WO2005019269A2 - Techniques and compositions for the diagnosis and treatment of cancer (muc1) - Google Patents
Techniques and compositions for the diagnosis and treatment of cancer (muc1) Download PDFInfo
- Publication number
- WO2005019269A2 WO2005019269A2 PCT/US2004/027954 US2004027954W WO2005019269A2 WO 2005019269 A2 WO2005019269 A2 WO 2005019269A2 US 2004027954 W US2004027954 W US 2004027954W WO 2005019269 A2 WO2005019269 A2 WO 2005019269A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- recited
- antibody
- peptide
- antigen
- binding fragment
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/71—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/08—Drugs for disorders of the urinary system of the prostate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B82—NANOTECHNOLOGY
- B82Y—SPECIFIC USES OR APPLICATIONS OF NANOSTRUCTURES; MEASUREMENT OR ANALYSIS OF NANOSTRUCTURES; MANUFACTURE OR TREATMENT OF NANOSTRUCTURES
- B82Y30/00—Nanotechnology for materials or surface science, e.g. nanocomposites
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4727—Mucins, e.g. human intestinal mucin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
- C07K2319/21—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
Definitions
- the invention relates to drug screening assays, products for cancer diagnosis and for the evaluation of cancer treatment and using the portion of the receptor that remains on the cell as a molecular target for cancer therapeutics, to binding peptides, such as antibodies or antigen-binding fragments thereof to such receptor cleavage products, polypeptides comprising the receptor cleavage products, and nucleic acid molecules for encoding the same.
- binding peptides such as antibodies or antigen-binding fragments thereof to such receptor cleavage products, polypeptides comprising the receptor cleavage products, and nucleic acid molecules for encoding the same.
- apoptosis The molecular basis of cell growth and programmed cell death, termed apoptosis, is of great interest to pharmaceutical companies and cancer researchers, in general. It appears that in cancers one or both of these processes has gone awry. Drug discovery for cancers is increasingly focused on the development of therapeutics that interfere with critical steps in the processes of cell growth and programmed cell death. Of particular interest are agents that interfere with growth factor receptors. Typically, growth factor receptors have extracellular domains that interact in a highly specific way with cognate ligands to transmit a proliferation signal to the inside of the cell. Interactions and signaling pathways inside the cell tend to be conserved and are not cell-specific. Specificity is usually achieved via extracellular interactions.
- Agents that interfere with intracellular processes may be undesirable as therapeutics because they may have widespread effects in healthy as well as diseased cells.
- therapeutics that target extracellular portions of growth factor receptors, especially if those portions are in some way altered in cancer cells are highly desirable as they would specifically target cancer cells.
- cell surface receptors that have been linked to cancer, make up an important class of therapeutic targets. Many pharmaceutical companies are actively involved in screening drug libraries for compounds that bind to and block these cell surface receptors.
- Herceptin Phase II study of receptor-enhanced chemosensitivity using recombinant humanized anti-pl 85 Her2/neu monoclonal antibody plus cisplatin, in patients with Her2/neu-overexpressing metastatic breast cancer refractory to chemotherapy treatment, J Clin Oncol, 1998, 16(8): 2659-2671).
- HER2/neu binds to and blocks HER2/neu (Ross J, Fletcher J: review, The Her2/neu oncogene in breast cancer: prognostic factor, predictive factor, and target for therapy. Stem Cells, 1998, 16(6): 413-428) which is a cell surface receptor that is over-expressed on 30% of breast tumors. Another cell surface receptor is called MUCl (Treon S, Mollick J, Urashima M, Teoh G, Chauhan D, Ogata A, Raje N, Hilgers J, Nadler L, Belch A, Pilarski L and Anderson K: MUCl core protein is expressed on multiple myeloma cells and is induced by dexamethasone. Blood, 1999, 93(4): 1287-1298).
- the MUCl receptor is a Type I transmembrane glycoprotein from the mucin family that has been implicated in many human cancers. It is estimated that approximately 75% of all solid tumors aberrantly express the MUCl receptor.
- the group of MUC1 + cancers includes more than 90% of breast carcinomas, 47% of prostate tumors and a high percentage of ovarian, colorectal, lung, and pancreatic cancers.
- MUCl is normally expressed on glandular secretory epithelial cells as well as on epithelium that line the airways. There is some evidence that among the normal functions of the MUCl receptor are roles in cell adhesion, fertility and immune response. The role of the MUCl receptor in cancers has not yet been established in the literature.
- MUCl expression on a healthy cell and expression in a cancer cell is that on a healthy cell, the receptor is clustered at the apical border, while on cancer cells the receptor is uniformly distributed over the entire surface of the cell. Additionally, there is some evidence that the receptor is overexpressed on tumor cells in addition to the aberrant patterning.
- the normal function of MUCl as well as its link to cancer has not yet been definitively determined. What is known is that a portion of the extracellular domain of MUCl is shed or cleaved and can be detected in the serum of breast cancer patients. In breast cancer patients, levels of shed MUCl in the serum are sometimes measured to monitor the patient's response to treatment.
- the cytoplasmic tail of MUCl is rich in motifs for a variety of signal transduction proteins. It has been reported in the literature that Grb2 and SOS, which are common signaling proteins, associate with MUCl's cytoplasmic tail. It is noted in the scientific literature that in cancer cells, the extracellular domain is underglycosylated. Although the MUCl receptor was cloned in 1990, its link to cancer has remained elusive.
- the present invention describes discoveries that elucidate critical aspects of the mechanism by which MUCl triggers cell proliferation and tumorigenesis. These discoveries provide novel molecular targets for drug screening assays which the inventors have used to identify compounds and binding peptides that inhibit the MUCl -dependent tumorigenesis. These discoveries also enable an early diagnostic assay and an accurate method for tracking the progress of cancer patients undergoing treatment.
- the inventors present evidence herein supporting a mechanism whereby that a portion of the MUCl receptor (proximal, i.e. external, to the cell surface), functions as a growth factor receptor.
- the addition of compounds that bind to the PSMGFR portion of the MUCl receptor is shown herein to inhibit cell growth, presumably by preventing the dimerization of the MGFR portion of the receptor.
- the inventors also demonstrate herein that monovalent antibodies raised against the MGFR portion of the MUCl receptor also inhibit cell growth by binding to and blocking the association of the MGFR portion of the receptor with cognate ligands.
- the present invention in certain aspects, describes that a shorter form of the MUCl receptor, either a proteolyzed fragment that is comprised essentially of the natural sequence of the PSMGFRTC (i.e. nat-PSMGFRTC - SEQ ID NO: 37 in Table 1 below) or an alternative splice isoform such as the MUC1-Y (SEQ ID NO: 40 - Table 1), functions as a growth factor receptor.
- a shorter form of the MUCl receptor either a proteolyzed fragment that is comprised essentially of the natural sequence of the PSMGFRTC (i.e. nat-PSMGFRTC - SEQ ID NO: 37 in Table 1 below) or an alternative splice isoform such as the MUC1-Y (SEQ ID NO: 40 - Table 1), functions as a growth factor receptor.
- the present invention also describes a monovalent fragment of an antibody and monovalent, single-chain antibodies that target a portion of the MUCl receptor proximal to the cell surface (e.g. MGFR) that inhibits receptor dimerization and thus can be used as a cancer therapeutic for MUCl cancers.
- a cell line that mimics MUC1 + cancer cells for use as a research tool for drug discovery is described.
- the present invention also provides experimental evidence that the dominant MUCl species in breast tumors is a cleavage product that is comprised essentially of nat- PSMGFRTC (SEQ ID NO: 37). Also provided are methods for utilizing labeled anti- PSMGFR abtibodies, or antigen binding fragments thereof, for cancer diagnostics and imaging purposes. In one such embodiment, such a labeled antibody that can be visualized by a surgeon during an operation to remove a MUC1 + cancer, is used to during an operation to selectively stain cancerous tissue so that the surgeon my be better able to ascertain when all such cancerous tissue has been excised from the patient.
- kits methods, compositions, peptide species, antibodies or fragments thereof specifically binding to the peptide species, nucleic acid molecules encoding such peptide species, and articles associated with cell proliferation, specifically cancer.
- the invention involves primarily techniques and components for the diagnosis and treatment of cancer.
- the invention provides a series of kits.
- One kit comprises an antibody or antigen-binding fragment thereof provided by the invention.
- One kit includes a first article having a surface, and a peptide sequence immobilized relative to or adapted to be immobilized relative to the surface.
- the peptide sequence includes a portion of a cell surface receptor that interacts with an activating ligand, such as a growth factor or a modifying enzyme, to promote cell proliferation.
- kits for affecting the ability of the peptide sequence to bind directly or indirectly to other identical peptide sequences in the presence of the activating ligand.
- the portion includes enough of the cell surface receptor to interact with the activating ligand.
- Another kit of the invention comprises a species able to become immobilized relative to a shed cell surface receptor interchain binding region, and a signaling entity immobilized relative to or adapted to be immobilized relative to the species.
- Another kit of the invention comprises a species able to bind to a portion of a cell surface receptor that remains attached to the cell surface after shedding of a cell surface receptor interchain binding region, and a signaling entity immobilized relative to or adapted to be immobilized relative to the species.
- kits of the invention comprises a species able to bind to a portion of a cell surface receptor that includes the interchain binding region, and a signaling entity immobilized relative to or adapted to be immobilized relative to the species.
- kits of the invention comprises an article (which can be a particle), and at least a fragment of the sequence that corresponds to that portion of a cell surface receptor that interacts with an activating ligand, such as a growth factor or modifying enzyme, to promote cell proliferation, the fragment being detached from any cell, fastened to or adapted to be fastened to the article.
- an activating ligand such as a growth factor or modifying enzyme
- One method comprises providing a peptide including a portion of a cell surface receptor that interacts with an activating ligand such as a growth factor to promote cell proliferation, the portion including enough of the cell surface receptor to interact with the activating ligand and the portion; and generating a antibody or antigen-binding fragment thereof that specifically binds to the peptide.
- An antibody or antigen binding fragment thereof produced by the above method is also disclosed.
- a method for treating a subject having a cancer characterized by the aberrant expression of MUCl comprising administering to the subject an antibody or antigen-binding fragment thereof in an amount effective to ameliorate the cancer is disclosed.
- a method of treating a subject having cancer or at risk for developing cancer comprising administering to the subject an antibody or antigen- binding fragment thereof that specifically binds to a peptide including a portion of a cell surface receptor that interacts with an activating ligand such as a growth factor to promote cell proliferation, the portion including enough of the cell surface receptor to interact with the activating ligand is disclosed.
- a method of determining the aggressiveness and/or metastatic potential of a cancer comprising contacting a sample obtained from a subject having or suspected of having the cancer with an antibody, antigen-binding fragment thereof, or similar recognition entity that specifically binds to a peptide expressed on a cell surface; and determining an amount of the antibody, antigen-binding fragment thereof or cognate ligand that specifically binds to the sample is disclosed.
- a method comprising transfecting or transforming a host cell with an expression vector encoding an amino acid sequence comprising a cell surface peptide including a portion of a cell surface receptor, the portion including enough of the cell surface receptor both to interact with an activating ligand, such as a growth factor or modifying enzyme, and to promote cell proliferation and being free of an interchain binding region of the cell surface receptor to the extent necessary to prevent spontaneous binding between portions; and facilitating expression of the peptide by the cell so that the cell presents the peptide on its surface.
- an activating ligand such as a growth factor or modifying enzyme
- a method comprising providing a peptide including a portion of a cell surface receptor, the portion including enough of the cell surface receptor both to interact with an activating ligand, such as a growth factor or modifying enzyme, and to promote cell proliferation and being free of an interchain binding region of the cell surface receptor to the extent necessary to prevent spontaneous binding between portions; and developing an expression vector comprising a nucleic acid molecule that encodes the peptide.
- an expression vector produced by the method described above is also disclosed.
- a method comprising providing a cell expressing on its surface a peptide including a portion of a cell surface receptor, the portion including enough of the cell surface receptor both to interact with an activating ligand such as a growth factor and to promote cell proliferation and being free of an interchain binding region of the cell surface receptor to the extent necessary to prevent spontaneous binding between portions; contacting the cell with a candidate drug for affecting the ability of the activating ligand to interact with the peptide, and to the activating ligand; and determining whether an intracellular protein that becomes phosphorylated upon interaction of the activating ligand with the peptide is phosphorylated.
- a method comprising providing a cell expressing on its surface a peptide comprising MGFR; contacting the cell with a candidate drug for affecting the ability of an activating ligand to interact with MGFR, and to the activating ligand; and determining whether an ERK-2 protein within the cell is phosphorylated.
- a method comprising simultaneously determining whether a drug candidate suspected of having the ability to interfere with the binding of an activating ligand to a cell surface receptor interferes with the binding of the activating ligand to the cell surface receptor and whether the drug candidate interacts with the cell surface receptor or the ligand.
- a method for determining the modification state of a biological molecule comprising providing a colloid particle, which is configured to become immobilized with respect to the biological molecule when the biological molecule is in a first modification state to a different extent than when the biological molecule is in a second modification state, in proximity with the biological molecule; and detecting immobilization of the colloid particle relative to the biological molecule.
- Another method of the invention involves treating a subject having cancer or being at risk for developing cancer, the method comprises administering to the subject an agent that reduces cleavage of a cell surface receptor.
- Another method of the invention for treating a subject having cancer or at risk for developing cancer comprises administering to the subject an agent that reduces cleavage of a cell surface receptor interchain binding region from the cell surface.
- Another method of the invention comprises determining an amount of cleavage of a cell surface receptor interchain binding region from a cell surface, and evaluating indication of cancer or potential for cancer based upon the determining step.
- Another method of the invention comprises determining a site of cleavage of a cell surface receptor in a sample from a subject, and evaluating an indication of cancer or potential for cancer based upon the determining step.
- Another method of the invention involves determining a cleavage site of a cell surface.
- the method comprises contacting a cell with an agent that binds specifically to one potential cell surface receptor cleavage site and another agent that binds specifically to another potential cell surface receptor cleavage site.
- the ratio of binding of the two agents to the cell surface is compared in the method.
- Another method of the invention comprises determining a first amount of cleavage of a cell surface receptor interchain binding region from a cell surface of a sample from a subject.
- a second amount of cleavage of cell surface receptor interchain binding region from a cell surface of a sample from the subject is also determined, and the first amount is compared to the second amount.
- Another composition comprises an antibody or antigen-binding fragment thereof provided according to the invention.
- compositions comprises an antibody or antigen-binding fragment thereof that specifically binds to MGFR.
- the invention also provides peptide species.
- One peptide species of the invention comprises at least a fragment of a sequence that corresponds to that portion of a cell surface receptor that interacts with an activating ligand such as a growth factor to promote cell proliferation, the portion being detached from any cell, and an affinity tag.
- an antibody or antigen-binding fragment thereof that specifically binds to MGFR is disclosed.
- an isolated protein or peptide comprising PSMGFR at its N-terminus, wherein the isolated protein or peptide does not comprise any of the amino acid sequences set forth in SEQ ID NOs: 1, 2, 3, 6, or 7 is disclosed.
- an isolated protein or peptide comprising the amino acid sequences set forth in SEQ ID NO: 7 at its N-terminus is disclosed.
- an isolated protein or peptide comprising the amino acid sequences set forth in SEQ ID NO: 64 at its N-terminus is disclosed.
- an isolated protein or peptide comprising the amino acid sequences set forth in SEQ ID NO: 2 is disclosed.
- an isolated protein or peptide comprising the amino acid sequences set forth in SEQ ID NO: 60 is disclosed.
- an isolated protein or peptide comprising the amino acid sequences set forth in SEQ ID NO: 7 is disclosed.
- an isolated protein or peptide comprising the amino acid sequences set forth in SEQ ID NO: 64 is disclosed.
- an antibody or antigen binding fragment thereof that specifically binds to the amino acid sequence set forth in SEQ ID NO: 8 is disclosed.
- an antibody or antigen binding fragment thereof that specifically binds to the amino acid sequence set forth in SEQ ID NO: 65 is disclosed.
- an antibody or antigen binding fragment thereof that specifically binds to the unique region of the amino acid sequence set forth in SEQ ID NO: 39 is disclosed.
- an antibody or antigen binding fragment thereof that specifically binds to a region spanning the N-terminus and amino acid no. 104 of the amino acid sequence set forth in SEQ ID NO: 39 is disclosed.
- a method comprising acts of applying an antibody or antigen-binding fragment thereof as disclosed herein to a sample; observing an interaction of the antigen-binding fragment thereof with the sample; and making a diagnosis of the presence or absence of cancer or the agressiveness of a cancer based at least in part on information observed in the observing act.
- an isolated protein or peptide comprising His-PSMGFR wherein the isolated protein or peptide does not comprise any of the amino acid sequences set forth in SEQ ID NOs: 1, 2, or 3 is disclosed.
- An isolated protein or peptide comprising the amino acid sequence set forth in SEQ ID NO: 7 is disclosed.
- the invention also provides a series of isolated nucleic molecules, expression vectors comprising the nucleic acid molecules, and cells transfected with the expression vectors or the nucleic acid molecules.
- an isolated nucleic acid molecule that encodes PSMGFRTC and functional variants and fragments thereof is disclosed.
- an isolated nucleic acid molecule that encodes the amino acid sequence set forth in SEQ ID NO: 37 and functional variants and fragments thereof is disclosed.
- an expression vector comprising either of the above- mentioned isolated nucleic acid molecules operably linked to a promoter is disclosed.
- a host cell transfected or transformed with an expression vector comprising either of the above-mentioned isolated nucleic acid molecules is disclosed.
- an isolated nucleic acid molecule that hybridizes to the nucleic acid sequence set forth in SEQ ED NO: 37 under high stringency conditions, and complements thereof is disclosed.
- an expression vector comprising the above-identified isolated nucleic acid molecule or complement thereof operably linked to a promoteris disclosed.
- a host cell transfected or transformed with an expression vector comprising the above-identified isolated nucleic acid molecule or complement thereof is disclosed.
- Fig. 1 is a schematic illustration of the MUCl receptor (top) and the various truncated
- MUCl receptor isoforms produced according to the invention are MUCl receptor isoforms produced according to the invention.
- Fig. 4 is a graph of percent cell proliferation that shows that an inventive antibody against an epitope of the MUCl receptor which is proximal to the cell surface, i.e. extracellular, and that dimerizes the receptor, enhances cell proliferation in a manner typical of a growth factor/receptor - antibody interaction;
- Fig. 5 is a graph of percent cell proliferation that shows that an inventive antibody against an epitope of the MUCl receptor which is proximal to the cell surface, and that dimerizes the receptor, dramatically enhances cell proliferation;
- Fig. 9 is a silver-stained gel showing ligands that were fished out of cell lysates using a particular PSMGFR peptide, in the presence of the protease inhibitor PMSF;
- Fig. 10 is a silver-stained gel showing ligands that were fished out of cell lysates using the
- Fig. 21 is a graph showing that bivalent anti-PSMGFR antibody stimulates cell growth in MUCH breast tumor cell line 1504;
- Fig. 22 is a graph showing that bivalent anti-PSMGFR antibody stimulates cell growth in
- Fig. 23 is another graph showing that bivalent anti-PSMGFR antibody stimulates cell growth in MUC1+ breast tumor cell line 1500;
- Fig. 24 is a graph showing that bivalent anti-PSMGFR antibody stimulates cell growth in
- Fig. 25 is a graph showing that bivalent anti-PSMGFR antibody stimulates cell growth in
- Fig. 27 is a graph showing that monovalent anti-PSMGFR inhibits cell growth in MUC1+ breast tumor cell line 1504;
- Fig. 28 is a graph showing that monovalent anti-PSMGFR inhibits cell growth in MUC1+ breast tumor cell line 1500;
- Fig. 29 is a histogram showing that monovalent anti-PSMGFR competes with bivalent anti- PSMGFR and blocks color change in a nanoparticle assay;
- Fig. 30 are western blots showing that breast tumor cells produce MUCl clevage products of apparent molecular weight 20-30 kDa;
- Fig. 31 is a western blot showing that bivalent anti-PSMGFR dimerizes MUCl in T47D cells and activates intracellular MAP kinase cell proliferation pathway;
- Fig. 32 is a western blot showing that bivalent anti-PSMGFR activates intracellular MAP kinase cell proliferation pathway in 1504 breast tumor cells;
- Fig. 33 is a western blot showing that bivalent anti-PSMGFR activates intracellular MAP kinase cell proliferation pathway in 1500 breast tumor cells;
- Fig. 34 is a western blot showing that drug compounds compete with bivalent anti- PSMGFR and block activation of intracellular MAP kinase cell proliferation pathway
- Fig. 35 is a western blot showing that monovalent anti-PSMGFR competes with bivalent anti-PSMGFR and block activation of intracellular MAP kinase cell proliferation pathway
- Fig. 36 is a western blot showing that breast tumor cells present full-length as well as cleaved MUCl;
- Fig. 37 is a western blot showing that MUCl cleavage products are N-glycosylated;
- Fig. 38 is a schematic illustration of the MUCl receptor variants transfected into HEK cells;
- Fig. 39 is a western blot showing a MUCl tumor-specific cleavage product runs as an approximately 20 kDa band;
- Fig. 40 is a histogram showing that monovalent anti-PSMGFR inhibits cell growth in nat- PSMGFRTC transfectants
- Fig. 41 is a western blot showing a bivalent anti-PSMGFR antibody induces ERK2 phosphorylation in HEK cells transfected with nat-PSMGFRTC isoform
- Fig. 42 is a western blot showing a in nat-PSMGFRTC transfectants, bivalent anti- PSMGFR antibody induces ERK2 phosphorylation and monovalent anti-PSMGFR antibody inhibits ERK2 phosphorylation;
- Fig. 43 is a western blot showing receptor clevage products for MUC1+ tumor cells and transfectants; and Fig. 44 is a western blot showing that breast tumor cells may produce two MUCl clevage products.
- MUCl Growth Factor Receptor is a functional definition meaning that portion of the MUCl receptor that interacts with an activating ligand, such as a growth factor or a modifying enzyme such as a cleavage enzyme, to promote cell proliferation.
- the MGFR region of MUCl is that extracellular portion that is closest to the cell surface and is defined by most or all of the PSMGFR, as defined below.
- the MGFR is inclusive of both unmodified peptides and peptides that have undergone enzyme modifications, such as, for example, phosphorylation, glycosylation, etc.
- IBR Interchain Binding Region
- the BBR may be approximately defined as a stretch of at least 12 to 18 amino acid sequence within the region of the full-length human MUCl receptor defined as comprising amino acids 507 to 549 of the extracellular sequence of the MUCl receptor (SEQ ID NO: 10), with amino acids 525 through 540 and 525 through 549 especially preferred (numbers refer to Andrew Spicer et al., J. Biol. Chem Vol 266 No. 23, 1991 pgs. 15099-15109; these amino acid numbers correspond to numbers 1067, 1109, 1085, 1100, 1085, 1109 of Genbank accession number P15941; PID G547937, SEQ ID NO: 10) or fragments, functional variants or conservative substitutions thereof, as defined in more detail below.
- cleaved IBR means the IBR (or a portion thereof) that has been released from the receptor molecule segment which remains attached to the cell surface. The release may be due to enzymatic or other cleavage of the IBR. As used herein, when the IBR is "at the surface of a cell", it means the IBR is attached to the portion of the cell surface receptor that has not been shed, or cleaved.
- the cleaved IBR of interest is a "disease-associated cleavage", i.e. that type of cleavage that can result in cancer.
- CR Constant Region
- CR Constant Region
- Repeats is given its normal meaning in the art.
- PSMGFR Primary Sequence of the MUCl Growth Factor Receptor
- PSMGFR is a peptide sequence that defines most or all of the MGFR in some cases, and functional variants and fragments of the peptide sequence, as defined below.
- the PSMGFR is defined as SEQ ID NO: 36 listed below in Table 1, and all functional variants and fragments thereof having any integer value of amino acid substitutions up to 20 (i.e.
- a "functional variant or fragment” in the above context refers to such variant or fragment having the ability to specifically bind to, or otherways specifically interact with, ligands that specifically bind to, or otherwise specifically interact with, the peptide of SEQ ID NO: 36, while not binding strongly to identical regions of other peptide molecules identical to themselves, such that the peptide molecules would have the ability to aggregate (i.e. self-aggregate) with other identical peptide molecules.
- PSMGFR that is a functional variant of the PSMGFR peptide of SEQ NO: 36 (referred to as nat-PSMGFR - for "native") is SEQ NO: 7 (referred to as var-PSMGFR, which differs from nat-PSMGFR by including an -SPY- sequence instead of the native -SRY- (see bold text in sequence listings)).
- Var-PSMGFR may have enhanced conformational stability, when compared to the native form, which may be important for certain applications such as for antibody production.
- the PSMGFR is inclusive of both unmodified peptides and peptides that have undergone enzyme modifications, such as, for example, phosphorylation, glycosylation, etc.
- a histidine-tagged PSMGFR (e.g. See Table 1 - SEQ ID NO: 2) is abbreviated herein as His-PSMGFR. His- tagged peptide sequences are typically tagged at their C-terminus.
- the invention provides an isolated protein or peptide comprising a PSMGFR, for example at the N-terminus of the protein or peptide, or consisting of a PSMGFR, wherein the isolated protein or peptide does not comprise any of the amino acid sequences set forth in SEQ IDs: 1, 2, 3, 6, or 7 listed below.
- the invention provides an isolated protein or peptide comprising His- PSMGFR, for example at the N-terminus of the protein or peptide, or consisting of His- PSMGFR, wherein the isolated protein or peptide does not comprise any of the amino acid sequences set forth in SEQ IDs: 1, 2, or 3 listed below.
- the term "Extended Sequence of the MUCl Growth Factor Receptor” (ESMGFR) is a peptide sequence, defined below (See Table 1 - SEQ ID NO: 3), that defines all of His- var-PSMGFR plus 9 amino acids of the proximal end of PSIBR.
- TESMGFR Tumor-Specific Extended Sequence of the MUCl Growth Factor Receptor
- PSIBR is a peptide sequence, defined below (See Table 1 - SEQ ID NO: 8), that defines most or all of the IBR.
- TPSIBR Trusted Interchain Binding Region
- PSMGFRTC is a truncated MUCl receptor isoform comprising PSMGFR and a at or within about up to 30 (i.e. within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30) amino acids of its N-terminus and comprising the transmembrane and cytoplasmic sequences of full-length MUCl receptor.
