VACCINE AND COMPOSITIONS FOR THE PREVENTION AND TREATMENT OF NEISSERIAL INFECTIONS The invention was made with the support of NLH Grant No. 5UI9 AI43924 and Al
43924-05. The U.S. government has certain rights in the invention.
Claim of Priority This application is a continuation of U.S. Serial No. 10/665,990, filed 19 September 2003, which is a continuation-in-part application of U.S. Serial No.
10/621,184, filed July 15, 2003, which is a continuation-in-part application of U.S. Serial No. 10/066,551, filed January 31, 2002, which claims benefit under 35 U.S.C. 119(e) from U.S. Provisional Application Serial No. 60/266,070, filed January 31, 2001; U.S. Provisional Application Serial No. 60/310,356, filed August 6, 2001; and U.S. Provisional Application Serial No. 60/344,452, filed October 23, 2001 ; all of which are incorporated herein by reference.
Background of the Invention Neisseria gonorrhoeae is the causative agent ofthe disease gonorrhea. Approximately 300,000 women a year contract gonorrhea in the U.S. Worldwide, the number of women with this infection is in the millions. It is a major cause of infertility and pelvic inflammatory disease. It is also a major co-factor in the spread of H1N1. In men, gonococcal infection develops as an acute urethritis that is typically characterized by a purulent discharge that results as a consequence ofthe concurrent inflammatory response to infection. In women, gonococcal infection can develop as an ascending infection ofthe genital tract that can lead to an acute pelvic inflammatory disease, infertility, or ectopic pregnancy. High proportions of women, however, initially develop asymptomatic gonococcal infections, in contrast to N. gonorrhoeae infection in men. The mechanisms by which the gonococcus infects and invades the female genital tract are only beginning to be understood. Research has shown that gonococci are
capable of invading primary human epithelial cells derived from both the endo- and the ectocervix. These studies implied that the mechanism(s) used by the gonococcus to breech the cervical epithelium are distinct from those mechanisms used to invade the urethral epithelium of men and that several endocytic mechanisms appear to play a role in gonococcal invasion ofthe female genital tract. Neisseria meningitidis is one ofthe leading causes of bacterial meningitis worldwide, affecting mainly children and young adults. The genomic sequence of Neisseria meningitidis B and Neisseria meningitidis A has been published (see, for example, Tettelin et al., Science. 287. 1809-1815 (2000) and Parkhill et al, Nature. 404. 502-506 (2000), respectively). The rapid progression of meningococcal disease makes proper diagnosis and subsequent treatment often vital to the survival of infected individuals. If not properly diagnosed and treated, meningococcal infections can lead to shock and death within a matter of hours. Thus, better prevention, diagnosis and treatment of meningococcal infections would be invaluable. Currently there is no vaccine for the prevention of gonorrhea or for the treatment of meningococcal meningitis. Therefore, there is a need for an effective means to prevent or ameliorate neisserial infections. Summary of the Invention The present invention provides a polypeptide, polynucleotide, vaccine, and a method of vaccination effective to immunize a mammal against a neisserial infection, e.g., an infection caused by Neisseria gonorrhoeae or Neisseria meningitidis. Such immunization can prevent, ameliorate or reduce the incidence of gonorrhea and/or meningococcal infection in a human. The vaccine contains an immunogenic amount of a neisserial phosphohpase D (PLD) polypeptide in combination with a physiologically- acceptable, non- toxic vehicle. Examples of neisserial PLD include gonococcal PLDs, such as SEQ LD NO:4, SEQ LD NO: 14, SEQ ID NO: 16 and SEQ LD NO: 18, and meningococcal PLD such as SEQ LD NO:20. In addition, the invention provides a transgenic Neisseria bacterium comprising a disrupted pld gene wherein the bacterium has reduced phosphohpase D activity as compared to the phosphohpase D activity of a corresponding wild-type Neisseria. In one embodiment ofthe invention, the transgenic Neisseria bacterium is N. gonorrhoeae, e.g.,
N. gonorrhoeae strain 1291, N. gonorrhoeae strain FA1090, or N. gonorrhoeae strain MSI 1. In another embodiment ofthe invention, the transgenic Neisseria bacterium is N. meningitidis, e.g., a N. meningitidis encapsulated strain or a N. meningitidis acapsular mutant strain. The pld gene of a transgenic bacterium of the invention can be disrupted by mutagenesis, for example, by insertion mutagenesis, deletion mutagenesis, substitution mutagenesis, or a combination thereof. Such a transgenic bacterium may have reduced amounts of phosphatidic acid and choline as compared to a corresponding wild-type Neisseria. In one embodiment ofthe invention, the transgenic bacterium has reduced toxicity as compared to a corresponding wild-type Neisseria. As an example, the pld gene ofthe transgenic bacterium comprises a nucleic acid sequence such as SEQ ID ΝO:9, SEQ D NO: 13, SEQ ID NO: 15, SEQ LD NO: 17, SEQ LD NO: 19, or SEQ ID NO:32. Also provided herein is an isolated and purified polynucleotide comprising a pld gene from a Neisseria bacterium. In one embodiment, the polynucleotide is a N. gonorrhoeae sequence, e.g., SEQ LD ΝO:9, SEQ ID NO: 13, SEQ ID NO: 15, SEQ LD NO: 17 or SEQ LD NO:32. In another embodiment, the polynucleotide is a N. meningitidis sequence, e.g., SEQ LD NO: 19. The invention provides an isolated and purified polypeptide encoded by a nucleic acid sequence that is SEQ LD NO:9, SEQ LD NO: 13, SEQ LD NO: 15, SEQ LD NO: 17, SEQ LD NO: 19 or SEQ ID NO:32. In addition, the invention provides an isolated and purified polypeptide comprising phosphohpase D from a Neisseria bacterium, such as polypeptides including SEQ LD NO:4, SEQ ID NOJ4, SEQ LD NOJ6, SEQ LD NOJ8 or SEQ ID NO:20. The invention provides a vaccine comprising an immunogenic amount of a PLD polypeptide from Neisseria, for example, a polypeptide encoded by SEQ ID NO:9, SEQ LD NO: 13, SEQ LD NO: 15, SEQ ID NO: 17, SEQ ID NO: 19 or SEQ ID NO:32, which amount is effective to immunize a patient against a neisserial infection, in combination with a physiologically-acceptable, non-toxic vehicle. A vaccine ofthe invention may also include an effective amount of an immunological adjuvant. In one embodiment, the PLD
polypeptide is conjugated or linked to a second peptide. In another embodiment, the PLD polypeptide is conjugated or linked to a polysaccharide. The invention also provides a method of protecting a patient against Neisseria colonization or infection, for example, a Neisseria gonorrhoeae and/or Neisseria meningitidis colonization or infection, comprising administering to the patient an effective amount of a vaccine comprising an immunogenic amount of a PLD polypeptide from Neisseria, which amount is effective to immunize a susceptible patient against a neisserial infection, in combination with a physiologically-acceptable, non-toxic vehicle. For example, the PLD polypeptide may be encoded by a polynucleotide comprising SEQ LD NO:9, SEQ LD NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ LD NO: 19 or SEQ LD NO:32. Such a vaccine may also contain an immunological adjuvant. The PLD can also be conjugated or linked to a second peptide or a polysaccharide. The vaccine can be administered orally, mucosally or by subcutaneous or intramuscular injection. Also provided is a method of preventing infection or colonization of Neisseria in a patient, e.g., Neisseria gonorrhoeae and/or Neisseria meningitidis, by administering to the patient a compound that inhibits bacterial phosphohpase D, e.g., neisserial PLD. In one embodiment, the compound is an antibody specific for a neisserial PLD. Also provided is an anti-neisserial PLD antibody. Brief Description of the Figures The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment ofthe necessary fee. FIG. 1. Anti-CR3 antibodies inhibit gonococcal attachment and invasion of CR3- transfected CHO cells. CHO-CR3 cell monolayers were pretreated with antibodies to the CR3 alpha subunit CDI lb (H5A4, Bearl) or CD18 (anti-CD18, L 4) or anti-CD18 antibody and an anti-CD 18 blocking peptide as outlined in the text. Antibody-treated cell monolayers were challenged for two hours with gonococci prior to gentamicin addition, cervical cell lysis, and plating of serial dilutions to determine colony- forming units. Gentamicin treatment was omitted from attachment assays. Percent inhibition was determined as a normalized function ofthe ability of gonococci to adhere to or invade
CHO-CR3 cells in the absence of antibody. Values given are the mean values of at least three trials. A Kruskal-Wallis analysis of variance was used to determine the statistical significance ofthe invasion assays, p-values were less than 0.05 for all ofthe antibodies tested alone. FIG. 2. Anti-CR3 antibodies inhibit gonococcal invasion of primary cervical cells. Invasion of primary, human, ecto- and endocervical cell monolayers by gonococci was performed as outlined in the text. Antibodies H5A4 and Bearl recognize the CR3 alpha subunit, CDI lb. Anti-CD 18 and L 4 are specific for the CR3 beta subunit, CD 18. Inhibition of invasion was determined as a normalized function ofthe ability of gonococci to invade primary ecto- and endocervical cells in the absence of antibody. Values given are the mean values of at least three trials. A Kruskal-Wallis analysis of variance was used to determine the statistical significance ofthe invasion assays, p- values were less than 0.05 for all ofthe antibodies tested. FIG. 3. The effect of Clostridium C3 neurotoxin on the invasion of primary cervical cells by N. gonorrhoeae. The ability of gonococci to invade primary ecto- and endocervical cells was determined as outlined in the text. Invasion was determined as a proportion ofthe original infection inoculum. Values given are the mean values of three trials. A Kruskal-Wallis analysis of variance was used to determine the statistical significance of percent invasion with C3 toxin in comparison to percent invasion without C3 toxin treatment, p-values were 0.05 for each assay. FIG. 4. Laser scanning confocal microscopy (LSCM) demonstrates that the characteristic cytokeratin staining pattern ofthe tissue biopsies has been retained in the respective primary cervical epithelial cell cultures. Sectioned tissue biopsies and primary cervical epithelial cell monolayers were incubated with a FITC-conjugated antibody to the noted specific cytokeratin. Ethidium bromide was used to counter-stain the tissue sections. Endocervical cells labeled intensely with antibody 8J2, which is specific for type I cytokeratins 13, 15, and 16 (panel A). The labeling of endocervical cells with an antibody specific for type II cytokeratin 4 (panel C) was considerably less intense, and it was not uniformly distributed. Ectocervical cells labeled positive with an antibody specific for cytokeratins 13, 15, and 16 (panel B) and cytokeratin 4 (panel D).
FIG. 5. Scanning electron microscopy (SEM) analysis shows the predominant changes that occur in the cervical cell membrane over the course of a three hour infection as the result of cervical epithelial cell-gonococcal interactions. At early (0 to 60 minutes) phases of infection N. gonorrhoeae could be found on the surface of endocervical cells either associated with microvilli (A) or undergoing an endocytic process (B). As the infection process continued, microvilli appeared to acquire directionality. Filopodia/lamellipodia became evident after thirty minutes post infection (C). Bacteria appeared to be in the process of internalization (D). Loss of microvilli with a smoothing ofthe cervical cell membrane around the periphery of some sites of gonococcal infection also became evident at approximately thirty minutes post infection (E). Membrane ruffles (F, endocervical; G, ectocervical) appeared at sixty minutes, and they became prevalent at ninety minutes post infection. Ruffles could be induced to occur at approximately thirty minutes post infection with use of a primed infection inoculum (see Example 1) (G). A visible smoothing ofthe cervical cell membrane encircling membrane ruffles can be seen (H). By three hours post infection large ruffles could readily be observed. FIG. 6. Bright-field light microscopy (BFLM) and immuno-transmission electron microscopy (TEM) studies demonstrate ruffling ofthe cervical surface and invasion of the primary cervical epithelial cells at ninety minutes and three hours post infection. For TEM analysis, bacteria were labeled with an antibody specific to the gonococcal surface protein, H.8; cervical cells were labeled with a polyclonal antibody to actin. 30 nm and 10 nm gold bead antibody-conjugates were used to label the bacteria- and host-specific primary antibodies, respectively. Membrane protrusions can be seen that are labeled with actin and that are encompassing gonococci at ninety minutes after the onset of infection (A). Bacteria can also be seen entering the cervical cell as individual entities in actin- lined, spacious vacuoles (B). Large membrane ruffles can be seen associating with gonococci at three hours post infection C and D). For BFLM (D) thick (1 μm) paraffin sections of endocervical cells were stained with hematoxylin and eosin. Arrows denote bacteria. Bar = 2 μm. FIG. 7. This figure shows TEM studies of cervical biopsies from women with gonococcal cervicitis. Panels A and B demonstrate cytoskeletal changes and membrane
ruffling occur during naturally acquired gonococcal infection. Panel A and panel B show large and small membrane protrusions associated with gonococci (designated by arrows) that are similar to those seen in figure 6. FIG. 8. Differential interference contrast (DIC) and LSCM analysis demonstrate co-localization of N. gonorrhoeae 1291 -green with a concentrated accumulation ofthe actin-associated protein, vinculin. In panel A, vinculin was immunolabeled with a TRITC-conjugated antibody and in a colored version of this figure was visible as a red fluorescence (A); in panel B, bacteria were transformed with green fluorescent protein (GFP) and in a colored version of this figure were visible as a green fluorescence. (C) In a merged image of panels A and B, arrows denote co-localization of bacteria with vinculin, which was visualized in a colored version of this figure as a yellow-orange because ofthe combined signal ofthe individual fluorophores. (D) Merged LSCM and DIC image (ofthe ectocervical cells). Similar results were seen with endocervical cells and for the actin-associated proteins ezrin and myosin, but the focal accumulation of a- actinin and talin was less pronounced. No accumulation of actin-associated proteins was observed in uninfected (control) cervical epithelial cells. Magnification, X20. FIG. 9. Neisseria gonorrhoeae co-localizes with CR3 in vivo. Cryosections of a clinical biopsy derived from a women with documented gonococcal cervicitis were immunolabeled with anti-CD 18 (visible as a green fluorescence) and 2C3 (specific for gonococcal H.8 outer membrane protein, visible as a red fluorescence) antibodies. Co- localization of CR3 with gonococci occurs as a yellow fluorescence because ofthe combined signal ofthe two fluorophores. A) 63X oil B) 5X zoom image ofthe area designated by the white box in A. Co-localization is confirmed as a profile plot ofthe area designated by the red line where the individual fluorescence of each fluorophore is recorded and plotted, individually, by the viewing system. C) Areas of confirmed co- localization are observed where the peaks ofthe lines ofthe graph overlap. FIG. 10. Bacterial products that are released with gonococcal infection. FIG. 11. Proteomic analysis of gonococcal products released upon infection of primary cervical epithelia. FIG. 12 depicts a coomassie-stained polyacrylamide gel showing that the gonococcal products released from a cervical cell infection are not released with an
infection of male urethral cells. Supernatants were obtained from 90 minute and 3 hour infections of ecto- and endocervical cells. FIG. 13 depicts histograms from quantitative association and invasion assays that show that PLD-deficient gonococci are impaired in their adhere to and to invade primary cervical cells. FIG. 14 depicts photographs from confocal microscopy showing that PLD- deficient gonococci are impaired in their ability to elicit increased levels of CR3 surface expression on primary cervical cells. CR3 (CD 18, CR3 β-subunit) was immunolabeled with a TRITC-conjugated antibody and is visible as a red fluorescence; gonococci were immunolabeled with an antibody to the highly conserved outer membrane protein, H.8. Application of a FITC-conjugated secondary antibody allowed visualization of gonococci as a green fluorescence. Co-localization of CR3 with gonococci occurs as a yellow fluorescence because ofthe combined signal ofthe two fluorophores. Magnification 60x. FIG. 15 depicts histograms showing surface level expression of CR3 on primary cervical cells. Wild-type gonococci cells (1291-WT), but not PLD-deficient gonococci (1291ΔPLD) elicit increased levels of CR3 surface expression. The antibody used was H5A4 (α-I-domain) diluted 1/400. FIG. 16. To determine if gonococcal PLD plays a role in the cytoskeletal rearrangements leading to membrane ruffling ofthe cervical epithelium, scanning electron microscopy (SEM) was performed. SEM analysis demonstrated that aberrant cytoskeletal rearrangements occur upon infection of cervical epithelia with PLD-mutant gonococci when compared to infection with wild-type gonococci. Endocytosis mediated by CR3 requires receptor clustering. The absence of bacterial clusters in electro graphs taken of mutant gonococci at 3 hours post-infection (upper panel) may be reflective ofthe inability of these bacteria to elicit up-regulation of CR3 or of their inability to initiate signaling cascades required for CR3 clustering. Similarly, the absence of membrane ruffles (lower panel) in PLD infected cells suggests gonococcal PLD may be required to potentiate the cytoskeletal rearrangements required to form membrane ruffles. These processes are restored when assays are performed with PLD-mutant gonococci in the presence of primed wild-type supernatants. No observable differences between mutant or wild-type gonococci were noted in the ability of gonococci to interact with each other or
with cervical cells at earlier points of infection. Electrographs shown in the lower panel correspond to the respective boxed areas shown in the upper panel. Magnification: A) x Ik, B) x 1.1 k C) 800k D) x 9k, E) x 10k, and F) x 15k. FIG. 17 depicts Western blots of primary cervical cells infected with wild-type gonococci (1291-WT) (A, C) and PLD-deficient gonococci (1291ΔPLD) (B, D).
Cervical cell lysates were harvested at variable times post-infection (A and C: lane 1 (0 minutes), lane 2 (five minutes), lane 3 (10 minutes), lane 4 (15 minutes), lane 5 (30 minutes), lane 6 (45 minutes), lane 7 (60 minutes), lane 8 (90 minutes), lane 9 (2 hours), lane 10 (2.5 hours), lane 11 (3 hours), lane 12 (4 hours); B and D: lane 1 (4 hours), lane 2 (3 hours), lane 3 (2.5 hours), lane 4 (2 hours), lane 5 (90 minutes), lane 6 (60 minutes), lane 7 (45 minutes), lane 8 (30 minutes), lane 9 (15 minutes), lane 10 (10 minutes), lane 11 (five minutes), lane 12 (0 minutes)). Blots were probed with antibodies specific for phosphorylated tyrosine (A, B) or threonine target residues (C, D). FIG. 18 depicts multiplex RT-PCR for analysis of cytokine cDNA in primary human cervical cells. Lane 1 is DNA from uninfected primary cells (endo- or ectocervical (as noted)); lane 2 is primary cells infected with wild- type gonoccocal cells (1291) and lane 3 is primary cells (endo- or ectocervical (as noted)) infected with PLD- deficient gonoccocal cells (1291 PLD mutant). FIG. 19 depicts multiplex RT-PCR for cytokine cDNA analysis in secondary bronchial epithelial cells. Lane 1 is DNA from uninfected bronchial epithelial cells; lane 2 is bronchial epithelial cells infected with wild-type Neisseria meningitidis type B (NMB WT) and lane 3 is bronchial epithelial cells infected with PLD-deficient Neisseria meningitidis type B (NMB PLD mutant). FIG. 20 depicts histograms showing that tyrosine kinase activation partially rescues phenotypic PLD-deficiency observed with N. gonorrhoeae infection of primary cervical cells. FIG. 21 depicts histograms showing that protein kinase C activation rescues phenotypic PLD-deficiency observed with N. gonorrhoeae infection of primary cervical cells. FIG. 22 shows that gonococcal products released with cervical cell infection are not released with infection of male urethral cells. Analysis of infection supernatants
demonstrated that gonococcal products are released upon infection of cervical epithelia. Similar results are observed upon analysis of supernatants obtained from 90 minute and 3 hour infections, from pex (A) and pen (B) cells, and from these same cells obtained from different tissue donors. An identical protein pattern is observed with N. gonorrhoeae strains 1291 (shown), FA1090, or MSI 1 indicating protein release is not strain- dependent. To determine if gonococcal proteins released upon cervical infection were specific to cervical cell invasion, these studies were repeated using male urethral epithelial cells. Autoradiography revealed that, while a minimal amount of protein products is released by 90 minutes post-infection, these proteins are not present by 3 hours of infection of uec (C). Collectively, these data suggest that a small basal level of gonococcal products are released constitutively, but, also that the continued release of gonococcal products was specific to gonococcal cervicitis. Western Blot analysis failed to reveal the presence of gonococcal LOS in culture supernatants, indicating the protein products identified were not present as the result of bacterial lysis (D). These data demonstrate the exquisite ability ofthe gonococcus to sense its extracellular environment and modify its pathogenicity accordingly. Lanes: CI) gonococci incubated in tissue culture dishes devoid of cervical cells, C2) uninfected cervical cells, C3) 90 minutes infection of uec, C4) 3 hours infection of uec, Dl) 3 hours infection of pen cells, D2) 90 minutes infection of pen, D3) uninfected pen cells, and D4) N. gonorrhoeae LOS. FIG. 23. RT-PCR analysis demonstrates that endogenous cervical cell PLD activity does not account for the observed increased in total PLD activity in gonococci infected cervical cell. Lanes: 1) uninfected pex or pen cells, 2) 3 hours infection of pex or pen cells with wild-type N. gonorrhoeae strain 1291, and 3) 3 hours infection of pex or pen cells with N. gonorrhoeae strain 1291ΔPLD.
