
| WO2021170763A1 (en) | 2020-02-26 | 2021-09-02 | Sphingotec Gmbh | Anti-adm-antibodies binding to the free n-terminus for accelerated transition of adm-gly to bio-adm in patients with adm-gly/ bio-adm ratio above a threshold and combination with vitamin c |
| EP3871689A1 (en) | 2020-02-26 | 2021-09-01 | sphingotec GmbH | Anti-adm-antibodies binding to the free n-terminus for accelerated transition of adm-gly to bio-adm in patients with adm-gly/ bio-adm ratio above a threshold and combination with vitamin c |
| WO2021170880A2 (en) | 2020-02-27 | 2021-09-02 | Adrenomed Ag | Anti-adrenomedullin (adm) binder for use in therapy of patients in shock |
| WO2021170838A1 (en) | 2020-02-27 | 2021-09-02 | 4TEEN4 Pharmaceuticals GmbH | Dpp3 for therapy guidance, monitoring and stratification of nt-adm antibodies in patients with shock |
| WO2021170876A1 (en) | 2020-02-27 | 2021-09-02 | Adrenomed Ag | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for use in therapy or prevention of shock |
| WO2021185786A1 (en) | 2020-03-16 | 2021-09-23 | 4TEEN4 Pharmaceuticals GmbH | Dpp3 in patients infected with coronavirus |
| WO2021185784A1 (en) | 2020-03-16 | 2021-09-23 | Sphingotec Gmbh | Pro-adrenomedullin or fragment thereof in patients infected with corona virus and treatments with binder against adrenomedullin |
| WO2021185785A1 (en) | 2020-03-16 | 2021-09-23 | Sphingotec Gmbh | Pro-adrenomedullin or fragment thereof in patients infected with corona virus and treatments with binder against adrenomedullin |
| EP3922993A1 (en) | 2020-06-12 | 2021-12-15 | 4TEEN4 Pharmaceuticals GmbH | Dpp3 in patients infected with coronavirus |
| WO2022025220A1 (en) | 2020-07-31 | 2022-02-03 | 中外製薬株式会社 | Pharmaceutical composition including cell expressing chimeric receptor |
| WO2022029306A1 (en) | 2020-08-07 | 2022-02-10 | F. Hoffmann-La Roche Ag | Method for producing protein compositions |
| WO2022034228A1 (en) | 2020-08-14 | 2022-02-17 | Ac Immune Sa | Humanized anti-tdp-43 binding molecules and uses thereof |
| WO2022043517A2 (en) | 2020-08-27 | 2022-03-03 | Cureab Gmbh | Anti-golph2 antibodies for macrophage and dendritic cell differentiation |
| WO2022079297A1 (en) | 2020-10-16 | 2022-04-21 | Ac Immune Sa | Antibodies binding to alpha-synuclein for therapy and diagnosis |
| WO2022117893A2 (en) | 2020-12-02 | 2022-06-09 | S-Form Pharma | Combination therapy for patients having acute and/or persistent dyspnea |
| EP4023218A1 (en) | 2020-12-02 | 2022-07-06 | S-Form Pharma | Combination therapy for patients having acute and/or persistent dyspnea |
| WO2022244838A1 (en) | 2021-05-19 | 2022-11-24 | 中外製薬株式会社 | Method for predicting in vivo pharmacokinetics of molecule |
| WO2022263648A1 (en) | 2021-06-18 | 2022-12-22 | Sphingotec Gmbh | A method for predicting sepsis and septic shock |
| WO2023275099A1 (en) | 2021-06-29 | 2023-01-05 | Berysol Gmbh | Composite biomarker for the identification of selenium deficiency in a bodily fluid |
| WO2023088959A1 (en) | 2021-11-16 | 2023-05-25 | Ac Immune Sa | Novel molecules for therapy and diagnosis |
| WO2023156549A1 (en) | 2022-02-16 | 2023-08-24 | Ac Immune Sa | Humanized anti-tdp-43 binding molecules and uses thereof |
| WO2023175035A1 (en) | 2022-03-15 | 2023-09-21 | Adrenomed Ag | Stable aqueous formulation of an anti-adrenomedullin (adm) antibody or anti-adm antibody fragment |
| WO2023194565A1 (en) | 2022-04-08 | 2023-10-12 | Ac Immune Sa | Anti-tdp-43 binding molecules |
| WO2024023369A1 (en) | 2022-07-29 | 2024-02-01 | Adrenomed Ag | Anti-adrenomedullin (adm) antibody or anti-adm antibody fragment or anti-adm non-ig scaffold for use in therapy or prevention of shock |
| WO2024023368A1 (en) | 2022-07-29 | 2024-02-01 | 4TEEN4 Pharmaceuticals GmbH | Prediction of an increase of dpp3 in a patient with septic shock |