- the PSMGFRTC as well as the other truncated MUCl receptor isoforms discussed below, can include a MUCl N-terminal signaling sequence (Table 1- SEQ ID NO: 47, 58, or 59), typically between 20 and 30 amino acids in length, or a functional fragment or variant thereof.
- Such a sequence is typically encoded by the nucleic acid constructs encoding the truncated MUCl receptor isoform and is translated but is typically cleaved prior to or upon insertion of the receptor in the membrane of the cell.
- a PSMGFRTC i.e. including the optional signal sequence, would still be a peptide or protein "having a PSMGFR" sequence "at its N-terminus" by the above definition.
- An example is nat-PSMGFRTC (SEQ ID NO: 37, with or without the signal peptide of SEQ ID NO: 47, 58, or 59 at the extreme N-terminus) having nat-PSMGFR (SEQ NO: 36) at its N- terminus (i.e.
- separation means physical separation from a cell, i.e. a situation in which a portion of MUC 1 that was immobilized with respect to a cell is no longer immobilized with respect to that cell.
- the portion that is cleaved is "separated” if it is free to migrate away from the cell and thereafter may be detected in a bodily fluid, or immobilized at a location remote from the cell from which it was cleaved such as another cell, a lymph node, etc.
- binding refers to the interaction between a corresponding pair of molecules that exhibit mutual affinity or binding capacity, typically specific or non-specific binding or interaction, including biochemical, physiological, and/or pharmaceutical interactions.
- Biological binding defines a type of interaction that occurs between pairs of molecules including proteins, nucleic acids, glycoproteins, carbohydrates, hormones and the like. Specific examples include antibody/antigen, antibody/hapten, enzyme/substrate, enzyme/inhibitor, enzyme/cofactor, binding protein/substrate, carrier protein/substrate, lectin/carbohydrate, receptor/hormone, receptor/effector, complementary strands of nucleic acid, protein/nucleic acid repressor/inducer, ligand/cell surface receptor, virus/ligand, etc.
- binding partner refers to a molecule that can undergo binding with a particular molecule.
- Biological binding partners are examples.
- Protein A is a binding partner of the biological molecule IgG, and vice versa.
- aggregate means a plurality of cell surface receptors or fragments thereof (e.g. MUC 1) immobilized with respect to each other with or without an intermediate auxiliary to the host system.
- Inductive multimerization This excludes aggregation that is the result of an intermediate naturally present in the host system such as a growth factor that can cause disease-associated aggregation (“Inductive multimerization”).
- “Aggregate” (verb) or “aggregation” means the process of forming an aggregate (noun).
- Inductive multimerization refers to aggregation wherein the aggregate formed can act to induce the cells to grow or proliferate.
- Inductive multimerization typically involves dimerization or tetramerization of cell surface receptors, for example by a growth factor or other activating ligand, but can also involve higher order multimerization, so long as the degree of multimerization is not so great as to mimic natural receptor clustering, in a particular cell type, which prevents receptors from signaling the cell to grow or proliferate.
- Preventative clustering refers to multimerization of receptors to form an aggregate involving a sufficient number of receptors to mimic natural receptor clustering, in a particular cell type, which prevents receptors from signaling the cell to grow or proliferate, for example with an intermediate auxiliary to the host system.
- a "ligand” to a cell surface receptor refers to any substance that can interact with the receptor to temporarily or permanently alter its structure and/or function. Examples include, but are not limited to binding partners of the receptor, (e.g. antibodies or antigen- binding fragments thereof), and agents able to alter the chemical structure of the receptor (e.g. modifying enzymes).
- An "activating ligand” refers to a ligand able interact with a receptor to transduce a signal to the cell.
- Activating ligands can include, but are not limited to, species that effect inductive multimerization of cell surface receptors such as a single molecular species with greater than one active site able to bind to a receptor; a dimer, a tetramer, a higher multimer, a bivalent antibody or bivalent antigen-binding fragment thereof, or a complex comprising a plurality of molecular species.
- Activating ligands can also include species that modify the receptor such that the receptor then transmits a signal.
- Enzymes can also be activating ligands when they modify a receptor to make it a new recognition site for other activating ligands, e.g.
- glycosylases are activating ligands when the addition of carbohydrates enhances the affinity of a ligand for the receptor.
- Cleavage enzymes are activating ligands when the cleavage product is the more active form of the receptor, e.g. by making a recognition site for a ligand more accessible.
- an activating ligand can be a species that cleaves MUCl, chemically modifies the receptor, or species that interact with the MGFRs on the surface of the MUCl tumor cells to transduce a signal to the cell that stimulates proliferation, e.g. a species that effects inductive multimerization.
- a “growth factor” refers to a species that may or may not fall into a class of previously-identified growth factors, but which acts as a growth factor in that it acts as an activating ligand.
- a “MUCl presenting cell” refers to both non-cancerous and cancerous cells expressing MUCl and/or MGFRs on the surface.
- a “MUCl tumor cell” or “MUCl cancer cell” or “cancerous MUCl cell” refers to a cancerous tumor cell that aberrantly expresses MUCl and/or MGFR on its surface.
- Colloids as used herein, means nanoparticles, i.e.
- colloid particles used in accordance with the invention are of less than 250 nm cross section in any dimension, more typically less than 100 nm cross section in any dimension, and in most cases are of about 2-30 nm cross section.
- colloids suitable for use in the invention is 10-30 nm in cross section, and another about 2-10 nm in cross section. As used herein this term includes the definition commonly used in the field of biochemistry.
- a component that is "immobilized relative to" another component either is fastened to the other component or is indirectly fastened to the other component, e.g., by being fastened to a third component to which the other component also is fastened, or otherwise is transitionally associated with the other component.
- a signaling entity is immobilized with respect to a binding species if the signaling entity is fastened to the binding species, is fastened to a colloid particle to which the binding species is fastened, is fastened to a dendrimer or polymer to which the binding species is fastened, etc.
- a colloid particle is immobilized relative to another colloid particle if a species fastened to the surface of the first colloid particle attaches to an entity, and a species on the surface of the second colloid particle attaches to the same entity, where the entity can be a single entity, a complex entity of multiple species, a cell, another particle, etc.
- “Signaling entity” means an entity that is capable of indicating its existence in a particular sample or at a particular location.
- Signaling entities of the invention can be those that are identifiable by the unaided human eye, those that may be invisible in isolation but may be detectable by the unaided human eye if in sufficient quantity (e.g., colloid particles), entities that absorb or emit electromagnetic radiation at a level or within a wavelength range such that they can be readily detected visibly (unaided or with a microscope including an electron microscope or the like), or spectroscopically, entities that can be detected electronically or electrochemically, such as redox-active molecules exhibiting a characteristic oxidation/reduction pattern upon exposure to appropriate activation energy (“electronic signaling entities”), or the like.
- electrochemically such as redox-active molecules exhibiting a characteristic oxidation/reduction pattern upon exposure to appropriate activation energy
- Examples include dyes, pigments, electroactive molecules such as redox-active molecules, fluorescent moieties (including, by definition, phosphorescent moieties), up-regulating phosphors, chemiluminescent entities, electrochemiluminescent entities, or enzyme-linked signaling moieties including horseradish peroxidase and alkaline phosphatase.
- "Precursors of signaling entities” are entities that by themselves may not have signaling capability but, upon chemical, electrochemical, electrical, magnetic, or physical interaction with another species, become signaling entities.
- An example includes a chromophore having the ability to emit radiation within a particular, detectable wavelength only upon chemical interaction with another molecule.
- signaling entities are distinguishable from, but are included within the definition of, "signaling entities” as used herein.
- “fastened to or adapted to be fastened” in the context of a species relative to another species or to a surface of an article, means that the species is chemically or biochemically linked via covalent attachment, attachment via specific biological binding (e.g., biotin/streptavidin), coordinative bonding such as chelate/metal binding, or the like.
- fastened in this context includes multiple chemical linkages, multiple chemical/biological linkages, etc., including, but not limited to, a binding species such as a peptide synthesized on a polystyrene bead, a binding species specifically biologically coupled to an antibody which is bound to a protein such as protein A, which is attached to a bead, a binding species that forms a part (via genetic engineering) of a molecule such as GST or Phage, which in turn is specifically biologically bound to a binding partner covalently fastened to a surface (e.g., glutathione in the case of GST), etc.
- a binding species such as a peptide synthesized on a polystyrene bead
- a binding species that forms a part (via genetic engineering) of a molecule such as GST or Phage, which in turn is specifically biologically bound to
- a moiety covalently linked to a thiol is adapted to be fastened to a gold surface since thiols bind gold covalently.
- a species carrying a metal binding tag is adapted to be fastened to a surface that carries a molecule covalently attached to the surface (such as thiol/gold binding) which molecule also presents a chelate coordinating a metal.
- a species also is adapted to be fastened to a surface if a surface carries a particular nucleotide sequence, and the species includes a complementary nucleotide sequence.
- Covalently fastened means fastened via nothing other than one or more covalent bonds. E.g.
- a species that is covalently coupled, via EDC/NHS chemistry, to a carboxylate- presenting alkyl thiol which is in turn fastened to a gold surface is covalently fastened to that surface.
- Specifically fastened or “adapted to be specifically fastened” means a species is chemically or biochemically linked to another specimen or to a surface as described above with respect to the definition of "fastened to or adapted to be fastened", but excluding all non-specific binding.
- Certain embodiments of the invention make use of self-assembled monolayers (SAMs) on surfaces, such as surfaces of colloid particles, and articles such as colloid particles having surfaces coated with SAMs.
- SAMs self-assembled monolayers
- SAMs formed completely of synthetic molecules completely cover a surface or a region of a surface, e.g. completely cover the surface of a colloid particle.
- Synthetic molecule in this context, means a molecule that is not naturally occurring, rather, one synthesized under the direction of human or human-created or human-directed control.
- “Completely cover” in this context means that there is no portion of the surface or region that directly contacts a protein, antibody, or other species that prevents complete, direct coverage with the SAM. I.e. in preferred embodiments the surface or region includes, across its entirety, a SAM consisting completely of non-naturally-occurring molecules (i.e. synthetic molecules).
- the SAM can be made up completely of SAM-forming species that form close-packed SAMs at surfaces, or these species in combination with molecular wires or other species able to promote electronic communication through the SAM (including defect-promoting species able to participate in a SAM), or other species able to participate in a SAM, and any combination of these.
- all of the species that participate in the SAM include a functionality that binds, optionally covalently, to the surface, such as a thiol which will bind to a gold surface covalently.
- a self-assembled monolayer on a surface in accordance with the invention, can be comprised of a mixture of species (e.g.
- thiol species when gold is the surface that can present (expose) essentially any chemical or biological functionality.
- they can include tri-ethylene glycol-terminated species (e.g. tri-ethylene glycol- terminated thiols) to resist non-specific adsorption, and other species (e.g. thiols) terminating in a binding partner of an affinity tag, e.g. terminating in a chelate that can coordinate a metal such as nitrilotriacetic acid which, when in complex with nickel atoms, captures a metal binding tagged-species such as a histidine-tagged binding species.
- tri-ethylene glycol-terminated species e.g. tri-ethylene glycol- terminated thiols
- other species e.g. thiols terminating in a binding partner of an affinity tag, e.g. terminating in a chelate that can coordinate a metal such as nitrilotriacetic acid which, when in complex with nickel
- the present invention provides a method for rigorously controlling the concentration of essentially any chemical or biological species presented on a colloid surface or any other surface. Without this rigorous control over peptide density on each colloid particle, co- immobilized peptides would readily aggregate with each other to form micro-hydrophobic- domains that would catalyze colloid-colloid aggregation in the absence of aggregate- forming species present in a sample. This is an advantage of the present invention, over existing colloid agglutination assays. In many embodiments of the invention the self- assembled monolayer is formed on gold colloid particles.
- the kits described herein contain one or more containers, which can contain compounds such as the species, signaling entities, biomolecules, and/or particles as described.
- kits also may contain instructions for mixing, diluting, and/or administrating the compounds.
- the kits also can include other containers with one or more solvents, surfactants, preservative and/or diluents (e.g. normal saline (0.9% NaCl, or 5% dextrose) as well as containers for mixing, diluting or administering the components to the sample or to the patient in need of such treatment.
- the compounds in the kit may be provided as liquid solutions or as dried powders. When the compound provided is a dry powder, the powder may be reconstituted by the addition of a suitable solvent, which also may be provided. Liquid forms of the compounds may be concentrated or ready to use. The solvent will depend on the compound and the mode of use or administration.
- Suitable solvents for are well known for drug compounds and are available in the literature.
- the term "cancer”, as used herein, may include but is not limited to: biliary tract cancer; bladder cancer; brain cancer including glioblastomas and medulloblastomas; breast cancer; cervical cancer; choriocarcinoma; colon cancer; endometrial cancer; esophageal cancer; gastric cancer; hematological neoplasms including acute lymphocytic and myelogenous leukemia; multiple myeloma; AIDS-associated leukemias and adult T-cell leukemia lymphoma; intraepithelial neoplasms including Bowen's disease and Paget's disease; liver cancer; lung cancer; lymphomas including Hodgkin' s disease and lymphocytic lymphomas; neuroblastomas; oral cancer including squamous cell carcinoma; ovarian cancer including those arising from epithelial cells, stromal cells, germ cells and mesenchy
- cancers are; breast, prostate, lung, ovarian, colorectal, and brain cancer.
- cancer treatment may include but is not limited to: chemotherapy, radiotherapy, adjuvant therapy, or any combination of the aforementioned methods. Aspects of treatment that may vary include, but are not limited to: dosages, timing of administration, or duration or therapy; and may or may not be combined with other treatments, which may also vary in dosage, timing, or duration.
- Another treatment for cancer is surgery, which can be utilized either alone or in combination with any of the aforementioned treatment methods.
- An "agent for prevention of cancer or tumorigenesis” means any agent that counteracts any process associated with cancer or tumorigenesis described herein.
- An "agent that reduces cleavage of a cell surface receptor interchain binding region" as used herein is any composition that prevents or reduces cleavage of the MUCl receptor between the MGFR and the N-terminus of the IBR that would otherwise occur in the absence of the agent. Cleavage of the receptor between the MGFR and the N-terminus of the IBR can be caused by activity of enzymes that are membrane-associated or soluble, e.g. matrix metalloproteases (MMPs and MT-MMPs).
- MMPs and MT-MMPs matrix metalloproteases
- Some of these enzymes are directly responsible for cleavage.
- Other enzymes can affect cleavage, (e.g. prevent cleavage at a particular location) by modifying MUCl with sugar groups or phosphates that mask a recognition epitope associated with cleavage.
- Other enzymes can promote cleavage at a particular location by modifying MUCl with sugar groups or phosphates that create a recognition motif for cleavage at that location.
- Other enzymes can promote cleavage of receptors by activating other cleavage enzymes.
- One way to select agents that reduce cleavage of a cell surface receptor IBR is to first identify enzymes that affect cleavage as described above, and screen agents, and their analogs, for their ability to alter the activity of those enzymes.
- agents are screened in a cell-free assay containing the enzyme and MUCl receptors, and the rate or position of cleavage measured by antibody probing, Polymerase Chain Reaction (PCR), or the like.
- PCR Polymerase Chain Reaction
- agents are screened against cells that present MUCl for the agents' ability to alter cleavage site or the rate of cleavage of MUCl.
- agents can be screened in an assay containing whole cells that present MUCl and aggregation potential of the cell supernatant can be measured, an indication of the amount of IBR that remains attached to the cleaved portion of MUCl, i.e. the degree of cleavage between MGFR and IBR.
- agents can be screened in an assay containing whole cells that present MUCl, the supernatant removed, and the cell remain tested for accessibility of the MGFR portion, e.g. using a labeled antibody to the MGFR.
- Agents can be identified from commercially available sources such as molecular libraries, or rationally designed based on known agents having the same functional capacity and tested for activity using the screening assays.
- An "agent that reduces cleavage of the MUCl receptor” is any composition that prevents or reduces cleavage of the MUCl receptor at any location. Such an agent can be used to treat a subject having cancer or at risk for developing cancer because if cleavage is prevented, then the accessibility of the MGFR, a functional receptor associated with cancer, is reduced or prevented. Such agents can be selected by exposing cells to a candidate agent and determine, in the supernatant, the amount of cleaved MUCl receptor, relative to a control.
- a subject refers to any mammal (preferably, a human), and preferably a mammal that may be susceptible to tumorigenesis or cancer associated with the abherrant expression of MUCl.
- samples include a human, non-human primate, cow, horse, pig, sheep, goat, dog, or cat.
- the invention is directed toward use with humans.
- the samples used herein are any body tissue or body fluid sample obtained from a subject. Preferred are body fluids, for example lymph, saliva, blood, urine, milk and breast secretions, and the like. Blood is most preferred. Samples of tissue and/or cells for use in the various methods described herein can be obtained through standard methods including, but not limited to: tissue biopsy, including punch biopsy and cell scraping, needle biopsy, and collection of blood or other bodily fluids by aspiration or other methods.
- tissue biopsy including punch biopsy and cell scraping, needle biopsy, and collection of blood or other bodily fluids by aspiration or other methods.
- the following patent applications and publications are inco ⁇ orated herein by reference and disclose or may disclose compositions, articles, and methods useful for practicing the present invention: U.S.
- One such set of cancers are those characterized by the aberrant expression of MUCl .
- Much of the description of the invention herein involves cells that aberrantly express MUCl. It is to be understood that in these instances the description is to be considered exemplary, and that the principles of the invention apply to other cell surface receptors that function by a similar mechanism. With the disclosure herein, those of ordinary skill in the art will readily be able to identify other cell surface receptors that function by this or a similar mechanism, and to apply the invention to those cancers characterized by aberrant expression of receptors.
- the invention is based on a novel mechanism involving cell surface receptors that have regions that self-aggregate, exemplified by MUCl, which was elucidated by the inventors.
- MUCl comprises several regions termed herein as follows, recited in an order starting from the region closest to the cell surface and progressing away from the cell.
- regions termed herein as follows, recited in an order starting from the region closest to the cell surface and progressing away from the cell.
- certain region of MUC 1 was defined differently. It is to be understood that the present definition supercedes.
- PSMGFR was with reference to the termeary peptide sequence of SEQ ID NO: 7 (currently referred to as "var-PSMGFR").
- the expanded definition of PSMGFR given above is intended to apply in the present application.
- the basic structure of the MUCl receptor is illustrated in FIG.l.
- the receptor as illustrated comprises: 1) cytoplasmic tail; 2) transmembrane section; 3) MGFR; 4) IBR, 5) Unique Region, 6) repeats, and N-terminus region comprising a signal peptide.
- MUCl receptors are clustered at one portion of the cell surface.
- MUCl-positive tumor cells are characterized by a loss of this "healthy" clustering.
- the invention anticipates uses for detecting and treating aberrant expression of the MUCl receptor in conditions other than cancer.
- the MUCl receptor is a key element in immune response and fertility. In the case of fertility, it may be beneficial for portions of the extracellular domain to be cleaved to induce embryo implantation.
- Methods of the invention may be used for non-cancerous conditions to promote or inhibit receptor cleavage. Additionally, method of the invention may be used to diagnose conditions of infertility.
- the MUCl receptors are no longer clustered but instead are typically distributed over the entire cell surface or in some cancer types, the receptors form a series of clustered islands that are expressed over a considerable portion of the cell surface. This loss of clustering of the MUCl receptor has been correlated to tumor aggressiveness, metastaic potential and eventual outcome for the patient.
- the inventors have shown that a cleavage product of the MUCl receptor, that remains attached to the cell surface, referred to herein as the MGFR, functions as a growth factor receptor.
- the MGFR portion of the receptor can become accessible to activating ligands by a variety of methods. For example, cleavage of the receptor that releases some or all of the IBR makes the MGFR more accessible to activating ligands. Agents that reduced the cell surface expression of the entire MUCl receptor keeps the receptors too far apart to cluster and thus increases availability of the PSMGFR and ESMGFR to activating ligands that transduce the signal to the cell to proliferate. Agents that essentially completely inhibit the expression of the MUCl receptor are good therapeutic candidates are provided according to one aspect of the invention.
- inhibitory agents include but are not limited to anti-sense oligos and RNAis, or inhibitory RNAs.
- the MUCl receptor may be cleaved to release the IBR or the TPSD3R, from the cell surface. Alternatively, cleavage can result in a release of a sufficient portion of the IBR that causes the MUCl receptor to lose the ability to self-aggregate. Loss of aggregation of MUCl may have several ramifications. Release of the IBR or sufficient portion of the IBR from the cell surface allows the receptors to evenly distribute on the cell surface, leaving the cytoplasmic tails free to associate with intracellular signaling proteins.
- External agents such as modifying enzymes and/or activating ligands, are then able to bind to the remaining extracellular portion of the receptor and induce disease-associated signals, either via a change in the multimerization state, i.e., inductive multimerization, or as an induced conformational change.
- ligands such as growth factors and hormones often induce receptor dimerization which triggers, in turn, an intracellular signaling cascade.
- bivalent ligands such as a bivalent antibody
- MAP mitogen activated protein
- Cell proliferation may result from accessibility of the MGFR portion to an activating ligand which can interact with the MGFR portion.
- the self-aggregating IBR of the MUCl receptor may form a dense reticulum which sterically prevents a ligand such as a growth factor from interacting with the MGFR portion of the receptor, which is proximal to the cell relative to the IBR. In a cancerous or tumor cell, this reticulum may be lost, allowing ligand interaction with the MGFR.
- the above mechanistic model is consistent with a mechanism whereby the portion of the MUCl receptor, that remains attached to the cell surface after shedding of the IBR region or the TPSD3R, i.e.
- the MGFR functions as a receptor for ligands that trigger cell proliferation.
- Evidence is also presented herein that demonstrates that: (a) an interaction between a ligand and a portion of the MUCl receptor (MGFR), which dimerizes the receptor, triggers cell proliferation; and (b) blocking the interaction of this portion of the MUCl receptor (MGFR) with its ligand(s), blocks cell proliferation.
- an inventive IgG antibody raised against the MGFR portion of the MUCl receptor e.g. PSMGFR
- the rate of cell proliferation is greatly enhanced. Since intact IgG antibodies are bivalent, i.e.
- an effective therapeutic strategy is therefore to block the MGFR portion of the receptor with a monomeric composition, thus preventing inductive multimerization and subsequent signaling cascades.
- a single chain, or monovalent, antibody, or a monovalent fragment of an intact, bivalent antibody see discussion of antibodies and antigen-binding fragments thereof below, raised against the MGFR portion of the MUCl receptor (e.g. raised against PSMGFR or against any peptide comprising a PSMGFR sequence at its N-terminus) would function as an effective anti-cancer therapeutic. Data and examples supporting this contention are presented below.
- Another therapeutic strategy is to block the activity of enzymes that modify the receptor, which may be required for some ligand binding
- the inventors present evidence that dimerization of the MUCl receptor triggered cell growth in T47D breast tumor cells. Dimerization was achieved in by raising an IgG antibody to MGFR, recall that IgG antibodies are bivalent and therefore can dimerize, a portion of the MUCl receptor that is proximal to the cell surface. The portion of the MUCl receptor that was used was the MGFR, and the sequence of the peptide used for generating the antibody was SEQ ID NO: 7 (Table 1 - var-PSMGFR).
- MUC1 + breast tumor cells T47D, 1500, 1504, and BT-474 were obtained from the ATCC, as described below in Example 5.
- MUCl " breast tumor cells MD-MB 453, HEK (human embilical kidney) cell line K293, and HeLa were also obtained from the ATCC, as described below in Example 5.
- the resultant antibody was purified by affinity chromatography over a column derivatized with the same peptide used to immunize the rabbits.
- the antibody was used as the cognate probe in western blots, see Example 5, wherein samples of the immunizing peptide and protein preparations from the MUCl positive as well as MUCl negative cell lines were run on a 15% polyacrylimide gel.
- the bivalent (able to dimerize) antibody was added to the panel of breast tumor cell lines that express the MUCl receptor along with control cell lines that did not. The addition of the antibody stimulated cell proliferation only in cells that expressed the MUCl receptor.
- Fig. 21 The 1504 breast tumor cells that were treated for either 5 or 6 days with the bivalent anti-PSMGFR antibody underwent 400% - 600% enhancement of cell growth, see Fig. 21 and Example 11. Still referring to Fig. 21, control cells K293 and Hela were unaffected by the same dosage of the same antibody, anti-PSMGFR.
- the shape of the proliferation enhancement curves argue that the antibodies dimerize the receptor; at very high antibody concentrations the rate of cell growth decreases, as each receptor is bound to a single antibody rather than one bivalent antibody bound to two receptors.
- Fig. 22 shows that cells from the breast tumor cell line 1500 underwent a 200% enhancement of cell proliferation after treatment with the bivalent anti-PSMGFR for 3 days.
- Fig. 23 Breast tumor cells from the T47D cell line were also tested for the ability of the bivalent anti-PSMGFR antibody to trigger cell proliferation. Fig. 24 shows that these cells also underwent an approximately 125%) enhancement of cell growth, and as with 1500 and 1504 cell lines, the response was dependent on the concentration of the antibody.
- Breast tumor cell line BT-474 displayed similar stimulation of cell growth (150 - 200%) in response to bivalent anti-PSMGFR, see Fig. 25.
- MUCl " cell line MDA-MB-453 was not affected by the addition of anti-PSMGFR at any concentration (data not shown).
- Monovalent forms of anti-PSMGFR fragments block cell growth in MUCl positive tumor cells.
- MUC1 + tumor cells are induced to proliferate when the MUCl receptor is dimerized.
- the signal to proliferate is generated when a portion of the MUCl receptor proximal to the cell surface is dimerized.
- one way in which the receptors can be dimerized is via a bivalent antibody directed against the MUCl receptor.
- the antibody is directed against the MGFR and in yet a more preferred embodiment it is directed against at least a portion of the PSMGFR.
- agents that bind to the MGFR portion of the MUCl receptor in a monomeric rather than dimeric fashion can block the dimerization of the receptor and in so doing inhibit cell proliferation.
- the discussion below describes several chemical compounds that inhibit the growth of MUCl + tumor cells by binding to the MGFR portion of the MUCl receptor.