Detailed Description ofthe Invention Definitions As used herein, "disrupted pld gene" or "disrupted gene" refers to an insertion, substitution, or deletion either in the gene encoding phosphohpase D or in the vicinity of the gene, i.e., upstream (5') or downstream (3') ofthe gene, which results in the reduction ofthe biological activity or the loss of substantially all ofthe biological activity
associated with the gene's product. For example, a disrupted pld gene would be unable to express a protein having substantial phosphohpase D activity. By disrupting a neisserial pld gene, neisserial phosphohpase D synthesis and/or function, e.g., enzymatic activity related to PLD such as the catalysis of phosphohpase D-related hydrolysis and/or phosphatidyl-transferase reactions, is reduced, e.g., inhibited, as compared to wild-type biological activity. Methods for measuring PLD activity are known in the art. The synthesis and/or function of a pld gene can be inhibited by any one of a number of methods known to the art, for example, by administration of chemical inhibitors of protein synthesis, by site-directed mutagenesis, by antisense methodology or using siRNA techniques. For example, PLD synthesis and/or function can be inhibited by the
"disruption" of a gene encoding a neisserial PLD, e.g., by insertion, substitution and/or deletion, in the pld gene or in a gene in the vicinity, i.e., either upstream (5') or downstream (3') of the pld gene, which results in the reduction ofthe biological activity or the loss of substantially all ofthe biological activity associated with the gene's product. As used herein, the term "neisserial PLD" includes homologs, variants or biologically active or inactive fragments of PLD from any Neisserial spp., e.g., N. gonorrhoeae or PLD from N. meningitidis. A "variant" ofthe polypeptide is a neisserial protein that is not completely identical to a native neisserial protein. A variant neisserial protein can be obtained by altering the amino acid sequence by insertion, deletion or substitution of one or more amino acid. The amino acid sequence ofthe protein is modified, for example by substitution, to create a polypeptide having substantially the same or improved qualities as compared to the native (i.e., wild type) polypeptide. The substitution may be a conserved substitution. A "conserved substitution" is a substitution of an amino acid with another amino acid having a similar side chain. A conserved substitution would be a substitution with an amino acid that makes the smallest change possible in the charge ofthe amino acid or size ofthe side chain ofthe amino acid (alternatively, in the size, charge or kind of chemical group within the side chain) such that the overall peptide retains its spacial conformation but has altered biological activity. For example, common conserved changes might be Asp to Glu, Asn or Gln; His to Lys, Arg or Phe; Asn to Gln, Asp or Glu and Ser to Cys, Thr or Gly. Alanine is commonly used to substitute for other amino acids. The 20 essential amino acids can be grouped as
follows: alanine, valine, leucine, isoleucine, proline, phenylalanine, tryptophan and methionine having nonpolar side chains; glycine, serine, threonine, cystine, tyrosine, asparagine and glutamine having uncharged polar side chains; aspartate and glutamate having acidic side chains; and lysine, arginine, and histidine having basic side chains. Stryer, L. Biochemistry (2d edition) W. H. Freeman and Co. San Francisco (1981), p. 14- 15; Lehninger, A. Biochemistry (2d ed., 1975), p. 73-75. It is known that variant polypeptides can be obtained based on substituting certain amino acids for other amino acids in the polypeptide structure in order to modify or improve biological activity. For example, through substitution of alternative amino acids, small conformational changes may be conferred upon a polypeptide that result in increased bioactivity. Alternatively, amino acid substitutions in certain polypeptides may be used to provide residues that may then be linked to other molecules to provide peptide- molecule conjugates that retain sufficient properties ofthe starting polypeptide to be useful for other purposes. One can use the hydropathic index of amino acids in conferring interactive biological function on a polypeptide, wherein it is found that certain amino acids may be substituted for other amino acids having similar hydropathic indices and still retain a similar biological activity. Alternatively, substitution of like amino acids may be made on the basis of hydrophilicity, particularly where the biological function desired in the polypeptide to be generated in intended for use in immunological embodiments. The greatest local average hydrophilicity of a protein, as governed by the hydrophilicity of its adjacent amino acids, correlates with its immunogenicity. U.S. Patent 4,554,101. Accordingly, it is noted that substitutions can be made based on the hydrophilicity assigned to each amino acid. In using either the hydrophilicity index or hydropathic index, which assigns values to each amino acid, substitutions may be conducted, for example, where these values are ±2, ± 1 or ±0.5. The variant neisserial protein comprises at least seven amino acid residues, preferably about 20 to about 2000 residues, and more preferably about 50 to about 1000 residues, and even more preferably about 80 to about 200 residues, wherein the variant neisserial protein has at least 50%, preferably at least about 80%, and more preferably at
least about 90% but less than 100%, contiguous amino acid sequence homology or identity to the amino acid sequence of a corresponding native neisserial protein. The amino acid sequence ofthe variant neisserial protein corresponds essentially to the native neisserial protein amino acid sequence. As used herein "correspond essentially to" refers to a polypeptide sequence that will elicit a protective immunological response substantially the same as the response generated by native neisserial protein. Such a response may be at least 60% ofthe level generated by native neisserial protein, and may even be at least 80% ofthe level generated by native neisserial protein. An immunological response to a composition or vaccine is the development in the host of a cellular and/or antibody-mediated immune response to the polypeptide or vaccine of interest. Usually, such a response consists ofthe subject producing antibodies, B cell, helper T cells, suppressor T cells, and/or cytotoxic T cells directed specifically to an antigen or antigens included in the composition or vaccine of interest. A variant ofthe invention may include amino acid residues not present in the corresponding native neisserial protein, or may include deletions relative to the corresponding native neisserial protein. A variant may also be a truncated "fragment" as compared to the corresponding native neisserial protein, i.e., only a portion of a full- length protein. Neisserial protein variants also include peptides having at least one D- amino acid. The neisserial protein ofthe present invention may be expressed from an isolated nucleic acid (DNA or RNA) sequence encoding the neisserial protein. Amino acid changes from the native to the variant neisserial protein may be achieved by changing the codons ofthe corresponding nucleic acid sequence. "Recombinant" is defined as a peptide or nucleic acid produced by the processes of genetic engineering. It should be noted that it is well-known in the art that, due to the redundancy in the genetic code, individual nucleotides can be readily exchanged in a codon, and still result in an identical amino acid sequence. The terms "protein," "peptide" and "polypeptide" are used interchangeably herein. The neisserial protein as described above may be operably linked to an amino acid sequence for a therapeutic agent. An amino acid or nucleic acid is "operably linked" when it is placed into a functional relationship with another amino acid or nucleic acid
sequence. For example, DNA a pre-sequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a pre-protein that participates in the secretion ofthe polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription ofthe sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation. Generally, "operably linked" means that the amino acid or nucleic acid sequences being linked are contiguous, and, in the case of a secretory leader in DNA, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice. The term "nucleic acid" refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form, composed of monomers (nucleotides) containing a sugar, phosphate and a base which is either a purine or pyrimidine. Unless specifically limited, the term encompasses nucleic acids containing known analogs of natural nucleotides which have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) and complementary sequences as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed- base and/or deoxyinosine residues (Batzer et al., Nucl. Acids Res.J9:508 (1991); Ohtsuka et al., JBC, 260:2605 (1985); Rossolini et al., Mol. Cell. Probes. 8:91 (1994)). A "nucleic acid fragment" is a fraction of a given nucleic acid molecule. Deoxyribonucleic acid (DNA) in the majority of organisms is the genetic material while ribonucleic acid (RNA) is involved in the transfer of information contained within DNA into proteins. The term "nucleotide sequence" refers to a polymer of DNA or RNA which can be single- or double-stranded, optionally containing synthetic, non-natural or altered nucleotide bases capable of incorporation into DNA or RNA polymers. The terms "nucleic acid", "nucleic acid molecule", "nucleic acid fragment", "nucleic acid sequence or segment", or
"polynucleotide" may also be used interchangeably with gene, cDNA, DNA and RNA encoded by a gene. The invention encompasses isolated or substantially purified nucleic acid or protein compositions. In the context ofthe present invention, an "isolated" or "purified" DNA molecule or an "isolated" or "purified" polypeptide is a DNA molecule or polypeptide that exists apart from its native environment and is therefore not a product of nature. An isolated DNA molecule or polypeptide may exist in a purified form or may exist in a non-native environment such as, for example, a transgenic host cell. For example, an "isolated" or "purified" nucleic acid molecule or protein, or biologically active portion thereof, is substantially free of other cellular material, or culture medium when produced by recombinant techniques, or substantially free of chemical precursors or other chemicals when chemically synthesized. In one embodiment, an "isolated" nucleic acid is free of sequences that naturally flank the nucleic acid (i.e., sequences located at the 5' and 3' ends ofthe nucleic acid) in the genomic DNA ofthe organism from which the nucleic acid is derived. For example, in various embodiments, the isolated nucleic acid molecule can contain less than about 5 kb, 4 kb, 3 kb, 2 kb, 1 kb, 0.5 kb, or 0J kb of nucleotide sequences that naturally flank the nucleic acid molecule in genomic DNA of the cell from which the nucleic acid is derived. A protein that is substantially free of cellular material includes preparations of protein or polypeptide having less than about 30%, 20%, 10%, 5%, (by dry weight) of contaminating protein. When the protein ofthe invention, or biologically active portion thereof, is recombinantly produced, preferably culture medium represents less than about 30%, 20%, 10%, or 5% (by dry weight) of chemical precursors or non-protein-of- interest chemicals. Fragments and variants ofthe disclosed nucleotide sequences and proteins or partial-length proteins encoded thereby are also encompassed by the present invention. By "fragment" or "portion" is meant a full length or less than full length ofthe nucleotide sequence encoding, or the amino acid sequence of, a polypeptide or protein. The term "gene" is used broadly to refer to any segment of nucleic acid associated with a biological function. Thus, genes include coding sequences and/or the regulatory sequences required for their expression. For example, gene refers to a nucleic acid fragment that expresses mRNA, functional RNA, or specific protein, including regulatory
sequences. Genes also include nonexpressed DNA segments that, for example, form recognition sequences for other proteins. Genes can be obtained from a variety of sources, including cloning from a source of interest or synthesizing from known or predicted sequence information, and may include sequences designed to have desired parameters. "Naturally occurring" is used to describe an object that can be found in nature as distinct from being artificially produced. For example, a protein or nucleotide sequence present in an organism (including a virus), which can be isolated from a source in nature and which has not been intentionally modified by man in the laboratory, is naturally occurring. The term "chimeric" refers to any gene or DNA that contains 1) DNA sequences, including regulatory and coding sequences, that are not found together in nature, or 2) sequences encoding parts of proteins not naturally adjoined, or 3) parts of promoters that are not naturally adjoined. Accordingly, a chimeric gene may comprise regulatory sequences and coding sequences that are derived from different sources, or comprise regulatory sequences and coding sequences derived from the same source, but arranged in a manner different from that found in nature. A "transgene" refers to a gene that has been introduced into the genome by transformation and is stably maintained. Transgenes may include, for example, DNA that is either heterologous or homologous to the DNA of a particular cell to be transformed. Additionally, transgenes may comprise native genes inserted into a non-native organism, or chimeric genes. The term "endogenous gene" refers to a native gene in its natural location in the genome of an organism. A "foreign" gene refers to a gene not normally found in the host organism but that is introduced by gene transfer. The terms "protein," "peptide" and "polypeptide" are used interchangeably herein. A "variant" of a molecule is a sequence that is substantially similar to the sequence ofthe native molecule. For nucleotide sequences, variants include those sequences that, because ofthe degeneracy ofthe genetic code, encode the identical amino acid sequence ofthe native protein. Naturally occurring allelic variants such as these can be identified with the use of well-known molecular biology techniques, as, for example, with polymerase chain reaction (PCR) and hybridization techniques. Variant nucleotide
sequences also include synthetically derived nucleotide sequences, such as those generated, for example, by using site-directed mutagenesis which encode the native protein, as well as those that encode a polypeptide having amino acid substitutions. "Conservatively modified variations" of a particular nucleic acid sequence refers to those nucleic acid sequences that encode identical or essentially identical amino acid sequences, or where the nucleic acid sequence does not encode an amino acid sequence, to essentially identical sequences. Because ofthe degeneracy ofthe genetic code, a large number of functionally identical nucleic acids encode any given polypeptide. For instance the codons CGT, CGC, CGA, CGG, AGA, and AGG all encode the amino acid arginine. Thus, at every position where an arginine is specified by a codon, the codon can be altered to any ofthe corresponding codons described without altering the encoded protein. Such nucleic acid variations are "silent variations" which are one species of "conservatively modified variations." Every nucleic acid sequence described herein which encodes a polypeptide also describes every possible silent variation, except where otherwise noted. One of skill will recognize that each codon in a nucleic acid (except ATG, which is ordinarily the only codon for methionine) can be modified to yield a functionally identical molecule by standard techniques. Accordingly, each "silent variation" of a nucleic acid which encodes a polypeptide is implicit in each described sequence. "Recombinant DNA molecule" is a combination of DNA sequences that are joined together using recombinant DNA technology and procedures used to join together DNA sequences as described, for example, in Sambrook and Russell (2001). The terms "heterologous DNA sequence," "exogenous DNA segment" or "heterologous nucleic acid," each refer to a sequence that originates from a source foreign to the particular host cell or, if from the same source, is modified from its original form. Thus, a heterologous gene in a host cell includes a gene that is endogenous to the particular host cell but has been modified. The terms also include non-naturally occurring multiple copies of a naturally occurring DNA sequence. Thus, the terms refer to a DNA segment that is foreign or heterologous to the cell, or homologous to the cell but in a position within the host cell nucleic acid in which the element is not ordinarily found. Exogenous DNA segments are expressed to yield exogenous polypeptides.
A "homologous" DNA sequence is a DNA sequence that is naturally associated with a host cell into which it is introduced. "Wild-type" refers to the native gene or organism as found in nature. "Genome" refers to the complete genetic material of an organism. A "vector" is defined to include, inter alia, any plasmid, cosmid, phage or binary vector in double or single stranded linear or circular form which may or may not be self transmissible or mobilizable, and which can transform prokaryotic or eukaryotic host either by integration into the cellular genome or exist extrachromosomally (e.g., autonomous replicating plasmid with an origin of replication). "Cloning vectors" typically contain one or a small number of restriction endonuclease recognition sites at which foreign DNA sequences can be inserted in a determinable fashion without loss of essential biological function ofthe vector, as well as a marker gene that is suitable for use in the identification and selection of cells transformed with the cloning vector. Marker genes typically include genes that provide tetracycline resistance, hygromycin resistance or ampicillin resistance. "Expression cassette" as used herein means a DNA sequence capable of directing expression of a particular nucleotide sequence in an appropriate host cell, comprising a promoter operably linked to the nucleotide sequence of interest which is operably linked to termination signals. It also typically comprises sequences required for proper translation ofthe nucleotide sequence. The coding region usually codes for a protein of interest but may also code for a functional RNA of interest, for example antisense RNA or a nontranslated RNA, in the sense or antisense direction. The expression cassette comprising the nucleotide sequence of interest may be chimeric, meaning that at least one of its components is heterologous with respect to at least one of its other components. The expression cassette may also be one which is naturally occurring but has been obtained in a recombinant form useful for heterologous expression. The expression ofthe nucleotide sequence in the expression cassette may be under the control of a constitutive promoter or of an inducible promoter which initiates transcription only when the host cell is exposed to some particular external stimulus. In the case of a multicellular organism, the promoter can also be specific to a particular tissue or organ or stage of development.
Such expression cassettes will comprise the transcriptional initiation region ofthe invention linked to a nucleotide sequence of interest. Such an expression cassette is provided with a plurality of restriction sites for insertion ofthe gene of interest to be under the transcriptional regulation ofthe regulatory regions. The expression cassette may additionally contain selectable marker genes. "Coding sequence" refers to a DNA or RNA sequence that codes for a specific amino acid sequence and excludes the non-coding sequences. It may constitute an "uninterrupted coding sequence", i.e., lacking an intron, such as in a cDNA or it may include one or more introns bounded by appropriate splice junctions. An "intron" is a sequence of RNA which is contained in the primary transcript but which is removed through cleavage and re-ligation ofthe RNA within the cell to create the mature mRNA that can be translated into a protein. The terms "open reading frame" and "ORF" refer to the amino acid sequence encoded between translation initiation and termination codons of a coding sequence. The terms "initiation codon" and "termination codon" refer to a unit of three adjacent nucleotides ('codon') in a coding sequence that specifies initiation and chain termination, respectively, of protein synthesis (mRNA translation). A "functional RNA" refers to an antisense RNA, ribozyme, or other RNA that is not translated. The term "RNA transcript" refers to the product resulting from RNA polymerase catalyzed transcription of a DNA sequence. When the RNA transcript is a perfect complementary copy ofthe DNA sequence, it is referred to as the primary transcript or it may be a RNA sequence derived from posttranscriptional processing ofthe primary transcript and is referred to as the mature RNA. "Messenger RNA" (mRNA) refers to the RNA that is without introns and that can be translated into protein by the cell. "cDNA" refers to a single- or a double-stranded DNA that is complementary to and derived from mRNA. "Regulatory sequences" and "suitable regulatory sequences" each refer to nucleotide sequences located upstream (5* non-coding sequences), within, or downstream (3' non-coding sequences) of a coding sequence, and which influence the transcription, RNA processing or stability, or translation ofthe associated coding sequence. Regulatory
sequences include enhancers, promoters, translation leader sequences, introns, and polyadenylation signal sequences. They include natural and synthetic sequences as well as sequences which may be a combination of synthetic and natural sequences. As is noted above, the term "suitable regulatory sequences" is not limited to promoters. However, some suitable regulatory sequences useful in the present invention will include, but are not limited to constitutive promoters, tissue-specific promoters, development- specific promoters, inducible promoters and viral promoters. "5' non-coding sequence" refers to a nucleotide sequence located 5' (upstream) to the coding sequence. It is present in the fully processed mRNA upstream ofthe initiation codon and may affect processing ofthe primary transcript to mRNA, mRNA stability or translation efficiency (Turner et al., Mol. Biotech., 3:225 (1995). "3' non-coding sequence" refers to nucleotide sequences located 3' (downstream) to a coding sequence and include polyadenylation signal sequences and other sequences encoding regulatory signals capable of affecting mRNA processing or gene expression. The polyadenylation signal is usually characterized by affecting the addition of polyadenylic acid tracts to the 3' end ofthe mRNA precursor. The term "translation leader sequence" refers to that DNA sequence portion of a gene between the promoter and coding sequence that is transcribed into RNA and is present in the fully processed mRNA upstream (5') ofthe translation start codon. The translation leader sequence may affect processing ofthe primary transcript to mRNA, mRNA stability or translation efficiency. The term "mature" protein refers to a post-translationally processed polypeptide without its signal peptide. "Precursor" protein refers to the primary product of translation of an mRNA. "Signal peptide" refers to the amino terminal extension of a polypeptide, which is translated in conjunction with the polypeptide forming a precursor peptide and which is required for its entrance into the secretory pathway. The term "signal sequence" refers to a nucleotide sequence that encodes the signal peptide. "Promoter" refers to a nucleotide sequence, usually upstream (51) to its coding sequence, which controls the expression ofthe coding sequence by providing the recognition for RNA polymerase and other factors required for proper transcription. "Promoter" includes a minimal promoter that is a short DNA sequence comprised of a
TATA- box and other sequences that serve to specify the site of transcription initiation, to which regulatory elements are added for control of expression. "Promoter" also refers to a nucleotide sequence that includes a minimal promoter plus regulatory elements that is capable of controlling the expression of a coding sequence or functional RNA. This type of promoter sequence consists of proximal and more distal upstream elements, the latter elements often referred to as enhancers. Accordingly, an "enhancer" is a DNA sequence which can stimulate promoter activity and may be an innate element ofthe promoter or a heterologous element inserted to enhance the level or tissue specificity of a promoter. It is capable of operating in both orientations (normal or flipped), and is capable of functioning even when moved either upstream or downstream from the promoter. Both enhancers and other upstream promoter elements bind sequence-specific DNA-binding proteins that mediate their effects. Promoters may be derived in their entirety from a native gene, or be composed of different elements derived from different promoters found in nature, or even be comprised of synthetic DNA segments. A promoter may also contain DNA sequences that are involved in the binding of protein factors which control the effectiveness of transcription initiation in response to physiological or developmental conditions. The "initiation site" is the position surrounding the first nucleotide that is part of the transcribed sequence, which is also defined as position +1. With respect to this site all other sequences ofthe gene and its controlling regions are numbered. Downstream sequences (i.e. further protein encoding sequences in the 3' direction) are denominated positive, while upstream sequences (mostly ofthe controlling regions in the 5' direction) are denominated negative. Promoter elements, particularly a TATA element, that are inactive or that have greatly reduced promoter activity in the absence of upstream activation are referred to as "minimal or core promoters." In the presence of a suitable transcription factor, the minimal promoter functions to permit transcription. A "minimal or core promoter" thus consists only of all basal elements needed for transcription initiation, e.g., a TATA box and/or an initiator.
"Constitutive expression" refers to expression using a constitutive or regulated promoter. "Conditional" and "regulated expression" refer to expression controlled by a regulated promoter. "Operably-linked" refers to the association of nucleic acid sequences on single nucleic acid fragment so that the function of one is affected by the other. For example, a regulatory DNA sequence is said to be "operably linked to" or "associated with" a DNA sequence that codes for an RNA or a polypeptide if the two sequences are situated such that the regulatory DNA sequence affects expression ofthe coding DNA sequence (i.e., that the coding sequence or functional RNA is under the transcriptional control ofthe promoter). Coding sequences can be operably-linked to regulatory sequences in sense or antisense orientation. "Expression" refers to the transcription and/or translation of an endogenous gene or a transgene in cells. For example, in the case of antisense constructs, expression may refer to the transcription ofthe antisense DNA only. In addition, expression refers to the transcription and stable accumulation of sense (mRNA) or functional RNA. Expression may also refer to the production of protein. "Transcription stop fragment" refers to nucleotide sequences that contain one or more regulatory signals, such as polyadenylation signal sequences, capable of terminating transcription. Examples include the 3' non-regulatory regions of genes encoding nopaline synthase and the small subunit of ribulose bisphosphate carboxylase. "Translation stop fragment" refers to nucleotide sequences that contain one or more regulatory signals, such as one or more termination codons in all three frames, capable of terminating translation. Insertion of a translation stop fragment adjacent to or near the initiation codon at the 5' end ofthe coding sequence will result in no translation or improper translation. Excision ofthe translation stop fragment by site-specific recombination will leave a site-specific sequence in the coding sequence that does not interfere with proper translation using the initiation codon. The terms " -acting sequence" and "czs-acting element" refer to DNA or RNA sequences whose functions require them to be on the same molecule. The terms "trans-acting sequence" and "trans-acting element" refer to DNA or
RNA sequences whose function does not require them to be on the same molecule.
"Chromosomally-integrated" refers to the integration of a foreign gene or DNA construct into the host DNA by covalent bonds. Where genes are not "chromosomally integrated" they may be "transiently expressed." Transient expression of a gene refers to the expression of a gene that is not integrated into the host chromosome but functions independently, either as part of an autonomously replicating plasmid or expression cassette, for example, or as part of another biological system such as a virus. The following terms are used to describe the sequence relationships between two or more nucleic acids or polynucleotides: (a) "reference sequence", (b) "comparison window", (c) "sequence identity", (d) "percentage of sequence identity", and (e) "substantial identity". (a) As used herein, "reference sequence" is a defined sequence used as a basis for sequence comparison. A reference sequence may be a subset or the entirety of a specified sequence; for example, as a segment of a full length cDNA or gene sequence, or the complete cDNA or gene sequence. (b) As used herein, "comparison window" makes reference to a contiguous and specified segment of a polynucleotide sequence, wherein the polynucleotide sequence in the comparison window may comprise additions or deletions (i.e., gaps) compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment ofthe two sequences. Generally, the comparison window is at least 20 contiguous nucleotides in length, and optionally can be 30, 40, 50, 100, or longer. Those of skill in the art understand that to avoid a high similarity to a reference sequence due to inclusion of gaps in the polynucleotide sequence a gap penalty is typically introduced and is subtracted from the number of matches. Methods of alignment of sequences for comparison are well known in the art. Thus, the determination of percent identity between any two sequences can be accomplished using a mathematical algorithm. Non-limiting examples of such mathematical algorithms are the algorithm of Myers and Miller, CABIOS. 4:11 (1988); the local homology algorithm of Smith et al., Adv. Appl. Math.. 2:482 (1981); the homology alignment algorithm of Needleman and Wunsch, JMB. 48:443 (1970); the search-for-similarity-method of Pearson and Lipman, Proc. Natl. Acad. Sci. USA. 85:2444 (1988); the algorithm of Karlin and Altschul, Proc. Natl. Acad. Sci. USA.
87:2264 (1990), modified as in Karlin and Altschul, Proc. Natl. Acad. Sci. USA. 90:5873 (1993). Computer implementations of these mathematical algorithms can be utilized for comparison of sequences to determine sequence identity. Such implementations include, but are not limited to: CLUSTAL in the PC/Gene program (available from Intelligenetics, Mountain View, California); the ALIGN program (Version 2.0) and GAP, BESTFIT, BLAST, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Version 8 (available from Genetics Computer Group (GCG), 575 Science Drive, Madison, Wisconsin, USA). Alignments using these programs can be performed using the default parameters. The CLUSTAL program is well described by Higgins et al., Gene, 73:237 (1988); Higgins et al., CABIOS. 5:151 (1989); Corpet et al., Nucl. Acids Res.. 16:10881 (1988); Huang et al., CABIOS. 8:155 (1992); and Pearson et al., Meth. Mol. Biol.. 24:307 (1994). The ALIGN program is based on the algorithm of Myers and Miller, supra. The BLAST programs of Altschul et al., JMB, 215:403 (1990); Nucl. Acids Res.. 25:3389 (1990), are based on the algorithm of Karlin and Altschul supra. Software for performing BLAST analyses is publicly available tlirough the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/). This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive- valued threshold score T when aligned with a word ofthe same length in a database sequence. T is referred to as the neighborhood word score threshold. These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always < 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension ofthe word hits in each direction are halted when the cumulative alignment score falls off by the quantity X from its maximum achieved value, the cumulative score goes to zero or below due to the accumulation of one or more negative-scoring residue alignments, or the end of either sequence is reached.