| WO2024126793A1 (en) | 2022-12-15 | 2024-06-20 | 4TEEN4 Pharmaceuticals GmbH | Dpp3 inhibitor for improvement of pulmonary function in critically ill patients |
| WO2024184494A1 (en) | 2023-03-08 | 2024-09-12 | Ac Immune Sa | Anti-tdp-43 binding molecules and uses thereof |
| WO2024194276A1 (en) | 2023-03-17 | 2024-09-26 | Pam Theragnostics Gmbh | Methods for determining peptidylglycine alpha-amidating monooxygenase (pam) and its use for diagnostic purpose |
| WO2024200862A1 (en) | 2023-03-29 | 2024-10-03 | 4TEEN4 Pharmaceuticals GmbH | Dpp3 inhibitor for myocardial protection and prevention of myocardial injury in critically ill patients with blood pressure decline |
| WO2025033296A1 (en) | 2023-08-10 | 2025-02-13 | 中外製薬株式会社 | Information processing system, information processing method, program, and method for manufacturing molecular compound |
| WO2025068313A1 (en) | 2023-09-25 | 2025-04-03 | Sphingotec Gmbh | A method for early diagnosis, early prediction, monitoring or prediction of severity of reduced graft function in a kidney transplantation patient |
| WO2025229075A1 (en) | 2024-05-03 | 2025-11-06 | Sphingotec Gmbh | A method for the specific determination of proenkephalin fragment 119-159 |
| WO2025248139A1 (en) | 2024-05-31 | 2025-12-04 | 4TEEN4 Pharmaceuticals GmbH | Use of adrenomedullin or fragments thereof in the treatment of a patient in need thereof |
| EP4675277A1 (en) | 2024-07-05 | 2026-01-07 | Predemtec AG | A method for diagnosing alzheimer´s disease or determining the risk of suffering from alzheimer´s disease |
| WO2026013218A1 (en) | 2024-07-10 | 2026-01-15 | Ac Immune Sa | Anti-tdp-43 vectors, binding molecules and uses thereof |
| WO2026046978A1 (en) | 2024-08-26 | 2026-03-05 | Pam Theragnostics Gmbh | Anti-adm antibodies, anti-adm antibody fragment or anti-adm non-ig scaffold for therapy or prevention of immune effector cell therapy side effects |
| WO2026046968A1 (en) | 2024-08-26 | 2026-03-05 | 4TEEN4 Pharmaceuticals GmbH | Dpp3 binders for the treatment of endothelial dysfunction |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2004284090A1 (en) | 2005-05-06 |
| US20050164301A1 (en) | 2005-07-28 |
| AU2004284090A8 (en) | 2008-04-17 |
| CA2543360A1 (en) | 2005-05-06 |
| WO2005040229A3 (en) | 2009-12-30 |
| EP1675878A2 (en) | 2006-07-05 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20050164301A1 (en) | LDL receptor class A and EGF domain monomers and multimers | |
| EP2198890B1 (en) | Combinatorial libraries of monomer domains | |
| US20050089932A1 (en) | Novel proteins with targeted binding | |
| AU2002256371B2 (en) | Combinatorial libraries of monomer domains | |
| US20050053973A1 (en) | Novel proteins with targeted binding | |
| US20050048512A1 (en) | Combinatorial libraries of monomer domains | |
| US20040175756A1 (en) | Methods for using combinatorial libraries of monomer domains | |
| US20060223114A1 (en) | Protein scaffolds and uses thereof | |
| US20060234299A1 (en) | Protein scaffolds and uses thereof | |
| US20060008844A1 (en) | c-Met kinase binding proteins | |
| AU2002256371A1 (en) | Combinatorial libraries of monomer domains | |
| AU2006268111A1 (en) | Il-6 binding proteins | |
| CA2587463A1 (en) | Protein scaffolds and uses therof | |
| HK1144912B (en) | Combinatorial libraries of monomer domains |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 2004796312 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2543360 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2004284090 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 2004284090 Country of ref document: AU Date of ref document: 20041022 Kind code of ref document: A |
|
| WWP | Wipo information: published in national office |
Ref document number: 2004284090 Country of ref document: AU |
|
| WWP | Wipo information: published in national office |
Ref document number: 2004796312 Country of ref document: EP |