- yet another method of providing an agent that prevents dimerization of the MUCl receptor is generating a monovalent antibody or a monovalent antigen binding fragment of an antibody directed against the MUCl receptor.
- Monovalent antibodies/fragments raised against the MUCl receptor would be excellent therapeutic agents for MUCl positive cancers.
- Monovalent antibodies/fragments that target portions of the receptor proximal to the cell surface are preferred.
- monovalent antibodies/fragments that bind to portions of the MUCl receptor that are C- terminal to the beginning of the repeats section. Still more preferred are monovalent antibodies/fragments that target portions of the receptor C-terminal to the unique region of the MUCl receptor and yet more preferred are monovalent antibodies/fragments that are directed against the PSMGFR sequence.
- Peptides used for antibody production may or may not be glycosylated prior immunizing animals. The sequence of these peptides need not exactly reflect the sequence of MUCl receptor as it exists in the general population.
- the inventors observed that antibodies raised against the the PSMGFR peptide variant var-PSMGFR (SEQ ID NO: 7), having an "-SPY-" motif have a higher affinity and greater specificity for the MUCl protein than antibodies raised against the actual native sequence (i.e. nat- PSMGFR, SEQ ID NO: 36), having an "-SRY-" motif.
- One may also, in certain embodiments, introduce mutations into the PSMGFR peptide sequence to produce a more rigid peptide that may enhance antibody production. For example the R to P mutation in the var-PFMGFR sequence of SEQ ID NO: 7 may actually have provided a more rigid peptide and was thus more immunogenic.
- Another method for producing antibodies against regions of peptides that are not particularly immunogenic, such as the IBR or TPSIBR is to tag the specific peptide sequence with an irrelevant sequence in which the amino acids are of the D- form and thus act to stimulate the immune response of the host animal.
- Peptide sequences that are used to immunize animals for antibody production may also be glycosylated.
- the MUCl peptide sequences that were used herein for drug screening and to generate cognate antibodies were derived from the human species of MUCl . Since there is considerable conservation across species for the PSMGFR and IBR and some portions of the UR, it is anticipated that MUCl peptides whose sequences are derived from other species can also be used in drug screens and to generate antibodies for these same purposes.
- the invention also involves, in certain embodiments the generation of bi-specific antibodies and bi- specific antibodies formed thereby.
- Those skilled in the art are familiar with methods to generate antibodies wherein each recognition fragment of a bivalent antibody binds to different but essentially adjacent sites on the same antigen.
- MUCl monovalent antibodies/fragments described above for use as cancer therapeutics may be polyclonal or monoclonal and may be obtained by immunizing a number of different animal species, i.e. rabbit, goat and the like. Additionally, techniques are known to those skilled in the art for generating hybridoma cells, which then are grown and harvested to yield a supply of antibody without the need for repeated animal immunization.
- humanized monovalent antibodies/fragments that target these portions of the MUCl receptor may be used as effective anti-cancer agents that are less likely to invoke immune responses in the patient.
- Methods of the invention also encompass recombinant methods for antibody and Fab production that do not include animal immunization. As explained below, methods of generating monovalent antibodies and monovalent antigen-binding fragments of antibodies are known to those skilled in the art. A standard method is the controlled proteolysis of a bivalent antibody. The inventors generated a monvalent PSMGFR-specific antibody fragment by proteolyzing their inventive bivalent anti-PSMGFR.
- Monovalent anti-PSMGFR competes with the bivalent anti-PSMGFR antibody for the same binding site within the MGFR portion of the MUCl receptor.
- the present invention details how monovalent antibodies/fragments, which are directed against a portion of the MUCl receptor that is proximal to the cell surface, inhibit the growth of MUCl + tumor cells.
- Monovalent antibodies/fragments that targeted the PSMGFR portion of the MUCl receptor were produced by proteolyzing the bivalent anti-PSMGFR antibody, which has been herein to induce cell growth, presumably by dimerizing the MUCl receptors.
- Monovalent anti-PSMGFR validates the in vitro drug screen; it inhibits the color change of the PSMGFR-immobilized nanoparticles caused by the addition of tumor cell lysates to the nanoparticles, as described in more detail below. It should be noted that the monvalent antibody/fragment also can inhibit the dimerization of the PSMGFR peptide in vitro. Nanoparticle-based drug screening assays to identify compounds that inhibit dimerization of the MGFR portion of the MUCl receptor are described herein and in commonly-owned U.S. patent application publication no. 2003/0036199; and International Publication No.
- histidine-tagged PSMGFR peptides (e.g. SEQ ID NO: 2), were immobilized on NTA-Ni++-SAM-coated gold nanoparticles. Lysates and supernatants from MUCl positive tumor cells, which presumably contain the cognate ligands of the MUCl receptor, were added to the nanoparticles. Upon addition of the lysate/supernatant mixture, the color of the nanoparticle solution turns from its characteristic pink to blue, presumably when the cognate ligands dimerize MUCl receptor peptides on two different nanoparticles.
- SEQ ID NO: 2 histidine-tagged PSMGFR peptides
- bivalent anti-PSMGFR antibody in place of the lysate/supernatant solution, also causes the nanoparticle solution to turn from pink to blue, as the bivalent antibody also dimerizes two PSMGFR peptides on different nanoparticles.
- monovalent anti- PSMGFR to the drug screening assay, to which the lysate/supernatant has also been added, inhibits the color change, presumably by competing with natural, cognate ligands for binding to the PSMGFR peptide.
- results described herein support the idea that a key mechanism of cell growth in MUCl positive cancers may depend more on the amount of MUCl cleavage that occurs rather than the overall amount of MUCl receptor that is expressed.
- Low molecular weight species that migrate on an acrylimide gel with an apparent molecular weight of around 20-30 kD (some glycosylated) exist in MUCl -positive tumor cells but do not exist in sufficient numbers to be detectable in non-tumor MUCl cells.
- the inventors identified two cleavage sites of the MUCl receptor in tumor cells.
- the first cleavage site occurs in the middle of the IBR and the second cleavage site, which our evidence indicates is the more tumorigenic form, occurs at the C-termial end of the IBR: the first cleavage site being located at the N-terminus of TPSH3R (SEQ ID NO: 8) and the second cleavage site being located at the N-terminus of the nat-PSMGFR having SEQ ID NO: 60.
- the portion of the receptor that remains attached to the cell surface is the similar to TSESMGFR (See Table 1, SEQ ID NO. 66, but with the native SRY sequence).
- the portion that remaining portion is a PSMGFR as shown in Table 1, SEQ ID NO. 63.
- This low molecular weight species that is tumor specific consists essentially of the native PSMGFR sequence and in some cases the TSESMGFR sequence and is available to cognate ligands, i.e. not self- aggregated, than on the overall amount of MUC 1 receptor expressed by the cell. Supporting this conclusion, susceptibility of tumor cells to proliferate was found, within the context of the present invention, to be a function of the amount of the shorter form of the MUCl receptor.
- the anti-PSMGFR- induced increase in the proliferation of cell lines 1500 and 1504 was up to about 400% (Fig. 23) and up to about 600% (Fig. 21) respectively, while there was no detectable increase in the rate of cell growth for control cells (Fig. 21) and the growth of BT-474 cells increased by only up to about 200%, see Fig. 25.
- HEK cells were transfected with MUCl variants that were either terminated after the PSMGFR (see Table 1, SEQ ID NO: 37) or after the entire interchain binding region (PSIBR) (SEQ ID NO:38).
- antibodies that are raised against the TPSIBR (SEQ ID NO: 65) portion of the MUCl receptor can be used to assess the aggressiveness of cancers that are MUCl -positive. Consistent with these findings, the amount of MGFR that is accessible on cells (tissues) predicts tumor aggressiveness and metastatic potential. Therefore, antibodies that recognize the MGFR portion of the receptor can be used to diagnose cancer or the propensity to develop cancer, to predict cancer aggressiveness and metastatic potential, to suggest therapeutic protocols and to track the progress of the therapeutic protocols. Consequently, the aggressiveness or metastatic potential of tumor cells can be assessed by determining the amount of lower molecular weight MUCl species that the cells produce.
- the inventive colloid assay techniques described herein could be utilized in which the antibodies/fragments are attached to a carrier that can be a nanoparticle or colloid.
- a patient's cells are probed with antibodies or antigen-binding fragments thereof directed toward the MGFR as this method reveals the amount of MGFR-containing MUCl that remains attached to the cell surface and, importantly, whether or not it is accessible to cognate ligands.
- a patient's cells are probed with antibodies or antigen-binding fragments thereof directed toward the PSMGFR.
- cells that display a high degree of MUCl receptor that reacts with antibodies or antigen-binding fragments thereof that recognize the PSMGFR, or a portion thereof is an indication that the MUCl receptors present on these cells have undergone of a greater degree of cleavage, leaving the PSMGFR portion accessible to cognate ligands that activate a cell growth pathway.
- Tumors comprised of cells thusly characterized are of higher metastatic potential and/or are more aggressive.
- the invention provides antibodies or antigen-binding fragments thereof.
- the invention provides an antibody or antigen-binding fragment that specifically binds to MGFR.
- such an antibody or antigen-binding fragment thereof is bivalent, while in other embodiments it is monovalent.
- the above-mentioned antibodies or antigen-binding fragments thereof specifically bind to PSMGFR.
- the antibodies or antigen-binding fragments thereof can specifically bind to the amino acid sequence set forth in SEQ. ID.
- the antibody or antigen-binding fragment of the invention is a human, humanized, xenogenic or a chimeric human-non-human antibody or antigen-binding fragment thereof.
- the antibodies or antigen-binding fragments thereof of the invention comprise an intact antibody or an intact single-chain antibody.
- they may comprise a single-chain Fv fragment, a Fab' fragment, a Fab fragment, or a Fd fragment.
- antibodies or antigen- binding fragments of the invention that are bivalent certain embodiments comprise an antigen-binding fragment that is a F(ab') 2 .
- compositions comprising the antibody or antigen-binding fragments of the invention as an ingredient.
- compositions comprise pharmaceutical compositions and further comprise a pharmaceutically-acceptable carrier.
- the antibody or antigen-binding fragment thereof can be polyclonal, while in other embodiments it can be monoclonal.
- kits in certain embodiments including any of the above-mentioned antibodies or antigen-binding fragments thereof of the invention.
- kit may also provide an article having a surface.
- the antibody or antigen-binding fragment thereof can be fastened or adapted to be fastened to the surface of the article.
- the article comprises a particle.
- the kit further includes a second particle and a peptide sequence comprising a portion of a cell surface receptor that remains attached to the cell surface after shedding of the cell surface receptor interchain binding region, the peptide sequence being detached from any cell, and fastened to or adapted to be fastened to the second particle.
- the kit may further include a candidate drug for affecting the ability of the peptide sequence to bind to other identical peptide sequences, and/or to the antibody or antigen-binding fragment thereof, in the presence of the antibody or antigen-binding fragment thereof.
- the peptide sequence provided can comprise, in certain embodiments, MGFR.
- the kit may further comprise a peptide sequence comprising a portion of a cell surface receptor that remains attached to the cell surface after shedding of the cell surface receptor interchain binding region, such peptide sequence being detached from any cell, and fastened to or adapted to be fastened to the particle.
- the above kit may, in certain embodiments, further comprise a second particle and have the peptide sequence mentioned above fastened to or adapted to be fastened to the second particle.
- the above-mentioned kits may be useful, in the context of the present invention, for performing various diagnostic, drug screening and other assays, which can involve colloid-colloid interactions and/or aggregation, as described in detail herein.
- the invention also involves, in certain embodiments, methods for producing or generating antibodies or antigen-binding fragments thereof that specifically bind to certain peptides, for example certain inventive peptides disclosed herein.
- an antibody or antigen-binding fragment is raised against a peptide including a portion of a cell surface receptor that interacts with an activating ligand such as a growth factor to promote cell proliferation, such portion including enough of the cell surface receptor to interact with the activating ligand and being free of an interchain binding region to the extent necessary to prevent spontaneous binding between such portions.
- the cell surface receptor comprises MUCl, in other embodiments MGFR, and in yet other embodiments a peptide comprising PSMGFR at it N-terminus; in yet other embodiments, the peptide comprises at its N-terminus the amino acid set forth in SEQ. ID. NO.: 36 or a functional variant or fragment thereof comprising up to 15 amino acid additions or deletions at its N-terminus and comprising up to 20 amino acid substitutions.
- an antibody or antigen-binding fragment is raised against PSMGFR.
- such peptides used to generate the antibody or antigen-binding fragment thereof can consists of the amino acid sequence set forth in SEQ. ID.
- the invention provides methods for treating a subject having a cancer or other condition requiring treatment with one or more of the antibodies or antigen-binding fragments thereof of the invention, i one such embodiment, the invention provides a method for treating a subject having a cancer characterized by the aberrant expression of MUCl. The method involves administering to the subject an antibody or antigen-binding fragment thereof in an amount effective to ameliorate the cancer. In certain such embodiments, the antibody or antigen-binding fragment thereof is administered in an amount effective to reduce tumor growth.
- any of the above- mentioned antibodies or antigen-binding fragments thereof can be used.
- the antibody or antigen-binding fragment thereof is administered in an amount effective to block the interaction of a natural ligand with a portion of a MUC 1 receptor, for example, MGFR, that remains attached to a cell after shedding of a interchain binding region of the MUCl receptor.
- the method involves administering an antibody or antigen-binding fragment thereof that is effective to reduce shedding of an interchain binding region of a MUCl receptor.
- such a treatment method can involve administering to the subject the antibody or antigen-binding fragment thereof in an amount effective to prevent inductive dimerization of a cancer-associated growth factor receptor, such as aberrantly cleaved MUCl.
- the above-described antibodies or antigen-binding fragments thereof can be utilized in a method for determining the aggressiveness and/or metastatic potential of a cancer.
- a sample obtained from a subject having or suspected of having a cancer is contacted with an antibody or antigen-binding fragment thereof of the invention that specifically binds to a peptide associated with the cancer that is expressed on the cell surface.
- the method involves determining an amount of the antibody or antigen-binding fragment that specifically binds to the sample, such amount being indicative of the aggressiveness and/or metastatic potential of the cancer.
- the sample utilized comprises cells of the subject and/or a solublized lysate thereof.
- the peptide expressed on the cell surface can include a portion of a cell surface receptor that interacts with an activating ligand such as a growth factor to promote cell proliferation, wherein the portion includes enough of the cell surface receptor to interact with the activating ligand while being free of any interchain binding region to the extent necessary to prevent spontaneous binding between portions.
- the cell surface receptor is MUCl and the peptide comprises MGFR or a peptide comprising PSMGFR at its N-terminus.
- the antibody or antigen-binding fragment thereof can be immobilized relative to or adapted to be mobilized relative to a signaling entity, such as any of the signaling entities described previously.
- the signaling entity can comprise one or more particles, such as colloid particles.
- the invention embraces peptide binding agents which, for example, can be antibodies or fragments of antibodies having the ability to selectively bind to PSMGFR and/or MGFR.
- Antibodies include polyclonal and monoclonal antibodies, prepared according to conventional methodology. Significantly, as is well-known in the art, only a small portion of an antibody molecule, the paratope, is involved in the binding of the antibody to its epitope (see, in general, Clark, W.R. (1986) The Experimental Foundations of Modern Immunology Wiley & Sons, Inc., New York; Roitt, I. (1991) Essential Immunology. 7th Ed., Blackwell
- the pFc' and Fc regions are effectors of the complement cascade but are not involved in antigen binding.
- an antibody from which the Fc region has been enzymatically cleaved, or which has been produced without the Fc region designated an antibody from which the Fc region has been enzymatically cleaved, or which has been produced without the Fc region, designated an Fab fragment, retains one of the antigen binding sites of an intact antibody molecule and comprises one type of monovalent antibody fragment according to the invention.
- Fab fragments consist of a covalently bound antibody light chain and a portion of the antibody heavy chain denoted Fd.
- the Fd fragments are the major determinant of antibody specificity (a single Fd fragment may be associated with up to ten different light chains without altering antibody specificity) and Fd fragments retain epitope-binding ability in isolation. Accordingly, a monovalent antibody fragment according to certain embodiments of the invention may be an Fd fragment.
- CDRs complementarity determining regions
- FRs framework regions
- CDR1 through CDR3 complementarity determining regions
- non-CDR regions of a mammalian antibody may be replaced with similar regions of conspecific or heterospecific antibodies while retaining the epitopic specificity of the original antibody.
- This is most clearly manifested in the development and use of "humanized" antibodies in which non-human CDRs are covalently joined to human FR and/or Fc/pFc' regions to produce a functional antibody. See, e.g., U.S. patents 4,816,567, 5,225,539, 5,585,089, 5,693,762 and 5,859,205.
- Such antibodies, or fragments thereof are within the scope of the present invention.
- Fully human monoclonal antibodies also can be prepared by immunizing mice transgenic for large portions of human immunoglobulin heavy and light chain loci. Following immunization of these mice (e.g., XenoMouse (Abgenix), HuMAb mice (Medarex/GenPharm)), monoclonal antibodies can be prepared according to standard hybridoma technology. These monoclonal antibodies will have human immunoglobulin amino acid sequences and therefore will not provoke human anti-mouse antibody (HAMA) responses when administered to humans.
- HAMA human anti-mouse antibody
- the present invention comprises methods for producing the inventive antibodies, or antigen-binding fragments thereof, that include any one of the step(s) of producing a chimeric antibody, humanized antibody, single-chain antibody, Fab- fragment, F(ab') 2 fragment, bi-specific antibody, fusion antibody, labeled antibody or an analog of any one of those.
- a chimeric antibody humanized antibody, single-chain antibody, Fab- fragment, F(ab') 2 fragment, bi-specific antibody, fusion antibody, labeled antibody or an analog of any one of those.
- Corresponding methods are known to the person skilled in the art and are described, e.g., in Harlow and Lane “Antibodies, A Laboratory Manual", CSH Press, Cold Spring Harbor, 1988.
- the production of chimeric antibodies is described, for example, in WO89/09622.
- xenogeneic antibodies A further source of antibodies to be utilized in accordance with the present invention are so-called xenogeneic antibodies.
- the general principle for the production of xenogeneic antibodies such as human antibodies in mice is described in, e.g., WO 91/10741, WO 94/02602, WO 96/34096 and WO 96/33735.
- the antibodies, of the invention may exist in a variety of forms (besides intact antibodies; including, for example, antigen binding fragments thereof, such as Fv, Fab and F(ab')2, as well as in single chains (i.e.
- the present invention also provides, in certain embodiments, for F(ab') 2 , Fab, Fv and Fd fragments; chimeric antibodies in which the Fc and/or FR and/or CDRl and/or CDR2 and/or light chain CDR3 regions have been replaced by homologous human or non-human sequences; chimeric F(ab') 2 fragment antibodies in which the FR and/or CDRl and/or CDR2 and/or light chain CDR3 regions have been replaced by homologous human or non-human sequences; chimeric Fab fragment antibodies in which the FR and/or CDRl and/or CDR2 and/or light chain CDR3 regions have been replaced by homologous human or non-human sequences; and chimeric Fd fragment antibodies in which the FR and/or CDRl and/or CDR2 regions have been replaced by homologous human or non-human sequences; and chimeric Fd fragment antibodies in which the FR and/or CDRl and/or CDR2 regions have been replaced by
- the present invention also includes so-called single chain antibodies. Moreover, the present invention, in certain embodiments, relates to compositions comprising the aforementioned antibodies or antigen-binding fragments of the invention or chemical derivatives thereof.
- the composition of the present invention may further comprise a pharmaceutically acceptable carrier.
- the term "chemical derivative" describes a molecule that contains additional chemical moieties that are not normally a part of the base molecule. Such moieties may improve the solubility, half-life, absorption, etc. of the base molecule. Alternatively the moieties may attenuate undesirable side effects of the base molecule or decrease the toxicity of the base molecule. Examples of such moieties are described in a variety of texts, such as Remington's Pharmaceutical Sciences.
- Suitable pharmaceutical carriers include phosphate buffered saline solutions, water, emulsions, such as oil/water emulsions, various types of wetting agents, sterile solutions etc.
- Compositions comprising such carriers can be fo ⁇ nulated by well known conventional methods.
- These pharmaceutical compositions can be administered to the subject at a suitable dose.
- Administration of the suitable compositions may be effected by different ways, e.g., by intravenous, intraperitoneal, subcutaneous, intramuscular, topical or intradermal administration.
- Aerosol formulations such as nasal spray formulations include purified aqueous or other solutions of the active agent with preservative agents and isotonic agents.
- Such formulations are preferably adjusted to a pH and isotonic state compatible with the nasal mucous membranes, e.g., for intranasal administration.
- Formulations for rectal or vaginal administration may be presented as a suppository with a suitable carrier.
- a therapeutically effective dose refers to that amount of antibodies and/or antigen- binding fragments of the invention ameliorate the symptoms or conditions of the cancer or other disease being treated.
- Therapeutic efficacy and toxicity of such compositions can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., ED50 (the dose therapeutically effective in 50% of the population) and LD50 (the dose lethal to 50% of the population).
- the dose ratio between therapeutic and toxic effects is the therapeutic index, and it can be expressed as the ratio, LD50/ED50.
- the biological activity of the antibodies and/or antigen binding fragments thereof, of the invention indicates that they may have sufficient affinity to make them candidates for drug localization to cells expressing the appropriate surface structures, e.g. MGFR.
- targeting and binding to cells of the antibodies and/or antigen binding fragments thereof, of the invention could be useful for the delivery of therapeutically or diagnostically active agents (including targeting drugs, DNA sequences, RNA sequences, lipids, proteins and gene therapy/gene delivery.
- the antibody and/or antigen binding fragments thereof, of the invention can be labeled (e.g., fluorescent, radioactive, enzyme, nuclear magnetic, colloid, other signaling entity, etc.) and used to detect specific targets in vivo or in vitro including "immunochemistry" like assays in vitro. In vivo they could be used in a manner similar to nuclear medicine imaging techniques to detect tissues, cells, or other material expressing MGFR.
- Another method involves delivering a therapeutically active agent to a patient. The method includes administering at least one antibody or an antigen-binding fragment thereof and the therapeutically active agent to a patient.
- the therapeutically active agent is selected from drugs, DNA sequences, RNA sequences, proteins, lipids, and combinations thereof.
- the present invention also provides inventive drug screening assays, treatment protocol screening assays, diagnostic assays, etc. that involve determining whether or not an intracellular protein has become chemically modified in a manner indicative of its participating in an intracellular signaling pathway.
- One such method involves providing a cell expressing on its surface a peptide that can act as a growth factor receptor, such as MUCl.
- the assay involves contacting such a cell with a candidate drug for affecting the ability of an activating ligand of the cell surface peptide to interact with the peptide, in the presence of the activating ligand, and determining whether an intracellular protein that becomes phosphorylated if the activating ligand interacts with the cell surface peptide, in fact, becomes phosphorylated.
- intracellular cell proliferation signaling occurs via the MAP kinase pathway and interaction of the cell surface receptor with its ligand, and associated inductive multimerization, involves phosphorylation of an intracellular protein comprising ERK-2.
- the inventive screening method utilizes a sample comprising a plurality of cells, which may, in certain embodiments, be lysed or permeablized, after having being exposed to the candidate drug and activating ligand.
- the method involves separating proteins contained in intracellular contents of the cells on a gel, for example using Western blot techniques, and visualizing or otherwise detecting the separated proteins.
- detection can be effected, as well understood by those of ordinary skill in the art utilizing antibodies or other molecules that specifically bind to the intracellular proteins to be detected.
- such molecules can be antibodies or antigen-binding fragments thereof, preferably including an auxiliary signaling entity permitting detection or visualization, such as one of those described previously.
- detecting phosphorylation of the intracellular protein after gel separation involves contacting the gel-separated proteins with a biological molecule, such as the above-mentioned antibodies, etc. that specifically bind to a phosphorylated form of the intracellular protein (e.g., phps-ERK-2, but not to the intracellular protein when it is not phosphorylated).
- a biological molecule such as the above-mentioned antibodies, etc. that specifically bind to a phosphorylated form of the intracellular protein (e.g., phps-ERK-2, but not to the intracellular protein when it is not phosphorylated).
- Western blot techniques useful for performing the above-described method are well known to those skilled in the art and are described in more detail below in Example 5.
- a colloid-based aggregation assay instead of using the above-described gel-based method for determining phosphorylation of the intracellular protein within the context of the present assays, a colloid-based aggregation assay, similar to those described elsewhere and herein, can be utilized for detecting the presence of the phosphorylated form of the intracellular protein.
- the intracellular contents are contacted with a plurality of colloid particles.
- the plurality of colloid particles preferably includes a first subset thereof that are immobilized relative to a first biological molecule, such as an antibody or antigen-binding fragment thereof, that specifically binds to a phosphorylated form of the intracellular protein but not to the intracellular protein when it is not phosphorylated, and to a second subset of colloid particles that are immobilized relative to another biological molecule, e.g., antibody or antigen-binding fragment thereof, that specifically binds to the intracellular protein at an epitope that is different from that to which the first biological molecule specifically binds. If the sample includes a phosphorylated form of the intracellular protein, the colloids will aggregate and a color change will be observed.
- a first biological molecule such as an antibody or antigen-binding fragment thereof
- the above-described methods for drug screening based on detection of phosphorylation, or other modification, of intracellular proteins will tend to show a positive test result only when the candidate drug acts by interacting directly with, e.g. by becoming immobilized relative to, the cell surface receptor, as opposed its acting via a mode of action wherein the candidate drug binds to or otherwise interacts with the ligand.
- Such a colloid-based assay as described immediately above is not limited to assays and systems for detecting intracellular signaling via phosphorylation of intracellular proteins.
- the above-described colloid-based assays are more generally applicable.
- such an assay method can involve a screening test for determining the modification state of essentially any biological molecule.
- Such a screening method can involve, in certain embodiments, assays involving detection of immobilization of a colloid particle relative to a biological molecule, wherein the colloid particle is configured such that it becomes immobilized with respect to the biological molecule when the biological molecule is in a first modification state to a different extent than when the biological molecule is in a different modification state.
- Modification states that may be determined using such methods include whether or not a particular biological molecule is phosphorylated, glycosylated, acetylated, etc.
- colloid-based assays involve colloid- colloid aggregation for detection
- the colloid-utilized may simply be used as a signaling entity for detecting whether or not the biological molecule under evaluation is modified or not by using Western blotting or another gel-based assay, etc.