In addition to calculating percent sequence identity, the BLAST algorithm also performs a statistical analysis ofthe similarity between two sequences. One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication ofthe probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a test nucleic acid sequence is considered similar to a reference sequence if the smallest sum probability in a comparison ofthe test nucleic acid sequence to the reference nucleic acid sequence is less than about 0J, more preferably less than about 0.01, and most preferably less than about 0.001. To obtain gapped alignments for comparison purposes, Gapped BLAST (in
BLAST 2.0) can be utilized as described in Altschul et al., Nucleic Acids Res. 25:3389 (1997). Alternatively, PSI-BLAST (in BLAST 2.0) can be used to perform an iterated search that detects distant relationships between molecules. See Altschul et al., supra. When utilizing BLAST, Gapped BLAST, PSI-BLAST, the default parameters ofthe respective programs (e.g. BLASTN for nucleotide sequences, BLASTX for proteins) can be used. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) of 10, a cutoff of 100, M=5, N=-4, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix. See http://www.ncbi.nlm.nih.gov. Alignment may also be performed manually by inspection. For purposes ofthe present invention, comparison of nucleotide sequences for determination of percent sequence identity to the promoter sequences disclosed herein can be made using the BlastN program (version 1.4.7 or later) with its default parameters or any equivalent program. By "equivalent program" is intended any sequence comparison program that, for any two sequences in question, generates an alignment having identical nucleotide or amino acid residue matches and an identical percent sequence identity when compared to the corresponding alignment generated by the BlastN program. (c) As used herein, "sequence identity" or "identity" in the context of two nucleic acid or polypeptide sequences makes reference to a specified percentage of residues in the
two sequences that are the same when aligned for maximum correspondence over a specified comparison window, as measured by sequence comparison algorithms or by visual inspection. When percentage of sequence identity is used in reference to proteins it is recognized that residue positions which are not identical often differ by conservative amino acid substitutions, where amino acid residues are substituted for other amino acid residues with similar chemical properties (e.g., charge or hydrophobicity) and therefore do not change the functional properties ofthe molecule. When sequences differ in conservative substitutions, the percent sequence identity may be adjusted upwards to correct for the conservative nature ofthe substitution. Sequences that differ by such conservative substitutions are said to have "sequence similarity" or "similarity." Means for making this adjustment are well known to those of skill in the art. Typically this involves scoring a conservative substitution as a partial rather than a full mismatch, thereby increasing the percentage sequence identity. Thus, for example, where an identical amino acid is given a score of 1 and a non-conservative substitution is given a score of zero, a conservative substitution is given a score between zero and 1. The scoring of conservative substitutions is calculated, e.g., as implemented in the program PC/GENE (Intelligenetics, Mountain View, California). (d) As used herein, "percentage of sequence identity" means the value determined by comparing two optimally aligned sequences over a comparison window, wherein the portion ofthe polynucleotide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment ofthe two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison, and multiplying the result by 100 to yield the percentage of sequence identity. (e)(i) The term "substantial identity" of polynucleotide sequences means that a polynucleotide comprises a sequence that has at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, or 79%, preferably at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, or 89%, more preferably at least 90%, 91%, 92%, 93%, or 94%, and most
preferably at least 95%, 96%, 97%, 98%, or 99% sequence identity, compared to a reference sequence using one ofthe alignment programs described using standard parameters. One of skill in the art will recognize that these values can be appropriately adjusted to determine corresponding identity of proteins encoded by two nucleotide sequences by taking into account codon degeneracy, amino acid similarity, reading frame positioning, and the like. Substantial identity of amino acid sequences for these purposes normally means sequence identity of at least 70%, more preferably at least 80%, 90%, and most preferably at least 95%. Another indication that nucleotide sequences are substantially identical is if two molecules hybridize to each other under stringent conditions (see below). Generally, stringent conditions are selected to be about 5°C lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. However, stringent conditions encompass temperatures in the range of about 1 °C to about 20 °C, depending upon the desired degree of stringency as otherwise qualified herein. Nucleic acids that do not hybridize to each other under stringent conditions are still substantially identical if the polypeptides they encode are substantially identical. This may occur, e.g., when a copy of a nucleic acid is created using the maximum codon degeneracy permitted by the genetic code. One indication that two nucleic acid sequences are substantially identical is when the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the polypeptide encoded by the second nucleic acid. (e)(ii) The term "substantial identity" in the context of a peptide indicates that a peptide comprises a sequence with at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, or 79%, preferably 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, or 89%, more preferably at least 90%, 91%, 92%, 93%, or 94%, or even more preferably, 95%, 96%, 97%, 98%o or 99%, sequence identity to the reference sequence over a specified comparison window. Preferably, optimal alignment is conducted using the homology alignment algorithm of Needleman and Wunsch, J. Mol. Biol. 48:443 (1970). An indication that two peptide sequences are substantially identical is that one peptide is immunologically reactive with antibodies raised against the second peptide. Thus, a peptide is substantially identical to a second peptide, for example, where the two peptides differ only by a conservative substitution.
For sequence comparison, typically one sequence acts as a reference sequence to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequence coordinates are designated if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters. As noted above, another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions. The phrase "hybridizing specifically to" refers to the binding, duplexing, or hybridizing of a molecule only to a particular nucleotide sequence under stringent conditions when that sequence is present in a complex mixture (e.g., total cellular) DNA or RNA. "Bind(s) substantially" refers to complementary hybridization between a probe nucleic acid and a target nucleic acid and embraces minor mismatches that can be accommodated by reducing the stringency of the hybridization media to achieve the desired detection ofthe target nucleic acid sequence. "Stringent hybridization conditions" and "stringent hybridization wash conditions" in the context of nucleic acid hybridization experiments such as Southern and Northern hybridizations are sequence dependent, and are different under different environmental parameters. Longer sequences hybridize specifically at higher temperatures. The thermal melting point (Tm) is the temperature (under defined ionic strength and pH) at which 50% ofthe target sequence hybridizes to a perfectly matched probe. Specificity is typically the function of post-hybridization washes, the critical factors being the ionic strength and temperature ofthe final wash solution. For DNA-DNA hybrids, the Tm can be approximated from the equation of Meinkoth and Wahl, Anal. Biochem., 138:267 (1984); Tm 81.5°C + 16.6 (log M) +0.41 (%GC) - 0.61 (% form) - 500/L; where M is the molarity of monovalent cations, %GC is the percentage of guanosine and cytosine nucleotides in the DNA, % form is the percentage of formamide in the hybridization solution, and L is the length ofthe hybrid in base pairs. Tm is reduced by about 1 °C for each 1% of mismatching; thus, Tm, hybridization, and/or wash conditions can be adjusted to hybridize to sequences ofthe desired identity. For example, if sequences with >90% identity are
sought, the Tm can be decreased 10°C. Generally, stringent conditions are selected to be about 5 °C lower than the Tm for the specific sequence and its complement at a defined ionic strength and pH. However, severely stringent conditions can utilize a hybridization and/or wash at 1, 2, 3, or 4 °C lower than the Tm; moderately stringent conditions can utilize a hybridization and/or wash at 6, 7, 8, 9, or 10°C lower than the Tm; low stringency conditions can utilize a hybridization and/or wash at 11, 12, 13, 14, 15, or 20 °C lower than the Tm . Using the equation, hybridization and wash compositions, and desired temperature, those of ordinary skill will understand that variations in the stringency of hybridization and/or wash solutions are inherently described. If the desired degree of mismatching results in a temperature of less than 45 °C (aqueous solution) or 32 °C (formamide solution), the SSC concentration can be increased so that a higher temperature can be used. An extensive guide to the hybridization of nucleic acids is found in Tijssen, Laboratory Techniques in Biochemistry and Molecular Biology Hybridization with Nucleic Acid Probes, part I chapter 2 "Overview of principles of hybridization and the strategy of nucleic acid probe assays" Elsevier, New York (1993). Generally, highly stringent hybridization and wash conditions are selected to be about 5°C lower than the Tm for the specific sequence at a defined ionic strength and pH. An example of highly stringent wash conditions is 0J5 M NaCl at 72 °C for about 15 minutes. An example of stringent wash conditions is a 0.2X SSC wash at 65 °C for 15 minutes (see, Sambrook and Russell, infra, for a description of SSC buffer). Often, a high stringency wash is preceded by a low stringency wash to remove background probe signal. An example medium stringency wash for a duplex of, e.g., more than 100 nucleotides, is IX SSC at 45 °C for 15 minutes. An example low stringency wash for a duplex of, e.g., more than 100 nucleotides, is 4-6X SSC at 40°C for 15 minutes. For short probes (e.g., about 10 to 50 nucleotides), stringent conditions typically involve salt concentrations of less than about 1.5 M, for example, about 0.01 to 1.0 M, Na ion concentration (or other salts) at pH 7.0 to 8.3, and the temperature is typically at least about 30°C and at least about 60°C for long probes (e.g., >50 nucleotides). Stringent conditions may also be achieved with the addition of destabilizing agents such as formamide. In general, a signal to noise ratio of 2X (or higher) than that observed for an unrelated probe in the particular hybridization assay indicates detection of a specific
hybridization. Nucleic acids that do not hybridize to each other under stringent conditions are still substantially identical if the proteins that they encode are substantially identical. This occurs, e.g., when a copy of a nucleic acid is created using the maximum codon degeneracy permitted by the genetic code. Very stringent conditions are selected to be equal to the Tm for a particular probe.
An example of stringent conditions for hybridization of complementary nucleic acids which have more than 100 complementary residues on a filter in a Southern or Northern blot is 50%) formamide, e.g., hybridization in 50% formamide, 1 M NaCl, 1% SDS at 37°C, and a wash in 0JX SSC at 60 to 65°C. Exemplary low stringency conditions include hybridization with a buffer solution of 30 to 35% formamide, IM NaCl, 1% SDS (sodium dodecyl sulphate) at 37°C, and a wash in IX to 2X SSC (20X SSC = 3.0 M NaCl/0.3 M trisodium citrate) at 50 to 55 °C. Exemplary moderate stringency conditions include hybridization in 40 to 45% formamide, 1.0 M NaCl, 1% SDS at 37 °C, and a wash in 0.5X to IX SSC at 55 to 60°C. By "variant" polypeptide is intended a polypeptide derived from the native protein by deletion (so-called truncation) or addition of one or more amino acids to the N- terminal and/or C-terminal end ofthe native protein; deletion or addition of one or more amino acids at one or more sites in the native protein; or substitution of one or more amino acids at one or more sites in the native protein. Such variants may results form, for example, genetic polymorphism or from human manipulation. Methods for such manipulations are generally known in the art. Thus, the polypeptides ofthe invention may be altered in various ways including amino acid substitutions, deletions, truncations, and insertions. Methods for such manipulations are generally known in the art. For example, amino acid sequence variants ofthe polypeptides can be prepared by mutations in the DNA. Methods for mutagenesis and nucleotide sequence alterations are well known in the art. See, for example, Kunkel, Proc. Natl. Acad. Sci. USA. 82:488 (1985); Kunkel et al., Meth. Enzvmol., 154:367 (1987); U. S. Patent No. 4,873,192; Walker and Gaastra, Techniques in Mol. Biol. (MacMillan Publishing Co. (1983), and the references cited therein. Guidance as to appropriate amino acid substitutions that do not affect biological activity ofthe protein of interest may be found in the model of Dayhoff et al., Atlas of Protein Sequence and
Structure (Natl. Biomed. Res. Found. 1978). In one embodiment ofthe invention, conservative substitutions, such as exchanging one amino acid with another having similar properties, are made. Thus, the genes and nucleotide sequences ofthe invention include both the naturally occurring sequences as well as mutant forms. Likewise, the polypeptides ofthe invention encompass both naturally occurring proteins as well as variations and modified forms thereof. Such variants will continue to possess the desired activity. The deletions, insertions, and substitutions ofthe polypeptide sequence encompassed herein are not expected to produce radical changes in the characteristics ofthe polypeptide. However, when it is difficult to predict the exact effect ofthe substitution, deletion, or insertion in advance of doing so, one skilled in the art will appreciate that the effect will be evaluated by routine screening assays. Individual substitutions deletions or additions that alter, add or delete a single amino acid or a small percentage of amino acids (typically less than 5%, more typically less than 1%) in an encoded sequence are "conservatively modified variations," where the alterations result in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. The following five groups each contain amino acids that are conservative substitutions for one another: Aliphatic: Glycine (G), Alanine (A), Valine (V), Leucine (L), Isoleucine (I); Aromatic: Phenylalanine (F), Tyrosine (Y), Tryptophan (W); Sulfur-containing: Methionine (M), Cysteine (C); Basic: Arginine (R), Lysine (K), Histidine (H); Acidic: Aspartic acid (D), Glutamic acid (E), Asparagine (N), Glutamine (Q). In addition, individual substitutions, deletions or additions which alter, add or delete a single amino acid or a small percentage of amino acids in an encoded sequence are also "conservatively modified variations." The term "transformation" refers to the transfer of a nucleic acid fragment into the genome of a host cell, resulting in genetically stable inheritance. Host cells containing the transformed nucleic acid fragments are referred to as "transgenic" cells, and organisms comprising transgenic cells are referred to as "transgenic organisms". "Transformed," "transgenic," and "recombinant" refer to a host cell or organism into which a heterologous nucleic acid molecule has been introduced. The nucleic acid
molecule can be stably integrated into the genome generally known in the art and are disclosed in Sambrook et al., Molecular Cloning: A Laboratory Manual (2d ed., Cold Spring Harbor Laboratory Press, Plainview, New York) (1989). See also Innis et al., PCR Protocols, Academic Press (1995); and Gelfand, PCR Strategies, Academic Press (1995); and Innis and Gelfand, PCR Methods Manual, Academic Press (1999). Known methods of PCR include, but are not limited to, methods using paired primers, nested primers, single specific primers, degenerate primers, gene-specific primers, vector- specific primers, partially mismatched primers, and the like. For example, "transformed," "transformant," and "transgenic" cells have been through the transformation process and contain a foreign gene integrated into their chromosome. The term "untransformed" refers to normal cells that have not been through the transformation process. A "transgenic" organism is an organism having one or more cells that contain an expression vector. By "portion" or "fragment", as it relates to a nucleic acid molecule, sequence or segment ofthe invention, when it is linked to other sequences for expression, is meant a sequence having at least 80 nucleotides, more preferably at least 150 nucleotides, and still more preferably at least 400 nucleotides. If not employed for expressing, a "portion" or "fragment" means at least 9, preferably 12, more preferably 15, even more preferably at least 20, consecutive nucleotides, e.g., probes and primers (oligonucleotides), corresponding to the nucleotide sequence ofthe nucleic acid molecules ofthe invention. As used herein, the term "therapeutic agent" refers to any agent or material that has a beneficial effect on the mammalian recipient. Thus, "therapeutic agent" embraces both therapeutic and prophylactic molecules having nucleic acid or protein components. The term "antibody" includes intact molecules of polyclonal or monoclonal antibodies, as well as fragments thereof, such as Fab and F(ab')2. For example, monoclonal antibodies are made from antigen containing fragments of a protein by methods well known to those skilled in the art (Kohler et al., Nature, 256, 495 (1975)). By "immunize" is meant to stimulate an immune response (humoral and/or cellular), e.g., such that may render immune a vaccine recipient. "Immunization" refers to the production of antibodies directed against an infecting agent and/or its toxic product. It may also initiate a cellular response. For example, a vaccine ofthe invention may be
used to immunize a mammal, such as a human, against current or subsequent infection caused by one or more Neisseria spp. A vaccine ofthe invention is effective for eliciting antibodies that are immunoreactive with a Neisseria spp. that expresses one or more phosphohpase D protein(s).
Direct Association of CR3 with Pathogenic Neisseria Phagocytosis that is mediated by complement receptor type 3 (CR3) occurs independently of a proinflammatory response in immune cells (Caron et al. 1998). CR3 exists as an integrin heterodimer composed of an alpha (αM or CDI lb) and a beta (β2 or CD 18) subunit. The distribution of CR3 is thought to be limited to professional phagocytes; however, Hussain et al. (1995) demonstrated the expression of CR3 in rectal epithelia. Additionally, Hussain et al. (1995) were able to detect the presence of CDI lb in a small subpopulation of cervicovaginal epithelia, although they were unable to detect the presence of CD 18. Up-regulation of CDI lb in neutrophils has been documented in response to
Neisseria meningiditis infection (Kragsbjerg et al. 2000). The direct association of CR3 with pathogenic Neisseria, however, has not been demonstrated. The present inventors herein describe the occurrence of CR3 expression in primary human cervical epithelial cells and its co-localization with N. gonorrhoeae upon infection of these primary epithelial cells. They also describe the distribution of CR3 in immortalized tissue culture cell lines and within tissue biopsies derived from the male and female urogenital tracts. Monoclonal antibodies directed against CR3 inhibit gonococcal invasion of primary cervical cells and of CR3 -transfected CHO cells suggesting that CR3 serves as a receptor for N. gonorrhoeae during infection. In addition, these studies help to explain why the inflammatory response initiated by gonococcal infection ofthe lower female genital tract differs from that observed with gonococcal infection ofthe male urogenital tract. The distribution of CR3 in tissue biopsies derived from defined sites within the human male and female genital tracts and in primary, immortalized, and malignant epithelial cells derived from these sites is described in Example 2 below. Laser scanning confocal microscopy (LSCM) demonstrated CR3 was not present in tissues and cells derived from the male urogenital tract and from tissue derived from the female urethra;
however, CR3 was present on tissues and cells derived from the female genital tract. CR3 expression was greatest within the ectocervix tissue. Surface levels of CR3 appeared to decrease progressively from the ectocervix to the upper female genital tract in these tissues. A low level of CR3-associated immuno fluorescence was observed in fallopian tube tissue. Consistent with results obtained with LSCM analysis of tissue biopsies, primary endo- and ectocervical cells possessed both CR3 subunits, and CR3 expression appeared to be greater on primary ectocervical cells in comparison to primary endocervical cells. In contrast to results obtained with analysis of tissue biopsies and primary cervical cells, CR3 expression was negligible on immortalized and malignant cell lines (i.e., HCK, Endl, ME180, HeclB). Infection studies using N. gonorrhoeae strains 1291, 1291-green, MSI 1 -green, or FA1090-green did not significantly influence the level of CR3 surface expression on these immortalized or malignant cell lines. However, N. gonorrhoeae did appear in induce up-regulation of CR3 surface expression on primary endo- and ectocervical cells. Gonococci were observed to co-localize with CR3 on primary cervical cells, and co-localization became increasingly prominent with extended infection. Immunoprecipitation studies confirmed the presence of CDI lb and CD 18 in primary cervical cells and CR3 co-localization with the gonococcus. Gonococci bound CR3- transfected K562 and CHO cells, and binding could be inhibited by the presence of anti- CDI lb or -CD18 antibodies (FIG. 1). Similarly, invasion of primary cervical cells and CHO-CR3 cells could be inhibited by the addition of anti-CR3 antibodies to gentamicin- survival assays (FIGs 1 and 2). Gonococcal invasion of primary endo- and ectocervical cells was also inhibited by the addition of Clostridium C3 neurotoxin to invasion assays (FIG. 3), which is consistent with CR3-mediated phagocytosis (Caron et al. 1998). Extensive membrane ruffling could be induced to occur in the absence of gonococci in primary endo- and ectocervical cells and in CHO-CR3 cells by the addition of anti-CD 1 lb or -CD18 antibodies to infection assays. This suggests that engagement of CR3 elicits membrane ruffling, which occurs in response to N. gonorrhoeae infection of the cervical epithelium. The role of complement (C) in innate immunity is multifactorial; however,
C predominately serves to eliminate foreign antigens and to regulate the inflammatory response directed towards these exogenous particles. C protein C3 ofthe C alternative pathway (AP) plays a paramount role in AP C regulation in that it serves to amplify the complement-mediated response by a positive feedback regulatory loop, which converts a relatively inefficient response to a highly efficient defense mechanism. Activation ofthe AP occurs constitutively at a low rate, which is tightly regulated by C regulatory proteins, e.g., factors H (fH) and I (fl). Deposition of C3 on an exogenous surface (e.g. a bacterium) results in spontaneous C3 hydrolysis to produce C3b. C3b can bind factor B (fB) to generate C3 convertase activity leading to the formation ofthe membrane attack complex. Alternatively, C3b can bind fH leading to C inactivation via cleavage of C3b by fl to produce iC3b, a ligand for CR3. CR3 distribution has generally been considered to be limited to immune cells (e.g., monocytes, neutrophils, and macrophages); however, CR3 has also been found on renal glomerular (Sandilands et αl. 1985) and rectal (Hussain et αl 1995) epithelial cells. By in situ hybridization Hussain et αl. (1995) detected CDI lb in a sub-population of endocervical tissue specimens, but they were unable to detect CD 18. The inability to detect CD 18 was attributed to a level of CR3 expression that was below the sensitivity of the antibody and detection method used (Hussain et αl. 1995). LSCM of surgical biopsies and of primary endo- and ectocervical cell monolayers (using two, well defined, antibodies to each CR3 subunit) demonstrated CR3 within the ectocervical, endocervical, endometrial, and fallopian tube epithelia; however, CR3 expression appeared to progressively decrease from the ectocervix to the fallopian tubes. Although CR3 is structurally and functionally related to the very late antigen (VLA) sub-family of integrins, which are present within the female genital tract (Stilz et αl. 1998), these two distinct groups of proteins are not immunologically cross-reactive (Hynes, R. O. 1987). Additionally, isotype control antibodies failed to label primary cell monolayers or tissue cryosections. The present inventors' immunohistochemical data provide evidence for the presence of CR3 within the female genital tract. Furthermore, immunoprecipitation of primary cervical cell lysates confirmed the presence of CR3 within the endo- and ectocervix by the presence ofthe appropriate 95 kDa (CD 18) and 170 kDa (CDI lb)
bands with subsequent western blotting. These data suggest that the distribution of CR3 should now be extended to include the endo- and ectocervix and, possibly, the epithelia of the endometrium and fallopian tubes. The female reproductive tract and seminal fluid have been hypothesized to exhibit anomalous C regulatory characteristics that exist to ensure successful reproduction by hindering an amplified immune response to seminal plasma (Vanderpuye et al. 1992). Seminal plasma has been demonstrated to contain unidentified CI and C3 C component inhibitors, trace amounts of fH and fl, and a soluble form ofthe C3 regulatory protein, CD46 (Hussain et al. 1995), but fB has not been detected (Vanderpuye et al. 1992). Full AP complement activity has been reported in cervical mucous (Price et al.
1979; Vanderpuye et al. 1992); however, C4 ofthe complement classical pathway (CP) was only detected in a small sub-population of luteal-phase cervical secretions (Vanderpuye et al. 1992). Additionally, AP, but not CP, components are produced by the vaginal epithelium (Price et al 1979), and there are some data to suggest that C components are synthesized by the endometrium (Vanderpuye et al 1992). Collectively these data suggest that CR3 present within the female genital tract would function to eliminate exogenous antigens (with the absence of neutrophil influx), following C inactivation of these antigens in seminal fluid or cervical mucous. In contrast to the results obtained with female genital tissue and primary endo- and ectocervical cells, the presence of CR3 was not detected in vas deferens or male and female urethral tissue. The absence of CR3 in these tissues may be the result of divergent embryonic development that occurs after differentiation ofthe nephrogenic mesoderm. CR3 belongs to a large family of cell adhesion molecules that exhibit broad ligand specificity, and, in this respect, differential expression of integrin receptors has been implicated to play a role in morphogenesis and differentiation. Drosophila spp. differentially express surface antigens, which structurally resemble human integrins, during the course of imaginal disc formation (Hynes, R. O. 1987). These cell surface molecules are hypothesized to influence embryonic development through differential cell adhesion (Hynes, R. O. 1987). In terms of evolutionary development, it is generally accepted that the female urogenital systems of apes and humans are more evolved than their male counteφarts. In humans, the
nephrogenic mesoderm differentiates to form the mesonephros and the metanephros. The metanephros gives rise to the renal glomerulus while the mesonephros regresses. Remnants ofthe mesonephric tubules exist in males as the vas deferens and in females as blind tubules in the ovarian dorsal mesentery. Muellerian ducts differentiate in females to form that portion ofthe female genital tract ranging from the fallopian tubes to the cephalic vagina. A complete division ofthe cloaca gives rise to the rectum and a urogenital sinus in both males and females. In males the muellerian ducts regress, and the urogenital sinus receives the mesonephric ducts, after which the rectum elongates and differentiation occurs. In females an additional portioning event ofthe urogenital sinus occurs to form the terminal vagina, the rectum, and the urethra. Since CR3 has been demonstrated on renal glomerular epithelium, rectal epithelium, and (considering the data of Hussain et al. (1995) and herein) the cervical epithelium, it is possible, although speculative, that the presence of CR3 in these tissues may correlate with a higher degree of embryonic development or cellular differentiation. The absence of CR3 on the immortalized (Endl, HCK) and the malignant
(ME 180, HeclB) cell lines used in these studies may be reflective ofthe functional properties of integrins in general or CR3 specifically. Tumor cells are frequently altered in their integrin expression patterns (Jones et al. 1999) as well as the expression of other cellular receptors, e.g., complement receptor type 1 (CR1) (Seya et al. 1990) and the insulin-like growth factor-II/mannose-6-phosphate receptor (O' Gorman et al. 1999). Generally, adhesion and/or stimulation of integrins initiate signaling events that allow cytoskeletal rearrangements, cellular migration, and immunological activation. Adhesive and cytoskeletal defects are associated with fibronectin loss on transformed cells; these defects are reasoned to be due to altered integrin function (Hynes, R. O. 1987). CR3 initiates a signaling cascade in which PI 3 -kinase functions as one effector (Elemer et al 1994). One function of PI- 3 kinase is activation ofthe Rho family of small GTPases that, in turn, activate Jun-N-terminal kinase (JNK) (Hauck et al. 1998; Obermeier et al. 1998). Effector functions of JNK include regulation of gene expression and induction of apoptosis (Hauck et al. 1998). Some tumor cells express proteases most of which have been described to cleave C3 (Jurianz et al. 1999). Binding of C3 cleavage products (e.g.,
iC3b) to their respective receptors (e.g., CR3) could trigger multiple cellular responses, including apoptosis. Additionally, CR3 can also play a role in antibody-dependent cell- mediated cytotoxicity (ADCC) and complement-dependent cell-mediated cytotoxicity (CDCC) (Perlmann et al. 1983; Ramos et al. 1988; Ramos et al. 1985; Wahlin et al 1983), which facilitate tumor killing (Becherer et al. 1989; Erdei et al. 1991). Therefore, it could be reasoned that the absence of CR3 in immortal or malignant cells might confer a survival advantage to these cells. A number of microorganisms have adapted mechanisms not only to evade complement-mediated killing but also to pilfer C components for their own advantage. Microorganisms that initiate infection via C receptors frequently activate C, which subsequently results in C3 deposition on their cell surface (Hondalus et al. 1993). The effect of C deposition is two-fold: 1) it allows for evasion of immune surveillance, and 2) it allows targeting to the appropriate host cell (Cooper, N. R. 1991). Microbial entry of host cells in a CR3 opsonic-dependent manner is thought to lead to a milder respiratory burst thereby promoting increased intracellular survival (Mosser et al. 1987; Wiirzner, R. 1999). Additionally, complement-mediated endocytosis occurs independently of a proinflammatory response (Caron et al. 1998). Asymptomatic gonococcal urethritis develops in a small proportion of men. In contrast, fifty to sixty percent of women with gonorrhea exhibit asymptomatic infections, and seventy percent of women with disseminated gonococcal infection (DGI) lack symptoms of genital track infection (Densen et al. 1982). The ability of pathogenic Neisseria to cause the range of disease states associated with infection requires highly efficient methods of immune avoidance. Although strain specific properties have been associated with resistance to complement-mediated killing (i.e., serum resistance) in vitro, most clinically isolated gonococci initially exhibit serum resistance, a property that is lost with sub-culturing (Densen, P. 1989; de la Paz et al. 1995; Ram et al. 1999; Ram et al. 1998; Vogel et al. 1999). Ram et al. (1998) suggest that an increased conversion of C3b to iC3b on the gonococcal surface might contribute to serum resistance in vivo. This idea is supported by in vitro studies of gonococcal infection of neutrophils where a predominance of iC3b is found on the surface of gonococci in comparison to C3b deposition (Jarvis et al. 1999;
McQuillen et al. 1999; Vogel et al. 1999). Conversion of C3b to iC3b on the gonococcal surface would permit efficient internalization of infecting gonococci into the cervical epithelium. Standard gentamicin-resistance assays measuring gonococcal invasion of primary endo- and ectocervical cells in the presence of anti-CR3 antibodies demonstrated greater than ninety-three percent invasion inhibition with the antibody inhibitors used. Similar studies performed previously in the inventors' laboratory, using antibody inhibitors specific for other putative gonococcal ligands such as an antibody specific for (i) CEACAM (commercially available from Santa Cruz Biotechnology Inc.); (ii) receptors for Opa proteins; (iii) E4.3 (a monoclonal antibody specific for CD46; commercially available from Santa Cruz Biotechnology Inc.); and (iv) a receptor for pilus, failed to inhibit invasion of or association with primary endo- and ectocervical cells. Additional support for a CR3-mediated mode of gonococcal invasion ofthe cervical epithelium is obtained from LSCM analysis of clinical biopsies derived from women with naturally acquired gonorrhea. Confirmed co-localization of gonococci with CR3 in these tissue sections provide evidence that CR3 -mediated gonococcal invasion probably occurs in vivo. Collectively these data suggest that CR3-mediated phagocytosis may serve as the primary mode of gonococcal invasion ofthe cervical epithelium. Only a small proportion of total cellular CR3 is found on the surface of resting cells (Frank et al. 1991; Ram et al. 1998). This CR3 population is relatively immobile in the plane ofthe cell membrane (van Kooyk et al. 1999) and is thought to facilitate phagocytosis triggered by other cell surface receptors, e.g., CR1 and Fcγ receptors (Frank et al. 1991). A mobile, intracellular CR3 store is associated with iC3b-dependent adherence (Frank et al. 1991). Upon activation this latent CR3 population, which resides in peroxidase-negative granules, is rapidly released, resulting in up to a ten-fold increase in CR3 surface expression (Elemer et al. 1994; Frank et al. 1991 ; Kishimoto et al. 1989). Early in the stages of phagocytosis CR3 aggregation also occurs (Caron et al. 1998; Elemer et al 1994; Frank et al. 1991; Kishimoto et al. 1989; van Kooyk et al. 1999). LSCM analysis of N. gonorrhoeae infected primary endo- and ectocervical cells were reflective of these events. Co-localization of infecting gonococci was readily visible by thirty minutes post-infection of endo- and ectocervical cells, and this association became more pronounced by ninety minutes and three hours post-infection suggesting an increase
in surface level expression of CR3. Additionally, co-localization of gonococci with CR3 was evident as clusters on the endo- and ectocervical cell surfaces. Several studies have demonstrated that efficient signal transduction mediated tlirough CR3 that subsequently allows phagocytosis may require co-operation among receptors that share adherence to a particular organism (Elemer et al. 1994; Frank et al. 1991; Hayashi et al. 1997; Ingalls et al. 1998; Kishimoto et al. 1989; Mesri et al. 1998; Stocks et al. 1995; Stocks et al. 1996; Wright et al. 1983). Cross-linking of this/these co- receptors to CR3 is thought to induce a conformational change in CR3 that leads to its increased ligand avidity and/or affinity followed by an increase in cell surface expression, a process called inside-out signaling. Studies focusing on the interaction of putative neisserial virulence factors with host cells have clearly demonstrated that the establishment of productive infection is multifactorial and several bacterial products may play a synergistic role in successful invasion. The present inventors have demonstrated a role for CR3-mediated invasion of primary endo- and ectocervical cells by the gonococcus. The mechanism used by this bacterium to achieve CR3 adherence is reported in Edwards and Apicella, 2002 and Edwards et al., 2002. Anti-CR3 immunoprecipitation studies of infected, primary endo- and ectocervical cell lysates demonstrated that gonococcal porin, pili, and opa proteins associate with CR3. These data may be indicative of opsonic (i.e., iC3b-mediated) adherence, alternatively, unopsonic binding of porin, pili, and opa proteins each to either CR3 or their respective co-receptor may facilitate CR3 -mediated entry. CR3 upregulation can be blocked by neutrophil treatment with an anion-specific channel blocker, but binding of neutrophils to endothelial cells remained unaffected (Kishimoto et al. 1989). N. gonorrhoeae porin proteins are anion selective water-filled channels that are capable of transmigration to and insertion into eukaryotic cell membranes (Bjerknes et al. 1995; Lynch et al. 1984); therefore, it is possible that these proteins play a role in upregulation of CR3 upon gonococcal attachment. Recent data has suggested that an association with selective members ofthe carcinoembryonic antigen family of cell adhesion molecules (CEACAM) (Stocks et al. 1995; Stocks et al. 1996) may augment CR3 activity. CEACAM are suggested to initiate a priming signal in neutrophils that results in activation of adhesion receptors without the
release of inflammatory mediators or the induction of a respiratory burst (Stocks et al. 1995). CEACAMl and CEACAM5 are also present on epithelial cells and have been shown to bind gonococcal Opa. It is tempting to speculate a role for an Opa-CEACAM interaction in CR3-mediated invasion. However, previous data and unpublished work in the inventors' laboratory has demonstrated that invasion of a N. gonorrhoeae strain
FA1090 Opa deletion mutant and strain 1291 Opa" phase variant (isolated on the basis of colony moφhology) is comparable to their respective wild type counteφarts. Additionally, membrane ruffling was observed upon SEM analysis of these Opa" strains. Therefore the significance of Opa proteins to these studies is unclear. One possibility is that binding of heparin to Opa facilitates fH (which possesses three heparin-binding domains (Zipfel et al. 1999)) adherence to surface bound C3. Support of this idea is that Chen et al. (1995) demonstrated that heparin treatment of gonococci resulted in a fifty-five to eighty-five percent increase in survival in normal human serum. fH has also been demonstrated to bind gonococcal porin. fH possesses a sialic acid binding site that has been shown to bind sialylated gonococcal LOS; consequently, the redundancy ofthe ability of fH to bind the gonococcus would preclude the absolute requirement for Opa proteins for successful infection by the gonococcus. Membrane co-factor protein (CD46) serves as a C regulatory protein on the surface of all nucleated cells thereby protecting them from C mediated lysis. Similar to fH, CD46 functions on the cell surface as a co-factor for fl-mediated C inactivation
(Seya et al. 1990). CD46 has been shown to function as a receptor for gonococcus pili on unpolarized ME180 cells (Kallstrόm et al. 1997); however, in polarized epithelial cells CD46 exists on the basolateral surface (Maisner et al 1997). Additionally, CD46 is not efficiently endocytosed and those surface molecules that are internalized are rapidly degraded (Maisner et al. 1997). These findings preclude the possibility of receptor recycling to the apical cell surface. The inventors' unpublished data and the work of others strongly suggests that gonococcal pili play a crucial role in gonococcal pathogenesis. A soluble form of CD46 (sCD46) also exists (Jurianz et al. 1999) and is present in seminal fluid (Vandeφuye et al. 1992); however, the significance of this molecule is unclear. In view of this work, its intriguing to speculate that the interaction of
gonococcal pili with sCD46 may augment the function of CR3 possibly by binding to or near the divalent cation binding domain of CR3. The presence of Mn2+ and Ca2+ are speculated to directly induce integrin changes required for efficient ligand binding by circumventing physiological triggering events (Altieri, D. C. 1991 ; Stewart et al 1996; Violette et al. 1995). Kallstrom et al. (2000) recently demonstrated that adherence of non-piliated N. gonorrhoeae strain MSI 1 could be induced to occur on ME180 cells in the presence of Ca2+. Although the inventors were unable to detect CR3 in any ofthe immortalized or malignant cell lines examined in this work (including ME 180 cells), the Ca2+-mediated invasion of non-piliated gonococci observed by Kallstom et al. might have occurred through an alternative integrin receptor. The cation-dependent induction of receptor function is a property attributed to integrins in general (Altieri, D. C. 1991). SEM analysis demonstrated that the addition of anti-CR3 antibodies to CHO-CR3 and primary endo- and ectocervical cell monolayers resulted in membrane ruffles, suggesting that this phenomenon is elicited by CR3 activation. Upon gonococcal infection of primary human endo- and ectocervical cells membrane ruffling is induced to occur (Edwards et al. 2000). TEM analysis of clinical cervical biopsies, which were derived from women with documented gonococcal cervicitis, suggested that membrane ruffling also occurred in vivo (Edwards et al. 2000). Additionally, membrane ruffling was predominately accompanied by a concentrated accumulation ofthe actin-associated proteins ezrin and vinculin (Edwards et al. 2000). Jones et al. (1998) recently described two CR3 signaling pathways: 1) FcγR- induced, PI-3 kinase dependent and 2) formylmethionylleucylphenylalanine (fMLP)- induced, PI-3 kinase independent pathways. Both modes of CR3 signaling lead to the activation of p21 activating kinase 1 (PAKl) (Jones et al. 1998). PAKl is a serine/threonine kinase demonstrated to exhibit multiple effector functions. PAKl can regulate membrane ruffling both independently and dependently ofthe action of Rac (Obermeier et al. 1998; Sells 1997). Additionally, PAKl regulates the formation of vinculin-containing focal complexes (Obermeier et al. 1998; Sells 1997). The ability of PAKl to regulate membrane ruffling and vinculin accumulation through a CR3- dependent signaling cascade corresponds well with previously described data, and data
presented herein. Additionally, this supports evidence for the induction of membrane ruffling of primary, human endo- and ectocervical cells by the binding ofthe gonococcus to CR3. It is interesting to note that Shigella are capable of membrane ruffle induction and that these organisms parasitize the rectal epithelium (Tran Van Mhieu et al. 1999), which also exhibits CR3 expression (Hussain et al. 1995). Also of interest is that the sexually transmitted organisms, Candida and H1N, are both capable of CR3-mediated internalization of host cells (Cooper, Ν. R. 1991; Hussain et al. 1995; Wiirzner, R. 1999). The pathogenic Neisseria have evolved multiple efficient mechanisms by which to evade host defense mechanisms. Among these immune avoidance mechanisms are the strain- specific attributes that confer serum-resistance e.g., sialylation of some LOS glycoforms and a PJ A porin serotype (Densen, P. 1989; Ram et al. 1999; Vogel et al 1999; et al. 1992). In vitro gonococcal infection studies and examination of clinically isolated gonococci have revealed C components (predominately iC3b) on the surface of gonococci (Densen, P. 1989; Jarvis et al 1999; McQuillen et al. 1999; Ross et al 1985). Additionally, gonococci have been demonstrated to activate both the classical and alternative C pathways; however, gonococcal killing primarily occurs via the CP (Densen et al. 1982). This would suggest a role for AP inactivation (and possibly subsequent CR3 -mediated internalization) as one mechanism by which the gonococcus persists within its primary niche, the human reproductive tract. The inventors' data suggests that CR3 -mediated invasion serves as a primary mechanism by which N. gonorrhoeae invades the cervical epithelium. This process involves ruffling ofthe cervical epithelium, which appears to be triggered by CR3 engagement.
Vaccine Preparations The present invention thus provides a vaccine for use to protect mammals against Neisseria colonization or infection, e.g., N gonorrhoeae and or N. meningitidis. For example, the vaccine may contain an immunogenic amount of polypeptide PLD, also known as p55, from N. gonorrhoeae, or an immunogenic amount of polypeptide PLD from N. meningitidis in combination with a physiologically-acceptable, non-toxic vehicle.
Vaccines ofthe present invention can also include effective amounts of immunological adjuvants known to enhance an immune response. The immunogenic neisserial protein can be conjugated or linked to another peptide or to a polysaccharide. For example, immunogenic proteins well-known in the art, also known as "carriers," may be employed. Useful immunogenic proteins include keyhole limpet hemocyanin (KLH), bovine serum albumin (BSA), ovalbumin, human serum albumin, human gamma globulin, chicken immunoglobulin G and bovine gamma globulin. Further provided are isolated and purified nucleic acid molecules, e.g., DNA molecules, comprising a nucleic acid segment that encodes at least a portion of a neisserial protein. For example, the invention provides an expression cassette comprising a DNA segment that codes for an RNA molecule that is substantially identical (sense) to all or a portion of a messenger RNA ("target" mRNA), i.e., an endogenous or "native" neisserial protein mRNA. The DNA segment in the expression cassette is operably linked to a promoter. As used herein, "substantially identical" in sequence means that two nucleic acid sequences have, for example, at least about 65%, about 70%, about 90%, or about 98% contiguous nucleotide sequence identity to each other. As an example, the preselected DNA segment hybridizes under hybridization conditions, such as stringent hybridization conditions, to a nucleic acid molecule encoding the corresponding native neisserial protein. As used herein, "substantially pure" means an object species is the predominant species present (i.e., on a molar basis it is more abundant than any other individual species in the composition). For example, a substantially purified fraction is a composition wherein the object species comprises at least about 50 percent (on a molar basis) of all macromolecular species present. Generally, a substantially pure composition will comprise more than about 80 percent of all macromolecular species present in the composition, for example, more than about 85%, about 90%, about 95%, and about 99%. The object species can be purified to essential homogeneity (contaminant species cannot be detected in the composition by conventional detection methods) wherein the composition consists essentially of a single macromolecular species.
As used herein, the term "recombinant nucleic acid" or " nucleic acid," e.g., "recombinant DNA sequence or segment" refers to a nucleic acid, e.g., to DNA, that has been derived or isolated from any appropriate source, that may be subsequently chemically altered in vitro, so that its sequence is not naturally occurring, or corresponds to naturally occurring sequences that are not positioned as they would be positioned in a genome that has not been transformed with exogenous DNA. An example of DNA "derived" from a source, would be a DNA sequence that is identified as a useful fragment within a given organism, and which is then chemically synthesized in essentially pure form. An example of such DNA "isolated" from a source would be a useful DNA sequence that is excised or removed from said source by chemical means, e.g., by the use of restriction endonucleases, so that it can be further manipulated, e.g., amplified, for use in the invention, by the methodology of genetic engineering. Recovery or isolation of a given fragment of DNA from a restriction digest can employ separation ofthe digest on polyacrylamide or agarose gel by electrophoresis, identification of the fragment of interest by comparison of its mobility versus that of marker DNA fragments of known molecular weight, removal ofthe gel section containing the desired fragment, and separation ofthe gel from DNA. See Lawn et al, Nucleic Acids Res., 9, 6103 (1981), and Goeddel et al, Nucleic Acids Res.. 8, 4057 (1980). Therefore, "DNA" includes completely synthetic DNA sequences, semi-synthetic DNA sequences, DNA sequences isolated from biological sources, and DNA sequences derived from RNA, as well as mixtures thereof. As used herein, the term "derived" with respect to a RNA molecule means that the RNA molecule has complementary sequence identity to a particular DNA molecule. Nucleic acid molecules encoding amino acid sequence variants of a neisserial protein are prepared by a variety of methods known in the art. These methods include, but are not limited to, isolation from a natural source (in the case of naturally occurring amino acid sequence variants) or preparation by oligonucleotide-mediated (or site- directed) mutagenesis, PCR mutagenesis, and cassette mutagenesis of an earlier prepared variant or a non- variant version ofthe neisserial protein. To immunize a subject, the neisserial protein is administered parenterally, usually by intramuscular or subcutaneous injection in an appropriate vehicle. Other modes of
administration, however, are also acceptable. For example, the vaccine may be administered orally, or via a mucosal route, such as a nasal, gastrointestinal or genital site. Vaccine formulations will contain an effective amount ofthe active ingredient in a vehicle. The effective amount is sufficient to prevent, ameliorate or reduce the incidence of N. gonorrhoeae colonization in the target mammal. The effective amount is readily determined by one skilled in the art. The active ingredient may typically range from about 1% to about 95% (w/w) ofthe composition, or even higher or lower if appropriate. The quantity to be administered depends upon factors such as the age, weight and physical condition ofthe human subject considered for vaccination. The quantity also depends upon the capacity ofthe person's immune system to synthesize antibodies, and the degree of protection desired. Effective dosages can be readily established by one of ordinary skill in the art through routine trials establishing dose response curves. The subject is immunized by administration ofthe neisserial protein in one or more doses. Multiple doses may be administered as is required to maintain a state of immunity to streptococci. To prepare a vaccine, the purified neisserial protein can be isolated, lyophilized and stabilized. The neisserial protein may then be adjusted to an appropriate concentration, optionally combined with a suitable vaccine adjuvant, and packaged for use. Suitable adjuvants include but are not limited to surfactants, e.g., hexadecylamine, octadecylamine, lysolecithin, dimethyldioctadecylammomum bromide, Ν,Ν-dioctadecyl- N'-N-bis(2-hydroxyethyl-propane di-amine), mefhoxyhexadecyl-glycerol, and pluronic polyols; polanions, e.g., pyran, dextran sulfate, poly IC, polyacrylic acid, carbopol; peptides, e.g., muramyl dipeptide, MPL, aimethylglycine, tuftsin, oil emulsions, alum, and mixtures thereof. Other potential adjuvants include the B peptide subunits of E. coli heat labile toxin or ofthe cholera toxin. McGhee, J.R., et al, "On vaccine development," Sem. Hematol., 30:3-15 (1993). Finally, the immunogenic product may be incoφorated into liposomes for use in a vaccine formulation, or may be conjugated to proteins such as keyhole limpet hemocyanin (KLH) or human serum albumin (HS A) or other polymers.
Antibodies The antibodies ofthe invention are prepared by using standard techniques. To prepare polyclonal antibodies or "antisera," an animal is inoculated with an antigen, i.e., a purified immunogenic PLD peptide or polypeptide, and immunoglobulins are recovered from a fluid, such as blood serum, that contains the immunoglobulins, after the animal has had an immune response. For inoculation, the antigen is preferably bound to a carrier peptide and emulsified using a biologically suitable emulsifying agent, such as Freund's incomplete adjuvant. A variety of mammalian or avian host organisms may be used to prepare polyclonal antibodies against gonococcol or meningococcal PLD. Following immunization, Ig is purified from the immunized bird or mammal, e.g., goat, rabbit, mouse, rat, or donkey and the like. For certain applications, particularly certain pharmaceutical applications, it is preferable to obtain a composition in which the antibodies are essentially free of antibodies that do not react with the immunogen. This composition is composed virtually entirely ofthe high titer, monospecific, purified polyclonal antibodies to PLD, or peptides thereof. Antibodies can be purified by affinity chromatography, using purified PLD, or peptides thereof. Purification of antibodies by affinity chromatography is generally known to those skilled in the art (see, for example, U.S. Patent No. 4,533,630). Briefly, the purified antibody is contacted with the purified PLD, or peptide thereof, bound to a solid support for a sufficient time and under appropriate conditions for the antibody to bind to the polypeptide or peptide. Such time and conditions are readily determinable by those skilled in the art. The unbound, unreacted antibody is then removed, such as by washing. The bound antibody is then recovered from the column by eluting the antibodies, so as to yield purified, monospecific polyclonal antibodies. Monoclonal antibodies can be also prepared, using known hybridoma cell culture techniques. In general, this method involves preparing an antibody-producing fused cell line, e.g., of primary spleen cells fused with a compatible continuous line of myeloma cells, and growing the fused cells either in mass culture or in an animal species, such as a murine species, from which the myeloma cell line used was derived or is compatible. Such antibodies offer many advantages in comparison to those produced by inoculation of animals, as they are highly specific and sensitive and relatively "pure"
immunochemically. Immunologically active fragments ofthe present antibodies are also within the scope ofthe present invention, e.g., the F(_b) fragment scFv antibodies, as are partially humanized monoclonal antibodies. Thus, it will be understood by those skilled in the art that the hybridomas herein referred to may be subject to genetic mutation or other changes while still retaining the ability to produce monoclonal antibody ofthe same desired specificity. The present invention encompasses mutants, other derivatives and descendants ofthe hybridomas. It will be further understood by those skilled in the art that a monoclonal antibody may be subjected to the techniques of recombinant DNA technology to produce other derivative antibodies, humanized or chimeric molecules or antibody fragments that retain the specificity ofthe original monoclonal antibody. Such techniques may involve combining DNA encoding the immunoglobulin variable region, or the complementarity determining regions (CDRs), ofthe monoclonal antibody with DNA coding the constant regions, or constant regions plus framework regions, of a different immunoglobulin, for example, to convert a mouse-derived monoclonal antibody into one having largely human immunoglobulin characteristics (see EP 184187A, 2188638A, herein incoφorated by reference).
Inhibitory Compounds The present invention provides a method of preventing entry of Neisseria gonorrhoeae and or N. meningitidis into a cell (or treating an existing infection) by administering a compound that inhibits, e.g., reduces the activity of, neisserial PLD. In particular, it has been discovered that it is possible to prevent the infection of cervical cells (endocervical or ectocervical cells) by blocking the activity of N. gonorrhoeae PLD. Any inhibitor could be used. For example, the inhibitor could be an antibody (e.g., a monoclonal or polyclonal antibody, or a fragment of an antibody) that specifically binds to N. gonorrhoeae PLD, i.e., N. gonorrhoeae PLD, or a compound such as a divalent cation chelator that inhibits gonococcal association and/or invasion or primary ectocervical cells and/or endocervical cells.