- biological molecules whose modification state is to be tested can be contacted with an agent, such an antibody, that specifically binds to the biological molecule when it is in a first state of modification but not when it is in a second state of modification.
- Such an agent could, in certain embodiments, be immobilized relative to a colloid particle, which could provide a signaling entity able to be detected, for example, in a gel; or, alternatively, the colloid could be immobilized with respect to another binding entity, such as a secondary antibody, having specificity for the agent binding to the biological molecule whose modification state is being determined.
- a sample containing the biological molecule is contacted with a plurality of colloid particles of at least a first and a second type.
- a first subset (type) of the colloid particles is immobilized relative to a first agent that specifically binds to the biological molecule when it is in a first state of modification but not to the biological molecule when it is in the second state of modification, and a second set (type) of the colloid particles is immobilized relative to a second agent that specifically binds to the biological molecule at an epitope that is different from the epitope at which the first agent specifically binds.
- the plurality of colloid particles will tend to aggregate, in proportion of the concentration of the biological molecule in the first state of modification, thereby causing a color change in the assay sample.
- the biological molecule is present only in the second state of activation, the first type of colloid will not become bound to it and no cross- linking or aggregation of the colloids, or color change resulting therefrom, will occur.
- the first agent on the first subset of colloid particles would be an antibody or other binding entity that specifically binds to the biological molecule only when it is in the first state of modification
- the second agent on the second subset of colloid particles could be an agent that binds to the biological molecule in either the first state of modification or the second state of modification.
- Such a colloid aggregation assay as described immediately above can be advantageously employed for determining, for example, which of a plurality of intracellular signaling pathways is activated upon binding of an activating ligand to a cell surface receptor.
- a plurality of different types of colloid particles could be employed including a plurality of different first and second colloid types having agents immobilized thereon able to detect a plurality of different modification states of a plurality of different intracellular signaling proteins enabling determination of the activity of various cell signaling pathways within a cell to be determined, in certain embodiments in a single assay.
- one aspect of the invention involves the discovery that dimerization of the extracellular portion of the MUCl receptor activates the MAP kinase pathway within the cell, which is a known signaling cascade that induces cell proliferation.
- the present invention also, in certain embodiments, involves various diagnostic assays, drug and treatment screening protocols, etc., related to the discovery by the inventors that dimerization of the MUCl receptor triggers cell proliferation via the MAP (mitogen activated protein) kinase cell proliferation signaling pathway. More specifically, dimerization of the MGFR portion of the receptor is necessary and sufficient to activate the MAP kinase pathway and induce cell proliferation.
- the MAP kinase signaling cascade is one of the intracellular signaling pathways that is fairly well understood. To summarize, a mitogen binds to the extracellular portion of a transmembrane receptor and alters its conformation in such a manner that a signal is then transduced to the cell interior.
- a downstream step in this cascade is the phosphorylation of ERK2.
- ERK2 a downstream step in this cascade
- cell proliferation proceeds.
- the inventors demonstrate that the addition of a bivalent antibody, which recognizes the MGFR, dimerizes the MUCl receptor and in some way generates or reveals binding sites for signaling proteins that bind to the cytoplasmic tails of the MUCl receptor.
- Figs. 31-33 respectively, show that in T47D, 1504, and 1500 breast tumor cells, dimerization of the MUCl receptor via bivalent anti-PSMGFR results in ERK2 phosphorylation, see Ex. 12. The effect is dose-dependent and time-dependent.
- synthetic compounds which the inventors previously showed bind to the MGFR portion of the MUCl receptor, compete with the bivalent anti-PSMGFR for binding to this region of the MUCl receptor.
- the compounds effectively prevent (also in a dose-dependent way) the binding of the bivalent antibody to the MGFR, resulting in a loss of dimerization of the receptor and a loss of ERK2 phosphorylation, see Fig. 34 and Ex. 12.
- the monovalent form of the anti-PSMGFR competed with the bivalent antibody and effectively inhibited ERK2 phosphorylation.
- Fig. 35 shows that monovalent anti-PSMGFR competes with the bivalent antibody and blocks the phosphorylation of ERK2 in cell line 1500. Accordingly, in certain embodiments of the invention, the phosphorylation state of
- ERK2 can be monitored as a method for identifying therapeutics for MUCl positive cancers.lt was described above that monovalent compounds and monovalent anti-PSMGFR that bound to the MGFR competed with the bivalent antibody for binding to the site and in so doing inhibited the activation of the MAP kinase signaling pathway; ERK2 phosphorylation did not occur. This suggests a drug screen that will identify agents that affect signaling through the MUCl receptor. In this drug screen, bivalent anti-PSMGFR is added to MUCl positive tumor cells. Drug candidates are also added and the I phosphorylation state of ERK2 is measured, as described previously.
- ERK2 phosphorylation indicates that that drug candidate successfully competed with the bivalent antibody for binding to the MGFR and in so doing inhibited its dimerization and subsequent activation of the MAP kinase signaling pathway.
- This drug screen also can identify compounds that act on intracellular proteins that affect the ERK2 arm of the MAP kinase signaling pathway.
- Monitoring levels of ERK2 phosphorylation, induced by adding the bivalent anti- PSMGFR also provides a method for determining which compounds identified as being able to inhibit the MUCl cell proliferation pathway do so by directly binding to the MGFR rather than to an associated factor such as the ligand.
- a more efficacious MUC1+ cancer treatment protocol can result from simultaneously treating the patient with drugs that target: the MUCl receptor, signaling elements within the MAPkinase/ERK2 pathway, and/or drugs that target the ligands to MGFR
- Another aspect of the invention provides an agent that binds together MGFR portions of MUCl following disease-associated cleavage to effect preventative clustering of the receptors.
- the agent can be any species that includes multiple sites each able to bind to a MFGR portion, and immobilized with respect to each other.
- a polymer or dendrimer or other continuous entity can include multiple sites each able to bind to a MGFR portion, causing clustering of these portions or other structural constraint that inhibits their association with factors that promote cell proliferation.
- IgM-type monoclonal or polyclonal antibodies raised against the MGFR or PSMGFR could be utilizied. Each anti-MGFR IgM antibody could be able to aggregate ten MGFRs on the cell surface to form preventative clusters.
- some or all of the above-identified antibodies, or antigen-binding fragments thereof directed that were specifically bind to the MGFR portion of the MUCl receptor can be modified to allow the antibodies, or antigen-binding fragments to act as a targeted delivery agent by attaching a cytotoxic drug or other agent (e.g. a radioactive substance) able to selectively kill cells to which the ligands become immobilized.
- a cytotoxic drug or other agent e.g. a radioactive substance
- an agent that binds to the MGFR region of the MUCl receptor can be modified with a radioactive substance to destroy tumor cells that aberrantly express the MUCl receptor.
- ricin can be attached to agents that bind the MGFR.
- antibodies, or antigen-binding fragments that bind to the MGFR could be modified to present a imaging agent for use in diagnostic imaging of MUC 1 + tumors and metastases.
- Such antibodies, or antigen-binding fragments can also, alternatively, be modified to act as drugs that can be useful for prevention and/or treatment of cancer.
- an antibodies, or antigen-binding fragments which in its unmodified form binds to multiple MGFRs causing inductive multimerization, is modified to remove or deactivate all but one of its active binding sites for MGFR, such that each modified antibody or antigen-binding fragment is able to bind to only a single receptor.
- a specific example of this would be the production of monovalent fragments of an anti-MGFR IgG via, for example, enzymatic or other cleavage methods.
- individual antibody or antigen-binding fragment are modified such that they are immobilized with respect to additional ligand molecules/peptides also able to bind MGFR, e.g.
- the peptide sequence of the remaining extracellular portion of MUCl can be attached to beads or colloids via a histidine tag.
- Potential binding partners can be histidine-tagged and attached to a second set of colloids (or beads) and assayed for binding to the colloid-immobilized portion of MUCl.
- potential binding partners can be attached to beads or colloids by EDC/NHS coupling or can be nonspecifically adsorbed to beads for the assay.
- An interaction between the MUCl peptide and the potential binding partner can be detected by either a change in solution color (for, the colloid-colloid assay) or by agglomeration of the colloids onto the bead, causing the bead to appear red (for the colloid-bead assay).
- biopsy specemins can be studied, or tissue can be studied interoperatively (e.g. tissue at a surgical site can be studied without removal of the tissue from the subject) to determine tumorigenesis or potential for tumorigenesis.
- a primary indicator of tumorigenesis or potential for tumorigenesis is the amount of MGFR at a cell surface accessible to interaction with external agents such as growth factors, etc. This determination can be made, for example, by determining the amount of an antibody to the MGFR region that binds to the sample, either using standard antibody binding study techniques, or by exposing the sample to colloids to which antibodies specific to the MGFR region have been immobilized and determining binding of the colloids to the samples using techniques described in International patent publication numbers WO 00/34783 and WO 00/43791, referenced above.
- antibodies to the MGFR region and to the IBR can be exposed to the sample and a determination made of the ratio of binding of each to the sample.
- a healthy sample will exhibit little or no antibody binding to the MGFR region.
- a sample indicating tumerigenesis or potential for tumorigenesis will show a non-zero ratio of MGFR antibody binding to IBR antibody binding.
- One aspect of the invention is the identification of antibodies or antigen-binding fragments thereof that directly bind to the MGFR portion of the MUCl receptor. Therefore, a sensitive method for diagnosing early tumors is to administer to the patient, antibodies or antigen-binding fragments thereof that bind to a PSMGFR that have also been derivatized with contrast or imaging agents.
- Imaging agents may include but are not limited to, technetium, rhenium, 123 I, and other contrast agents or radioactive entities commonly used in imaging techniques. Imaging techniques include but are not limited to single photon computed tomography (SPECT), MRI, microscopy and the like. In some applications, an attached colloid can act as an imaging agent. Since the carrier for the imaging agent can also be a therapeutic, this technique can combine an early diagnostic with a directed therapeutic.
- Inventive peptides may include, but are not limited to, those defined above as PSMGFR and PSMGFRTC, and those listed as SEQ ID NOs: 1, 2, 3, 4, 5, 6, 36, 7, 8, 9, 37, 38, 39, 40, 41, 47, 60-66 and 14-35. Additionally, the invention encompasses any protein or peptide, not specifically mentioned above that is encoded by any of the isolated nucleic acid molecules of the invention discussed below. The invention also encompasses unique fragments of the above-mentioned proteins or peptides.
- Proteins can be isolated from biological samples including tissue or cell homogenates, and can also be expressed recombinantly in a variety of prokaryotic and eukaryotic expression systems by constructing an expression vector appropriate to the expression system, introducing the expression vector into the expression system, and isolating the recombinantly expressed protein.
- Short polypeptides including antigenic peptides (such as are presented by MHC molecules on the surface of a cell for immune recognition) also can be synthesized chemically using well-established methods of peptide synthesis.
- isolated means separated from its native environment and present in sufficient quantity to permit its identification or use.
- Isolated when referring to a protein or polypeptide, means, for example: (i) selectively produced by expression of a recombinant nucleic acid or (ii) purified as by chromatography or electrophoresis.
- Isolated proteins or polypeptides may, but need not be, substantially pure.
- the term "substantially pure” means that the proteins or polypeptides are essentially free of other substances with which they may be found in nature or in vivo systems to an extent practical and appropriate for their intended use. Substantially pure proteins may be produced by techniques well known in the art. Because an isolated protein may be admixed with a pharmaceutically acceptable carrier in a pharmaceutical preparation, the protein may comprise only a small percentage by weight of the preparation.
- the protein is nonetheless isolated in that it has been separated from the substances with which it may be associated in living systems, e.g. isolated from other proteins.
- the invention also encompasses unique fragments of the inventive proteins or peptides.
- a fragment of any one of the inventive proteins or peptides generally has the features and characteristics of fragments including unique fragments as discussed herein in connection with nucleic acid molecules.
- the size of a fragment which is unique will depend upon factors such as whether the fragment constitutes a portion of a conserved protein domain. Thus, some regions of the inventive proteins or peptides will require longer segments to be unique while others will require only short segments, typically between 5 and 12 amino acids (e.g. 5, 6, 7, 8, 9, 10, 11, and 12 amino acids long).
- Unique fragments of a protein preferably are those fragments which retain a distinct functional capability of the protein.
- Functional capabilities which can be retained in a fragment of a protein include interaction with antibodies, interaction with other proteins or fragments thereof, selective binding of nucleic acid molecules, and enzymatic activity.
- One important activity is the ability to act as a signature for identifying the polypeptide.
- Those skilled in the art are well versed in methods for selecting unique amino acid sequences, typically on the basis of the ability of the fragment to selectively distinguish the sequence of interest from non-family members. A comparison of the sequence of the fragment to those on known data bases typically is all that is necessary.
- the invention embraces variants of the inventive proteins or peptides described herein.
- a "variant" of a protein is a protein which contains one or more modifications to the primary amino acid sequence of such protein. Modifications which create a protein variant can be made to such protein 1) to produce, increase, reduce, or eliminate-an activity of the protein; 2) to enhance a property of the protein, such as protein stability in an expression system or the stability of protein-protein binding; 3) to provide a novel activity or property to a protein, such as addition of an antigenic epitope or addition of a detectable moiety; and/or 4) to provide equivalent or better binding to a ligand molecule.
- Modifications to a protein can be made via modifications to the nucleic acid molecule which encodes the protein, and can include deletions, point mutations, truncations, amino acid substitutions and additions of amino acids or non-amino acid moieties. Alternatively, modifications can be made directly to the protein, such as by cleavage, substitution of one or more amino acids during chemical systhesis, addition of a linker molecule, addition of a detectable moiety, such as biotin, addition of a fatty acid, etc. Modifications also embrace fusion proteins comprising all or part of an amino acid sequence of the invention.
- variants include proteins which are modified specifically to alter a feature of the protein unrelated to its desired physiological activity.
- cysteine residues can be substituted or deleted to prevent unwanted disulfide linkages.
- certain amino acids can be changed to enhance expression of a protein by eliminating proteolysis by proteases in an expression system (e.g., dibasic amino acid residues in yeast expression systems in which KEX2 protease activity is present).
- Mutations of a nucleic acid molecule which encode a protein or peptide of the invention preferably preserve the amino acid reading frame of the coding sequence, and preferably do not create regions in the nucleic acid which are likely to hybridize to form secondary structures, such a hairpins or loops, which can be deleterious to expression of the variant protein.
- Mutations can be made by selecting an amino acid substitution, or by random mutagenesis of a selected site in a nucleic acid which encodes the protein. Variant proteins are then expressed and tested for one or more activities to determine which mutation provides a variant protein with the desired properties. Further mutations can be made to variants (or to the non-variant proteins) which are silent as to the amino acid sequence of the protein, but which provide preferred codons for translation in a particular host, as well known to those of ordinary skill in the art. Still other mutations can be made to the non- coding sequences of a gene expressing the protein or cDNA clone to enhance expression of the protein.
- variants of particular proteins can be tested by cloning the gene encoding the variant protein into a bacterial or mammalian expression vector, introducing the vector into an appropriate host cell, expressing the variant protein, and testing for a functional capability of the protein, for example its ability to bind to or interact with a particular ligand or its ability to act as ligand to a particular biomolecule, such as a receptor. Preparation of other variant proteins may favor testing of other activities, as will be known to one of ordinary skill in the art.
- amino acid substitutions such as for example conservative amino acid substitutions, may be made in the inventive proteins or peptides to provide "functional variants" of the foregoing proteins or peptides, i.e, variants which possess functional capabilities of the corresponding inventive proteins or peptides.
- a "conservative amino acid substitution” refers to an amino acid substitution which does not alter the relative charge or size characteristics of the protein in which the amino acid substitution is made.
- amino acids include substitutions made amongst amino acids within the following groups: (a) M, I, L, V; (b) F, Y, W; (c) K, R, H; (d) A, G; (e) S, T; (f) Q, N; and (g) E, D.
- amino acid substitutions e.g. conservative amino acid substitutions, to the amino acid sequence of a protein or peptide of the invention.
- the substituted peptides can then be tested for one or more of the desired functions of the non-substituted peptide, in vivo and/or in vitro.
- variants can be tested for, for example, improved stability or other desirable properties and, which could, for example, render them more useful, inter alia, in pharmaceutical compositions.
- Functional variants of the inventive proteins or peptides i.e., variants of proteins or peptides which retain functionality of the original proteins or peptides, can be prepared according to methods for altering polypeptide sequence known to one of ordinary skill in the art such as are found in references which compile such methods, e.g. Molecular Cloning: A Laboratory Manual, J. Sambrook, et al., eds., Second Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 1989, or Current Protocols in Molecular Biology, F.M.
- amino acid substitutions typically are made by alteration of the nucleic acid molecule encoding a protein or peptide. Such substitutions can be made by a variety of methods known to one of ordinary skill in the art. For example, amino acid substitutions may be made by PCR-directed mutation, site-directed mutagenesis according to the method of Kunkel (Kunkel, Proc. Nat. Acad. Sci. U.S.A. 82: 488-492, 1985), or by chemical synthesis of a gene encoding a protein.
- substitutions are made to a small unique fragment of a protein or peptide of the invention
- the substitutions can be made by directly synthesizing the peptide.
- the activity of functional variants or fragments of the inventive protein or peptides can be tested by cloning the gene encoding the altered protein into a bacterial or mammalian expression vector, introducing the vector into an appropriate host cell, expressing the altered protein, and testing for a functional capability of the proteins as disclosed herein.
- the foregoing methods can be performed, e.g. by sequential repetition, to yield functional variants having up to 1, 2, 3, A, 5, 6, 1, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more amino acid substitutions.
- the above or other functional variants can be prepared having, or also having, up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or more amino acid additions or deletions at their C- and/or N-terminus.
- Variants of the proteins or peptides prepared by the foregoing methods can be sequenced, if desired, to determine the amino acid sequence and thus deduce the nucleotide sequence which encodes such variants.
- the present invention in another aspect provides nucleic acid sequences encoding a variety of truncated MUCl receptor proteins, or functional variants or fragments thereof, and other nucleic acid sequences that hybridize to the above nucleic acid sequences under high stringency conditions.
- the sequence of certain of the nucleic acid molecules of of the present invention are presented in Table 2 below as SEQ ID NOs : 42-46, and the predicted amino acid sequences of these genes' protein products, each comprising an isoform of a truncated MUCl receptor protein, are presented in Table 1 below.
- the invention thus involves in one aspect peptide sequences representing truncated isoforms of the MUCl receptor, genes encoding those peptide sequences and functional modifications and variants of the foregoing, useful fragments of the foregoing, as well as therapeutic and diagnostic products and methods relating thereto.
- the peptides referred to herein as truncated MUCl receptor proteins include fragments of the full length MUCl receptor but do not include the full length MUCl receptor protein (i.e. SEQ ID NO: 10).
- nucleic acid molecules that encode the various truncated isoforms of the MUCl receptor described herein can include fragments of the MUCl gene coding region, but do not include the full length MUCl coding region.
- an isolated nucleic acid molecule is provided.
- the isolated nucleic acid molecule is selected from the group consisting of: (a) nucleic acid molecules which encode the MUCl truncated receptor isoform peptides listed as SEQ ID NOs.
- nucleic acid molecules which hybridize under highly stringent conditions to the nucleic acid molecules of (a), (c) deletions, additions and substitutions of the nucleic acid molecules of (a) or (b), (d) nucleic acid molecules that differ from the nucleic acid molecules of (a), (b) or
- nucleic acids of the invention are nucleic acid molecules which encode a truncated isoform of the MUCl receptor, or a functional fragment or varient thereof, or a functional equivalent thereof (e.g., a nucleic acid sequence encoding the same protein as encoded by one of the nucleic acid sequences, e.g. SEQ ID NO. 42, listed below in Table 2), provided that the functional fragment or equivalent encodes a protein which exhibits the functional activity of a truncated isoform of the MUCl receptor encoded by such a listed sequence.
- the functional activity of the truncated isoforms of the MUCl receptor refers to the ability of the truncated isoforms of the MUCl receptor peptide sequence to specifically interact with ligands for MGFR and to modulate cell growth or cell proliferation in response to such interaction.
- the isolated nucleic acid molecule is SEQ ID NO: 42.
- the invention provides nucleic acid molecules which hybridize under high stringency conditions to a nucleic acid molecule consisting of the nucleotide sequences set forth in SEQ TD NOs: 42-46.
- nucleic acids may be DNA, RNA, composed of mixed deoxyribonucleotides and ribonucleotides, or may also incorporate synthetic non-natural nucleotides.
- Various methods for determining the expression of a nucleic acid and/or a polypeptide in normal and tumor cells are known to those of skill in the art.
- the term "highly stringent conditions” or “high stringency conditions”as used herein refers to parameters with which those skilled in the art are familiar. Nucleic acid hybridization parameters may be found in references which compile such methods, e.g. Molecular Cloning: A Laboratory Manual, J.
- stringent conditions refers, for example, to hybridization at 65°C in hybridization buffer (3.5 x SSC, 0.02% Ficoll, 0.02% polyvinyl pyrrolidone, 0.02% Bovine Serum Albumin, 2.5mM NaH2P04 (pH 7), 0.5% SDS, 2mM EDTA).
- SSC 0.15M sodium chloride/0.15M sodium citrate, pH 7; SDS is sodium dodecyl sulphate; and EDTA is ethylenediaminetetracetic acid.
- SSC 0.15M sodium chloride/0.15M sodium citrate, pH 7; SDS is sodium dodecyl sulphate; and EDTA is ethylenediaminetetracetic acid.
- the membrane upon which the DNA is transferred is washed at 2 x SSC at room temperature and then at 0.1 x SSC/0.1 x SDS at temperatures up to 68°C.
- the foregoing set of hybridization conditions is but one example of highly stringent hybridization conditions known to one of ordinary skill in the art. There are other conditions, reagents, and so forth which can be used, which result in a highly stringent hybridization. The skilled artisan will be familiar with such conditions, and thus they are not given here.
- nucleotide identity and/or at least 50% amino acid identity typically will share at least 40% nucleotide identity and/or at least 50%) amino acid identity to such a nucleotide sequence or amino acid sequence, respectively, in some instances will share at least 50% nucleotide identity and/or at least 65% amino acid identity and in still other instances will share at least 60%> nucleotide identity and/or at least 75% amino acid identity.
- Preferred homologs and alleles share nucleotide and amino acid identities with SEQ ID NO: 42 and SEQ ID NO: 37, respectively; or SEQ ID NO: 43 and SEQ ID NO: 38, respectively; or SEQ ID NO: 44 and SEQ ID NO: 39, respectively; or SEQ ID NO: 45 and SEQ ID NO: 40, respectively; or SEQ ID NO: 46 and SEQ ID NO: 41, respectively; and encode polypeptides of greater than 80%, more preferably greater than 90%), still more preferably greater than 95% and most preferably greater than 99% identity.
- the percent identity can be calculated using various, publicly available software tools developed by NCBI (Bethesda, Maryland) that can be obtained through the internet (ftp:/ncbi.nlm.nih.gov/pub/).
- Exemplary tools include the BLAST system available at http://www.ncbi.nlm.nih.gov, which uses algorithms developed by Altschul et al. (Nucleic Acids Res. 25:3389-3402, 1997).
- Pairwise and ClustalW alignments (BLOSUM30 matrix setting) as well as Kyte-Doolittle hydropathic analysis can be obtained using the MacVector sequence analysis software (Oxford Molecular Group).
- Watson-Crick complements of the foregoing nucleic acid molecules also are embraced by the invention.
- the invention also includes degenerate nucleic acid molecules which include alternative codons to those present in the native materials.
- serine residues are encoded by the codons TCA, AGT, TCC, TCG, TCT and AGC.
- Each of the six codons is equivalent for the purposes of encoding a serine residue.
- any of the serine-encoding nucleotide triplets may be employed to direct the protein synthesis apparatus, in vitro or in vivo, to incorporate a serine residue into an elongating peptide sequence of the invention.
- nucleotide sequence triplets which encode other amino acid residues include, but are not limited to: CCA, CCC, CCG and CCT (proline codons); CGA, CGC, CGG, CGT, AGA and AGG (arginine codons); ACA, ACC, ACG and ACT (threonine codons); AAC and AAT (asparagine codons); and ATA, ATC and ATT (isoleucine codons).
- Other amino acid residues may be encoded similarly by multiple nucleotide sequences.
- the invention embraces degenerate nucleic acids that differ from the biologically isolated nucleic acids in codon sequence due to the degeneracy of the genetic code.
- the invention also provides isolated unique fragments of SEQ ID NOs: 42-46 and/or complements of SEQ ID NOs: 42-46.
- a unique fragment is one that is a 'signature' for the larger nucleic acid. It, for example, is long enough to assure that its precise sequence is not found in molecules outside of the inventive nucleic acid molecules defined above. Those of ordinary skill in the art may apply no more than routine procedures to determine if a fragment is unique within the human or mouse genome. Unique fragments can be used as probes in Southern blot assays to identify such nucleic acid molecules, or can be used in amplification assays such as those employing PCR.
- Unique fragments also can be used to produce fusion proteins for generating antibodies or determining binding of the polypeptide fragments, or for generating immunoassay components. Likewise, unique fragments can be employed to produce nonfused fragments of certain polypeptides of the invention useful, for example, in the preparation of antibodies, in immunoassays. Unique fragments further can be used as antisense oligonucleotides to inhibit the expression of nucleic acids and polypeptides, particularly for therapeutic purposes. The invention also encompasses antisense oligonucleotides of the above-described nucleic acid molecules of the invention.
- antisense oligonucleotide or “antisense” describes an oligonucleotide that is an oligoribonucleotide, oligodeoxyribonucleotide, modified oligoribonucleotide, or modified oligodeoxyribonucleotide which hybridizes under physiological conditions to DNA comprising a particular gene or to an mRNA transcript of that gene and, thereby, inhibits the transcription of that gene and/or the translation of that mRNA.
- the exact length of the antisense oligonucleotide and its degree of complementarity with its target will depend upon the specific target selected, including the sequence of the target and the particular bases which comprise that sequence. It is preferred that the antisense oligonucleotide be constructed and arranged so as to bind selectively with the target under physiological conditions, i.e., to hybridize substantially more to the target sequence than to any other sequence in the target cell under physiological conditions.
- One of skill in the art can easily choose and synthesize any of a number of appropriate antisense molecules for use in accordance with the present invention.