Formulations of Compounds and Methods of Administration In cases where compounds are sufficiently basic or acidic to form stable nontoxic acid or base salts, administration ofthe compounds as salts may be appropriate. Examples of pharmaceutically acceptable salts are organic acid addition salts formed with acids that form a physiological acceptable anion, for example, tosylate, methanesulfonate, acetate, citrate, malonate, tartarate, succinate, benzoate, ascorbate, α-ketoglutarate, and α- glycerophosphate. Suitable inorganic salts may also be formed, including hydrochloride, sulfate, nitrate, bicarbonate, and carbonate salts. Pharmaceutically acceptable salts are obtained using standard procedures well known in the art, for example by reacting a sufficiently basic compound such as an amine with a suitable acid affording a physiologically acceptable anion. Alkali metal (for example, sodium, potassium or lithium) or alkaline earth metal (for example calcium) salts of carboxylic acids also are made. The compounds may be formulated as pharmaceutical compositions and administered to a mammalian host, such as a human patient in a variety of forms adapted to the chosen route of administration, i.e., orally or parenterally, by intravenous, intramuscular, topical or subcutaneous routes. Thus, the present compounds may be systemically administered, e.g., orally, in combination with a pharmaceutically acceptable vehicle such as an inert diluent or an assimilable edible carrier. They may be enclosed in hard or soft shell gelatin capsules, may be compressed into tablets, or may be incoφorated directly with the food ofthe patient's diet. For oral therapeutic administration, the active compound may be combined with one or more excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like. Such compositions and preparations should contain at least 0J % of active compound. The percentage of the compositions and preparations may, of course, be varied and may conveniently be between about 2 to about 60% ofthe weight of a given unit dosage form. The amount of active compound in such therapeutically useful compositions is such that an effective dosage level will be obtained. The tablets, troches, pills, capsules, and the like may also contain the following: binders such as gum tragacanth, acacia, corn starch or gelatin; excipients such as
dicalcium phosphate; a disintegrating agent such as corn starch, potato starch, alginic acid and the like; a lubricant such as magnesium stearate; and a sweetening agent such as sucrose, fructose, lactose or aspartame or a flavoring agent such as peppermint, oil of wintergreen, or cherry flavoring may be added. When the unit dosage form is a capsule, it may contain, in addition to materials ofthe above type, a liquid carrier, such as a vegetable oil or a polyethylene glycol. Various other materials may be present as coatings or to otherwise modify the physical form ofthe solid unit dosage form. For instance, tablets, pills, or capsules may be coated with gelatin, wax, shellac or sugar and the like. A syrup or elixir may contain the active compound, sucrose or fructose as a sweetening agent, methyl and propylparabens as preservatives, a dye and flavoring such as cherry or orange flavor. Of course, any material used in preparing any unit dosage form should be pharmaceutically acceptable and substantially non-toxic in the amounts employed. In addition, the active compound may be incoφorated into sustained-release preparations and devices. The active compound may also be administered intravenously or intraperitoneally by infusion or injection. Solutions ofthe active compound or its salts may be prepared in water, optionally mixed with a nontoxic surfactant. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, triacetin, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms. The pharmaceutical dosage forms suitable for injection or infusion can include sterile aqueous solutions or dispersions or sterile powders comprising the active ingredient that are adapted for the extemporaneous preparation of sterile injectable or infusible solutions or dispersions, optionally encapsulated in liposomes. In all cases, the ultimate dosage form should be sterile, fluid and stable under the conditions of manufacture and storage. The liquid carrier or vehicle can be a solvent or liquid dispersion medium comprising, for example, water, ethanol, a polyol (for example, glycerol, propylene glycol, liquid polyethylene glycols, and the like), vegetable oils, nontoxic glyceryl esters, and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the formation of liposomes, by the maintenance ofthe required particle size in the case of dispersions or by the use of surfactants. The
prevention ofthe action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars, buffers or sodium chloride. Prolonged absoφtion ofthe injectable compositions can be brought about by the use in the compositions of agents delaying absoφtion, for example, aluminum monostearate and gelatin. Sterile injectable solutions are prepared by incoφorating the active compound in the required amount in the appropriate solvent with various ofthe other ingredients enumerated above, as required, followed by filter sterilization. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and the freeze drying techniques, which yield a powder of the active ingredient plus any additional desired ingredient present in the previously sterile-filtered solutions. For topical administration, the present compounds may be applied in pure form, i.e., when they are liquids. However, it will generally be desirable to administer them to the skin as compositions or formulations, in combination with a dermatologically acceptable carrier, which may be a solid or a liquid. Useful solid carriers include finely divided solids such as talc, clay, microcrystalline cellulose, silica, alumina and the like. Useful liquid carriers include water, alcohols or glycols or water-alcohol/glycol blends, in which the present compounds can be dissolved or dispersed at effective levels, optionally with the aid of non-toxic surfactants. Adjuvants such as fragrances and additional antimicrobial agents can be added to optimize the properties for a given use. The resultant liquid compositions can be applied from absorbent pads, used to impregnate bandages and other dressings, or sprayed onto the affected area using pump-type or aerosol sprayers. Thickeners such as synthetic polymers, fatty acids, fatty acid salts and esters, fatty alcohols, modified celluloses or modified mineral materials can also be employed with liquid carriers to form spreadable pastes, gels, ointments, soaps, and the like, for application directly to the skin ofthe user. Examples of useful dermato logical compositions that can be used to deliver the compounds ofthe present invention to the skin are known to the art; for example, see
Jacquet et al. (U.S. Pat. No. 4,608,392), Geria (U.S. Pat. No. 4,992,478), Smith et al. (U.S. Pat. No. 4,559,157) and Wortzman (U.S. Pat. No. 4,820,508). Useful dosages ofthe compounds ofthe present invention can be determined by comparing their in vitro activity, and in vivo activity in animal models. Methods for the extrapolation of effective dosages in mice, and other animals, to humans are known to the art; for example, see U.S. Pat. No. 4,938,949. Generally, the concentration ofthe compound(s) ofthe present invention in a liquid composition, such as a lotion, will be from about OJ-25 wt-%, preferably from about 0.5-10 wt-%. The concentration in a semi-solid or solid composition such as a gel or a powder will be about 0J-5 wt-%, preferably about 0.5-2.5 wt-%. The amount ofthe compound, or an active salt or derivative thereof, required for use in treatment will vary not only with the particular salt selected but also with the route of administration, the nature ofthe condition being treated and the age and condition of the patient and will be ultimately at the discretion ofthe attendant physician or clinician. In general, however, a suitable dose will be in the range of from about 0.5 to about
100 mg/kg, e.g., from about 10 to about 75 mg/kg of body weight per day, such as 3 to about 50 mg per kilogram body weight ofthe recipient per day, preferably in the range of 6 to 90 mg/kg/day, most preferably in the range of 15 to 60 mg/kg/day. The compound is conveniently administered in unit dosage form; for example, containing 5 to 1000 mg, conveniently 10 to 750 mg, most conveniently, 50 to 500 mg of active ingredient per unit dosage form. Ideally, the active ingredient should be administered to achieve peak plasma concentrations ofthe active compound of from about 0.5 to about 75 μM, preferably, about 1 to 50 μM, most preferably, about 2 to about 30 μM. This may be achieved, for example, by the intravenous injection of a 0.05 to 5% solution ofthe active ingredient, optionally in saline, or orally administered as a bolus containing about 1-100 mg ofthe active ingredient. Desirable blood levels may be maintained by continuous infusion to provide about 0.01-5.0 mg/kg/hr or by intermittent infusions containing about 0.4-15 mg/kg ofthe active ingredient(s). The desired dose may conveniently be presented in a single dose or as divided doses administered at appropriate intervals, for example, as two, three, four or more sub-
doses per day. The sub-dose itself may be further divided, e.g., into a number of discrete loosely spaced administrations; such as multiple inhalations from an insufflator or by application of a plurality of drops into the eye. The following examples are intended to illustrate but not limit the invention.
EXAMPLE 1 Membrane Ruffling and Cytoskeletal Rearrangements in Neisseria gonorrhoeae The sexually transmitted pathogen Neisseria gonorrhoeae, the causative agent in gonorrhea, can infect the male and female genital tract. Studies have shown that the organism can discriminate between the sexes and uses different mechanisms for infection of men than for infection of women. During the course of female infection, it appears that the organism releases a group of proteins that initiate a process called membrane ruffling on endocervical and exocervical epithelial cells. Organisms adherent to or proximal to the ruffled area invade the epithelial cell. The gonococcus can proliferate within the intracellular environment, cause the death ofthe infected cell and are released. They re-enter new cells and the cycle continues until an inflammatory response ensues or the organisms spreads to the endometrium and fallopian tubes. Bacteria: N. gonorrhoeae strains 1291, 1291-green (1291 expressing green fluorescent protein and to be described elsewhere, the plasmid pLES98 was a gift from V. Clark), FA1090, MS 11 -A, and MS 11 mkC were used in these infection studies. These strains are P+ and Opa+. Strains 1291, 1291-green, MSI 1-A, and MSI lmι<C contain the pathogenicity island recently described by Dillard (Dillard, J. 1999). Development of Primary Cervical Cell Culture Systems: Surgical biopsies were obtained from 30 pre-menopausal women undergoing hysterectomy at the University of Iowa Hospitals and Clinics (Iowa City, IA). Endocervical (proximal to the cervical os) and ectocervical (distal to the cervical os) tissue biopsies were obtained in 4-6 mm2 sections and further subdivided into 2-3 mm2 sections. Sectioned tissues were rinsed twice for 10 min in Hanks Balanced Salt Solution (HBSS) supplemented with 1% fungizone (Irvine Scientific, Santa Ana, CA) and 1% penicillin (100 U/ml)-streptomycin (1 mg/ml). The tissue was placed with the epithelium downward on polystyrene, 35 mm tissue culture dishes (Falcon, Becton Dickinson; Franklin Lake, ΝJ). Tissue explants
were incubated in filtered airway medium (1 part Dulbecco Modified Eagle Medium, 1 part Ham's F12, 5% fetal calf serum (FCS), 1% nonessential amino acids (Sigma- Aldrich, St. Louis, MO), 1% penicillin-streptomycin, and insulin (10 μg/ml)). After 48 h, airway medium was replaced with keratinocyte growth medium (KGM)-2 Bullet Kit (Clonetics, San Diego, CA). KGM-2 was replaced every 2-3 days until near-confluence was obtained (1-2 weeks) at which time the cells were passaged as outlined below. Although variability exists among tissue samples, this process allows for an average of three passages of cell growth to fresh tissue culture dishes from a single tissue explant prior to fibroblast development, at which time tissue explants were discarded. Cell Passage: At near-confluent growth cells were passaged by a 5 min, 37 °C incubation in HBSS-0.25% Trypsin-0J% EDTA. Cell suspensions were collected and centrifuged at 5000 φm for 5 min. The resulting cell pellet was rinsed in HBSS, resuspended in KGM-2, and used to seed transwell membrane systems (Biocoat Cell Environments, Becton Dickinson, Bedford, MA) (to allow for polarized cell growth); glass, 8-well chamber slides (Nalge Nunc International, Naperville, IL); or human, placental collagen-coated, 12 mm glass coverslips previously placed in 24-well tissue culture dishes (Falcon). Primary cervical cells were maintained in KGM-2 until near- confluence was again obtained at which time they were infected with N. gonorrhoeae as outlined below. Where applicable, cellular polarity was determined as an electrical resistance greater than 2KΩ/cm as measured across the cell monolayer. Infected and uninfected (i.e., control) cervical cell-harboring membranes (from transwell systems) were subsequently subdivided into equal sections. Sections to be used for scanning electron microscopy (SEM) were processed while attached to the well apparatus so that the cellular orientation would be maintained. Remaining sections were removed from the well structure and subsequently processed independently for either confocal, transmission electron, or bright-field light microscopy. Infection of the Primary Cells: N. gonorrhoeae cells allowed to grow overnight (37 °C, 5% CO2) on GC-IsoVitaleX agar plates were harvested using a sterile swab and resuspended in sterile saline. Culture density was determined spectrophotometrically where an optical density (OD) of 1 at 600 nm was equivalent to 109 bacteria ml"1 of cell culture. Bacterial cells were then diluted to a concentration of 107 bacteria ml"1 in KGM-
2 lacking gentamycin and used to infect 105 primary cervical cells (maintained as outlined above). Gonococcal infection was allowed to progress for variable time periods after which the infection was stopped by the removal ofthe infection medium, rinsing infected cervical cells with phosphate buffered saline (PBS), and cell fixation. Samples to be used in laser scanning confocal microscopy (LSCM) or differential interference contrast (DIC) analysis were immunolabeled directly following fixation. SEM, transmission electron microscopy (TEM), and bright field light microscopy (BFLM) samples were further processed by graded ethanol dehydration and resin (TEM) or paraffin (BFLM) embedment. Embedded samples were sectioned and immunolabeled as noted. Where indicated, the infection medium was harvested from the cervical cell monolayer and reused to infect fresh, uninfected cell cultures, which were subsequently processed for SEM analysis. Invasion Assays in the Presence of Inhibitors of Cytoskeletal Motility and Protein Synthesis: Cervical cells were passed to 12 mm collagen-coated coverslips as outlined above. Prior to infection with N. gonorrhoeae 1291 wild-type cells, primary cell cultures were left untreated, or they were pre-incubated with 300 nM wortmannin (Sigma), 1 μM cytochalasin D (Sigma), or 400 mM ethylene glycol bis- (2-aminoethyl ether)-Ν, N, N', N' tetraacetic acid ((EGTA) Amresco, Solon, OH) for 2 h, 30 min, and 30 min, respectively, or they were pretreated with 100 g/ml nocodazole (Calbiochem- Novabiochem Coφ., La Jolla, CA) for 1 h at 4°C followed by a 30 min incubation at 37 °C. The requirement for de novo protein synthesis, either by the bacteria or by the primary cervical cells, was tested by pretreatment (30 min, 37 °C) ofthe bacterial cultures or cervical cell monolayers with 4 μg/ml chloramphenicol (Sigma) or 25 μM cycloheximide (Calbiochem-Novabiochem Coφ.), respectively. All chemical reagents used were maintained in the infection medium throughout the course ofthe infection.
Trypan blue exclusion revealed no significant toxicity to the primary cervical cells at the indicated concentrations for each ofthe chemical reagents used. Infection was allowed to progress at 37 °C, 5% CO , for 1.5 h after which the medium was removed, the cells were rinsed with PBS, and then incubated with KGM-2 containing 100 μg/ml gentamycin to kill extracellular bacteria. Post incubation the cervical cells were lysed with 0.5% saponin to release invasive bacteria. Percent invasion was determined as a function ofthe
original inoculum and the number of colonies formed with subsequent plating ofthe cellular lysate. A Kruskal- Wallace ANOVA was used to determine the statistical significance ofthe calculated percent invasion for each ofthe cytoskeletal motility inhibitors used with respect to the untreated, infected cell cultures. Microscopy: Samples were processed for LSCM, SEM, or TEM as previously described (Ketterer et al. 1999). Samples to be analyzed by BFLM were paraffin embedded using an automated tissue processor (RMC 1530 Paraffin Tissue Processor, Tucson, AZ), cut into thick (1 μm) sections, and mounted onto glass microscope slides. Immunolabeling of infected and uninfected cervical cells for TEM analysis was performed using the monoclonal antibody 2C3, which specifically recognizes the H.8 gonococcal surface protein, or the anti-gonococcal porin monoclonal antibody, 3H1 (a gift from Mylan Blake); in conjunction with a polyclonal antibody to filamentous (F) actin. Secondary labeling proceeded with the use of 30 nm and 10 nm colloidal gold- beaded antibody conjugates (Amersham Pharmacia Biotech, Piscataway, NJ) to the bacterial- and actin-specific antibodies, respectively. B. A. Evans generously provided clinical biopsies used in TEM analysis. The samples were viewed with an H-7000 Hitachi Transmission Electron Microscope (Hitachi Coφoration, Mountain View, CA). Primary antibodies used for LSCM or DIC microscopy were as follows: anti- cytokeratin 8.12 (Sigma), -cytokeratin 4 (Sigma), -talin (Sigma), -vinculin (Sigma), -α- actinin (Sigma), -myosin (Sigma), -ezrin (Santa Cruz Biotechnology, Santa Cruz, CA), - CD66 (DAKO, Caφinteria, CA), -CD46 (Santa Cruz Biotechnology), and 2C3. Immunolabeling of cervical cell monolayers with anti-cytokeratin, -talin, -vinculin, - myosin, -ezrin, and -α-actinin occurred subsequent to a 15 min incubation in 0.2% Triton X-100 to allow cervical cells to become permeable. Where indicated, counter staining occurred at room temperature (RT) for 6 min. Counter stains used were specific for nucleic acids and consisted of YOYO- 1 (Molecular Probes, Eugene, OR) or ethidium bromide. Samples were viewed using the BioRad MRC-1024 or the Zeiss 510 Laser Scanning Confocal viewing systems. Cervical tissue biopsies (obtained as outlined above) to be used for LSCM cytokeratin analysis were processed (within 1-2 h of obtaining the tissue specimen) for cyrosectioning by a 30 min incubation in 1% paraformaldehyde followed by infiltration
with 30%) sucrose prior to embedment in Tissue-Tek O. C. T. compound (Sakura Finetek USA, Inc., Torrance, CA) and sectioning (6-8 nm). Frozen sections were allowed to stand at RT for lh prior to immunolabeling with the indicated anti-cytokeratin antibody. A fluoroscein isothiocyanate (FITC)-conjugated secondary antibody was applied and tissues were subsequently counter-stained with ethidium bromide (0.5 ng/ml, 6 min). Cervical cells passaged to 12 mm coverslips were used to assay for gonococcal- induced macropinocytosis. Cervical cell monolayers were infected with 1291-green for variable time periods in the presence of 1 mg/ml tetramethylrhodamine B isothiocyanate (TRITC)-dextran (MW 150,000). Infection was stopped by the removal ofthe infection medium. Infected monolayers were extensively washed prior to fixation with 2% paraformaldehyde. Coverslips were mounted onto glass microscope slides and viewed using the BioRad MRC-1024 Laser Scanning Confocal viewing system. Slides prepared for BFLM were hematoxylin-eosin stained using a standard protocol and viewed with a Leitz Diaplan microscope with an Optronics Engineering viewing system. SEM analysis was performed using an H-4000 Hitachi Scanning Electron Microscope (Hitachi).
Results Characterization of Primary Human Endocervical Epithelial Cells: Primary cervical epithelial cells were allowed to grow as described above. Epithelial cells could be seen extending from the cervical explants within two to three days from the start ofthe cultures. Growth radiated from the tissue foci in a contiguous monolayer, and confluence was observed within ten to fourteen days. Transfer of endocervical-derived cells to transwell membrane systems resulted in polarized cell growth. The cytokeratin expression pattern ofthe normal human uterine cervix has been well characterized. LSCM was used to determine the cytokeratin expression pattern of the primary cervical cell monolayers with respect to the tissue from which they were derived. Sectioned tissue biopsies (obtained from the endo- and ectocervix) and the cervical-derived cell monolayers were immunohistochemically examined with antibodies to cytokeratins 4, 13, 15, and 16. The results of these studies can be seen in FIG. 4. The
specific cytokeratin staining character ofthe endo- and ectocervical tissue was retained in the primary cell monolayers (FIG. 4). LSCM analysis of sectioned tissue biopsies and cervical-derived cell monolayers demonstrated the expression of CD66 and CD46 in both the endo- and ectocervix. N. gonorrhoeae Infection of Primary Cervical Epithelial Cells: SEM analysis of N. gonorrhoeae 1291 infected polarized and non-polarized cells showed bacteria could adhere to both types of primary cervical cells. Bacteria were found distributed across the monolayer surface. The interaction ofthe bacteria with the cervical cell surface appeared to occur by multiple mechanisms. At approximately ten minutes post infection gonococci could be found associated with the cervical cell membrane both dependent (FIG. 5 A) and independent of microvilli (FIG. 5B). Small tufts of microvilli were associated with bacteria on some cervical cells. Gonococci associated with the cervical cells independent of microvilli appeared to be entering the cervical cell by an endocytic process. At approximately 20 and 30 minutes post-infection, filopodia and lamellipodia formation was readily observed (FIG. 5C) and bacteria appeared to be undergoing internalization (FIG. 5D). Additionally, a visible smoothing ofthe cervical cell membrane was evident around the periphery of some sites of bacterial infection (FIG. 5E). By 60 minutes post- infection, the filopodia and lamellipodia became less prominent. Large membrane ruffles (FIGs 5F and 5G) became prominent at about 90 minutes post infection of cervical cells. Membrane ruffles were abutting and contiguous with gonococci. Generally, ruffles could be readily identified by a smoothing ofthe cervical cell membrane that encircled the ruffle (FIG. 5H). At 3 h post-gonococcal infection, membrane ruffles and bacteria associated with microvilli were still evident. Perturbations ofthe cell membrane that were reminiscent of ruffles were also evident. Ruffling could be induced to occur at approximately thirty minutes post-gonococcal infection in both primary cell systems when uninfected cervical cells were infected with a primed infection inoculum (i.e., infection medium transferred from an immediately prior N. gonorrhoeae cervical cell infection) derived from one hour (ectocervical) (FIG. 5G) and ninety minute (endocervical) infections. Bright-field light microscopy and TEM analysis of polarized endocervical cells infected with N. gonorrhoeae 1291 confirmed the observation made with SEM analysis
(FIG. 6). Actin-filled membrane protrusions were readily observed encompassing gonococci at ninety minutes and three hours post infection. Clusters of bacteria were found breaching the superficial cervical epithelial layer; however, bacteria entered the cervical cells as single entities with each bacterium being surrounded by its own actin- lined vacuole (FIG. 6B). Consistent with SEM analysis, gonococcus-associated membrane ruffles were readily observed at 3 h post-infection by both high-powered (TEM, FIG. 6C) and low-powered (BFLM, FIG. 6D) magnification with microscopy. TEM analysis revealed that, within the host cell cytoplasm, bacteria-containing vacuoles appeared to coalesce prior to bacterial exocytosis to the subepithelial space. TEM analysis of epon-embedded, clinically-derived cervical biopsies from women naturally infected with gonococci revealed similar processes (FIG. 7). Large membrane protrusions (indicative of ruffles) (FIG. 7B) and smaller, less organized membrane structures (FIG. 7A), were readily observed. Gonococci were, again, observed to enter the cervical cells as single entities in spacious vacuoles. Primary cell monolayers infected with gonococci in the presence of a TRITC- conjugated dextran, which would be excluded by non-macropinocytic cellular events, demonstrated that, upon invasion, gonococci reside within macropinosomes. LSCM analysis of infection studies performed using polarized endocervical cells and ectocervical cell monolayers suggested co-localization of CD66 and CD46 with gonococci. With extended infection (i.e., six hours) clustering of CD46 molecules, which was not observed to occur at earlier time points in the infection, became prevalent in response to gonococci. Cytoskeletal Changes Occur in Cervical Cells with Gonococcal Infection: Immunolabeling of N. gonorrhoeae infected primary cells with antibody-conjugates to actin-associated proteins confirmed that changes ofthe cervical cell cytoskeletal network were occurring (FIG. 8). Antibodies to talin, vinculin, ezrin, myosin, and α-actinin demonstrated a focused accumulation of these proteins, in membrane projections, at ten minutes post infection with gonococci. Membrane projections were also observed to co- localize with gonococci. This effect was most pronounced with the use of vinculin and ezrin; however, a modest accumulation of talin and α-actinin was also observed to occur. Immunolabeled projections were not observed upon analysis of uninfected cervical cells.
Gonococcal Invasion of Cervical Cells Occurs Primarily in an Actin- Dependent Manner and Does Not Require de novo Protein Synthesis: Standard gentamycin-resistance assays performed with endo- and ectocervical-derived cells confirmed results obtained by BFLM and TEM analysis and the invasive nature of gonococci with respect to both the endo- and ectocervix. Gonococci were found to invade endocervical-derived cells at a proportion of 1.57% (Table 1). A slightly higher percentage (2.70%) was observed to occur with gonococcal invasion ofthe ectocervical- derived cells (Table 1). The inclusion of wortmannin, cytochalasin D, and EGTA in the invasion assay prohibited bacterial entry into both cell types (Table 1). Pretreatment of primary cervical cell monolayers with the microtubule-specific depolymerizing agent, nocodazole, resulted in an approximate 67% decrease in gonococcal invasion (Table 1). Chloramphenicol and cycloheximide, which inhibit gonococcal and eukaryotic cell protein synthesis (respectively), did not inhibit gonococcal invasion ofthe primary cervical cell monolayers (table 1).
" The mean is the average percentage of at least three trials in which the percent invasion was determined as a function ofthe original inoculum and the subsequent CFU.
b P values given were determined using a Kruskal-Wallis κ-sample test ofthe percent gonococcal invasion determined for each cellular treatment applied to primary cervical cells in comparison to the percent gonococcal invasion of untreated, primary cervical cells.
c NA, not applicable.
d ND, not determined.
Discussion Primary human ecto- and endocervical epithelial cell models have been described whose cytokeratin, CD66, and CD46 profiles are identical to the tissue from which they were derived. Confocal and electron microscopic analysis of primary, human, cervical cells infected with N. gonorrhoeae 1291, FA 1090, and MSI 1 have demonstrated the ability of gonococci to adhere to and to induce cytoskeletal changes within both of these cell systems. Bacteria were found to associate with the primary cervical cells by more than one mechanism as evidenced by microvillus-dependent and -independent modes of bacterial attachment. Membrane perturbations resulted in the formation of membrane ruffles, which became prominent by ninety minutes post infection and after which ruffles remained readily observable. Ruffling could be induced to occur at thirty minutes post gonococcal infection in both primary cell systems when uninfected cervical cells were infected with a primed infection inoculum; however, de novo protein synthesis was not required to prime the infection process for invasion. Actin-associated proteins were also observed to accumulate in response to gonococcal infection. Gonococci were found to be internalized within the cervical cells in actin-lined spacious vacuoles. The ability of gonococci to attach to the endocervical epithelium is well accepted. In contrast, attachment to the stratified squamous epithelium ofthe ectocervix and to transitional cells ofthe cervical squamocolumnar junction (Draper et al. 1980; Evans, B.
A. 1977) remains controversial. Studies, in vitro, with the inventors' primary cell culture systems demonstrated gonococcal adherence to both the endo- and ectocervix. Considerable anatomical variation exists in the length ofthe squamocolumnar transition zone ofthe cervix (Fluhmann, C. F. 1959). Additionally, to a variable measure, columnar epithelium may overlap the stratified squamous epithelium (ofthe ectocervix) at the transition zone. This may, in part, account for the controversy associated with gonococcal attachment to the cervical epithelium. Cervical biopsies, used in the studies described herein, were obtained from sites distinct from the transformation zone i.e., greater than 0.5 cm from the squamocolumnar junction. Ofthe thirty cervical specimens used to generate primary cell cultures for use in these studies, all have supported gonococcal adherence with minimal variability. Gonococcal adherence, to date, has primarily been associated with microvilli formation; however, gonococci associated with the cervical epithelium were found both dependent and independent of microvilli. Attachment is not synonymous with tissue damage or with the initiation of a diseased state; it is a discrete event from phagocytic internalization i.e., invasion. Four general mechanisms of bacterial invasion of host cells have been proposed to occur: receptor mediated endocytosis (Robinson, M. S. 1994), micro tubule-dependent endocytosis (Mukherjee et al. 1997; Oelschlager et al. 1993; Silverstein et α/. 1977), zippering (Griffin, Jr., et al. 1976; Griffin, Jr., et al. 1975), and triggering (Dramsi et al. 1998; Finlay et al. 1997; Moulder, J. W. 1985; Rabinovitch, M. 1995; Watarai et al. 1996). Several eukaryotic cell surface molecules have been proposed to serve as receptors for gonococcal invasion (for review Dehio et al. 1998; Dramsi et al. 1998; Jerse et al. 1997 ; McGee et al. 1983; Meyer, T. F. 1999; Nassif et al. 1999; Nassif et al. 1995; Naumann et al. 1999). In fallopian tube organ culture (FTOC) gonococcal invasion has been proposed to occur in a manner reminiscent of "zipper" type phagocytosis. (Dramsi et al. 1998; McGee et al 1983; Stephens, D. S. 1989). The observation that gonococci appear to induce membrane ruffling is a novel finding. Ruffling is the result of a complex interaction that occurs between a bacterium and a host cell and is associated with a triggering mechanism (Silverstein et al. 1977) that leads to macropinocytosis (Alpuche-Aranda et al, 1994; Francis et al. 1993; Garcia-del Portiilo et al. 1994; Swanson et α/. 1995). Infection ofthe inventors' primary cell culture
systems resulted in ruffling of both the endo- and ectocervical-derived cells. Ruffling was evident in the endocervical cells as convoluted spheres whereas ruffling ofthe ectocervical cells was observed to occur as long, ribbon-like folds. The characteristic structural moφhology of endo- and ectocervical-associated ruffles appeared to be specific for each of their respective cell types; hence, the ruffles found on the ectocervical cells were termed "ribbons." Salmonella and Shigella have been shown to induce membrane ruffling in a contact-dependent manner in which a (highly conserved) type III secretion system (TTSS) allows for the secretion of numerous effector proteins that initiate the cellular response required for the observed cytoskeletal rearrangements (Finlay et al. 1991;
Rosqvist et al. 1995; Tran Van Mhieu et al. 1999). A TTSS has not been described for N. gonorrhoeae. A search ofthe N. gonorrhoeae strain FA 1090 genome data base (University of Oklahoma Advanced Center for Genome Technology) for the possible existence of Salmonella and Shigella TTSS and effector protein homologs yielded no significant matches to ruffling-associated proteins. Dillard et al. (1999) recently described the existence of a pathogenicity island in Ν. gonorrhoeae strain MSI 1, which encodes a secretion system. This pathogenicity island is also present in N. gonorrhoeae strain 1291, but it is absent in N. gonorrhoeae strain FA 1090. This pathogenicity island (and its encoded secretion system) may, therefore, share homology to Salmonella and Shigella TTSS and effector proteins; however, this data is currently unavailable. Ruffling and subsequent invasion by Salmonella and Shigella shows an actin- dependence but occurs independent of micro tubules. It has previously been demonstrated that gonococcal invasion of tissue culture cell lines is dependent upon microtubules and a functional actin cytoskeleton (Bessen et al. 1986; Grassme et al. 1996; Richardson et al. 1998). Using standard gentamycin-resistance assays endo- and ectocervical cells were examined to determine if these primary cells displayed a microtubule- or actin- dependence for gonococcal invasion. Cytochalasin D, wortmannin, and EGTA brought invasion levels down to (essentially) zero in both cell systems suggesting that gonococcal entry is dependent upon actin rearrangements. TEM analysis of N. gonorrhoeae infected polarized cervical cells supported a role for actin in the gonococcal invasion process in that actin-filled ruffles and large, spacious, actin-lined vacuoles encompassed invading
gonococci. The latter finding is in contrast to Grassme et al. (1996) who demonstrated that gonococcal association with actin was transient. In multiple experiments, using cervical cell monolayers derived from different patients, invasion was not significantly inhibited when primary cervical cells were pretreated with nocadazole to disrupt micro tubules. A concentrated accumulation of actin-associated proteins has been demonstrated to occur in response to membrane ruffling (Clerc et al. 1987; Finlay et al. 1991; Skoudy et al 1999). To the knowledge ofthe present inventors, the role of actin-associated proteins in gonococcal infection has not been examined. It was found that in response to gonococcal invasion a concentrated accumulation of predominately ezrin and vinculin occurs in a manner analogous to Shigella. A modest accumulation of talin and α-actinin also was observed during gonococcal infection of cervical cells. Additionally, although myosin was observed to accumulate in response to, and co-localize with, gonococci at five and ten minutes post infection, myosin was also observed to be fairly diffuse throughout some ofthe infected cervical cells. This may reflect the relative abundance of this protein in comparison to the other actin-associated proteins that were examined. Alternatively, the observed myosin distribution may be indicative ofthe initiation of a concurrent change occurring in the actin cytoskeleton, or it is possible that gonococci elicit only a minimal recruitment of myosin upon ruffle induction. The host cell surface molecule exploited by Salmonella to initiate ruffling has, to date, not been elucidated. The Shigella protein complex of IpaB/C/D has been shown to bind the fibronectin receptor, integrin α5βι (Watarai et al. 1996). The predominant accumulation of ezrin and vinculin in N. gonorrhoeae infected primary cervical cells and the ability of these actin-associated proteins to directly interact with integrin molecules to initiate cellular responses (Clarke et al. 1977; Schmidt et al. 1998) make integrin molecules attractive candidates as potential gonococcal receptors that serve to initiate gonococcal-induced ruffling. Studies using the larynx carcinoma cell line, HEp-2, have demonstrated that gonococcal binding of fibronectin results in co-ligation of heparin sulphate proteoglycan (HSPG) to gonococcal Opa proteins and subsequent binding to the α5βt integrin (Νaumann et al. 1999). Ruffling was not observed to occur in these cells suggesting that gonococcal induction of ruffles may be unique to the cervical epithelium.
Investigation of male primary urethral cells has shown that some gonococci can enter these cells by focal macropinocytosis, but no evidence of ruffling was seen. This would suggest that perhaps a cell surface molecule unique to the cervical epithelium may be involved in ruffle induction and that gonococci invoke membrane ruffles by a mechanism distinct from that observed for Shigella. Salmonella and Shigella share many common characteristics with respect to their ability to induce membrane ruffles; however, they each also display ruffling characteristics that are unique to their genus. Through co-evolution with their exclusive human hosts the pathogenic Neisseria have developed several mechanisms by which they successfully persist in the general population. Previous studies of N. gonorrhoeae have demonstrated the ability of these organisms to invade eukaryotic cells by receptor-mediated endocytosis, microtubule- dependent endocytosis, and zippering. Here yet another mechanism by which gonococci are able to exploit their human host is described. Ruffling, via a triggering mechanism, has not been observed to occur in male primary urethral cells, tissue culture cell lines, or FTOC nor has ruffling been described to occur with Neisseria meningiditis infections. Ruffling of primary cervical cells, which is induced with gonococcal infection, therefore, is a novel finding.
EXAMPLE 2 Complement Receptor 3 (CR3) Is the Factor Responsible for Ruffling Tissues and Cell Culture. Surgical biopsies derived from the endo- and the ectocervix that were used to seed primary cervical epithelial cell systems were procured and maintained as described (Example 1 above) in Defined Keratinocyte Serum Free Medium (dk-SFM) (Life Technologies, Rockville, MD). Urethra epithelia was obtained from adult males undergoing uro logic surgery at the University of Iowa Hospitals and Clinics and used to seed primary urethral cell culture systems as described by Harvey et al. (1997). Primary male urethral cells were immortalized with the E6 and E7 genes from the Human Papilloma Virus prior to use. E6E7 immortalized human ectocervical keratinocytes (HCK) and endocervical (Endl) cells (generously provided by A. Klinglehutz (University of Iowa, Iowa City, IA) and D. Anderson (Fearing Research Laboratory, Boston, MA), respectively) were cultured in dk-SFM. ME 180 cervical
carcinoma cells (ATCC # HTB-33) were cultured in McCoy's 5A medium (Life Technologies) according to ATCC recommendations. HeclB endometrial carcinoma cells, Chinese hamster ovary cells (CHO-K1), and K562 myeloid cells were maintained in RPMI tissue culture medium (Life Technologies). CR3 -expressing CHO (CHO-CR3) and K562 (K562-CR3) cells were maintained in RPMI-G418 (100 μg/ml). CHO cells were generously provided by L. A. Allen and L. Schlsinger (University of Iowa) with permission from D. Golenbock (Boston Medical Center, Boston, MA). E. Brown (University of Calif, San Francisco, CA) generously provided K562 and K562-CR3 cells. McCoy's 5A and RPMI media were replaced with dk-SFM 48 h prior to infection studies. Surgical biopsies derived from the fallopian tube, endometrium, endocervix, ectocervix, vas deferens, and the male and the female urethra that were to be used for immunohistochemical tissue analysis were processed for cryosectioning as previously described in Example 1 above. Clinical biopsies derived from the cervix of women with documented gonorrhea were provided by D. Fortenberry (Indiana University School of Medicine, Indianapolis, IN) and were processed for immunohistochemical analysis as previously described in Example 1 above. Bacteria and Infection Studies. N. gonorrhoeae strains 1291, 1291-green, FA1090-green, and MSI 1 -green were used in the infection studies described below. N. gonorrhoeae strains 1291-green, FA1090-green, and MSI 1 -green express green fluorescent protein and will be described elsewhere; the plasmid pLES98 was a gift from V. Clark (University of Rochester, Rochester, ΝY). N. gonorrhoeae 1291 and FA1090- and MSI 1 -green parental strains (N. gonorrhoeae FA 1090 and MSI 1-A, respectively) are clinically isolated gonococci. N. gonorrhoeae FA1090 is a serum-resistant, genital isolate from a patient with disseminated gonococcal infection. N. gonorrhoeae 1291 is a serum- sensitive, urethral isolate obtained from a male patient with gonococcal urethritis. N. gonorrhoeae 1291, 1291-green, and MSl l-green contain the pathogenicity island described by Dillard et al. (1999). For infection studies bacteria were allowed to grow overnight (37 °C, 5% CO2) on GC-IsoVitaleX agar plates prior to harvesting with a sterile swab and resuspending in sterile saline. Culture density was determined spectrophotometrically where an optical density of 1 at 600 nm was equivalent to 109 bacteria/ml. Bacterial cultures were further diluted in dk-SFM to a density of 107
bacteria/ml and used to infect cell monolayers at a multiplicity of infection of 100. Infection was allowed to progress for variable time periods after which the infection medium was removed and the cell monolayers were extensively washed with phosphate- buffered saline (PBS) prior to fixation with 2% paraformaldehyde. Uninfected, control cell monolayers were simultaneously processed with challenged cell monolayers.
Infected and uninfected (control) cell monolayers were subsequently processed for Laser Scanning Confocal Microscopy (LSCM), Scanning Electron Microscopy (SEM), or Transmission Electron Microscopy (TEM) as described previously in Example 1 above; or the cells were harvested for immunoprecipitation assays. Immunolabeling and Microscopy. Immunolabeling of frozen tissue sections and cell monolayers was performed as described in Example 1 above. Primary antibodies used for immunolabeling were specific for CDllb (H5A4 (Developmental Studies Hybridoma Bank (DSHB), the University of Iowa, Iowa City, IA) and Bearl (Immunotech, Marseille, France)) or CD 18 (anti-CD 18 (Santa Cruz Biotechnology, Santa Cruz, CA) and LB4, generously provided by E. Brown (University of Calif.)).
Tetramethyl rhodamine isothiocyanate (TRITC)- or fluorescein isothiocyanate (FITC)- conjugated secondary antibodies were applied to cell monolayers and bacteria, as noted. Uninfected, tissue cryosections were labeled with FITC -conjugated secondary antibodies and counter stained with ethidium bromide (0.5 ng/ml, 6 min). Clinical biopsy cryosections were incubated with 2C3 and anti-CD 18 primary antibodies followed by immunolabeling with TRITC- and FITC-conjugated secondary antibodies, respectively. The 2C3 monoclonal antibody recognizes the H.8 gonococcal surface protein. Infected and uninfected (control) K562 and K562-CR3 cells to be used for TEM analysis were labeled with colloidal-gold secondary antibodies as indicated, immunolabeled cryosections, cell monolayers, and K562 cells were viewed using the Bio-Rad MRC- 1024, the Zeiss 510 Laser Scanning Confocal, or the H-7000 (Hitachi Coφ., CA) transmission electron viewing systems. Primary cervical cell and CHO cell monolayers processed for SEM analyses were viewed using the Hitachi S-4000 scanning electron microscope. Immunoprecipitation and Western Blot Analysis. Immunoprecipitation was performed as described by Wen et al. (2000). Anti-CD 18 or H5A4 were used as capture
antibodies. Western blotting was subsequently performed using monoclonal antibodies to gonococcal porin (3H1), pili (TE8G8), or to the opacity associated outer membrane proteins, Opa, (4B12), all of which were generously provided by M. Blake (North American Vaccine, Beltsville, MD). Antibody 6B4, which recognizes the Galβl- 4GlcNAc conserved epitope of gonococcal lipooligosaccharide (LOS), was used to probe for the association of LOS with CR3. Inhibition of N. gonorrhoeae Attachment and Invasion. Primary cervical cell monolayers, CHO-CR3 and -Kl cells, and K562-CR3 and K562 cells were pretreated (30 min, 4°C) with 20 μg/ml H5A4, Bearl, LB4, or anti-CD 18 antibody competitors prior to infection with gonococci as outlined above. Where indicated anti-CD 18 blocking peptide (Santa Cruz Biotechnology) was included in the inhibition assay. Infected, control cell assays (devoid of antibody competitors) and uninfected, control cell assays (with anti- CR3 antibodies) were treated in parallel with inhibition assays. The ability of gonococci to bind primary cervical, K562-CR3, or CHO-CR3 cells in the presence or absence of antibody competitors was assessed by LSCM, TEM, or SEM qualitative analysis.
Quantitative analysis ofthe ability of gonococci to invade primary endo- and ectocervical cells and CHO-CR3 and -Kl cells was determined by standard gentamicin-resistance assays as described previously in Example 1 above and in which antibody competitors were included or excluded from the invasion assay as described above. Where indicated primary endo- and ectocervical cell monolayers were pretreated (2h, 37 °C) with 10 ng/ml Clostridium C3 neurotoxin prior to infection. The ability of anti-CR3 antibodies to inhibit gonococcal invasion was determined as a normalized function ofthe ability of gonococci to invade primary endo- and ectocervical cells and CHO cells in the absence of antibody inhibitors. A Kruskal-Wallis non-parametric analysis of variance was used to determine the statistical significance of invasion assays performed in the presence ofthe C3 neurotoxin.
Results Analysis of CR3 Expression in Tissue Biopsies. LSCM of surgical biopsies derived from the ectocervix, endocervix, endometrium, and fallopian tube revealed the presence of both the alpha and beta subunits of CR3. Immunolabeling of tissue sections
with anti-CD 18 and anti-CD 1 lb (H5A4) antibodies revealed comparable levels of immunofluorescence for each antibody in each ofthe tissues examined. CR3 expression appeared to be greatest in the ectocervix. Expression levels decreased progressively from the ectocervix to the upper female genital tract with a low level of CR3 expression being observed in the fallopian tube tissue. Immunohistological examination of male urethra and vas deferens tissues failed to reveal the presence of either CR3 subunit. Similarly, tissue derived from the female urethra failed to label positively for CR3. An isotype control antibody yielded no immunofluorescence. Analysis of CR3 expression in Primary Human Cervical Epithelial Cells. Consistent with results obtained by immunohistochemical examination of endocervical and ectocervical tissue biopsies, primary endo- and ectocervical epithelial cells labeled positive for both CDI lb and CD 18, and no immunofluorescence was observed with an isotype control. Equivalent fluorescence was observed with either anti-CD 18 or H5A4 antibodies. Immunofluorescence paralleled results obtained with immunohistological examination of tissue biopsies in that a lower level of expression was qualitatively observed in endocervical-derived cells in comparison to ectocervical-derived cells. LSCM analysis of infection studies using N. gonorrhoeae strains 1291, 1291-green, MSI 1 -green, and FA1090-green suggested that a higher level of CR3 surface expression occurred in the presence ofthe gonococcus. However, the level of CR3 expression in infected endocervical cells did not obtain that level observed for infected ectocervical cells. Infected ectocervical cells exhibited very high levels of CR3 expression. Co- localization of gonococci with CR3 was observed to occur by thirty minutes post- infection; however, the gonococcus-CR3 association became more prominent by ninety minutes and three hours post-infection. Analysis of CR3 Expression in Immortalized Epithelial Cells. In contrast to results obtained with primary cervical epithelial cells, cervical and endometrial carcinoma cell lines (ME180 and HeclB, respectively) failed to demonstrate CR3 expression as determined by LSCM. CR3 could not be identified on E6E7 transfected endo- and ectocervical or male urethral cells by immunofluorescence using anti-CD 18 antibody or monoclonal antibody H5A4. Infection of these cell lines with gonococci revealed the presence of minimal amounts of CD 18 after ninety minutes and three hours; however, in
comparison to results obtained with the primary cervical cells, the level of CR3 expression in the immortalized and carcinoma-derived cells was negligible. CDI lb expression was not observed in ME 180, HeclB, HCK, or Endl cells subsequent to gonococcal infection. Western Blot Analysis Confirmed the Presence of CR3 in Primary Cervical
Cells. To confirm the presence of CR3 in primary cervical epithelial cells immunoprecipitation was performed in which an antibody to CDI lb or CD 18 was used to capture CR3. Confirmation of CR3 expression was subsequently demonstrated by Western Blot analysis using antibodies to CD 18 or CDI lb and chemiluminescence. immunoprecipitation using the monoclonal antibody, H5A4, specific for CDI lb and subsequent western blotting with anti-CD 18 antibody revealed the presence of an approximately 90 kDa band consistent with CDI 8. The reverse experiment, in which immunoprecipitation was performed with an anti-CD 18 antibody and which the respective western blot was probed with H5A4, demonstrated the presence of an approximately 150 kDa band indicative of CDI lb. Parallel immunoprecipitation and Western Blot experiments using male urethral epithelial cells did not reveal the presence of either CR3 subunit. Control immunoprecipitation experiments in which the H5A4 or anti-CD 18 capture antibody was omitted, or in which an isotype control was used as the capture antibody, failed to show the 90 or 150 kDa bands with subsequent western blotting. CR3 Associates with N. gonorrhoeae Porin, Pilus, and Opa Proteins. To confirm LSCM analysis of gonococcal co-localization with CR3, immunoprecipitation was performed in which antibodies to CDI lb or CD 18 were used to capture CR3 on infected and uninfected primary endo- and ectocervical cells. The association of gonococci with CR3 was subsequently examined by Western Blot analysis using antibodies to gonococcal porin, opa, or pili proteins or to LOS. Membranes probed with antibodies to LOS failed to reveal a CR3 association. Western blots probed with the monoclonal antibodies; 3H1, specific for gonococcal porin, IE8G8, specific for gonococcal pili, or 4B12, which recognizes a conserved epitope of gonococcal Opa proteins, revealed that these proteins associated with CR3 present on primary endo- and ectocervical epithelial cells. Antibody probes to porin, Opa, pili, and LOS did not reveal
the presence of these N. goworrboeαe-associated molecules in uninfected endo- and ectocervical cells. Immunoprecipitation (control) experiments in which the antibody to CR3 was omitted also failed to demonstrate the presence ofthe gonococcal-associated molecules examined. Anti-CR3 Antibodies Inhibit N. gonorrhoeae Binding to Cell Surfaces. To more closely examine the association ofthe gonococcus with CR3 TEM and SEM analysis was performed ofthe ability of N. gonorrhoeae to bind CR3-transformed K562 myeloid cells and CHO cells in the presence of antibodies to both the alpha and beta subunits of CR3. TEM analysis demonstrated N. gonorrhoeae binding to K562-CR3 cells and inhibition of N. gonorrhoeae binding in the presence ofthe anti-CR3 antibodies H5A4, Bearl, LB4, and anti-CD18. Similar results were obtained with SEM analysis of infected endo- and ectocervical cells and CHO-CR3 cells. Binding of gonococci could be inhibited by the addition ofthe same anti-CR3 antibodies. Binding inhibition that occurred in the presence of anti-CD 18 could be reversed by the addition ofthe anti-CD 18 blocking peptide to the infection assay. Binding of gonococci to CHO-Kl (control) cells, which do not express CR3, was not observed. _V. gonorrhoeae Co-localizes with CD18 in vivo. The studies outlined above demonstrate that CR3 serves as a receptor for gonococcal attachment and invasion ofthe cervical epithelium in vitro. To determine if CR3 is bound by the gonococcus in vivo, LSCM analysis was performed of cervical biopsies derived from women with documented gonorrhea. Immunolabeling of these tissue cryosections demonstrated the presence of CD 18 as a green fluorescence and gonococci as a red fluorescence. Gonococci were found to co-localize with CD 18, which was visible as a yellow fluorescence. Co-localization was confirmed as a profile plot where the individual fluorescence of each fluorophore (within a designated area of presumed co-localization) was recorded and plotted, individually, by the Zeiss 510 Laser Scanning Confocal viewing system (FIGS 9 A, B). These studies confirm in vitro studies using primary endo- and ectocervical cells and provide evidence that CR3 can serve as a receptor for N. gonorrhoeae infection in vivo. Binding of CR3 Stimulates Membrane Ruffling. Extensive membrane ruffling of N. goworrboeαe-infected K562-CR3, CHO-CR3, and primary cervical cells was
observed by TEM, SEM, and LSCM analysis. Ruffles were observed in the presence of gonococci or gonococci in the presence of anti-CR3 antibody, but membrane ruffles were not observed in uninfected cells to which antibody had not been added. Uninfected endocervical, ectocervical, and CHO-CR3 cell monolayers treated with the anti-CR3 antibodies H5A4, Bearl, EB4, and anti-CD 18 also revealed extensive membrane ruffling by SEM analysis. Membrane ruffling was most pronounced with the use ofthe anti- CD18 antibody, LB4. Control assays using CHO-Kl cells failed to reveal the presence of membrane ruffles. These studies suggest that engagement of these cells by anti-CR3 antibodies can initiate membrane ruffling. N. gonorrhoeae Invasion of Primary Endocervical and Ectocervical Cells is
Dependent on CR3. Standard gentamicin-resistance assays of infected endo- and ectocervical cells performed in the presence of antibodies to both the alpha and beta subunits of CR3 confirmed results obtained by TEM and SEM analysis of CR3- transfected myeloid and CHO cells. The addition of anti-CDl lb and anti-CD18 antibodies to the invasion assays resulted in greater than 93% invasion inhibition of both endo- and ectocervical cells (FIG. 2) with greatest inhibition (99.86% for endocervical cells, 100% for ectocervical cells) being observed with the addition ofthe anti-CDl lb monoclonal antibody, H5A4. Invasion inhibition that occurred in the presence ofthe anti-CD 18 antibody could be reversed by the addition (to the invasion assay) of a blocking peptide to the anti-CD 18 antibody. Pretreatment of endo- and ectocervical cells with Clostridium C3 neurotoxin, which inactivates the effector domain ofthe Rho subfamily of GTPases, also significantly inhibited gonococcal invasion supporting a role for CR3-mediated phagocytosis (FIG. 3). EXAMPLE 3 Identification of Inhibitory Peptides The present inventors have a phage display library that contains 100 million different copies of 15-mer amino acids. This library is used to screen for phage particles that bind to the CR3 receptor. Briefly, the library is amplified and approximately 1012 phage are applied to a petri dish contain CHO cells expressing CR3. The phage are allowed to interact with the cells for 1 hour and the dish is washed to remove unbound
phage. The bound phage are released with a high pH (9.6 -10) buffer, reamplified and the process repeated six more times to enrich for phages particles specific for the CHO-CR3 cells. After the final enrichment, the resulting phage are placed over CHO cells lacking CR3. In this case, the unbound phage (containing CR3 binding peptides) are collected after one hour and amplified, and this process repeated six times. At that point, enriched CR3 binding phage are plaque purified and tested for the ability to inhibit gonococcal interaction with CHO-CR3 cells. It is estimated that 100 plaque purified phages will be examined to find a phage that inhibits this interaction. When this phage is identified, the 15 mer peptide is sequenced and the peptide synthesized. Gonococcal-CHO-CR3 inhibition studies are then performed with the purified peptide.