- antisense oligonucleotides should comprise at least 10 and, more preferably, at least 15 consecutive bases which are complementary to the target, although in certain cases modified oligonucleotides as short as 7 bases in length have been used successfully as antisense oligonucleotides (Wagner et al., Nature Biotechnology 14: 840-844, 1996).
- the antisense oligonucleotides of the invention also may include "modified" oligonucleotides.
- the oligonucleotides may be modified in a number of ways known in the art, which do not prevent them from hybridizing to their target but which enhance their stability or targeting, or which otherwise enhance their therapeutic effectiveness.
- Antisense oligonucleotides may be administered as part of a pharmaceutical composition.
- Such a pharmaceutical composition may include the antisense oligonucleotides in combination with any standard physiologically and/or pharmaceutically acceptable carriers which are known in the art.
- the compositions should be sterile and contain a therapeutically effective amount of the antisense oligonucleotides in a unit of weight or volume suitable for administration to a patient.
- the size of the above-mentioned unique fragment will depend upon its conservancy in the genetic code.
- some regions of SEQ ID NOs : 42-46 and their complements will require longer segments to be unique while others will require only short segments, typically between 12 and 32 nucleotides or more in length (e.g.
- a unique fragment can be a functional fragment.
- a functional fragment of a nucleic acid molecule of the invention is a fragment which retains some functional property of the larger nucleic acid molecule, such as coding for a functional polypeptide, binding to proteins, regulating transcription of operably linked nucleic acid molecules, and the like.
- One of ordinary skill in the art can readily determine using the assays described herein and those well known in the art to determine whether a fragment is a functional fragment of a nucleic acid molecule using no more than routine experimentation.
- isolated means: (i) amplified in vitro by, for example, polymerase chain reaction (PCR); (ii) recombinantly produced by cloning; (iii) purified, as by cleavage and gel separation; or (iv) synthesized by, for example, chemical synthesis.
- An isolated nucleic acid molecule is one which is readily manipulable by recombinant DNA techniques well known in the art.
- PCR polymerase chain reaction
- An isolated nucleic acid molecule may be substantially purified, but need not be.
- a nucleic acid molecule that is isolated within a cloning or expression vector is not pure in that it may comprise only a tiny percentage of the material in the cell in which it resides.
- Such a nucleic acid molecule is isolated, however, as the term is used herein because it is readily manipulable by standard techniques known to those of ordinary skill in the art.
- An isolated nucleic acid molecule as used herein is not a naturally occurring chromosome.
- the invention embraces the use of sequences, such as those discussed immediately above, that encode a peptide or fragment or variant thereof of the invention, in expression vectors, as well their use to transfect host cells and cell lines, be these prokaryotic (e.g., E. coli), or eukaryotic (e.g., CHO cells, COS cells, yeast expression systems and recombinant baculovirus expression in insect cells).
- prokaryotic e.g., E. coli
- eukaryotic e.g., CHO cells, COS cells, yeast expression systems and recombinant baculovirus expression in insect cells.
- mammalian cells such as human, mouse, hamster, pig, goat, primate, etc. They may be of a wide variety of tissue types, and they may be primary cells or cell lines.
- the expression vectors include the pertinent sequence, i.e., those inventive nucleic acids encoding the peptide sequences of the invention, described above, operably linked to a promoter.
- expression vectors comprising any of the isolated nucleic acid molecules of the invention, preferably operably linked to a promoter, are provided.
- host cells transformed or transfected with such expression vectors also are provided.
- Expression vectors containing all the necessary elements for expression are commercially available and known to those skilled in the art. See, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor Laboratory Press, 1989.
- RNA heterologous DNA
- RNA heterologous DNA
- a "vector” may be any of a number of nucleic acid molecules into which a desired sequence may be inserted by restriction and ligation for transport between different genetic environments or for expression in a host cell.
- Vectors are typically composed of DNA although RNA vectors are also available. Vectors include, but are not limited to, plasmids, phagemids and virus genomes.
- a cloning vector is one which is able to replicate in a host cell, and which is further characterized by one or more endonuclease restriction sites at which the vector may be cut in a determinable fashion and into which a desired DNA sequence may be ligated such that the new recombinant vector retains its ability to replicate in the host cell.
- replication of the desired sequence may occur many times as the plasmid increases in copy number within the host bacterium or just a single time per host before the host reproduces by mitosis.
- replication may occur actively during a lytic phase or passively during a lysogenic phase.
- an "expression vector” is one into which a desired DNA sequence may be inserted by restriction and ligation such that it is operably joined to regulatory sequences and may be expressed as an RNA transcript.
- Vectors may further contain one or more marker sequences suitable for use in the identification of cells that have or have not been transformed or transfected with the vector. Markers include, for example, genes encoding proteins that increase or decrease either resistance or sensitivity to antibiotics or other compounds, genes that encode enzymes whose activities are detectable by standard assays known in the art (e.g., ⁇ -galactosidase or alkaline phosphatase), and genes that visibly affect the phenotype of transformed or transfected cells, hosts, colonies or plaques (e.g., green fluorescent protein).
- Preferred vectors are those capable of autonomous replication and expression of the structural gene products present in the DNA segments to which they are operably joined.
- a coding sequence and regulatory sequences are said to be "operably” joined when they are covalently linked in such a way as to place the expression or transcription of the coding sequence under the influence or control of the regulatory sequences.
- two DNA sequences are said to be operably joined if induction of a promoter in the 5' regulatory sequences results in the transcription of the coding sequence and if the nature of the linkage between the two DNA sequences does not (1) result in the introduction of a frame-shift mutation, (2) interfere with the ability of the promoter region to direct the transcription of the coding sequences, or (3) interfere with the ability of the corresponding RNA transcript to be translated into a protein.
- a promoter region would be operably joined to a coding sequence if the promoter region were capable of effecting transcription of that DNA sequence such that the resulting transcript might be translated into the desired protein or polypeptide.
- regulatory sequences needed for gene expression may vary between species or cell types, but shall in general include, when necessary, 5' non-transcribed and 5' non-translated sequences involved with the initiation of transcription and translation respectively, such as a TATA box, capping sequence, CAAT sequence, and the like.
- 5' non-transcribed regulatory sequences will include a promoter region that includes a promoter sequence for transcriptional control of the operably joined gene.
- Regulatory sequences may also include enhancer sequences or upstream activator sequences as desired.
- the vectors of the invention may optionally include 5' leader or signal sequences. The choice and design of an appropriate vector is within the ability and discretion of one of ordinary skill in the art.
- Possible regulatory elements permitting expression in prokaryotic host cells comprise, e.g., the PL, lac, trp or tac promoter in E. coli, and examples of regulatory elements permitting expression in eukaryotic host cells are the AOXl or GALl promoter in yeast or the CMV-promoter, SV40-promoter, RSV-promoter (Rous sarcoma virus), CMV- enhancer, SV40-enhancer or a globin intron in mammalian and other animal cells.
- Beside elements which are responsible for the initiation of transcription such regulatory elements may also comprise transcription termination signals, such as the SV40- poly-A site or the tk-poly-A site, downstream of the polynucleotide.
- leader sequences capable of directing the polypeptide to a cellular compartment e.g. the cell cytoplasmic membrane, or secreting it into the medium may be added to the coding sequence of the polynucleotides of the invention and are well known in the art.
- the leader sequence(s) is (are) assembled in appropriate phase with translation, initiation and termination sequences, and in certain embodiments, a leader sequence capable of directing the polypeptide to a cellular compartment or directing secretion of translated protein, or a portion thereof, into the periplasmic space or extracellular medium.
- suitable expression vectors are known in the art such as Okayama-Berg cDNA expression vector pcDVl (Pharmacia), pCDM8, pRc/CMV, pcDNAl , pcDNA3 (Invitrogen), or pSPORTl (GIBCO BRL).
- the present invention furthermore relates to host cells transformed with a polynucleotide or vector of the invention.
- host cell may be a prokaryotic or eukaryotic cell.
- the polynucleotide or vector of the invention which is present in the host cell may either be integrated into the genome of the host cell or it may be maintained extrachromosomally.
- the host cell can be any prokaryotic or eukaryotic cell, such as a bacterial, insect, fungal, plant, animal or human cell.
- Certain fungal cells are, for example, those of the genus Saccharomyces, in particular those of the species S. cerevisiae.
- the term "prokaryotic” is meant to include all bacteria which can be transformed or transfected with DNA or RNA molecules for the expression of a peptide sequence of the invention.
- Prokaryotic hosts may include gram negative as well as gram positive bacteria such as, for example, E. coli, S. typhimurium, Serratia marcescens and Bacillus subtilis.
- eukaryotic is meant to include yeast, higher plant, insect and preferably mammalian cells, for example NSO and CHO cells.
- the peptide sequences encoded by the polynucleotides of the present invention may be glycosylated or may be non-glycosylated.
- a polynucleotide of the invention can be used to transform or transfect the host using any of the techniques commonly known to those of ordinary skill in the art.
- Suitable source cells for the DNA sequences and host cells for polypeptide expression can be obtained from a number of sources, such as the American Type Culture Collection ("Catalogue of Cell Lines and Hybridomas," Fifth edition (1985) Rockville, Maryland, U.S.A., which is incorporated herein by reference).
- a virus vector for delivering a nucleic acid molecule encoding a peptide sequence of the invention is selected from the group consisting of adenoviruses, adeno-associated viruses, poxviruses including vaccinia viruses and attenuated poxviruses, Semliki Forest virus, Venezuelan equine encephalitis virus, retroviruses, Sindbis virus, and Ty virus-like particle.
- replication- defective adenoviruses e.g., Xiang et al., Virology 219:220-227, 1996; Eloit et al., J. Virol. 7:5375-5381, 1997; Chengalvala et al., Vaccine 15:335-339, 1997)
- the virus vector is an adenovirus.
- Another virus which can potentially be used for certain applications, is the adeno- associated virus, a double-stranded DNA virus.
- the adeno-associated virus is capable of infecting a wide range of cell types and species and can be engineered to be replication- deficient. It further has advantages, such as heat and lipid solvent stability, high transduction frequencies in cells of diverse lineages, including hematopoietic cells, and lack of superinfection inhibition thus allowing multiple series of transductions.
- the adeno- associated virus can integrate into human cellular DNA in a site-specific manner, thereby minimizing the possibility of insertional mutagenesis and variability of inserted gene expression, h addition, wild-type adeno-associated virus infections have been followed in tissue culture for greater than 100 passages in the absence of selective pressure, implying that the adeno-associated virus genomic integration is a relatively stable event.
- the adeno- associated virus can also function in an extrachromosomal fashion.
- Other viral vectors are based on non-cytopathic eukaryotic viruses in which non- essential genes have been replaced with the gene of interest.
- Non-cytopathic viruses include retroviruses, the life cycle of which involves reverse transcription of genomic viral RNA into DNA with subsequent proviral integration into host cellular DNA.
- Adenoviruses and retroviruses have been approved for human gene therapy trials.
- the retroviruses are replication-deficient (i.e., capable of directing synthesis of the desired proteins, but incapable of manufacturing an infectious particle).
- Such genetically altered retroviral expression vectors can have general utility for the high-efficiency transduction of genes in vivo.
- the foregoing nucleic acid delivery vectors (1) contain exogenous genetic material that can be transcribed and translated in a mammalian cell and that can produce a peptide sequence of the invention that is localized within, and oriented with respect to, the cytoplasmic membrane of the cell, such that an extracellular receptor portion of the peptide sequence (e.g. PSMGFR) is expressed on the external surface of the cell cytoplasmic membrane, and (2) contain on a surface a ligand that selectively binds to a receptor on the surface of a target cell, such as a mammalian cell, and thereby gains entry to the target cell.
- an extracellular receptor portion of the peptide sequence e.g. PSMGFR
- nucleic acid molecules of the invention may be introduced in vitro or in vivo in a host.
- Such techniques include transfection of nucleic acid molecule- calcium phosphate precipitates, transfection of nucleic acid molecules associated with DEAE, transfection or infection with the foregoing viruses including the nucleic acid molecule of interest, liposome-mediated transfection, and the like.
- a vehicle used for delivering a nucleic acid molecule of the invention into a cell e.g., a retrovirus, or other virus; a liposome
- a targeting molecule attached thereto e.g., a retrovirus, or other virus; a liposome
- a molecule such as an antibody specific for a surface membrane protein on the target cell or a ligand for a receptor on the target cell can be bound to or incorporated within the nucleic acid molecule delivery vehicle.
- monoclonal antibodies are employed.
- proteins that bind to a surface membrane protein associated with endocytosis may be incorporated into the liposome formulation for targeting and/or to facilitate uptake.
- proteins include capsid proteins or fragments thereof tropic for a particular cell type, antibodies for proteins which undergo internalization in cycling, proteins that target intracellular localization and enhance intracellular half life, and the like.
- transgenic non-human animals includes non-human animals having one or more exogenous nucleic acid molecules inco ⁇ orated in germ line cells and/or somatic cells.
- transgenic animal include animals having episomal or chromosomally incorporated expression vectors, etc.
- expression vectors can use a variety of promoters which confer the desired gene expression pattern (e.g., temporal or spatial).
- Conditional promoters also can be operably linke ⁇ " to nucleic acid molecules of the invention to increase or decrease expression of the encoded polypeptide molecule in a regulated or conditional manner.
- 7 ⁇ r ⁇ -acting negative or positive regulators of polypeptide activity or expression also can be operably linked to a conditional promoter as described above.
- Such tnms-acting regulators include antisense nucleic acid molecules, nucleic acid molecules that encode dominant negative molecules, transcription factors, ribozyme molecules specific for nucleic acid molecules, and the like.
- the transgenic non-human animals are useful in experiments directed toward testing biochemical or physiological effects of diagnostics or therapeutics, for example for cancers characterized by aberrant expression of MUCl.
- Other uses will be apparent to one of ordinary skill in the art.
- the invention also embraces so-called expression kits, which allow the artisan to prepare a desired expression vector or vectors.
- Such expression kits include at least one of the previously discussed inventive nucleotide sequences encoding a peptide sequence of the invention. Other components may be added, as desired, as long as the above-mentioned sequences are included.
- MUCl transfectants i.e. cells transfected with nucleic acid molecules encoding isoforms of the MUCl receptor on the cell surface
- PSMGFR is the functionally necessary and sufficient portion of the MUCl receptor that mediates cell growth.
- MUCl receptor which is aberrantly expressed in about 75% of all human solid tumors, is a key receptor that mediates the growth of tumor cells.
- results presented herein and discussed above and in the examples provide evidence that a portion of the MUCl receptor, which remains attached to the cell surface after cleavage, is the part of the MUCl extracellular domain that is sufficient and necessary for MUCl -dependent cell proliferation. As shown and discussed previously, dimerization of the MGFR portion of the MUCl receptor induced cell proliferation.
- MUC1 + breast tumor cells T47D, 1500, 1504, and BT-474 were obtained from the ATCC (See Example 5).
- MUCl " breast tumor cells MDA-MB-453, HEK (human embilical kidney) cell line K293, and HeLa cells were also obtained from the ATCC (See Example 5).
- Western blot analysis was performed (See Example 5) to determine the expressed levels of MUCl in each cell type.
- the protein bands of BT-474 are concentrated at 20 kDa with a low intensity presence at around 15 kDa (See Fig. 30).
- K293 cells showed no MUCl expression as expected and HeLa cells showed minimal MUCl between 20 - 30 kDa as previously reported in the literature.
- MDA-MB-453 also did not express detectable levels of cleaved or uncleaved MUCl (data not shown).
- Cellular proteins often undergo post-translational modifications such as cleavage, glycosylation and phosphorylation.
- the extracellular domain of the MUCl receptor is cleaved (at an unknown location) and shed into the bloodstream.
- the extracellular portion of the receptor can also be glycosylated, although it has been reported that in tumor cells, it is often underglycosylated.
- the fact that the MUCl receptor undergoes these indeterminate modifications makes it difficult to characterize the portion of the receptor that remains on the cell surface after cleavage in terms of length.
- the degree of glycosylation alters the molecular weight of the receptor when analyzed by western blot, for example. Therefore, in order to compare expression levels of MUCl among various cells types and to get a better determination of their true molecular weights, it is advantageous to deglycosylate protein samples prior to western gel analysis.
- Fig. 37 the method for producing which is described in Ex.
- the 1500 cell line was deglycosylated using enzymes that specifically remove O- or N-lined glycol units.
- Fig. 37 shows that the shift in molecular weight only occurs after treatment with the N-specific deglycosylase. This suggests that the PSMGFR region of the MUCl receptor is only N- glycosylated.
- MUCl isoform constructs of varying length were transfected into HEK cells and analyzed by western blot using anti-PSMGFR to determine cleavage patterns of the various MUCl constructs.
- HEK human embryonic kidney
- constructs were generated to produce the entire MUCl receptor (SEQ ID NO: 10 - Table 1), a MUCl receptor variant with only 1.3 kilobases of the repeats section ("Rep isoform" - SEQ ED NO: 41 - Table 1), a MUCl receptor variant that terminates after the IBR (interchain binding domain)("CM isoform" - SEQ ED NO: 38 - Table 1), a MUCl receptor variant that terminates after the PSMGFR ("nat-PSMGFRTC isoform" - SEQ ID NO: 37 - Table 1), and the entire MUC1-Y alternative splice variant ("Y isoform" - SEQ ID NO: 40 - Table 1).
- anchorage-independent cell growth is a phenomenon that is not yet understood but is a hallmark characteristic of true tumor cells. It was also observed that attempts to transiently transfect cells with the full length or repeats (Rep isoform) constructs were difficult and frequently failed. In sharp contrast, the nat-PSMGFRTC isoform construct transfected easily each and every time it was tried. These results support the premise that it is the PSMGFR portion of the receptor that acts as a growth factor receptor. To determine whether in HEK cells the MUCl truncated receptors would behave as they do in tumor cells, a series of cell growth stimulation and inhibition were performed.
- Fig. 40 shows that the addition of bivalent anti-PSMGFR (solid red bars) to the nat- PSMGFRTC isoform construct transfected cells caused an 80% enhancement of cell proliferation, while the addition of monovalent anti-PSMGFR inhibited native cell growth by 50%). The figure also shows that the monovalent antibody competed with the bivalent antibody to diminish the extent of the enhanced cell growth.
- Fig. 41 shows that the addition of the bivalent antibody triggers ERK2 phosphorylation while Fig. 42 shows that the monovalent antibody competes with the bivalent to block ERK2 phosphorylation.
- nat- PSMGFRTC isoform transfected cell lines therefore constitute an excellent research tool for drug discovery for MUC1 + cancers, since they behave similarly to tumor cells and this form of the receptor appears to be constitutively active.
- the extracellular domains that were represented in the transfected cells generated within the context of the present invention included: 1) the PSMGFR alone (nat-PSMGFRTC isoform - SEQ ID NO: 37 - Table 1); 2) the PSMGFR and the PSIBR (CM isoform - SEQ ID NO: 38 -Table 1); 3) the PSMGFR, PSIBR and a unique sequence that was ended just before the repeats region (UR isoform - SEQ ID NO: 39 - Table 1); 4) the PSMGFR, PSEBR, unique sequence and 1 kb of repeat sequences (Rep isoform - SEQ ID NO: 41 - Table 1); 5) the entire MUCl extracellular domain (Full length MUCl receptor - SEQ ID NO: 10 - Table 1);
- the calculated molecular weight of the nat- PSMGFRTC isoform transfected construct is 19 Kd.
- the MUCl construct termed "Y isoform" produced a series of protein bands reacted with anti-PSMGFR in a western blot that moved through an SDS-PAGE gel with apparent molecular weights that ranged between 35 - 45 Kd (see Fig. 39). After deglycosylation, the motility of the proteins shifted to apparent molecular weights that ranged from 29 - 40 Kd.
- the calculated molecular weight of the transfected MUCl-Y isoform is 29 Kd.
- FIG. 39 shows a clear difference between breast cancer patient-derived MUCl proteins (1500 cell line) and the Y isoform transfected into HEK cells ("Y" lane).
- the lanes that were loaded with breast tumor cell samples do not show protein bands between 35 and 45 Kd; however, the glycosylated Y isoform protein bands are quite visible and intense between 35 and 45 Kd.
- CM isoform construct produced a doublet that ran at about 28 Kd. After deglycosylation, the bands shifted to a lower molecular weight of about 25 Kd. Comparison indicates that this construct is resistant to cleavage as the lower 20 Kd band apparent in the nat-PSMGFRTC isoform construct is not present.
- the UR isoform construct produced MUCl protein bands that ran at 29 - 30 Kd. After deglycosylation, the bands shifted to molecular weights of about 24 Kd. A faint band at 20 Kd is visible, indicating that some cleavage of this construct takes place.
- the "Full Length" construct and the Rep isoform construct appear to behave identically, producing PsMGFR specific bands at 25 - 30 Kd that shift to about 23 Kd after deglycosylation. By western blot it is impossible to distinguish this species from those produced by the patient derived breast tumor cells.
- the (calculated) molecular weight of a portion of the MUCl receptor that includes the cytoplasmic tail, the transmembrane domain and the PSMGFR (unglycosylated) is about 19Kd, (i.e. nat-PSMGFRTC isoform - see SEQ ID NO: 37 - Table 1)
- breast tumor cells express a shorter form of the MUCl receptor that normal breast cells do not express and it runs on an SDS-PAGE gel at about 20Kd (deglycosylated), suggesting that the extracellular domain of this tumor specific form consists essentially of the PSMGFR.
- breast tumor cells derived from actual breast cancer patients, produce a MUCl cleavage product that is similar to the transfection constructs described above
- Breast tumor cell lines 1500, 1504, T47D, BT-474 and MDA-MB-453 were tested.
- the molecular weights of the MUCl receptor fragments were then determined by performing standard western blot analysis, again using the antibody raised against the PSMGFR, as described above. Western blots showed that the breast tumor cell lines produced several MUCl protein bands that run between 25 and 30 Kd.
- the 1500 and T47D cells may produce two cleavage products, running as a doublet on the gel having a band at about 19-20 Kd and another at about 22 Kda.
- the 22 Kda band appears to correspond with the band produced by the CM isoform, which includes the PSIBR at its N-terminus.
- the 22 Kd band was also evident in the MUCl cleavage products produced by transfected cells expressing "healthy" forms (i.e. Full Length receptor and Rep isoform - See Fig. 44).
- the 22 Kd band product represents a product of normal, non-aberrant cleavage and that aberrant cleavage (i.e. producing the 19-20 Kd band may be prevented by the presence of the IBR.
- the resolution of molecular weights by SDS-PAGE analysis is only accurate to within about 1 Kd, which is about 9 amino acids, the actual portion of the MUCl receptor that remains on the surface of tumor cells may be +/- 9 - 15 amino acids N-terminal to the end of the PSMGFR and could possibly be as much as +/-20 amino acids.
- the gels show that the proteins run at approximately the same molecular weight.
- one aspect of the invention is directed to methods for treating a subject diagnosed with or at risk of developing a cancer or tumor characterized by the aberrant expression of MUCl.
- the treatments of the present invention involve the use of drugs or "agents" as described herein. That is, one aspect involves a series of compositions useful for treatment of cancer or tumor characterized by the aberrant expression of MUCl, including these compositions packaged in kits including instructions for use of the composition for the treatinent of such conditions. That is, the kit can include a description of use of the composition for participation in any biological or chemical mechanism disclosed herein that is associated with cancer or tumor.
- the kit also can include instructions for use of a combination of two or more compositions of some embodiments of the invention.
- Instructions also may be provided for administering the drug orally, intravenously, or via another known route of drug delivery.
- These and other embodiments of the invention can also involve promotion of the treatment of cancer or tumor according to any of the techniques and compositions and combinations of compositions described herein.
- patients can be treated with compositions of the invention even though the patients exhibit indication for treatment of one of the compositions of the invention for a condition different from cancer or tumor, including conditions that can be unrelated to cell proliferation or conditions that can accompany cell proliferation, cancer, or tumor. That is, if a composition of the invention is known for treatment of a different condition, some embodiments of the present invention also involve use of that composition for treatments that accompany cell proliferation, cancer, or tumor disease where indicated.
- compositions of the invention can include such treatment where the dosage, delivery technique or vehicle, combination with other pharmaceutical compositions or lack of combination with other pharmaceutical compositions, rate of administration, timing of administration, or other factor differs from the use of the composition for treatment of the condition different from cell proliferation, cancer, or tumor.
- treatment of cell proliferation, cancer, or tumor with compositions of the invention may occur under conditions that are similar to or overlap the use of compositions of the invention for treatment of a different condition, but the compositions of the invention are promoted for treatments that accompany cell proliferation, cancer, or tumor or includes instructions for treatments that accompany cell proliferation, cancer, or tumor as mentioned above.
- promoted includes all methods of doing business including methods of education, hospital and other clinical instruction, pharmaceutical industry activity including pharmaceutical sales, and any advertising or other promotional activity including written, oral, and electronic communication of any form, associated with compositions of the invention in connection with treatments that accompany cell proliferation, cancer, or tumor.
- Instructions can and often do define a component of promotion, and typically involve written instructions on or associated with packaging of compositions of the invention. Instructions also can include any oral or electronic instructions provided in any manner.
- the "kit” typically, and preferably, defines a package including both any one or a combination of the compositions of the invention and the instructions, but can also include the composition of the invention and instructions of any form that are provided in connection with the composition in a manner such that a clinical professional will clearly recognize that the instructions are to be associated with the specific composition.
- Subjects for whom certain treatment methods of the invention (with specific compositions directed toward cell proliferation, cancer, or tumor) are not intended are those who are diagnosed with a condition which may already call for treatment with the specific composition. Accordingly, one aspect of the invention involves treatment of cell proliferation, cancer, or tumor with a specific composition disclosed herein for that purpose, not in combination with another agent where the other agent has been taught previously for use in treatment of cell proliferation, cancer, or tumor itself.
- Another embodiment involves treatment of cell proliferation, cancer, or tumor with this specific composition alone, not in combination with any other active agent.
- Another embodiment involves treatinent of cell proliferation, cancer, or tumor with this specific composition where the use of the composition in the treatment is specifically instructed (through, e.g. written instructions that can accompany the composition) for the treatment of cell proliferation, cancer, or tumor.
- the invention involves treatment of cell proliferation, cancer, or tumor with the specific composition where the use of the composition in the treatment is specifically instructed to affect a mechanism associated with cell proliferation, cancer, or tumor as disclosed herein.