EXAMPLE 4 Radiolabeling and Collection of Gonococcal Products Released with Infection of Primary Cervical Cells. Gonococci allowed to grow overnight on GC agar were harvested with a sterile swab and used to inoculate 5 ml cultures of Morse's Defined Medium (MDM). MDM was prepared such that half the recommended methionine and cysteine was replaced with 125 μCi Redivue Pro-mix L-[35S] in vitro cell labeling mix (Amersham Pharmacia Biotech Inc, Piscataway, NJ). After approximately 4 h gonococci were collected by centrifugation (4000 φm, 5 min), rinsed with sterile physiological saline to remove excess label, and resuspended in cold MDM such that a culture density of 107 bacteria ml" 1 was obtained. MDM containing the 5S-labeled gonococci was then used to infect approximately 105 primary, human, ecto- and endocervical cells or 35 mm tissue culture dishes devoid of cervical cells. Prior to infection ecto- and endocervical cells were pretreated (30 min, 37° C) with 250 mM cycloheximide to inhibit cervical cell protein synthesis. Cycloheximide was maintained in the culture medium through out the course ofthe infection. Cervical cells and tissue culture plates lacking cervical cells were challenged with gonococci for 90 min and 3 h time periods after which the culture supernatants were collected. Gonococci were removed from the culture supernatants by
filtration through low-protein binding 0.22 μm syringe filter units. Supernatant filtrates were concentrated using Centricon YM-3 centrifugal filter units (Millipore Coφoration, Bedford, MA) prior to suspension in IM Tris-1% SDS. Concentrated supernatants were separated on a SDS 12% to 4% polyacrylamide gradient gel prior to gel-extraction for mass spectrometry at the Mass Spectrometry Facility located at the University of California (San Francisco, CA). Analysis of mass data was performed using Protein Prospector (University of California San Francisco, CA) (Clauser et al, 1999) and ProFound (Rockefeller University, New York, NY) (Zhang et al, 2000) database systems for protein identification. During in vitro infection of primary endocervical and exocervical cells, the inventors have found that there is a 60 to 90 minute delay in the onset of ruffle formation after infection begins. This suggested as one possibility that the gonococcus must be releasing a factor that needed to be at a critical concentration to be effective to induce • _ _ ruffling. Using bacteπa labeled with S cysteine/methionine, the inventors studied the tissue culture supernatant being released by the bacteria (FIG. 10). Using mass spectroscopy and proteomic analysis of a SDS-Gel, the inventors identified a number of the proteins being released by the bacteria. These proteins include the following (see, FIG. 11): gonococcal protein pl77, gonococcal protein p88, gonococcal protein p64, gonococcal protein p55, gonococcal protein p46, gonococcal porin, gonococcal pilE, and gonococcal pilC. Five of these proteins have not been previously described as important in gonococcal pathogenesis (pl77, p88, p64, p55, and p46). Homologues of three ofthe five genes are present in the Neisseria meningitidis genomic database. The inventors have confirmed that the genes for two ofthe proteins (pl77 and p55) were present in gonococcal DNA. Protein pl77 encodes a 100 amino acid region that has high homology to the filamentous hemagglutinin of Bordetella pertussis. This protein is a bridging molecules (can span two structures) that has been shown capable of engaging and activating CR3. Protein p55 has enzymatic activity that involves modification of phospholipid membranes and could be involved in modification ofthe cell membrane enhancing bacterial entry.
EXAMPLE 5 Inhibition of Cellular Invasion by Neisseria gonorrhoeae Experiments have been performed showing that recombinant murine I-domain from the Alpha-subunit ofthe complement type 3 receptor inhibits Neisseria gonorrhoeae from invading primary human cervical cells. The recombinant murine I-domain (rl domain) is a 23 kilodalton peptide that contains Myc and His domains. It is recognized by monoclonal antibodies specific for human CR3 I-domain. The amino acid identity to the human I domain is over 90%. The amino acid sequence ofthe peptide is given below (SEQ LD NO: 11).
FPQQESDINFLroGSGSljNrNroFQKMKEFVSTVMEQFKXSKT^^ EFRfflFTFtNTDFK-RNPSPRSHVSPIKQLNGRTKTASGπiKVVRELFHKTNGAR ENAAKILVVITDGEKFGDPLDYKDVIPEADRAGVΓRYVIGVGNAFNKPQSR RELDTIASK-PAGEHVFQVDNFEALNTIQNQLQEKIFAIPAAASFL
The peptide is encoded by the nucleotide sequence given below (SEQ LD NO: 12).
TTCCCTCAGCAGGAGAGTGACATTCTCTTCTTGATTGATGGCTCCGGTA GCATCAACAACATTGACTTTCAGAAGATGAAGGAGTTTGTCTCAACTG TGATGGAGCAGTTCAAAAAGTCTAAAACCTTGTTCTCTTTGATGCAGT ACTCGGACGAGTTCCGGATTCACTTCACCTTCAATGACTTCAAGAGAA ACCCTAGCCCAAGATCACATGTGAGCCCCATAAAGCAGCTGAATGGGA GGACAAAAACTGCCTCAGGGATCCGGAAAGTAGTGAGAGAACTGTTT CACAAAACCAATGGGGCCCGGGAGAATGCTGCCAAGATCCTAGTTGTC ATCACAGATGGAGAAAAATTCGGTGATCCCTTGGATTATAAGGATGTC ATCCCCGAGGCAFACAGAGCAGGGGTCATTCGCTACGTAATTGGGGTG GGAAATGCCTTCAACAAACCACAGTCCCGCAGAGAGCTCGACACCATC GCATCTAAGCCAGCTGGTGAACACGTGTTCCAAGTGGACAACTTTGAA GCCCTGAATACCATTCAGAACCAGCTTCAGGAAAAGATCTTTGCAATT CCCGCGGCCGCCAGCTTTCTA
Studies were performed evaluating the ability ofthe rl-domain to inhibit adherence and invasion of primary human ectocervical cells by Neisseria gonorrhoeae. The cervical cells were infected with IO N. gonorrhoeae strain 1291. The results of these studies are shown in table 2 below. Recombinant I-domain is a potent inhibitor of ectocervical cell association by Neisseria gonorrhoeae. As little as 1 ng of rl-domain gives over 90% inhibition of invasion. With decreasing amounts of rl-domain the inhibition decreases in a dose dependent fashion.
Table 2
Individual, smaller peptides based on the sequence of rl-domain duplicate the inhibitory activity ofthe rl-domain.
EXAMPLE 6 Phospholipase D (PLD) of Neisseria gonorrhoeae and Neisseria meningitidis Phosphohpase D (PLD) is an important molecule involved in cell signaling. It hydrolyzes phosphatidylcholine (PC) to phosphatidic acid (PA) and choline in response to various extracellular stimuli. Phosphatidic acid has been implicated as a lipid second messenger to a variety of extracellular stimuli. Phosphatidic acid has been implicated as a lipid second messenger in the regulation of protein kinases, GTPase-activating proteins, PI kinases, adenyl cyclase and other signaling molecules. Phospholipase D has been
implicated in membrane trafficking and vesicular transport, in which processes, acidic phospholipids may facilitate membrane budding and/or fusion. Two biochemically distinct phospholipase D activities have been characterized. One is dependent upon the small GTPase Arf and upon phosphatidylinositol 4, 5- bisphosphate (PLP2) and another is stimulated by oleate. Phospholipase D activation by v-Src depends upon a GTPase cascade containing Ras and Ral. Ral constitutively associates with phospholipase D through Ral's novel amino terminus. Evidence also implicates Rho in phospholipase D activation suggesting a complex inteφlay of multiple small GTPases. The present inventors have found that polypeptide p55 is neisserial phospholipase
D (PLD) (FIG. 11). PLD is released from gonococci when exposed to primary human cervical epithelial cells (FIG 12). Identification ofthe gene encoding N. gonorrhoeae PLD, e.g., SEQ LD ΝO:9, SEQ LD NOJ3, SEQ ID NOJ5 and SEQ LD NO.J7, which encode the polypeptides SEQ LD NO:4, SEQ ID NOJ4, SEQ ID NOJ6 and SEQ LD NOJ8, respectively, is disclosed herein. Also disclosed herein is identification of the pld gene from N. meningitidis SEQ LD ΝOJ9 encoding the PLD polypeptide SEQ LD NO:20. The Neisserial ?/- DNA sequences disclosed herein were compared to other Neisserial genome sequences. Analysis revealed a more than 99% identity between a N. gonorrhoeae 1090 pld nucleic acid sequence (SEQ ID ΝO:25) and a more than 99% identity between a N. gonorrhoeae 1291 pld nucleic acid sequence (SEQ ID ΝO:27) to the Neisserial genomic sequence at the University of Oklahoma's database (SEQ LD NO:26); and a 96% identity between SEQ ID NO:25 and a 97% identity between SEQ LD NO:27 to the Neisserial genomic sequence at the Sanger database (SEQ ED NO:24). In addition, disclosed herein is the construction of a mutant in this gene in both Neisseria gonorrhoeae and N. meningitidis, which mutants do not produce the PLD enzyme (Tables 3 and 4). The mutants have been designated 1291ΔPLD and NMBΔPLD, respectively.
Table 3
Table 4 A. Cervical Cell Lysates
The present inventors cloned the gene encoding PLD, i.e., pld, from Neisseria gonorrhoeae and N. meningitidis, and have expressed the neisserial PLD in Escherichia coli using the pBAD Directional TOPO Expression Kit (Invitrogen, Carlsbad, CA) according to the manufacturer's protocol. A. Gonococcal PLD Primary ecto- and endocervical cell monolayers were pretreated and maintained with cycloheximide as described in Example 1, above, to inhibit the protein synthesis of the monolayer cells. At variable times post-infection (90 minutes and 3 hours), infection supernatants were collected from gonococci-infected and uninfected cervical cell monolayers. Supernatant filtrates were concentrated using Centricon YM-3 centrifugal filter units (Millipore) before suspension in 0JM Tris-0J% SDS. Concentrated supernatants were separated (18 mA) on a SDS 12% to 4% polyacrylamide gel. Secreted products were originally identified by autoradiography. Subsequent gels were stained with Coomassie Blue for mass spectroscopy analysis, which was performed at the Mass Spectrometry Facility located at the University of California (San Francisco, CA). While gonococcal porin and pilus have been implicated in N. gonorrhoeae pathogenesis, PLD has not been described in the gonococcus. Gonococcal phospholipase D (FIG. 11) is of interest because it is required for complement mediated endocytosis in professional phagocytic cells. Analysis of infection supernatants demonstrated that gonococcal products are released upon infection of cervical epithelia. Similar results are observed upon analysis of supernatants obtained from 90 minute and 3 hour infections, from ecto- and endocervical cells, and from these same cells obtained from different tissue donors (FIG. 11). To determine if gonococcal proteins released upon cervical infection were specific to cervical cell invasion, these studies were repeated using male urethral epithelial cells
(FIG. 12). Briefly, autoradiography of pulse-labeled gonococci and Coomassie-stained gels were analyzed to determine if gonococcal products are secreted in response to infection of urethral epithelial cells. Coomassie staining was performed according to standard protocols, gels were then fixed in a methanol-acetic acid solution before staining over night at room temperature. Destaining was performed with 40% methanol with frequent exchange ofthe destaining solution with fresh 40% methanol, as needed. Analysis revealed that while protein products are released at 90 minutes post-infection, these proteins are not present by 3 hours of infection. Collectively, these data suggest that a small basal level of gonococcal products are released constitutively and that the continued release of gonococcal products was specific to gonococcal cervicitis. Thus, FIG. 11 and FIG. 12 show that gonococcal PLD is released preferentially in the presence of cervical epithelial cells.
B. Gonoccal PLD recruits CR3 PLD deficient gonococci were prepared as described hereinbelow. Both quantitative association and invasion assays, performed as described herein, demonstrate a role for gonococcal PLD in cervical cell infection (FIG. 13). PLD- deficient (when compared to wild-type) gonococci have impaired ability to adhere to and to invade primary cervical cells. The decrease in adherence observed for mutant gonococci may be indicative ofthe inability of these bacteria to elicit up-regulation of CR3 surface level expression. The striking decrease in the ability of these bacteria to invade cervical epithelia may suggest a role for gonococcal PLD in CR3-mediated endocytosis or engagement of an aberrant trafficking pathway once internalized, which does not permit gonococcal intracellular survival. These processes are restored when association and/or invasion assays are performed with PLD-mutant gonococci in the presence of primed wild-type supernatants (i.e., supernatants collected from a previous infection using wild-type gonococci and which have been filtered to remove bacteria), which would contain secreted gonococcal PLD. The exogenous addition of PLD from Streptomyces spp. to association and invasion assays of N. gonorrhoeae ΔPLD infected cervical cells does not compensate for the absence of gonococcal PLD. This suggests that
gonococcal PLD exhibits unique effector functions in addition to sharing structural and functional properties with Streptomyces spp. PLD. Methods for CR3 detection by confocal microscopy are described hereinbelow and in Edwards et al. (2001). Confocal microscopy suggests that PLD-deficient gonococci do not elicit up-regulation of CR3 surface level expression (FIG. 14). CR3 (CD18, CR3 β-subunit) was immunolabeled with a TRITC-conjugated antibody (commercially available from Sigma and Jackson ImmunoResearch, West Grove, PA) and was visible as a red fluorescence. Gonococci were immunolabeled with an antibody to the highly conserved outer membrane protein, H.8 (antibody 2C3). Application of a FITC-conjugated secondary antibody (commercially available from Sigma and Jackson ImmunoResearch, West Grove, PA) allowed visualization of gonococci as a green fluorescence. Co-localization of CR3 with gonococci appeared as a yellow fluorescence because ofthe combined signal ofthe two fluorophores (FIG. 15). After 3 hours of infection of primary cervical cells with wild-type gonococci, CR3 was readily visible on the cervical epithelial surface, and the vast majority of gonococci were co-localized with this receptor. In contrast, infection with PLD-mutant gonococci revealed that only a small, sub-population of cervical cells still express CR3 on their surface. Additionally, a significant proportion of mutant gonococci are not co-localized with CR3. As described hereinbelow, primary cervical cells were seeded in 96-well microtiter plates to comparatively quantitate surface level expression of CR3. In the procedure, cells were (i) uninfected; (ii) challenged with wild-type gonococci; (iii) challenged with PLD-mutant gonococci; and/or (iv) challenged with filtered, primed (see infra) wild-type or PLD-mutant gonococcal supernatants. After removal ofthe infection supernatant, cell monolayers were rinsed, fixed and subsequently labeled with an antibody (anti-CDl lb antibody H5A4; Hildreth and August, 1985) specific for the CR3 I- domain subunit followed by an HRP antibody-conjugate (commercially available from Kirkegaard & Perry Laboratories, Gaithersburg, MD) using standard ELISA protocols. Absorbance ofthe o-phenylenediamine dihydrochloride peroxidase substrate was determined spectrophotometrically at 490 nm (FIG. 15). These data indicate that gonococcal PLD facilitates the up-regulation of CR3 surface level expression and confirm the observations made by confocal microscopy.
FIG. 13, FIG. 14 and FIG. 15 show that gonococcal PLD enhances the invasiveness of gonococci through the recruitment of CR3.
C. Gonoccal PLD plays a role in membrane ruffling, leading to gonococcal invasion through phosphotyrosine and phosphothreonine signal transduction events Phospholipase D activation in mammalian cells is thought to occur early in the phagocytic process, before the onset of actin reorganization. To determine if gonococcal PLD plays a role in the cytoskeletal rearrangements leading to membrane ruffling ofthe cervical epithelium, scanning electron microscopy (SEM) was performed as described hereinbelow and as in Ketterer et al., 1999. SEM analysis demonstrated that aberrant cytoskeletal rearrangements occur upon infection of cervical epithelia with PLD-mutant gonococci, when compared to infection with wild-type gonococci (FIG. 16). Endocytosis mediated by CR3 requires receptor clustering. The absence of bacterial clusters in electro graphs taken of mutant gonococci at 3 hours post-infection may be reflective ofthe inability of these bacteria to elicit upregulation of CR3 or of their inability to initiate signaling cascades required for CR3 clustering (FIG. 16). Similarly, the absence of membrane ruffles in PLD infected cells suggests gonococcal PLD may be required to potentiate the cytoskeletal rearrangements required to form membrane ruffles. These processes are restored when assays are performed with PLD-mutant gonococci in the presence of primed supernatants as described above. No observable differences between mutant or wild-type gonococci were noted in the ability of gonococci to interact with each other or with cervical cells at earlier points of infection (i.e., less than 90 minutes).
D. Signal transduction Protein kinases (e.g., tyrosine kinases and protein kinase C (PKC)) play an integral role in CR3-mediated signal transduction in professional phagocytic cells.
Additionally, in eukaryotic cell systems phospholipase D activation triggers a complex signal transduction cascade. This signal transduction cascade involves PKC and protein tyrosine stimulation, as well as the activation of small G-protein binding-proteins. To determine if signal transduction initiated upon gonococcal infection ofthe cervical
epithelium is altered in the absence of gonococcal PLD, Western blot analysis of cervical cell lysates was performed. Western blotting was performed using standard protocols. Cervical cell lysates were harvested at variable times post-infection (0 minutes, 5 minutes, 10 minutes, 15 minutes, 30 minutes, 45 minutes, 60 minutes, 90 minutes, two hours, 2.5 hours, 3 hours and 4 hours) and lysed in a Tris-0J% SDS solution. Cell lysates were separated (18 mA) on a 4% to 12% gradient polyacrylamide gel and then transferred to Immobilon-P membranes (Millipore) over-night at 150 mA. Membranes were blocked 30 minutes in 0.25% bovine serum albumin (BSA)- tris buffered saline 0.5% tween-20 (TBST) at room temperature with rotation for two hours. Membranes were then incubated with an appropriate dilution ofthe primary antibody. The antibody solution was removed, and membranes were rinsed 5 times for ten minutes each in wash buffer (TBST). Membranes were then incubated (1 hour, room temperature with rotation) in BSA-TBST containing a 1:10,000 dilution ofthe appropriate HRP secondary antibody conjugate. Membranes were rinsed five times for 5-10 minutes per rinse in wash buffer. Following the final rinse, membranes were incubated in SuperSignal (Pierce) chemiluminescent substrate and allowed to stand approximately 5 minutes in the dark before exposure to BioMax MR film (Kodak). Western blot analyses of membranes probed with antibodies specific for phosphorylated tyrosine (anti-phosphotyrosine antibody obtained from Santa Cruz) or threonine (anti-phosphothreonine antibody obtained from Kirkegaard & Perry Laboratories) target residues revealed that alternative proteins serve as kinase and phosphatase targets in the absence of gonococcal PLD. (FIG. 17). The mass of each tyrosine kinase target (Table 5) and Ser-Thr kinase target (Table 6) was determined. Masses corresponding to targets unique to their specific experimental condition are shown in regular type, bold type corresponds to peptides too close in mass to be defined as different, and italicized type corresponds to a shared target.
Table 5
Table 6
Following RNA isolation and cDNA synthesis as described hereinbelow, multiplex RT-PCR was performed using the CytoXpress MPCR Kit for Human Inflammatory Genes Set-I according to manufacturer's protocol. The analysis of cytokine message levels provided further evidence that alternative signal transduction events are triggered in the absence of gonococcal PLD (FIG. 18). The most striking differences were observed in ectocervical cells in which the absence of gonococcal PLD resulted in decreased message levels of GAPDH, TNF-α, IL- 6, LL-8, and TGF-β when compared to wild-type infected cells. As shown in FIG. 18, gonococcol PLD is able to modify human cell signaling.
E. NMB PLD mutants The Neisseria meningitidis B PLD mutants were prepared as described hereinbelow.
F. NMB PLD augments cytokine cellular transcription Human PMNLs have been shown to react differentially when stimulated with pathogenic and nonpathogenic N. meningitidis (Kragsbjerg et al, 2000). Using multiplex RT-PCR, the present inventors detected a number of cytokine transcripts in N. meningitidis infected secondary bronchial epithelial cells. Multiplex RT- PCR was performed using the CytoXpress MPCR Kit for Human Inflammatory Genes Set-I (Biosource). Briefly, total RΝA was isolated from secondary bronchial epithelial cells infected with pathogenic N. meningitidis ΝMB and ΝMBcap- and the corresponding PLD mutants. PCR was set up using DΝA from uninfected primary (bronchial) cells
(lane 1, FIG. 19), NMB wild-type infected cells (lane 2, FIG. 19) and NMB PLD mutant infected cells (lane 3, FIG. 19), and primers for GAPDH, TNF-α, IL-lβ, GM-CSF, IL-8, IL-6 and TGF-β. Actin was used as an internal control. Multiplex RT-PCR was performed according to the manufacturer's protocol (BioSource) following RNA isolation and cDNA synthesis as described hereinbelow. Multiplex RT-PCR analysis of cytokine message levels provided evidence that, similar to gonococcal PLD, alternative signal transduction events are triggered in the absence of meningococcal PLD in primary human bronchial cells (FIG. 19). Differences in levels of cytokine message were restricted to un-encapsulated organisms, which is consistent with these organisms' ability to associate with and invade airway epithelia. As compared to uninfected cells or cells infected with wild-type meningococci, decreased cytokine message levels were observed in bronchial cells that were infected with PLD mutant meningococci. Example 7 By disrupting a neisserial pld gene, neisserial phospholipase D synthesis and/or function, e.g., enzymatic activity related to PLD such as the catalysis of phospholipase D- related hydrolysis and/or phosphatidyl-transferase reactions, is reduced, e.g., inhibited. Table 7 Mean PLD activity in A) uninfected and 1291 wild-type and 1291ΔPLD infected cervical cell lysates and in B) 1291 wild-type and 1291 ΔPLD gonococci. C) Assay controls
Example 8 Anti-PLD sera was generated by BioSource International (Camarillo, CA) by injecting rabbits with a peptide designed to the first HKD region of PLD ( RRMHNKSFTADNRAC comprising amino acids 181-195' (SEQ LD NO:21)). The anti- PLD antibody was screened for specificity to PLD using assays well-known to the art. This anti-PLD sera was found to inhibit PLD activity and the association and invasion of cervical cells by gonococci (Table 8).
Table 8 PLD Activity in presence or absence of 1307 anti-PLD Ab or 1307 pre-bleed serum A. PLD activity
B. Association of primary cervical cells
C. invasion of primary cervical cells
Example 9 2,3-diphosphoglycerate (DPG) is a specific inhibitor of PLD activity and inhibits gonococcal association and invasion of primary ecto- (pex) and endocervical (pen) cells (Table 9).