- the drugs and agents of the invention can be used for the pu ⁇ ose of disease prevention.
- the invention is particularly directed to a patient population never before treated with drugs useful according to certain methods of the invention, including patients who are not suffering from cell proliferation, cancer, or tumor and who may or may not be presently indicating susceptibility to cell proliferation, cancer, or tumor.
- the preventative treatment preferably is directed to patient populations that otherwise are free of disease symptoms that call for active treatment with any of the drugs described herein as useful according to the invention.
- the invention involves the discovery that certain antibodies and antigen-binding fragments thereof, particularly, monovalent antibodies or monovalent antigen-binding fragments of antibodies, having specific affinity for MGFR (e.g.
- the invention involves treatment of subjects associated with tumor or cancer associated with aberrant expression of MUCl with these agents or a combination.
- the method comprises administering to the subject any of the above-described antibody derived or based drugs (e.g. a monovalent anti-MGFR antibody or a monovalent MGFR-binding portion of an anti-MGFR antibody), in an amount effective to provide a medically desirable result.
- the method comprises administering to the subject any one of the above-described antibody derived or based drugs (e.g. a monovalent anti-MGFR antibody or a monovalent MGFR-binding portion of an anti-MGFR antibody), in an amount effective to lower the risk/prevent/reduce/inhibit tumors or cancer associated with aberrant expression of MUCl.
- the effective amount will vary with the particular condition being treated, the age and physical condition of the subject being treated, the severity of the condition, the duration of the treatment, the nature of the concurrent therapy (if any), the specific route of administration and like factors within the knowledge and expertise of the health practitioner.
- an effective amount is that amount which prevents interaction of MGFR with its ligand that otherwise would promote cell proliferation (for agents that act according to that mechanism, including certain of the above-described antibody derived or based drugs (e.g. a monovalent anti-MGFR antibody or a monovalent MGFR-binding portion of an anti-MGFR antibody).
- an effective amount is that amount which maintains self-aggregation of MUCl receptors (for agents such as polymers or dendrimers that act according to that mechanism).
- an effective amount is one which reduces levels of cleaved MUCl IBRs, or maintains low levels of cleaved MUCl IBRs (for agents that act according to that mechanism).
- an effective amount for treatment would be an amount sufficient to lessen or inhibit altogether the levels of cleaved MUCl BR (for agents that act according to that mechanism) so as to slow or halt the development of or the progression of tumor or cancer associated with aberrant expression of MUCl . It is preferred generally that a maximum dose be used, that is, the highest safe dose according to sound medical judgment When used therapeutically, the agents of the invention are administered in therapeutically effective amounts.
- a therapeutically effective amount means that amount necessary to delay the onset of, inhibit the progression of, or halt altogether the particular condition being treated.
- a therapeutically effective amount will vary with the subject's age, condition, and sex, as well as the nature and extent of the disease in the subject, all of which can be determined by one of ordinary skill in the art.
- the dosage may be adjusted by the individual physician or veterinarian, particularly in the event of any complication.
- a therapeutically effective amount typically varies from 0.01 mg/kg to about 1000 mg/kg. It is expected that does ranging from 1-500 mg/kg, and preferably doses ranging from 1-50 mg/kg will be suitable.
- the agents will be administered in doses ranging from 1 ⁇ g/kg/day to 10 mg/kg/day, with even more preferred doses ranging from 1-200 ⁇ g/kg/day, 1-100 ⁇ g/kg/day, 1-50 ⁇ g/kg/day or from 1-25 ⁇ g/kg/day.
- dosages may range from about 0.1 mg/kg to about 200 mg/kg, and most preferably from about 0.2 mg/kg to about 20 mg/kg. These dosages can be applied in one or more dose administrations daily, for one or more days.
- the agent of the invention should be administered for a length of time sufficient to provide either or both therapeutic and prophylactic benefit to the subject. Generally, the agent is administered for at least one day.
- the agent may be administered for the remainder of the subject's life.
- the rate at which the agent is administered may vary depending upon the needs of the subject and the mode of administration. For example, it may be necessary in some instances to administer higher and more frequent doses of the agent to a subject for example during or immediately following a event associated with tumor or cancer, provided still that such doses achieve the medically desirable result. On the other hand, it may be desirable to administer lower doses in order to maintain the medically desirable result once it is achieved.
- the same dose of agent may be administered throughout the treatment period which as described herein may extend throughout the lifetime of the subject. The frequency of administration may vary depending upon the characteristics of the subject.
- the agent may be administered daily, every 2 days, every 3 days, every 4 days, every 5 days, every week, every 10 days, every 2 weeks, every month, or more, or any time there between as if such time was explicitly recited herein.
- daily doses of active compounds will be from about 0.01 milligrams/kg per day to 1000 milligrams/kg per day. It is expected that oral doses in the range of 50 to 500 milligrams/kg, in one or several administrations per day, will yield the desired results. Dosage may be adjusted appropriately to achieve desired drug levels, local or systemic, depending upon the mode of administration.
- the degree of activity of the drug is at least 10%. In other embodiments, the degree of activity of the drug is as least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%.
- compositions of the invention When administered to subjects for therapeutic purposes, the formulations of the invention are applied in pharmaceutically acceptable amounts and in pharmaceutically acceptable compositions.
- a pharmaceutical composition may include the agents of the invention in combination with any standard physiologically and/or pharmaceutically acceptable carriers which are known in the art.
- the compositions should be sterile and contain a therapeutically effective amount of the agent in a unit of weight or volume suitable for administration to a patient.
- pharmaceutically-acceptable carrier as used herein means one or more compatible solid or liquid filler, diluents or encapsulating substances which are suitable for administration into a human or other animal.
- carrier denotes an organic or inorganic ingredient, natural or synthetic, with which the active ingredient is combined to facilitate the application.
- compositions also are capable of being co-mingled with the molecules of the present invention, and with each other, in a manner such that there is no interaction which would substantially impair the desired pharmaceutical efficacy.
- Pharmaceutically acceptable further means a non-toxic material that is compatible with a biological system such as a cell, cell culture, tissue, or organism.
- the characteristics of the carrier will depend on the route of administration.
- Physiologically and pharmaceutically acceptable carriers include diluents, fillers, salts, buffers, stabilizers, solubilizers, and other materials which are well known in the art. Such preparations may routinely contain salts, buffering agents, preservatives, compatible carriers, and optionally other therapeutic ingredients.
- salts When used in medicine the salts should be pharmaceutically acceptable, but non-pharmaceutically acceptable salts may conveniently be used to prepare pharmaceutically acceptable salts thereof and are not excluded from the scope of the invention.
- pharmacologically and pharmaceutically acceptable salts include, but are not limited to, those prepared from the following acids: hydrochloric, hydrobromic, sulphuric, nitric, phosphoric, maleic, acetic, salicylic, p-toluene sulfonic, tartaric, citric, methane sulfonic, formic, malonic, succinic, naphthalene-2-sulfonic, and benzene sulfonic.
- salts can be prepared as alkaline metal or alkaline earth salts, such as sodium, potassium or calcium salts of the carboxylic acid group.
- Suitable buffering agents include: acetic acid and a salt (1-2% W/V); citric acid and a salt (1-3%) W/V); boric acid and a salt (0.5-2.5%) W/V); and phosphoric acid and a salt (0.8-2% W/V).
- Suitable preservatives include benzalkonium chloride (0.003-0.03% W/V); chlorobutanol (0.3-0.9% W/V); parabens (0.01-0.25% W/V) and thimerosal (0.004-0.02% W/V).
- benzalkonium chloride 0.003-0.03% W/V
- chlorobutanol 0.3-0.9% W/V
- parabens 0.01-0.25% W/V
- thimerosal 0.004-0.02% W/V
- the particular mode selected will depend, of course, upon the particular combination of drugs selected, the severity of the cancer condition being treated, the condition of the patient, and the dosage required for therapeutic efficacy.
- the methods of this invention may be practiced using any mode of administration that is medically acceptable, meaning any mode that produces effective levels of the active compounds without causing clinically unacceptable adverse effects.
- modes of administration include oral, rectal, topical, nasal, other mucosal forms, direct injection, transdermal, sublingual or other routes.
- "Parenteral" routes include subcutaneous, intravenous, intramuscular, or infusion. Direct injection may be preferred for local delivery to the site of the cancer.
- Oral administration may be preferred for prophylactic treatment e.g., in a subject at risk of developing a cancer, because of the convenience to the patient as well as the dosing schedule.
- Chemical/physical vectors may be used to deliver the agents of the invention to a target (e.g. cell) and facilitate uptake thereby.
- a "chemical/physical vector” refers to a natural or synthetic molecule, other than those derived from bacteriological or viral sources, capable of delivering the agent of the invention to a target (e.g. cell).
- a preferred chemical/physical vector of the invention is a colloidal dispersion system. Colloidal dispersion systems include lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
- a preferred colloidal system of the invention is a liposome.
- Liposomes are artificial membrane vessels which are useful as a delivery vector in vivo or in vitro. It has been shown that large unilamellar vessels (LUV), which range in size from 0.2-4.0.mu. can encapsulate large macromolecules. RNA, DNA, and intact virions can be encapsulated within the aqueous interior and be delivered to cells in a biologically active form (Fraley, et al., Trends Biochem. Sci., v. 6, p. 77 (1981)).
- LUV large unilamellar vessels
- a liposome In order for a liposome to be an efficient gene transfer vector, one or more of the following characteristics should be present: (1) encapsulation of the gene of interest at high efficiency with retention of biological activity; (2) preferential and substantial binding to a target cell in comparison to non-target cells; (3) delivery of the aqueous contents of the vesicle to the target cell cytoplasm at high efficiency; and (4) accurate and effective expression of genetic information.
- Liposomes may be targeted to a particular (e.g. tissue), such as (e.g. the vascular cell wall), by coupling the liposome to a specific ligand such as a monoclonal antibody, sugar, glycolipid, or protein. Liposomes are commercially available from Gibco BRL, for example, as LIPOFECTINTM.
- the preferred vehicle is a biocompatible micro particle or implant that is suitable for implantation into the mammalian recipient.
- PCT International application no. PCT/US/03307 Publication No. WO 95/24929, entitled “Polymeric Gene Delivery System", claiming priority to U.S. patent application Ser. No. 213,668, filed Mar. 15, 1994.
- PCT/US/0307 describes a biocompatible, preferably biodegradable polymeric matrix for containing an exogenous gene under the control of an appropriate promoter. The polymeric matrix is used to achieve sustained release of the exogenous gene in the patient, h accordance with the instant invention, the agent of the invention is encapsulated or dispersed within the biocompatible, preferably biodegradable polymeric matrix disclosed in PCT/US/03307.
- the polymeric matrix preferably is in the form of a micro particle such as a micro sphere (wherein the agent is dispersed throughout a solid polymeric matrix) or a microcapsule (wherein the agent is stored in the core of a polymeric shell).
- Other forms of the polymeric matrix for containing the agents of the invention include films, coatings, gels, implants, and stents.
- the size and composition of the polymeric matrix device is selected to result in favorable release kinetics in the tissue into which the matrix device is implanted.
- the size of the polymeric matrix devise further is selected according to the method of delivery which is to be used, typically injection into a tissue or administration of a suspension by aerosol into the nasal and/or pulmonary areas.
- the polymeric matrix composition can be selected to have both favorable degradation rates and also to be formed of a material which is bioadhesive, to further increase the effectiveness of transfer when the devise is administered to a vascular surface.
- the matrix composition also can be selected not to degrade, but rather, to release by diffusion over an extended period of time.
- Both non-biodegradable and biodegradable polymeric matrices can be used to deliver agents of the invention of the invention to the subject.
- Biodegradable matrices are preferred.
- Such polymers may be natural or synthetic polymers. Synthetic polymers arc preferred.
- the polymer is selected based on the period of time over which release is desired, generally in the order of a few hours to a year or longer.
- the polymer optionally is in the form of a hydrogel that can absorb up to about 90% of its weight in water and further, optionally is cross-linked with multi-valent ions or other polymers.
- the agents of the invention are delivered using the bioerodible implant by way of diffusion, or more preferably, by degradation of the polymeric matrix.
- Exemplary synthetic polymers which can be used to form the biodegradable delivery system include: polyamides, polycarbonates, polyalkylenes, polyalkylene glycols, polyalkylene oxides, polyalkylene terepthalates, polyvinyl alcohols, polyvinyl ethers, polyvinyl esters, polyvinyl halides, polyvinylpyrrolidone, polyglycolides, polysiloxanes, polyurethanes and co- polymers thereof, alkyl cellulose, hydroxyalkyl celluloses, cellulose ethers, cellulose esters, nitro celluloses, polymers of acrylic and methacrylic esters, methyl cellulose, ethyl cellulose, hydroxypropyl cellulose, hydroxy-propyl methyl cellulose, hydroxybutyl methyl cellulose, cellulose acetate, cellulose propionate, cellulose acetate butyrate, cellulose acetate phthalate, carboxylethyl cellulose, cellulose triacetate
- non-biodegradable polymers include ethylene vinyl acetate, poly(meth)acrylic acid, polyamides, copolymers and mixtures thereof.
- biodegradable polymers include synthetic polymers such as polymers of lactic acid and glycolic acid, polyanhydrides, poly(ortho)esters, polyurethanes, poly(butic acid), poly(valeric acid), and poly(lactide-cocaprolactone), and natural polymers such as alginate and other polysaccharides including dextran and cellulose, collagen, chemical derivatives thereof (substitutions, additions of chemical groups, for example, alkyl, alkylene, hydroxylations, oxidations, and other modifications routinely made by those skilled in the art), albumin and other hydrophilic proteins, zein and other prolamines and hydrophobic proteins, copolymers and mixtures thereof.
- Bioadhesive polymers of particular interest include bioerodible hydrogels described by H. S. Sawhney, C. P. Pathak and J. A.
- the invention provides a composition of the above-described agents for use as a medicament, methods for preparing the medicament and methods for the sustained release of the medicament in vivo.
- the compositions may conveniently be presented in unit dosage form and may be prepared by any of the methods well known in the art of pharmacy. All methods include the step of bringing the therapeutic agents into association with a carrier which constitutes one or more accessory ingredients.
- the compositions are prepared by uniformly and intimately bringing the therapeutic agent into association with a liquid carrier, a finely divided solid carrier, or both, and then, if necessary, shaping the product.
- Compositions suitable for parenteral administration conveniently comprise a sterile aqueous preparation of the therapeutic agent, which is preferably isotonic with the blood of the recipient.
- This aqueous preparation may be formulated according to known methods using those suitable dispersing or wetting agents and suspending agents.
- the sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally-acceptable diluent or solvent, for example as a solution in 1, 3-butane diol.
- a non-toxic parenterally-acceptable diluent or solvent for example as a solution in 1, 3-butane diol.
- the acceptable vehicles and solvents that may be employed are water, Ringer's solution, and isotonic sodium chloride solution.
- sterile, fixed oils are conventionally employed as a solvent or suspending medium.
- any bland fixed oil may be employed including synthetic mono or di-glycerides.
- fatty acids such as oleic acid find use in the preparation of injectables.
- Carrier formulations suitable for oral, subcutaneous, intravenous, intramuscular, etc. can be found in Remington's Pharmaceutical Sciences, Mack Publishing Company, Easton, PA.
- Compositions suitable for oral administration may be presented as discrete units such as capsules, cachets, tablets, or lozenges, each containing a predetermined amount of the therapeutic agent.
- Other compositions include suspensions in aqueous liquors or non-aqueous liquids such as a syrup, an elixir, or an emulsion.
- Other delivery systems can include time-release, delayed release or sustained release delivery systems. Such systems can avoid repeated administrations of the therapeutic agent of the invention, increasing convenience to the subject and the physician. Many types of release delivery systems are available and known to those of ordinary skill in the art.
- polymers based systems such as polylactic and polyglycolic acid, poly(lactide- glycolide), copolyoxalates, polyanhydrides, polyesteramides, polyorthoesters, polyhydroxybutyric acid, and polycaprolactone.
- microcapsules of the foregoing polymers containing drugs are described in, for example, U.S. Pat. No. 5,075,109.
- Nonpolymer systems that are lipids including sterols such as cholesterol, cholesterol esters and fatty acids or neutral fats such as mono-, di- and tri-glycerides; liposomes; phospholipids; hydrogel release systems; silastic systems; peptide based systems; wax coatings, compressed tablets using conventional binders and excipients, partially fused implants and the like.
- Specific examples include, but are not limited to: (a) erosional systems in which the polysaccharide is contained in a form within a matrix, found in U.S. Patent Nos. 4,452,775, 4,675,189, and 5,736,152, and (b) diffusional systems in which an active component permeates at a controlled rate from a polymer such as described in U.S.
- a long-term sustained release implant may be particularly suitable for treatment of established cancer conditions as well as subjects at risk of developing a cancer.
- "Long-term" release as used herein, means that the implant is constructed and arranged to deliver therapeutic levels of the active ingredient for at least 7 days, and preferably 30-60 days.
- the implant may be positioned at the site of the tumor. Long-term sustained release implants are well known to those of ordinary skill in the art and include some of the release systems described above.
- the therapeutic agent may be administered in alone or in combination with an anti- cancer drug.
- the compounds may be administered by the same method, e.g. intravenous, oral, etc. or may be administered separately by different modes, e.g. therapeutic agent administered orally, anti-cancer drug administered intravenously, etc.
- therapeutic agent and the anti-cancer drug are co-administered intravenously.
- therapeutic agent and the anti-cancer drug are administered separately.
- Anti-cancer drugs that can be co-administered with the compounds of the invention include, but are not limited to Acivicin; Aclarubicin; Acodazole Hydrochloride; Acronine; Adriamycin; Adozelesin; Aldesleukin; Altretamine; Ambomycin; Ametantrone Acetate; Aminoglutethimide; Amsacrine; Anastrozole; Anthramycin; Asparaginase; Asperlin; Azacitidine; Azetepa; Azotomycin; Batimastat; Benzodepa; Bicalutamide; Bisantrene Hydrochloride; Bisnafide Dimesylate; Bizelesin; Bleomycin Sulfate; Brequinar Sodium; Bropirimine; Busulfan; Cactinomycin; Calusterone; Caracemide; Carbetimer; Carboplatin; Carmustine; Carubicin Hydrochloride; Carzelesin; Cedefin
- Interferon Alfa-2b Interferon Alfa-nl; Interferon Alfa-n3; Interferon Beta- 1 a; Interferon
- Losoxantrone Hydrochloride Losoxantrone Hydrochloride; Masoprocol; Maytansine; Mechlorethamine Hydrochloride;
- Megestrol Acetate Melengestrol Acetate; Melphalan; Menogaril; Mercaptopurine;
- Methotrexate Methotrexate Sodium; Metoprine; Meturedepa; Mitindomide; Mitocarcin;
- Mitocromin Mitogillin; Mitomalcin; Mitomycin; Mitosper; Mitotane; Mitoxantrone Hydrochloride; Mycophenolic Acid; Nocodazole; Nogalamycin; Ormaplatin; Oxisuran;
- Teroxirone Testolactone; Thiamiprine; Thioguanine; Thiotepa; Tiazofurin; Tirapazamine;
- Topotecan Hydrochloride Toremifene Citrate; Trestolone Acetate; Triciribine Phosphate; Trimetrexate; Trimetrexate Glucuronate; Triptorelin; Tubulozole Hydrochloride; Uracil
- Vindesine Vindesine; Vindesine Sulfate; Vinepidine Sulfate; Vinglycinate Sulfate; Vinleurosine
- Zeniplatin Zinostatin
- Zorubicin Hydrochloride Additional antineoplastic agents include those disclosed in Chapter 52, Antineoplastic Agents (Paul Calabresi and Bruce A.
- His-TR Histidine-Tagged Truncated receptor (His-TR) (having "SPY” sequence of var-PSMGFR): GTINVHDVETQFNQYKTEAASPYNLTISDVSVSFIHHHHH (SEQ ID NO: 1)
- His-var-PSMGFR MUCl Growth Factor Receptor
- His-var-PSMGFR Histidine-Tagged Primary Sequence of the MUCl Growth Factor Receptor (His-var-PSMGFR) (having "SPY" sequence of var-PSMGFR) having a single amino acid deletion at the C-terminus of SEQ D NO: 2):
- ESMGFR Histidine-Tagged Extended Sequence of MUCl Growth Factor Receptor (ESMGFR) (having "SPY" sequence of var-PSMGFR):
- VQLTLAFREGTINVHDVETQFNQYKTEAASPYNLTISDVSVS DVPFPFHHHHHH (SEQ ID NO: 3)
- TSESMGFR Histidine-Tagged Tumor-Specific Extended Sequence of MUCl Growth Factor Receptor
- Histidine-Tagged Primary Sequence of the Interchain binding Region (His-PSIBR): HHHHHHGFLGLSNIKFRPGSVVVQLTLAFRE (SEQ ID NO: 4)
- Histidine-Tagged Truncated Interchain binding Region (His-TPSEBR): HHHHHHSVVVQLTLAFREG (SEQ ID NO: 62)
- Histidine-Tagged Repeat Motif 2 (His-RM2):
- Truncated PSMGFR receptor (TR) (having "SPY" sequence of var-PSMGFR): GTINVHDVETQFNQYKTEAASPYNLTISDVSVS (SEQ ID NO: 6)
- PSMGFR Native Primary Sequence of the MUCl Growth Factor Receptor (nat-PSMGFR - An example of "PSMGFR"), having a single amino acid deletion at the C-terminus of SEQ ID NO: 36):
- SPY functional variant of the native Primary Sequence of the MUCl Growth Factor Receptor having enhanced stability (var-PSMGFR - An example of "PSMGFR”): GT ⁇ NVHDVETQFNQYKTEAASPYNLTISDVSVSDVPFPFSAQSGA (SEQ ID NO: 7)
- SPY functional variant of the native Primary Sequence of the MUCl Growth Factor Receptor having enhanced stability (var-PSMGFR - An example of "PSMGFR"), having a single amino acid deletion at the C-terminus of SEQ ID NO: 7): TINVHDVETQFNQYKTEAASPYNLTISDVSVSDVPFPFSAQSGA (SEQ ID NO: 64)
- PSEBR Interchain Binding Region
- TPSIBR Truncated Interchain Binding Region
- TSESMGFR Tumor-Specific Extended Sequence of MUCl Growth Factor Receptor (TSESMGFR) (having "SPY” sequence of var-PSMGFR): SVWQLTLAFREGTINVHDVETQFNQYKTEAASPYNLTISDVSVS DVPFPFSAQSGA (SEQ ID NO: 66)
- a truncated MUCl receptor isoform having nat-PSMGFR and PSIBR at its N-terminus and including the fransmembrane and cytoplasmic sequences of a full-length MUCl receptor ("CM isoform"- shown excluding optional N-terminus signal sequence - S SEQ ID NOS: 47, 58, or 59 which may be cleaved after translation and prior to expression of the receptor on the cell surface):
- APGSTAPPAHGVTSAPDNRPALGSTAPPVHNVTSASGSASGSASTLVHNGTSARAT TTPASKSTPFSEPSHHSDTPTTLASHSTKTDASSTHHSSVPPLTSSNHSTSPQLSTGVSF FFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVV VQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVP GWGIALLVLVCVLVALA ⁇ VYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYH THGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAAASANL
- N-terminal MUC-1 signaling sequence for directing MUCl receptor and truncated isoforms to cell membrane surface (optionally present, in whole or part - e.g. up to 3 a.a. may be absent at C-terminal end as indicated by variants in SEQ ID NOS: 47, 58, and 59, at N- terminus of above-listed MUCl truncated receptor isoforms): MTPGTQSPFFLLLLLTVLT (SEQ ID NO 47).
- MTPGTQSPFFLLLLLTVLT VVTG SEQ ED NO 59
- Proopiomelanocortin (adrenocorticotropin/ beta-lipofropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endo ⁇ hin) [Homo sapiens]. Accession number: XP_002485
- nucleic acid molecule encoding the nat-PSMGFRTC of SEQ ED NO: 37 ACGGGCACGGCCGGTACCATCAATGTCCACGACGTGGAGACACAGTTCAATCA GTATAAAACGGAAGCAGCCTCTCGATATAACCTGACGATCTCAGACGTCAGCGT GAGTGATGTGCCATTTCCTTTCTCTGCCCAGTCTGGGGCTGGGGTGCCAGGCTG GGGCATCGCGCTGCTGGTGCTGGTCTGTCTGTCTAT CTCATTGCCTTGGCTGTCTGTCAGTGCCGCCGAAAGAACTACGGGCAGCTGGAC ATCTTTCCAGCCCGGGATACCTACCATCCTATGAGCGAGTACCCCACCTACCAC ACCCATGGGCTATGTGCCCTAGCAGTACCGATCGTAGCCTATGAAACGGTGGCAGCAGCCTCTTACACAAACCCAGCAGTGGCA GCCGCTTCTGCCAACTTGTA
- nucleic acid molecule encoding the CM isoform of SEQ ID NO: 38:
- nucleic acid molecule encoding the UR isoform of SEQ ID NO: 39 ACGGCCGCTACCACAACCCCAGCCAGCAAGAGCACTCCATTCTCAATTCCCAGC CACCACTCTGATACTCCTACCACCCTTGCCAGCCATAGCACCAAGACTGATGCC AGTAGCACTCACCATAGCTCGGTACCTCCTCTCACCTCCTCCAATCACAGCACTT CTCCCCAGTTGTCTACTGGGGTCTCTTTCTTTTTCCTGTCTTTTCACATTTCAAAC CTCCAGTTTAATTCCTCTCTGGAAGATCCCAGCACCGACTACTACCAAGAGCTG CAGAGAGACATTTCTGAAATGTTTTTGCAGATTTATAAACAAGGGGGTTTTCTG GGCCTCTCCAATATTAAGTTCAGGCCAGGATCTGTGGTGGTACAATTGACTCTG GCCTTCCGAGAAGGTACCATCAATGTCCACGACGTGGAAAGCAGCCTCA GTATAAAACGGAAGCAGCCTCTCGATATAACCTGACGAAA
- nucleic acid molecule encoding the Y isoform of SEQ ID NO: 40 ACAGGTTCTGGTCATGCAAGCTCTACCCCAGGTGGAGAAAAGGAGACTTCGGC TACCCAGAGAAGTTCAGTGCCCAGCTCTACTGAGAAGAATGCTTTTAATTCCTC TCTGGAAGATCCCAGCACCGACTACTACCAAGAGCTGCAGAGACATTTCTG AAATGTTTTTGCAGATTTATAAACAAGGGGGTTTTCTGGGCCTCTCCAATATTA AGTTCAGGCCAGGATCTGTGGTGGTACAATTGACTCTGGCCTTCCGAGAAGGTA CCATCAATGTCCACGACGTGGAGACACAGTTCAATCAGTATAAAACGGAAGCA GCCTCTCGATATAACCTGACGATCTCAGACGTCAGCGTGAGTGATGTGCCATTT CCTTTCTCTGCCCAGTCTGGGGCTGGGGTGCCAGGCTGGGGCATCGCGCTGCTG GTGCTGGTCTGTTCTGGTTGCTGTTGCTGGTTGGTTGCT
- nucleic acid molecule encoding the full-length MUCl receptor of SEQ ID NO: 10:
- SAMs self-assembled monolayers
- Colloids were derivatized with SAMs and prepared for drug screening in a manner similar to that described in International Patent Publication No. WO 00/43791, published July 27, 2000, entitled “Rapid and Sensitive Detection of Aberrant Protein Aggregation in Neurodegenerative Diseases", inco ⁇ orated herein by reference.
- 1.5 ml of commercially available gold colloid (Auro Dye by Amersham) were pelleted by centrifugation in a microfuge on high for 10 minutes.
- the pellet was resuspended in 100 ⁇ L of the storage buffer (sodium citrate and tween-20). 100 ⁇ L of a dimethyl formamide (DMF) solution containing thiols. Following a 3-hour incubation in the thiol solution, the colloids were pelleted and the supernatant discarded. They were then heat cycled in 100 ⁇ L of 400 ⁇ M tri-ethylene glycol-terminated thiol in DMF for 2 minutes at 55°C, 2 minutes at 37°C, 1 minute at 55°C, 2 minutes at 37°C, then room temperature for 10 minutes. Heat cycling results in the elimination of any species that are not in the lowest energy confirmation, resulting in a stable, close-packed, self-assembled monolayer.
- the storage buffer sodium citrate and tween-20
- DMF dimethyl formamide
- Heat cycling can be carried out with any of a wide variety of self-assembled monolayer-forming species.
- the colloids were then pelleted and 100 ⁇ L lOOmM NaCl phosphate buffer were added.
- the colloids were then diluted 1:1 with 180 ⁇ M NiS0 in the colloid storage buffer.
- Thiols used in coating colloids typically were derived from solutions containing about 40 ⁇ M nitrilo tri-acetic acid (NTA)-thiol, and other thiols such as methyl-terminated thiol (HS-(CH2)15 CH3), 40% tri-ethylene glycol-terminated thiol, HS(CH 2 ) n (CH 2 CH2) 3 OH, (formula) and 50% poly (ethynylphenyl) thiol (C 16 H ⁇ oS).
- NTA nitrilo tri-acetic acid
- other thiols such as methyl-terminated thiol (HS-(CH2)15 CH3), 40% tri-ethylene glycol-terminated thiol, HS(CH 2 ) n (CH 2 CH2) 3 OH, (formula) and 50% poly (ethynylphenyl) thiol (C 16 H ⁇ oS).
- NTA nitrilo tri-acetic
- Example 1 Dimerization of the MGFR portion of the MUCl receptor triggers enhanced Cell Proliferation Consistent with the Mechanism Presented for MUCl Tumor Cells
- This example demonstrates the effect of dimerization on the MUCl receptor.
- a bivalent antibody was raised against either var-PSMGFR or nat-PSMGFR sequences shown in Table 1 (i.e., a single antibody having the ability to bind simultaneously to two MGFRs was produced).
- T47Ds MUCl tumor cells
- T47Ds MUCl tumor cells
- T47D (HTB-133) cells a human breast cancer cell line that overexpresses MUCl, were cultured to 30% confluency.
- An inventive antibody raised against the PSMGFR portion of the MUCl receptor i.e. an antibody to the MFGR (produced under contract with the inventors from nat-PSMGFR or var-PSMGFR peptide sequences supplied by the inventors by Zymed, San Francisco, California, USA), was added to cells at varying concentrations in a multi-well cell culture plate.
- As a negative control a second set of T47D cells was treated with an irrelevant antibody (anti-streptavidin). Prior to adding antibody, cells were counted (at time zero). All experiments were performed in triplicate. Cells were allowed to grow in a C0 2 incubator under normal conditions. Cells were counted using a hemacytometer (3 counts per well) at 24 hours and again at 48 hours.
- Results show that in a concentration-dependent manner, addition of antibody caused enhanced cell proliferation compared to the proliferation of the same cells treated with a control antibody.
- Figure 4 is a graph in which measured cell growth at 24 and 48 hours is plotted as a function of anti-MGFR concentration. At the optimal antibody concentration, when presumably one antibody binds bivalently to two MGFR portions of the MUCl receptor, i.e. dimerizes the receptor, cell proliferation is at a maximum.
- a concentration of the anti-MGFR antibody identified to maximize cell proliferation, was added to a first group of T47D tumor cells, grown as described above. The same amount of the anti-MGFR antibody was added to a set of confrol cells, K293 cells.
- FIG 5 shows that the addition of the anti-MGFR antibody to MUCl tumor cells (T47D) enhanced proliferation by 180% 24 hours, but had no effect on the control cells.
- the growth of the T47D cells plateaued to saturation, for cells with added antibody, at 48 hours. Control cells never reached saturation within the time frame of the experiment and were at 70% confluency at 48 hours.
- Example 2 Identification of Ligands that bind to the MGFR portion of the MUCl receptor
- synthetic, His-var-PSMGFR peptides In an effort to identify ligands to the MUCl receptor, synthetic, His-var-PSMGFR peptides,
- GTINVHDVETQFNQYKTEAASPYNLTISDVSVSDVPFPFSAQSGA ⁇ HHHHH (SEQ ED NO: 2), which is representative of the portion of the MUCl receptor, that remains attached to the cell surface after cleavage of the interchain binding region, were loaded onto NTA-Ni beads (cat. #1000630; available from Qiagen GmbH, Germany) and incubated with cell lysates in the presence (Fig. 9) or absence (Fig. 10) of the protease inhibitor PMSF (phenyl methyl sulfonyl fluoride). Lysates from T47D cells were used because this breast tumor cell line is known to overexpress MUCl and MUCl ligand(s).
- PMSF phenyl methyl sulfonyl fluoride
- T47D cells were cultured then sonicated for 1 minute to lyse the cells. Lysates were mixed with the PSMGFR peptide-presenting beads and incubated on ice with intermittent mixing for lhr. As a negative control, an irrelevant peptide, HHHHHHRGEFTGTYITAVT (SEQ ID NO: 13), was attached to NTA-Ni beads and treated identically. Both sets of beads were washed 2X with phosphate buffer pH 7.4. Bound protein species were eluted by 3 additions of lOOuL of phosphate buffer that also contained 250mM imidazole.
- Lanes were loaded as follows: (from left to right) (1) Benchmark pre-stained protein ladder (Gibco); (2) first eluate from the MUCl peptide; (3) 1/10* of TCA-concentrated sample; (4) blank; (5) 9/10 th TCA- concentrated sample; (6) first eluate negative confrol peptide; (7) 1/10* of TCA-concentrated sample from the negative control peptide; (8) 0.5 picomoles BSA (as a standard); (9) 9/10 th TCA- concentrated sample from the negative control peptide; (10) silver stain SDS page standard (BioRad cat. #1610314).
- Example 3 Demonstration that the Ligand That Interacts with MUCl Cancer Cells is a Multimer
- a ligand produced by MUCl cancer cells that triggers cell proliferation in these cells is a multimer.
- Protein bands at 17 kD, 23 kD, and 35 kD were excised from the gels described above in Example 2 of and submitted for peptide analysis. These gel bands purportedly contained ligands to the MGFR region of the MUCl receptor. Recall that the 17 kD and 23 kD species bound to the MGFR peptide in the presence of the protease inhibitor, PMSF, while the 35 kD species bound when PMSF was not added to the cell lysate mixture.
- NM23 Metastasis Inhibition Factor NM23, which has been implicated in both the promotion and inhibition of metastasis of human cancers. Whether the role of NM23 is a tumor supressor or promoter may depend on the type of cancer.
- NM23 overexpression has been linked to a more malignant phenotype (Schneider J, Romero H, Ruiz R, Centeno MM, Rodriguez-Escudero FJ, "NM23 expression in advanced and borderline ovarian carcinoma", Anticancer Res, 1996; 16(3A): 1197-202).
- breast cancer studies indicate that reduced expression of NM23 correlates with poor prognosis (Mao H, Liu H, Fu X, Fang Z, Abrams J, Worsham MJ, "Loss of nm23 expression predicts distal metastases and poorer survival for breast cancer", Int J Oncol 2001 Mar;18(3):587-91).
- Metastasis Inhibition Factor NM23 exists as a hexamer and may recognize an unmodified form of the MGFR portion of the MUCl receptor.
- Peptide sequences that were identified from the 35 kD gel band corresponded to more than one protein species, including 14-3-3, which is a signaling protein implicated in many cancers, and cathepsin D, which is a protease and is also implicated in tumor progression.
- Cathepsin D is a protease and may be involved in the cleavage of the MUCl receptor.
- a therapeutic strategy is to identify compounds that either interrupt the interaction of one of the ligands with the MGFR portion of the MUCl receptor, or to identify compounds that bind to and block the action of the ligand(s).
- TFIAIKPDGVQR (SEQ ID NO: 14)
- VM*LGETNPADSKPGTIR (SEQ ID NO: 15)
- VMLGETNPADSKPGTER (SEQ ED NO: 16) NELHGSDSVK (SEQ ID NO: 17)
- GLVGEIIK (SEQ ED NO: 19)
- AASDIAM*TELPPTHPIR (SEQ ID NO: 22)
- YLAEFATGNDR (SEQ ID NO: 23)
- VAGM*DVELTVEER SEQ ED NO: 26
- HLIPAANTGESK SEQ ID NO: 27
- the release of the MUC 1 IBR can be correlated to the progression of cancer.
- the following is a description of a whole cell assay that identifies drug candidates that affect cleavage state of these receptors.
- the screen also identifies drug candidates that directly or indirectly modulate any step, including but not limited to enzyme cleavage, receptor production, expression, stability, fransport or secretion, that ultimately results in a reduction of the self-aggregating portion of the receptor being shed and released from the cell.
- Tumor derived cells expressing a cell surface receptor of the type described above are cultured and treated with a drug candidate.
- a peptide aggregation assay is performed on the solution surrounding the cell.
- Colloids bearing a binding peptide e.g. an antibody against a constant region of the receptor, remote from the enzyme cleavage site (amino acid 425-479 for MUCl; numbers refer to Andrew Spicer et al, J. Biol. Chem Vol 266 No. 23, 1991 pgs. 15099-15109; these amino acid numbers correspond to numbers 985-1039 of Genbank accession number P15941; PID G547937), are added to the solution.
- the receptors in solution will aggregate and cause the attached colloids to aggregate, causing a visibly detectable change in the solution, for example: color change or the formation of visible aggregates.
- a visibly detectable change in the solution for example: color change or the formation of visible aggregates.
- An inhibition of this visible change indicates an agent that is effective for treating the disease state.
- the list of sequences in Table 1 is representative of sequence fragments that are, in certain instances, found within the overall sequence of the full-length peptide, or are fragments or variants thereof. Any set of, for example, at least 10 contiguous amino acids within any of the sequence fragments of Table 1 may be sufficient to identify the cognate binding motif.
- sequences of Table 1 is meant to embrace each single sequence and when mentioning fragment size, it is intended that a range embrace the smallest fragment mentioned to the full-length of the sequence (less one amino acid so that it is a fragment), each and every fragment length intended as if specifically enumerated. Thus, if a fragment could be between 10 and 15 in length, it is explicitly meant to mean 10, 11, 12, 13, 14, or 15 in length.
- the receptor can be cleaved at a number of different sites to generate peptide fragments with alternative beginnings and endings. For these fragments of Table 1 any stretch of, for example, 8 to 10 contiguous amino acids, either upstream or downstream, may be enough to identify the particular fragment that is the binding entity referred to herein.
- Example 5 Protocols for western blot analysis Cell Culture: All cell lines were obtained from ATCC (American Type Culture Collection) and were cultured according to ATCC recommendations accompanying cell lines. Cells used include [Applicant designation (ATCC No.)]: T-47D (HTB-133), 1500 (CRL-1500), 1504 (CRL-1504), HeLa (CCL-2), HEK-293 (CRL-17Q5), BT-474 (HTB-20), MDA-MB-453 (HTB-131).
- ATCC No. ATCC No.
- Lysate Preparation For cell lysate preparation, healthy cells were plated on 100mm culture treated dishes and incubated until cells were approximately 80-90%) confluent. Media was then removed and monolayers were washed twice with 5 ml cold PBS. Any remaining PBS was removed thoroughly. Cells were lysed by applying 1 ml of cold High Salt RJPA lysis buffer [400mM NaCl, 50mM Tris pH 8.0, 1% NP-40, 0.1% SDS, 0.5% Sodium Deoxycholate, lx Protease Inhibitor Cocktail (Roche Applied Sciences; Indianapolis, IN)] to the monolayer and incubating on ice for 5 minutes with occasional agitation. Cells were scraped off and lysate collected in 1.5 ml eppendorf tubes. Lysates were centrifuged at 10,000 ⁇ m and clear supernatants were removed, placed in new tubes, and stored at -20°C until use.
- Protein Concentrations Protein concentrations were obtained using the Pierce BCA Protein Assay
- Deglvcosylations Samples were deglycosylated using the Enzymatic Protein Deglycosylation Kit from Sigma (St. Louis, MO), which contains O-glycosidase, PNGase-F, and ⁇ -Neuraminidase enzymes, along with reaction and denaturing buffers. Each deglycosylation was performed using lOOug total protein from lysates, and enzymes and buffers were added per manufacturer's protocol accompanying the kit.
- SDS-PAGE electrophoresis was employed to separate lysate proteins. Cell lysates were thawed and samples were prepared with 50 ⁇ g of total protein diluted in appropriate SDS-loading buffer to a final volume of 60 ⁇ l. 15% polyacrylamide gels were used in order to separate the lower molecular weight bands for cleaved MUCl portions. Gels were electrophoresed in the BioRad Mini-Protean 3 (Hercules, CA).
- Membranes were then incubated in secondary antibody solution [1:20000 dilution of HRP(horseradish peroxidase)-conjugated Goat- ⁇ -Rabbit IgG antibody or HRP- conjugated Rabbit- ⁇ -Mouse IgG antibody (Jackson Immunoresearch; West Grove, PA) in Blotto] for 1 hour at room temperature. Solution was discarded and the membrane was washed 5 times for 10 minutes each in PBS-T. The membrane was then placed in a 1 : 1 mixture of Immun-Star HRP Luminol/Enhancer and Peroxide Buffer from BioRad Laboratories (Hercules, CA) for 5 minutes. Substrate was removed and membrane placed in saran wrap and exposed to film and developed in Kodak X-OMAT.
- Example 6 Transfectants: The construction of six mammalian expression plasmids encoding six different lengths of the Mucl receptor
- the pMucl-Full construct contains the complete cDNA for MUCl and encodes the full length Mucl protein ( Figure 38 and SEQ ED NO: 10).
- the pMucl-Full plasmid was put together from two separate plasmids containing different parts of the MUCl cDNA.
- the amino-terminus of MUCl was acquired from EST0039670 obtained from the Genome Research Center and the Center for Functional Analysis of Human Genome (GRC/CFAHG) Korea Research Institute of Bioscience and Biotechnology (Taejeon, Korea).
- the EST0039670 plasmid contained a cDNA starting at the amino-terminus of the MUCl open reading frame to about 800 base pairs into the tandem repeats segment of MUCl.
- the carboxy-terminus of the MUCl cDNA was obtained from Integrated Molecular Analysis of Genomes and their Expression (IMAGE) clone number 2428103 obtained from American Type Culture Collection (ATCC) (Manassas, VA).
- IMAGE Integrated Molecular Analysis of Genomes and their Expression
- ATCC American Type Culture Collection
- This plasmid contains the remaining 1300 base pairs of the tandem repeats through the carboxy-terminus of MUCl .
- the full length Mucl construct (Mucl-Full) was generated by restriction digesting the plasmid containing IMAGE 2428103 with Sail and subcloning into the Xhol digested EST0039670.
- the resulting sublcone, pESTMucl was confirmed by restriction digest and agarose gel electrophoresis and was found to have the expected size bands for the correctly constructed plasmid.
- the pESTMucl plasmid was used for subcloning into the mammalian expression vector pIRES2-GFP.
- the expression vector used for all of the MUCl constructs was pIRES2-EGFP from Becton Dickinson Clontech (Palo Alto, CA).
- This vector will express MUCl from a cytomegalo virus (CMV) early promoter.
- CMV cytomegalo virus
- This vector also contains an internal ribosome entry site (IRES) for expression of the green fluorescent protein (GFP) from the same message as MUCl.
- IRES internal ribosome entry site
- the expression vector, pIRES2-GFP was digested with EcoRI and Sail and gel purified. The two pieces of DNA were ligated to yield pMucl-Full, containing the full length MUCl protein encoded in the mammalian expression vector pERES2-EGFP.
- Subclones of the mammalian expression vector with the correct insert were selected for sequencing. The sequence confirmed the proper construction of the desired plasmid. All sequencing was carried out by GeneWiz Inc. (North Brunswick, NJ) Sequencing was done by PCR sequencing. All results were confirmed by comparison of sequences to the National Center for Biotechnology (NCBI) database.
- NCBI National Center for Biotechnology
- pMucl-Rep Encoding the Rep isoform
- the pMucl-Rep (Table 2: SEQ ED NO: 46) construct encodes a Mucl protein which has been amino terminally deleted ( Figure 1 - Table 1 : SEQ ED NO: 41).
- the Rep isoform is missing the amino terminus and only contains about half of the terminal repeats of MUCl.
- First pSP-Rep was generated by subcloning the PCR amplified signal peptide for MUC1 into the EST plasmid (IMAGE 2428103). The signal peptide of MUCl was subcloned at the amino-terminus to ensure expression of the protein in the plasma membrane.
- PCR amplification of the normal MUCl signal peptide from IMAGE clone number 4695020 was carried out using the primers in Table 6.
- the PCR product was digested with EcoRI and Xhol and subcloned into the EcoRI and Sail digested EST plasmid (IMAGE 2428103).
- the proper construction of the resulting subclone, pSP-Rep was confirmed by digestion and agarose gel electrophoresis.
- the pSP-Rep plasmid and pI ES2-GFP were digested with EcoRI and BamHl and ligated together.
- the correct construction of pMucl- Rep was confirmed by restriction digestion followed by gel electrophoresis. Sequencing also showed that the pMucl-Rep plasmid was made correctly.
- pMucl-UR Encoding the UR isoform
- pMucl-CM Encoding the CM isoform
- pMucl -PSMGFRTC Encoding the nat-PSMGFRTC isoform: These three constructs encode various amino terminal deletion isoforms of MUCl, carboxy terminal to the tandem repeats (see Figure 1.
- pMucl-UR (Table 2; SEQ ID NO: 44) encodes Table 1: SEQ ID NO: 39
- pMucl-CM Table 2: SEQ ID NO: 43
- pMucl-PMMGFRTC Table 2: SEQ ID NO: 42) encodes Table 1 SEQ NO: 37)).
- pMucl-UR encodes an isoform that contains from amino acid 981 to 1255 of MUCl.
- pMucl-CM encodes an isoform that contains from amino acids 1085 to 1255 of MUCl and encodes a peptide of 168 amino acids.
- pMucl -PSMGFRTC encodes a peptide from amino acid 1110 to amino acid 1255 of Mucl and will be 143 amino acids long. All three of these plasmids were constructed following the same procedure. First the signal peptide of MUCl was amplified by PCR from IMAGE clone number 4695020 using primers that each contained either a restriction site for EcoRI or Eagl.
- the carboxy- terminal portions of the constructs were amplified by PCR with primers that contained a Eagl or BamHl site.
- the primers used for PCR are listed in Table 6.
- the PCR products were digested with Eagl and then ligated.
- the ligation was amplified again by PCR using the EcoRI and BamHl containing primers used previously. This amplified the joined PCR products.
- the resulting DNA fragment was digested with EcoRI and BamHl and subcloned into p]RES2-EGFP that had been similarly digested.
- the size of the desired PCR products and plasmids were confirmed by agarose gel electrophoresis. Sequencing established that the correct plasmids had been created.
- pMucl-Y Encoding the Y isoform:
- the pMucl-Y plasmid encodes an alternately spliced form of MUCl (see Figure 1.
- pMucl-UR Table 2; SEQ ID NO: 45
- Table 1 SEQ ID NO: 40
- the cDNA of the Mucl-Y was obtained from IMAGE clone number 4695020. When this clone was sequenced it was found to contain an extra 9 amino acids. These were deleted by PCR.
- the front part of the Mucl-Y cDNA was amplified with a primer containing the restriction site EcoRI and a primer containing the AlwNI restriction site.
- the terminal part of Mucl-Y was amplified with a primer containing the AlwNI restriction site and a primer containing the restriction site BamHl. After AlwNI digestion of both PCR products the two fragments were ligated. The ligation was amplified again by PCR using the EcoRI and BamHl containing primers used previously. This amplified the joined PCR products. The resulting DNA fragment was digested with EcoRI and BamHl and subcloned into pIRES2-EGFP that had been similarly digested. The size of the desired PCR products and plasmids were confirmed by agarose gel elecfrophoresis. Sequencing established that the correct plasmid with the 9 amino acid deletion had been created.
- Mucl-CtermSP-XhoI 5'-GGTCTCGAGAACAACTGTAAGCACTGT-3' SEQ ID NO: 50
- Mucl-CtermSP-Eagl 5'-GGTCGGCCGTAACAACTGTAAGCACTGT-3' SEQ ID NO: 51
- Mucl-UR-Eagl 5'-GCACGGCCGCTACCACAACCCCAGCCAG-3' SEQ ED NO: 52
- Mucl-CM-Eagl 5'-GCACGGCCGGTTTTCTGGGCCTCTCCAA-3' SEQ ID NO: 53
- Muc 1 -PSMGFRTC-Eagl 5 '-GCACGGCCGGTACCATCAATGTCCACGAC-3 ' SEQ ED NO: 54
- cTerMuclBamHI 5'-GGGGGATCCTACAAGTTGGCAGAAGCGG-3' SEQ ID NO: 55
- PCR Polymerase chain reaction
- the PCR reaction contained 2ng plasmid DNA, IX Pfx amplification buffer, ImM MgS0 4 , 0.3 ⁇ l of each primer, 1.25 Units of Pfx polymerase, and 0.3 ⁇ M of each dNTP in a 50 ⁇ l reaction volume.
- PCR products were purified away from primers and buffers using Qiaquick PCR clean up kit form Qiagen. PCR products were treated this way before restriction digestion. All DNA restriction enzymes were purchased from New England BioLabs (Beverly, MA).
- Restriction digests were carried out as recommended by the manufacuter at 37°C in supplied reaction buffers.To purify DNA fragments, bands on agarose gels were visualized with ethidium bromide and cut out of the gel. The Qiaquick gel purifaction columns from Qiagen (Valencia, CA) were then used to purify the fragment following the recommended protocol of the manufacturer. Small quantities of plasmid DNA were prepared by alkaline lysis as outlined in
- DNA sequencing was done by PCR sequencing and was carried out by GeneWiz Inc.
- Example 7 Transfection of HEK293 cells enabled expression of MUCl isoforms on the surface of cells: The goal was to transfect HEK293 cells with various isoforms of the MUCl protein and have the protein expressed at the cell surface. HEK293 cells were transfected with MUCl isoforms and demonsfrated the expression of MUCl isoforms on the surface of the transfected cells.
- HEK 293 cells Human embryonic kidney (HEK) 293 cells were plated to yield 90% confluency. Lipofectamine 2000 from Invitrogen (Carlsbad, CA) was use to transfect the cell. The protocol from the manufacturer was followed. Both the DNA and Lipofectamine were diluted in serum and antibiotic free media. After 5 minutes the DNA and Lipofectamine were mixed and incubated for 30 minutes at room temperature. Cells were washed once with sterile lx PBS and then the transfection mixture was added to the cells. Cells were incubated with the DNA:Lipofectamine complexes for 4-6 hours before the media was changed to media containing 10% serum. These cells were then assayed 24 or 48 hours later for expression of MUCl isoforms. Stable cell lines were selected 48 hrs after transfection with 600 ⁇ g/ml Genetimicin (G418) from Invitrogen for 10 days.
- G418 Genetimicin
- Example 8 Polyclonal anti-PSMGFR Antibody Production: The sequence of the peptide used for immunication was GTINVHDVETQFNQYKTEAASPYNLTISDVSVSDVPFPFSAQSGA (var-PSMGFR SEQ ID NO: 7). Two rabbits were immunized using the PolyquickTM method, a proprietary commercially available technology. After four weeks bleeds were evaluated for PSMGFR specific antibodies. The rabbits received an additional boost of antigen two weeks before harvesting the antibody. The antibody was affinity purified using the peptide conjugated to a column support.
- Example 9 Production of monovalent antibody fragments: Antibody fragmentation of the polyclonal antibody as produced in Example 8 was performed using papain digestion by Maine Biotechnology Services Inc (Portand, ME). Fragmented antibody was purified from uncleaved antobody and Fc fragments. The cleavage reaction and purification was evaluated on SDS PAGE.
- Example 10 Evaluation of transfectants for MUCl isoform expression: To establish that the MUCl isoform transfectants expressed the protein on the surface of the cell, flow cytometry was carried out on the fransfected cells. The indirect staining protocol of the cells follows breifly below. One million cells were stained with the lmg of primary anti-PSMGFR antibody. The cells were then washed with lx PBS. The cells were then stained with a Phycoerythrin (PE)-labeled-Fab-fragment anti-rabbit secondary antibody from Jackson Laboratories. The cells were washed and stained with PL Flow cytometery was performed on the Becton Dickenson (Palo Alto, CA) FACS Calibur machine.
- PE Phycoerythrin
- Cell population were gated for live cells by forward and side scatter and propidium iodide (PI) negative staining.
- Cells were evaluated for levels of GFP, indicating a transfectant, and for PE, indicating MUCl staining.
- Transfectants stained for PSMGFR over the level of the vector control (data not shown). It was observed that the MUC1- PSMGFRTC and MUCl-Y constructs stained to higher levels compared to the other transfectants. A large portion of the other transfectants are GFP-low, possibly indicating low transfection levels.
- the cells were washed with lx PBS.
- the cells were fixed with 4% paraformaldehyde in lx PBS.
- the cover slips were then washed with lx PBS.
- anti-PSMGFR antibodies were added to the cover slips at 2ug/ml.
- the cover slips were washed again in lx PBS.
- Anti-rabbit tetramethyl rhodamine isothiocyanate (TRITC) labeled secondary antibody from Zymed was added to the cover slip after which they were washed in IxPBS.
- Nuclei were stained with 4',6-diamidino-2-phenylindole dihydrochloride hydrate (DAPI) from Sigma (StLouis, MO).
- the cover slips were placed on slides using Mounting Media. The cover slips were sealed with nail polish. The slides were viewed using the 60X objective of a Olympus LX70 microscope equipped with Delta Vision® microscope system Applied Precision (Issaquah, WA). Pictures were taken using SoftwoRx® software from Applied Precision. The resulting pattern of staining seen with the anti-PSMGFR antibody was characteristic of that for a protein localized to the surface of the cell.
- Example 11 The stimulatory/inhibitorv effects of bi- versus mono-valent anti- PSMGFR antibodies on cell proliferation: Reagents: * Serial dilutions of the ANTI-PSMGFR antibody produced as described in Examples 8 and 9 in serum free RPMI media (IX, 1/10 of IX, 1/50 ,1/250, 1/1000)
- Method 1. Place lOOul of media in the peripheral wells of a 96 well plate. Plate 6000 cells per well (in 100 ul volume of growth media containing 10 % serum) into the inside wells. 2. Next day, change media to 0.1%> serum growth media and incubate over night (12- 24 hours), except for BT474 cells where the media is changed to that containing 2.5%) serum. 3. Next Add antibody (lul per well) to the desired well, gently mix and put back in incubator. Antibodies were added every 24 hrs. For the tumor cell lines 1500, 1504 and BT474, antibody was added 5 times and the cells counted 24 hr after the last antibody addition. For the tumor cell line T47D antibody was added two or three times.
- Cells were plated in T75 vented flask in RPMI 1640 containing 10% fetal calf serum, Pen/Ste ⁇ , ImM sodium pyruvate, 0.5% glucose, and 0.15% sodium bicarbonate. In addition, cells were passaged 10 times prior to experiments. When ready, cells were plated on a 96-well plate (6000 cells per well in 100 ul media) in in RPMI 1640 containing 10%> fetal calf serum, Pen/Ste ⁇ , ImM sodium pyruvate, 0.5%> glucose, and 0.15% sodium bicarbonate and incubated for 24 h at 5% C02 and 37C.
- CRL-1500 cells were harvested 24 hours after the last antibody addition with 50 ul trypsin, and the number of cells per well was determined using a hemacytometer (3 wells counted per condition).
- the same protocol as described above for CRL-1500 cells was used for CRL-1504 cells.
- BT-474 (HTB-20) cells the protocol used was the same as that for the CRL-1500 cells with two exceptions: (1) The cells were cultured in ATCC Hybricare (Cat # 46-X) media supplemented with 10% fetal bovine serum and penicillin/streptomycin, and (2) during the experiment, the cells were cultured in the presence of 2.5 % serum or 5.0 % serum containing media as specified in the individual experiment.
- T47-D (HTB-133) cells the media used was RPMI 1640 supplemented with
- HEK293 (CRL-1705) cells were cultured in DMEM (BioWhittaker #BW12-640F) media supplemented with penicillin/streptomycin and 10% fetal bovine serum. The antibody experiments were carried out as described for the CRL-1500 cells.
- HEK293 (CRL-1705) cell transfectants were cultured in DMEM (BioWhittaker #BW12-640F media supplemented with penicillin/streptomycin, 10% fetal bovine serum and 600ug/ml geneticin (GibcoBRL #11101-011). The selecting drug geniticin was not added to the media during the experiment.
- % growth 100 X ⁇ Final cell count - Starting cell count ⁇ / Starting cell count
- Normalized % growth 100 X ⁇ Final cell count with or without antibody ⁇ /Final cell count without antibody.
- Example 12 Measurement of ERK2 phosphorylation state in breast tumor cells as a determinant of MGFR dimerization Human breast adenocarcinoma CRL-1500 cells were obtained form the American
- ATCC Type Culture Collection
- cells were immediately washed (2x) with ice- cold PBS and lysed using buffer (1% Triton X-100, 10% glycerol, 20 mM HEPES, pH 7.2, 100 mM NaCl, 1 mM phenylmethylsulfonyl fluoride, 10 ⁇ g/ml aprotinin, 10 ⁇ g/ml leupeptin, and 1 mM Na 3 VO .
- the cell lysate was incubated on a rotating plate for 15 minute and then centrifuged for 10 minutes (lOg) to remove the detergent-insoluble material.
- Equal amounts of protein (100 ⁇ g per lane) were mixed with SDS-PAGE sample buffer, boiled for 5 minutes, separated on 10% SDS-polyacrylamide gels, and then transferred to polyvinylidene difluoride membrane. The membrane was then blocked for 1 h at room temperature in Phosphate-buffered saline (PBS) containing 5% nonfat dry milk. The membrane was the incubated over night at 4 degrees with either anti-ERK2 or anti- ppERKl/2 antibody (Cell Signaling Technology Inc., Beverly, MA, USA) (diluted 1:1,000 in PBS with 0.5% milk).
- PBS Phosphate-buffered saline
- Immunoblots were washed with PBS once for 20 minutes and twice for 5 minutes, incubated with the secondary antibody conjugated with horseradish peroxidase (diluted 1 :20,000) for 1 hour, washed with PBS once for 20 minutes and twice for 5 minutes and visualized by chemiluminescence using enhanced chemiluminescence reagents (BioRad).
- Example 13 Colloid Assay for testing the Monovalent - Bivalent antibody competition
- Colloids were prepared as described above with 25 uM NTA thiol. Next, Histidine tagged PSMGFR peptide (e.g. His-var-PSMGFR SEQ ED NO:2) or control RGD peptide were bound to the colloid. In the wells of the microtiter plate, 55 ul phosphate buffer was added followed by 5 ul of 100 uM BSA (bovine serum albumin). Antibody/antibodies (minimum of lOul of undiluted stock, roughly 1 ug/ul) were then added to the wells and the contents mixed by pipetting. 30 ul of either the control RGD colloid or His-PSMGFR colloid was added next followed by mixing.
- BSA bovine serum albumin
- the invention relates to therapeutic methods for the treatment and prevention of cancer and related products. For instance, in one aspect the invention relates to a method for treating a subject having a cancer or at risk of developing cancer by administering to the subject an agent that reduces cleavage of a cell surface receptor IBR from a cell surface receptor.
- the invention specifically includes, also, the compound for use in the treatment or prevention of that particular condition, as well as use of the compound for the manufacture of a medicament for the treatment or prevention of that particular condition.
- all transitional phrases such as “comprising”, “including”, “carrying”, “having”, “containing”, “involving”, and the like are to be understood to be open-ended, i.e. to mean including but not limited to. Only the transitional phrases “consisting of and “consisting essentially of, respectively, shall be closed or semi-closed transitional phrases.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Pharmacology & Pharmacy (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Zoology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Nanotechnology (AREA)
- Gastroenterology & Hepatology (AREA)
- Animal Behavior & Ethology (AREA)
- Toxicology (AREA)
- Condensed Matter Physics & Semiconductors (AREA)
- Cell Biology (AREA)
- Crystallography & Structural Chemistry (AREA)
- Materials Engineering (AREA)
- General Physics & Mathematics (AREA)
- Composite Materials (AREA)
- Physics & Mathematics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Urology & Nephrology (AREA)
- Peptides Or Proteins (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
Description
Claims
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US10/570,010 US20060173171A1 (en) | 2003-08-26 | 2004-08-26 | Techniques and compositions for diagnosis and treatment of cancer (muci) |
| EP04782436A EP1660535A2 (en) | 2002-11-27 | 2004-08-26 | Techniques and compositions for the diagnosis and treatment of cancer (muc1) |
| AU2004267112A AU2004267112B2 (en) | 2000-11-27 | 2004-08-26 | Techniques and compositions for the diagnosis and treatment of cancer (MUC1) |
| JP2006524896A JP2007531505A (en) | 2002-11-27 | 2004-08-26 | Techniques and compositions for diagnosis and treatment of cancer (MUC1) |
| CA2537263A CA2537263C (en) | 2002-11-27 | 2004-08-26 | Techniques and compositions for the diagnosis and treatment of cancer (muc1) |
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US99606902A | 2002-11-27 | 2002-11-27 | |
| US49826003P | 2003-08-26 | 2003-08-26 | |
| US60/498,260 | 2003-08-26 |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US11/564,981 Continuation-In-Part US7558780B2 (en) | 2006-02-13 | 2006-11-30 | Minimal difference query and view matching |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US10/236,863 Continuation-In-Part US20030119834A1 (en) | 2001-09-05 | 2002-09-05 | Compositions and methods of treatment of cancer |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2005019269A2 true WO2005019269A2 (en) | 2005-03-03 |
| WO2005019269A3 WO2005019269A3 (en) | 2005-05-12 |
Family
ID=34555636
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2004/027954 Ceased WO2005019269A2 (en) | 2000-11-27 | 2004-08-26 | Techniques and compositions for the diagnosis and treatment of cancer (muc1) |
Country Status (5)
| Country | Link |
|---|---|
| EP (2) | EP2363410B1 (en) |
| JP (1) | JP2007531505A (en) |
| AU (3) | AU2009213107A1 (en) |
| CA (1) | CA2537263C (en) |
| WO (1) | WO2005019269A2 (en) |
Cited By (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2006105448A2 (en) | 2005-03-30 | 2006-10-05 | Minerva Biotechnologies Corporation | Proliferation of muc1 expressing cells |
| US20090092603A1 (en) * | 2007-09-25 | 2009-04-09 | Bamdad Cynthia C | Early diagnosis and treatment of drug resistance in muc1-positive cancer |
| US7700715B2 (en) | 2000-11-27 | 2010-04-20 | Minerva Biotechnologies Corporation | Diagnostic tumor markers, drug screening for tumorigenesis inhibition, and compositions and methods for treatment of cancer |
| WO2013038412A3 (en) * | 2011-09-15 | 2013-06-27 | Vaxil Bio Therapeutics Ltd. | Antibodies directed against signal peptides, methods and uses thereof |
| US8535944B2 (en) | 2009-06-11 | 2013-09-17 | Minerva Biotechnologies Corporation | Culturing embryonic stem cells, embryonic stem-like cells, or induced pluripotent stem cells with a Muc1 or Muc1* ligand |
| JP2016144450A (en) * | 2005-03-30 | 2016-08-12 | ミネルバ バイオテクノロジーズ コーポレーション | Identification of tumor associated cell surface antigen for diagnosis and therapy |
| EP2089423B1 (en) * | 2006-09-21 | 2016-10-26 | Vaxil Biotherapeutics Ltd. | Antigen specific multi epitope vaccines |
| US11560435B2 (en) | 2008-10-06 | 2023-01-24 | Minerva Biotechnologies Corporation | MUC1* antibodies |
| US11746159B2 (en) | 2015-02-10 | 2023-09-05 | Minerva Biotechnologies Corporation | Humanized anti-MUC1* antibodies |
| US11898160B2 (en) * | 2008-10-09 | 2024-02-13 | Minerva Biotechnologies Corporation | Method for maintaining pluripotency in cells |
| US11976295B2 (en) | 2011-10-17 | 2024-05-07 | Minerva Biotechnologies Corporation | Media for stem cell proliferation and induction |
| WO2024073726A3 (en) * | 2022-09-30 | 2024-05-23 | Dana-Farber Cancer Institute, Inc. | Personalized muc1-c induced pluripotent stem cell and dendritic cell based vaccines |
| US12049618B2 (en) | 2011-03-17 | 2024-07-30 | Minerva Biotechnologies Corporation | Method for making pluripotent stem cells |
| US12415868B1 (en) | 2020-06-26 | 2025-09-16 | Minerva Biotechnologies Corporation | Anti-NME antibody and method of treating cancer or cancer metastasis |
| US12491259B2 (en) | 2022-04-12 | 2025-12-09 | Minerva Biotechnologies Corporation | Anti-variable MUC1* antibodies and uses thereof |
Family Cites Families (36)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3854480A (en) | 1969-04-01 | 1974-12-17 | Alza Corp | Drug-delivery system |
| US4675189A (en) | 1980-11-18 | 1987-06-23 | Syntex (U.S.A.) Inc. | Microencapsulation of water soluble active polypeptides |
| US4452775A (en) | 1982-12-03 | 1984-06-05 | Syntex (U.S.A.) Inc. | Cholesterol matrix delivery system for sustained release of macromolecules |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| GB8607679D0 (en) | 1986-03-27 | 1986-04-30 | Winter G P | Recombinant dna product |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5075109A (en) | 1986-10-24 | 1991-12-24 | Southern Research Institute | Method of potentiating an immune response |
| AU612370B2 (en) | 1987-05-21 | 1991-07-11 | Micromet Ag | Targeted multifunctional proteins |
| AU631545B2 (en) | 1988-04-15 | 1992-12-03 | Protein Design Labs, Inc. | Il-2 receptor-specific chimeric antibodies |
| IL162181A (en) | 1988-12-28 | 2006-04-10 | Pdl Biopharma Inc | A method of producing humanized immunoglubulin, and polynucleotides encoding the same |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5133974A (en) | 1989-05-05 | 1992-07-28 | Kv Pharmaceutical Company | Extended release pharmaceutical formulations |
| US5859205A (en) | 1989-12-21 | 1999-01-12 | Celltech Limited | Humanised antibodies |
| ES2284161T3 (en) | 1990-01-12 | 2007-11-01 | Amgen Fremont Inc. | GENERATION OF XENOGENIC ANTIBODIES. |
| FR2668064B1 (en) * | 1990-10-23 | 1994-12-16 | Transgene Sa | PHARMACEUTICAL COMPOSITION FOR THE TREATMENT OR PREVENTION OF MALIGNANT TUMOR. |
| US5407686A (en) | 1991-11-27 | 1995-04-18 | Sidmak Laboratories, Inc. | Sustained release composition for oral administration of active ingredient |
| ES2301158T3 (en) | 1992-07-24 | 2008-06-16 | Amgen Fremont Inc. | XENOGENIC ANTIBODY PRODUCTION. |
| WO1995024929A2 (en) | 1994-03-15 | 1995-09-21 | Brown University Research Foundation | Polymeric gene delivery system |
| IL110464A0 (en) * | 1994-07-26 | 1994-10-21 | Univ Ramot | Novel proteins for the diagnosis, imaging, and therapy of human cancer |
| US6548643B1 (en) * | 1994-11-16 | 2003-04-15 | Austin Research Institute | Antigen carbohydrate compounds and their use in immunotherapy |
| EP0822830B1 (en) | 1995-04-27 | 2008-04-02 | Amgen Fremont Inc. | Human anti-IL-8 antibodies, derived from immunized xenomice |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5736152A (en) | 1995-10-27 | 1998-04-07 | Atrix Laboratories, Inc. | Non-polymeric sustained release delivery system |
| EP1137938A4 (en) | 1998-12-08 | 2003-03-19 | Smithkline Beecham Corp | Methods of screening for agonists and antagonists of the hdpxu17 receptor |
| CA2361013A1 (en) | 1999-01-25 | 2000-07-27 | Minerva Biotechnologies Corporation | Rapid and sensitive detection of aberrant protein aggregation in neurodegenerative diseases |
| AU9263101A (en) * | 2000-09-11 | 2002-03-26 | Donald W Kufe | Muc1 extracellular domain and cancer treatment compositions and methods derived therefrom |
| EP2241887B1 (en) | 2000-11-27 | 2015-01-14 | Minerva Biotechnologies Corporation | Diagnostics, drug screening and treatment for cancer |
| ES2353273T3 (en) * | 2000-12-26 | 2011-02-28 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | ANTI-CD28 ANTIBODIES. |
| US20050019324A1 (en) * | 2001-03-29 | 2005-01-27 | Wreschner Daniel H. | Peptides and antibodies to muc 1 proteins |
| EP1383802A4 (en) * | 2001-03-30 | 2005-08-03 | Univ California | MONOCATENARY ANTIBODIES AGAINST MUC-1 FOR TARGETING A TUMOR |
| CA2459583A1 (en) * | 2001-09-05 | 2003-03-13 | Minerva Biotechnologies Corporation | Compositions and methods of treatment of cancer |
| JP2005501887A (en) * | 2001-09-05 | 2005-01-20 | ミナーヴァ・バイオテクノロジーズ・コーポレーション | Compositions and uses thereof in the treatment of cancer |
| US6716627B2 (en) * | 2001-12-20 | 2004-04-06 | Isis Pharmaceuticals, Inc. | Antisense modulation of mucin 1, transmembrane expression |
| JP2006504630A (en) * | 2002-04-22 | 2006-02-09 | ダイアックス コーポレイション | Antibodies specific for mucin polypeptides |
| CA2491017A1 (en) * | 2002-07-03 | 2004-01-15 | Immunogen, Inc. | Antibodies to non-shed muc1 and muc16, and uses thereof |
| US8510225B2 (en) | 2004-09-01 | 2013-08-13 | Research In Motion Limited | Split channel authenticity queries in multi-party dialog |
-
2004
- 2004-08-26 EP EP10184859.6A patent/EP2363410B1/en not_active Expired - Lifetime
- 2004-08-26 CA CA2537263A patent/CA2537263C/en not_active Expired - Lifetime
- 2004-08-26 WO PCT/US2004/027954 patent/WO2005019269A2/en not_active Ceased
- 2004-08-26 EP EP04782436A patent/EP1660535A2/en not_active Withdrawn
- 2004-08-26 JP JP2006524896A patent/JP2007531505A/en active Pending
-
2009
- 2009-09-11 AU AU2009213107A patent/AU2009213107A1/en not_active Abandoned
-
2012
- 2012-12-07 AU AU2012261585A patent/AU2012261585A1/en not_active Abandoned
-
2016
- 2016-09-09 AU AU2016225927A patent/AU2016225927A1/en not_active Abandoned
Cited By (32)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7700715B2 (en) | 2000-11-27 | 2010-04-20 | Minerva Biotechnologies Corporation | Diagnostic tumor markers, drug screening for tumorigenesis inhibition, and compositions and methods for treatment of cancer |
| US8344113B2 (en) | 2000-11-27 | 2013-01-01 | Minerva Biotechnologies Corporation | Diagnostic tumor markers, drug screening for tumorigenesis inhibition, and compositions and methods for treatment of cancer |
| EP2526957A2 (en) | 2005-03-30 | 2012-11-28 | Minerva Biotechnologies Corporation | Proliferation of MUC1 expressing cells |
| EP1875244A4 (en) * | 2005-03-30 | 2010-03-03 | Cynthia C Bamdad | Proliferation of muc1 expressing cells |
| US10703821B2 (en) | 2005-03-30 | 2020-07-07 | Minerva Biotechnologies Corporation | Method for stimulating or enhancing proliferation of cells by activating the mucin 1 (MUC1) receptor |
| EP2527365A2 (en) | 2005-03-30 | 2012-11-28 | Minerva Biotechnologies Corporation | Proliferation of MUC1 expressing cells |
| US8859495B2 (en) | 2005-03-30 | 2014-10-14 | Minerva Biotechnologies Corporation | Methods for stimulating or enhancing proliferation of non-tumorous cells expressing MUC1 receptors |
| JP2008543276A (en) * | 2005-03-30 | 2008-12-04 | ミネルバ バイオテクノロジーズ コーポレーション | Proliferation of MUC1-expressing cells |
| EP2526957A3 (en) * | 2005-03-30 | 2013-02-20 | Minerva Biotechnologies Corporation | Proliferation of MUC1 expressing cells |
| EP2527365A3 (en) * | 2005-03-30 | 2013-02-20 | Minerva Biotechnologies Corporation | Proliferation of MUC1 expressing cells |
| WO2006105448A2 (en) | 2005-03-30 | 2006-10-05 | Minerva Biotechnologies Corporation | Proliferation of muc1 expressing cells |
| JP2013176387A (en) * | 2005-03-30 | 2013-09-09 | Minerva Biotechnologies Corp | Identification of tumor-related cell surface antigen for diagnosis and treatment |
| JP2016144450A (en) * | 2005-03-30 | 2016-08-12 | ミネルバ バイオテクノロジーズ コーポレーション | Identification of tumor associated cell surface antigen for diagnosis and therapy |
| US9487574B2 (en) | 2006-09-21 | 2016-11-08 | Vaxil Biotherapeutics Ltd. | Antigen specific multi epitope vaccines |
| EP2089423B1 (en) * | 2006-09-21 | 2016-10-26 | Vaxil Biotherapeutics Ltd. | Antigen specific multi epitope vaccines |
| US11179452B2 (en) | 2006-09-21 | 2021-11-23 | Vaxil Biotherapeutics Ltd. | Antigen specific multi epitope vaccines |
| US20090092603A1 (en) * | 2007-09-25 | 2009-04-09 | Bamdad Cynthia C | Early diagnosis and treatment of drug resistance in muc1-positive cancer |
| US11560435B2 (en) | 2008-10-06 | 2023-01-24 | Minerva Biotechnologies Corporation | MUC1* antibodies |
| US11898160B2 (en) * | 2008-10-09 | 2024-02-13 | Minerva Biotechnologies Corporation | Method for maintaining pluripotency in cells |
| US20250067746A1 (en) * | 2009-06-11 | 2025-02-27 | Minerva Biotechnologies Corporation | Methods for culturing stem and progenitor cells |
| US8535944B2 (en) | 2009-06-11 | 2013-09-17 | Minerva Biotechnologies Corporation | Culturing embryonic stem cells, embryonic stem-like cells, or induced pluripotent stem cells with a Muc1 or Muc1* ligand |
| US12049618B2 (en) | 2011-03-17 | 2024-07-30 | Minerva Biotechnologies Corporation | Method for making pluripotent stem cells |
| US12195728B2 (en) | 2011-03-17 | 2025-01-14 | Minerva Biotechnologies Corporation | Method for making pluripotent stem cells |
| WO2013038412A3 (en) * | 2011-09-15 | 2013-06-27 | Vaxil Bio Therapeutics Ltd. | Antibodies directed against signal peptides, methods and uses thereof |
| US9732153B2 (en) | 2011-09-15 | 2017-08-15 | Vaxil Biotherapeutics Ltd. | Antibodies directed against signal peptides, methods and uses thereof |
| US11976295B2 (en) | 2011-10-17 | 2024-05-07 | Minerva Biotechnologies Corporation | Media for stem cell proliferation and induction |
| US11897967B2 (en) | 2015-02-10 | 2024-02-13 | Minerva Biotechnologies Corporation | Humanized anti-MUC1* antibodies |
| US12006371B2 (en) | 2015-02-10 | 2024-06-11 | Minerva Biotechnologies Corporation | Humanized anti-MUC1* antibodies |
| US11746159B2 (en) | 2015-02-10 | 2023-09-05 | Minerva Biotechnologies Corporation | Humanized anti-MUC1* antibodies |
| US12415868B1 (en) | 2020-06-26 | 2025-09-16 | Minerva Biotechnologies Corporation | Anti-NME antibody and method of treating cancer or cancer metastasis |
| US12491259B2 (en) | 2022-04-12 | 2025-12-09 | Minerva Biotechnologies Corporation | Anti-variable MUC1* antibodies and uses thereof |
| WO2024073726A3 (en) * | 2022-09-30 | 2024-05-23 | Dana-Farber Cancer Institute, Inc. | Personalized muc1-c induced pluripotent stem cell and dendritic cell based vaccines |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2009213107A1 (en) | 2009-10-08 |
| EP1660535A2 (en) | 2006-05-31 |
| AU2016225927A1 (en) | 2016-10-20 |
| CA2537263A1 (en) | 2005-03-03 |
| CA2537263C (en) | 2017-05-30 |
| WO2005019269A3 (en) | 2005-05-12 |
| EP2363410B1 (en) | 2017-10-11 |
| JP2007531505A (en) | 2007-11-08 |
| EP2363410A1 (en) | 2011-09-07 |
| AU2012261585A1 (en) | 2013-01-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2016225927A1 (en) | Techniques and compositions for the diagnosis and treatment of cancer (MUC1) | |
| JP7064275B2 (en) | Identification of tumor-related cell surface antigens for diagnosis and treatment | |
| JP6516778B2 (en) | Diagnostic tumor markers, drug screening for inhibition of tumor formation, and compositions and methods for cancer treatment | |
| NZ578130A (en) | Genetic products differentially expressed in tumors and the use thereof | |
| WO2009042814A1 (en) | Early diagnosis and treatment of drug resistance in muc1-positive cancer | |
| JP6505031B2 (en) | Identification of tumor associated cell surface antigens for diagnosis and treatment | |
| US20060173171A1 (en) | Techniques and compositions for diagnosis and treatment of cancer (muci) | |
| DK2363410T3 (en) | ISOFORMER OF MUC1 | |
| AU2004267112B2 (en) | Techniques and compositions for the diagnosis and treatment of cancer (MUC1) | |
| AU2002243251A1 (en) | Diagnostics, drug screening and treatment for cancer |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 2004782436 Country of ref document: EP Ref document number: 2006524896 Country of ref document: JP |
|
| ENP | Entry into the national phase |
Ref document number: 2006173171 Country of ref document: US Kind code of ref document: A1 Ref document number: 2537263 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 10570010 Country of ref document: US Ref document number: 2004267112 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 2004267112 Country of ref document: AU Date of ref document: 20040826 Kind code of ref document: A |
|
| WWP | Wipo information: published in national office |
Ref document number: 2004267112 Country of ref document: AU |
|
| WWP | Wipo information: published in national office |
Ref document number: 2004782436 Country of ref document: EP |
|
| WWP | Wipo information: published in national office |
Ref document number: 10570010 Country of ref document: US |