Table 9
Example 10 Experimental Procedures
1. Cell Culture. Surgical biopsies derived from the ecto- and the endocervix that were used to seed primary cervical epithelial cell systems were procured and maintained as described previously (Edwards et al., 2000) in Defined Keratinocyte Serum Free Medium (dk-SFM) (Life Technologies, Rockville, MD). The primary (uec) and immortal (tuec), male urethral epithelial cells used in these studies have been described (Harvey et al. 1997; Harvey et al. 2003) and were maintained according to the methods of Harvey et al. (1997, 2003).
2. Bacteria and Infection Studies. N. gonorrhoeae strains 1291 (Apicella, 1974; Dudas and Apicella, 1988), FA1090 (Cohen et al., 1994), and MS11 (Schoolnik et al., 1984; Segal et al., 1985) were used in the infection studies outlined below, which were performed as previously described (Edwards et al., 2000). Briefly, overnight cultures of gonococci were harvested from GC-IsoVitaleX agar plates with a sterile swab and resuspended in sterile physiological saline. Optical density ofthe bacterial suspension was determined spectrophotometrically where an optical density of 1 at 600 nm was equivalent to 109 bacteria ml"1. 107 gonococci were used to infect cervical cell monolayers at a multiplicity of infection of 100. Primary cervical cells were challenged with gonococci for variable time-periods (as noted) after which the infection medium was removed, and the cell monolayers were extensively washed with phosphate-buffered saline (PBS). Uninfected control cell monolayers were simultaneously processed with challenged cell monolayers. Infected and uninfected (control) cell monolayers were subsequently harvested for cellular fractionation, quantitative association (i.e., adherence
and invasion) or invasion assays, or they were processed for microscopic analyses. Alternatively (as noted), infection supernatants were harvested, immediately transferred to ice, and gonococci were then removed by filtration through a 0.22 μm filter. For PLD activity assays, supernatants depleted of gonococci were filtered using Centricon YM-30 centrifugal filter units (Millipore Coφoration, Bedford, MA). Protein products were then collected with an equal volume of PLD assay buffer. N. gonorrhoeae strain 1291 ΔPLD was constructed by the insertion of a kanamycin-resistance cassette using the EZ::TΝ <KAN-2> Insertion Kit (EPICENTRE, Madison, WI). Polymerase chain reaction (PCR) of full-length NgPLD, using the primer pair of 5'-GGT GGT CAT ATG ATG CAT ACA GAC CCC AAA AT- 3' (SEQ LD
NO:22) and 5'-GGT GGT TGCTCT TCC GCA TAA TAA ACC TTC TTC GAT GGG CAG-3' (SEQ LD NO. 23), suggested the insertion ofthe kanamycin-resistance cassette within the pld gene, which was then confirmed by sequence analysis performed at the University of Iowa DNA Sequencing Facility (Iowa City, IA). 3. Radiolabeling and Collection of Gonococcal Products Released with Infection of Primary Cervical Cells. Gonococci allowed to grow overnight on GC agar were harvested with a sterile swab and used to inoculate 5 ml cultures of Morse's Defined Medium (MDM) (Morse and Barenstein, 1980). MDM was prepared such that half the recommended methionine and cysteine was replaced with 125 μCi Redivue Pro-mix L- [35S] in vitro cell labeling mix (Amersham Pharmacia Biotech Inc, Piscataway, NJ). After approximately 4 hours, gonococci were collected by centrifugation (4000 φm, 5 minutes), rinsed with sterile physiological saline to remove excess label, and resuspended in cold MDM such that a culture density of 107 bacteria ml"1 was obtained. MDM containing the 35S-labeled gonococci was then used to infect approximately 105 primary, human, ecto- (pex) and endocervical (pen) cells or 35mm tissue culture dishes devoid of cervical cells. Alternatively, gonococci were labeled during the course of infection by a _ _
30-minute pulse with S-MDM at 1 hour and 2.5 hours post-infection. Before infection pex and pen cells were treated (30 minutes, 37° C) with 250 μM cycloheximide to inhibit cervical cell protein synthesis. Cycloheximide was maintained in the culture medium through out the course ofthe infection. Cervical cells and tissue culture plates lacking cervical cells were challenged with gonococci for 90 minutes and 3 hours after which the
culture supernatants were collected. Gonococci were removed from the culture supernatants by filtration through low-protein binding 0.22 μm syringe filter units. Supernatant filtrates were concentrated using Centricon YM-3 centrifugal filter units (Millipore) before suspension in 0JM Tris-0J% SDS. Concentrated supernatants were separated (18 mA) on a SDS 12% to 4% polyacrylamide gel before autoradiography or gel-extraction for mass spectrometry at the Mass Spectrometry Facility located at the University of California (San Francisco, CA). Analysis of mass data was performed using the Protein Prospector (University of California San Francisco, CA) and the ProFound (Rockefeller) mass analysis databases. 4. Determination of PLD Activity. PLD activity was accessed using the Amplex™ Red Phospholipase D Assay Kit (Molecular Probes, Eugene OR). Wild-type and PLD mutant gonococci were suspended in PLD assay buffer to a final concentration of 107 bacteria ml" ', and activity was determined according to the manufacturer's protocol. Assessment of PLD activity at acidic pH was determined in a two-step assay according to the manufacturer's protocol. For the first step, 108 gonococci were suspended in PBS with the pH adjusted to 3.0, 4.5, or 6.0. Gonococcal suspensions were diluted 10-fold in PLD assay buffer for the second step ofthe reaction. Cervical cell fractions were prepared as outlined below and PLD activity was assessed at neutral pH according to the manufacturer's protocol. 5. Fractionation of Primary Cervical Cells. Uninfected (control) and infected cervical cell monolayers were lysed in buffer A (50 mM tris, pH 7.5; 10 mM NaCl, 1 mM KC1; 2 mM MgCl2, 1 mM PMSF) by scraping cervical cells from tissue culture dishes placed on ice. The cell lysate was sonicated (two bursts of 20 seconds each). Cell debris and the nuclear fraction was removed by centrifugation (750 X g, 10 minutes), and the supernatant from this spin was then subjected to filtration through a low-protein binding 0.22 μm syringe filter to ensure removal of gonococci. Alternatively, gonococci were removed by immunoprecipitation (as described by Wen et al., 2000) using the monoclonal antibody, 2C3, which recognizes the H.8 outer membrane protein ofthe pathogenic Neisseria. Sucrose was added to the resulting gonococcus-depleted supernatant (Sl) to a final concentration of 300 mM. Ultracentrifugation (150,000 X g, 90 minutes) was then performed to produce the plasma membrane- (pellet) and cytosol
(supernatant 2, S2)-enriched fractions. The membrane-enriched fraction was resuspended in PLD assay buffer (50 mM Tris, 5 mM CaCl2, pH 8.0). S2 was concentrated by filtration through Centricon YM-30 centrifugal filter units (Millipore) after which cytosolic constituents were recovered in PLD assay buffer. Where indicated, prior to infection studies primary pex and pen cell monolayers were treated with 300 nM wortmannin (Sigma) (2 hours, 37°C) or 1 μM cytochalasin D (Sigma) (30 minutes, 37°C) to inhibit macropinocytosis of gonococci. Wortmannin and cytochalasin D were maintained in cervical cell cultures during the course of infection. 6. RNA Isolation and RT-PCR of Primary, Human, Cervical Epithelial Cells. Primary, pex and pen cell monolayers were challenged with N. gonorrhoeae 1291 or 1291 ΔPLD, or they were left uninfected. After 3 hours, infection supernatants were removed and cell monolayers were extensively rinsed with PBS. Total RNA (intracellular gonococcal and cervical cell RNA) was isolated using the RNAqueous- 4PCR kit (Ambion, Inc., Austin, TX) according to the manufacturer's protocol. Ribosomal RNA was removed from the total RNA using the MICROBExpress kit
(Ambion) according to the manufacturer's protocol, yielding message-enriched bacterial and cervical cell RNA. Cervical cell RNA was then separated from intracellular bacterial RNA using the Poly(A)Purist kit (Ambion) according to the manufacturer's protocol with slight modification. Supernatants from the capture and wash steps, which contained gonococcal RNA, were saved and pooled. Gonococcal RNA was recovered by ethanol precipitation. cDNA was synthesized using RETROscript™ First Strand Synthesis Kit for RT-PCR (Ambion); reactions lacking the reverse transcriptase (RT) (negative control) were run simultaneously with reactions containing RT. PCR analysis of reverse- transcribed and of mock reactions using primers to α-actin and to gonococcal reduction modifiable protein (Rmp) demonstrated the absence of contaminating DNA and of gonococcal DNA and RNA in the isolated cervical cell RNA. PCR of reverse-transcribed cervical cell RNA was performed using the primer pairs 5'-TCC ATG CAA GAA TCT GGT TTC-3' (SEQ LD NO:28) and 5'-CGA CAA TGA GCA CAG ACT CAC A-3' (SEQ LD NO:29) for human PLD1 to yield a 462 bp product and 5'-CCT TCA GGA TTC TGT CCA CAA-3* (SEQ ID NO:30) and 5'-CCT CTC TCA CAA CCA ATT CTT C-3' (SEQ LD NO:31) for human PLD2 to yield a 508 bp product.
7. Determination of CR3 Surface Expression on Primary Cervical Cells. Pex and pen cells were passed to 96-well microtiter plates and allowed to grow to confluence. Cervical cells were then challenged with wild-type or PLD mutant gonococci after which the infection medium was removed and cells were rinsed thrice with PBS. Cells were fixed with 2% paraformaldehyde. Prior to immuno-analysis of CR3 surface level expression, cells were again rinsed with PBS. Immunoassays were then performed according to standard ELISA protocols using the H5A4 anti-CDl lb (i.e., CR3) primary and peroxidase-conjugated secondary antibodies. Absorbance ofthe o-phenylenediamine dihydrochloride peroxidase substrate was determined spectrophotometrically at 490 nm. Primary antibody was omitted from one well, and the secondary antibody was omitted from a second well, which served as a control for endogenous peroxidase activity. Where indicated 200 nM phorbol myristate (PMA), 200 nM 4-α phorbol, 100 μM pervanadate, 3 mM hydrogen peroxide, or gonococci-depleted supernatants collected from wild-type or PLD mutant infection studies were included in the infection studies as outlined below. Gonococcal PLD augments cytokine cellular transcription Alternative functional responses occur within cervical cells in the absence of gonococcal PLD. The data herein indicate that tyrosine and serine-threonine kinases play an integral role in CR3-mediated gonococcal cervical invasion. Pervanadate, a tyrosine kinase activator/phosphatase inhibitor, or PMA, an activator ofthe serine-threonine kinase, PKC, were included in infection studies to determine if protein kinase activation could rescue the observed decrease in CR3 recruitment and cervical cell association and invasion, which occurs in the absence of gonococcal PLD (FIG. 21 A and FIG. 2 IB). These data indicate that tyrosine kinase activation rescues CR3 recruitment, but it is not sufficient to allow gonococcal intracellular survival in the absence of gonococcal PLD. Similarly, PKC activation rescues CR3 recruitment and partially restores intracellular survival of gonococci. The role for PLD in gonococcal cervicitis is multifactorial. PLD modulates signaling events upstream of PKC, which are required for gonococcal survival. PLD plays an early role in modulating signal transduction events leading to CR3 recruitment at the cervical cell surface.
8. N. gonorrhoeae Attachment to and Invasion of Primary, Human, Cervical Cells.
Primary cervical cell monolayers were infected with wild-type or PLD mutant gonococci as outlined above. Variable concentrations of Streptomyces spp. PLD (SsPLD) (Sigma), PMA, or 4-α phorbol were included in association (adherence and invasion) or invasion assays, as noted. Cervical cells were preincubated (30 minutes, 37 °C) with 200 nM PMA or 4-α phorbol before the addition of gonococci. 10 units ml"1 SsPLD was added simultaneously with gonococci. Alternatively, where noted, cervical cell monolayers were pre-incubated (30 minutes, 37°C) with pervanadate, which was made by mixing 100 μM ortho-sodium vanadate in 3 mM hydrogen peroxide. In separate assays, infection supernatants were collected from wild- type or PLD mutant-infected cervical cell monolayers, gonococci were removed by filtration through a 0.22 μm syringe filter (i.e., wild-type or mutant primed supernatants) and were added to association and/or invasion assays, as noted. The ability of gonococci to adhere to and/or invade pex and pen cells was quantitatively determined using standard gentimicin-resistance assays, performed as described previously (Edwards et al., 2000), and in which chemical or protein additives were included or excluded from the invasion assay as described above. The total association (i.e., adherence and invasion) of gonococci with pex and pen cells was quantitated by the omission of gentimicin from the above described invasion assay. Percent invasion of N. gonorrhoeae 1291 or 1291ΔPLDin the presence or absence of experimental additives was determined as a function ofthe original inoculum and the number of colonies formed with subsequent plating ofthe cellular lysate. A Kruskal- Wallis non-parametric analysis of variance was used to determine the statistical significance ofthe association and invasion assays described above.
9. Immunolabeling and Microscopy. Immunolabeling of N. gonorrhoeae 1291 or 1291 ΔPLD infected pex cell monolayers was performed as described previously
(Edwards et al., 2000). Primary antibodies used for immunolabeling were specific for the CR3 beta-subunit, CD 18 (anti-CD 18) (Santa Cruz Biotechnology, Santa Cruz, CA) or for the gonococcal H.8 outer membrane protein (antibody 2C3). FITC- and TRITC- conjugated secondary antibodies were applied to cell monolayers, as noted. Infected and uninfected (control) cell monolayers were viewed using the Bio-Rad MRC-1024 or the Zeiss 510 Laser Scanning Confocal viewing systems. Primary cervical cell monolayers
were processed for SEM analyses (as described by Edwards et al., 2000) and viewed using the Hitachi S-4000 scanning electron microscope. All the microscopes used in these studies are located at the Central Microscopy Research Facility at the University of Iowa (Iowa City, LA).
Results
Gonococcal PLD Acts at Multiple Levels in Cervical Cell Infection. Alternative functional responses occur within cervical cells in the absence of gonococcal PLD. Protein kinases (e.g., tyrosine kinases and protein kinase C (PKC)) play an integral role in CR3-mediated signal transduction in professional phagocytic cells. Additionally, extensive PLD activity occurs upon CR3 ligation with iC3b-opsonized particles. PLD activation also triggers a complex signal transduction cascade involving PKC and protein tyrosine stimulation as well as the activation of small G-proteins. Pervanadate, a potent phosphatase inhibitor/tyrosine kinase activator, or PMA, an activator ofthe serine- threonine kinase, PKC, were included in infection studies to determine if protein kinase activation could rescue the observed decrease in CR3 cell surface recruitment and cervical cell association and invasion by PLD mutant gonococci. The addition of pervanadate to infection studies demonstrated that tyrosine kinase activation rescues CR3 recruitment in the absence of NgPLD, but it is not sufficient to allow the intracellular survival of PLD mutant gonococci. No effect was observed in the association or invasion of wild-type or mutant gonococci with cervical cells or with CR3 cell surface recruitment with the addition of 3 mM hydrogen peroxide (negative control) to infection assays. Similarly, PKC activation by the addition of PMA to infection studies rescued CR3 recruitment to the cervical cell surface and partially restored intracellular survival of PLD mutant gonococci. The addition of PMA to uninfected cervical cell monolayers increased CR3 surface level expression to levels comparable to those observed with wild-type infected cells, suggesting PKC plays a critical role in CR3 recruitment to the cervical cell surface. The addition of 4- α-phorbol, a non-activating analog of PMA, had no affect on gonococcal association with or invasion of cervical epithelia or on CR3 cell surface recruitment. Collectively, these data indicate that NgPLD exerts multiple effects on cervical epithelia during gonococcal infection.
Discussion Phospholipases play critical roles in many important cellular functions. All members ofthe PLD superfamily contain (usually) two HKD motifs, which are thought to associate to form a catalytic center. Within this superfamily, unique to PLD is the ability to catalyze a transphosphatidylation reaction in which a primary alcohol preferentially serves as a nucleophilic acceptor instead of water, resulting in the near-exclusive production of a phosphatidylalcohol (PtOH) at the expense of PA. The resulting PtOH is metabolically stable and, thus, serves as a specific indicator of PLD activity. Few bacterial PLDs have been described, although a role for these enzymes in bacterial pathogenesis is suggested. Herein is described PLD activity in N. gonorrhoeae. A role for this secreted protein in gonococcal pathogenesis of cervical epithelia is demonstrated. Characteristic PLD activity (i.e., removal of Cho by cleavage ofthe terminal phosphodiester bond of PtC) was observed in gonococcal whole cell lysates but was absent in gonococci in which pld was mutated by the insertion of a kanR cassette. PLD activity was observed over a pH range of 3.0 to 7.4, consistent with its ability to function as an effector protein within the lower female genital tract under normal (uninfected) or diseased states. The addition of SsPLD to association and invasion assays of N. gonorrhoeae PLD infected cervical cells did not compensate for the absence of ΝgPLD, suggesting ΝgPLD exhibits unique effector functions in addition to sharing structural and functional properties with SsPLD. An observed increase in PLD activity in infected pex and pen cells was attributed to ΝgPLD and not endogenous PLD activity. The ability of ΝgPLD activity to promote gonococcal invasion of primary cervical cells was inhibited in the presence of PtC and ethanol (a primary alcohol) but not 2-butanol (a secondary alcohol). These data definitively demonstrate that this gonococcal protein does indeed exhibit characteristic PLD function and argue against a role for endogenous pex or pen cell phospholipase C (PLC) activity in CR3-mediated invasion of cervical epithelia by gonococci. (A BLAST search ofthe Ν. gonorrhoeae and Ν. meningitidis genomic databases using sequences to several bacterial PLCs failed to reveal the presence of this enzyme in the pathogenic Neisseria.) Furthermore, these data indicate that the generation
of PA or its catabolic products are required for CR3-mediated macropinocytosis of gonococci. NgPLD appears to modulate cervical cell function, either directly or indirectly in a cooperative manner with host cell effector molecules, to promote the appropriate targeting of gonococci to permissive host cells (i.e., CR3 -expressing ecto- and endocervical cells) and to ensure their intracellular survival. The association with and invasion of primary cervical epithelia is impaired in the absence of NgPLD. CR3, the primary receptor by which gonococci invade the cervical epithelia, is not recruited to the cervical cell surface in the absence of NgPLD. Membrane ruffling is not evident in the absence of NgPLD with extended infection. Cervical cell tyrosine kinase and PKC activation (at least partially) rescue signal transduction events occurring in the absence of NgPLD. Integrin receptors are thought to not possess intrinsic enzymatic function, although they do interact with other cellular factors to transduce the signals required for effector functions. The cytoplasmic region of CR3 contains a constitutively phosphorylated serine residue (in resting professional phagocytic cells) on the CDI lbα - subunit (Ahearn and Rosengard, 1998). The CD 18 (β-subunit) cytoplasmic tail is not constitutively phosphorylated but does contain one tyrosine, three threonine, and four serine residues (Ahearn and Rosengard, 1998). Upon CR3 activation with phorbol esters (e.g., PMA), phosphorylation of primarily serine residues occurs, but small amounts of phosphotryrosine and phosphothreonine are also observed (Ahearn and Rosengard, 1998; Gahmberg et al., 1998). Recent data suggest that a phosphorylation/dephosphorylation cycle occurs on the three contiguous threonine residues whereas serine phosphorylation remains stable (Gahmberg et al., 1998). Mutation ofthe three threonine residues results in diminished adhesive function, suggesting threonine phosphorylation plays a role in CR3 ligand binding (Gahmberg et al., 1998). It is currently not known if a similar phosphorylation cycle occurs on the CD 18 cytoplasmic tyrosine residue. However, the protein tyrosine kinases Fyn, Lyk, Hck, and Frg are proposed to function in CR3- mediated signal transduction (Morley and Walport, 2000), suggesting that phosphorylation ofthe cytoplasmic tyrosine residue may also modulate CR3 function.
The absence of CR3 recruitment to the cervical cell surface and the ability of pervanadate to restore this phenotype in N. gonorrhoeae PLD infected primary cervical cells indicates that tyrosine phosphorylation is critical for CR3 recruitment to the infected cervical cell surface. Pervanadate does not stimulate CR3 surface recruitment in uninfected cells, suggesting that the pathway triggered by gonococci that results in CR3 surface recruitment may be unique from that pathway promoting CR3 trafficking in resting cells. These data strongly suggest an early role for ΝgPLD in, directly or indirectly, modulating CR3 effector function possibly by initiating phosphorylation ofthe cytoplasmic tyrosine residue ofthe CR3β -subunit, CDI 8. Studies using Streptomyces chromofuscus PLD (ScPLD) indicate that exogenous ScPLD can cause rapid choline release from vascular smooth muscle cells and can mimic endogenous PLD activity within these cells by triggering cytoskeletal rearrangements, DΝA synthesis, and cell proliferation. Lysophosphatidylcholine (LPtC), within the outer leaflet ofthe plasma membrane, serves as the substrate for ScPLD cleavage resulting in the formation of lysophosphatidic acid (LPA), which, in turn, activates a PLC- and Rho-dependent signal transduction cascade upon LPA binding to its cognate G-protein coupled receptor. ΝgPLD, a secreted bacterial protein, modulates CR3 effector function in primary cervical epithelial cells. In contrast to tyrosine kinase activation, PMA-stimulated PKC activation was capable of rescuing CR3 recruitment to the cervical cell surface and of partially rescuing the ability of gonococci to survive the mortal insult of gentamicin treatment. These data are consistent with the ability of PLD activity to regulate or to be regulated by kinase activity (Houle and Bourgoin, 1999; Choi et al., 2002). These data also suggest that ΝgPLD acts at several levels during gonococcal invasion of cervical epithelia in that signal transduction events leading to CR3 recruitment to the cervical cell surface (tyrosine- and/or serine-threonine kinase dependent) are distinct from intracellular trafficking and/or signaling events promoting gonococcal survival (tyrosine kinase independent, PKC dependent). Several studies have linked PLD to the generation of antimicrobial reactive oxygen species (ROS) in mammalian cells. Recent evidence indicates that Ymt promotes the survival of Y. pestis within the flea midgut from a cytotoxic digestion product present in blood plasma and, consequently, promotes disease
transmission. Data herein indicate that the presence of a functional NgPLD is essential for the tyrosine kinase independent, PKC-dependent survival of these bacteria within primary cervical cells and that it plays a role in gonococcal survival within urethral epithelial cells. Reorganization ofthe actin cytoskeleton is the result ofthe activation of a complex network of signal transduction pathways involving many effector molecules. Bacterial, plant, and human PLDs directly bind polymeric F-actin, which in turn increases PLD activity. In contrast, monomeric G-actin inhibits PLD activity in a species-specific manner in that, in vitro, G-actin-induced PLD inhibition is twenty-fold greater for human PLD1 than it is for SsPLD. The greatest degree of inhibition occurs upon the initiation of PLD activity in the presence of G-actin; less inhibition is observed when G-actin is added to previously activated PLD. Phosphatidylinositol 4, 5 -bisphosphate (PLP2) is a required co-factor in human PLD activity. In contrast, bacterial PLD activity does not exhibit a cofactor requirement. Previous data have indicated that vinculin, ezrin, and α-actinin co- localize with gonococci and accumulate in focal contacts in infected primary cervical cells before the onset of membrane ruffling. Previous data also show that consistent with CR3 -mediated endocytosis in professional phagocytic cells, gonococcal invasion ofthe cervical epithelium requires the activation of Rho proteins. Activation of Rho can cause the activation of phosphatidylinositol-4-phosphate kinase, resulting in PLP2 formation. In resting cells, mammalian PLD resides in an inactive state because PEP2, which remains bound to actin-associated proteins (e.g. vinculin, α-actinin, fodrin), is unavailable as a required co-factor. Fukami et al. (1994) have demonstrated that activation of Balb/c 3T3 cells with platelet-derived growth factor resulted in a rapid decrease in the amount of PLP2 that was bound by vinculin and α-actinin, but which was gradually reversed over a one hour incubation. In the absence of gonococcal PLD microvilli/filopodia were formed because of the negative effects of vinculin and α-actinin on the availability of PLP2 and because of the presence of a (relatively) large pool of monomeric G-actin. The inhibitory effect of G-actin on bacterial PLD was significantly less than human PLD, and bacterial PLDs did not require co-factor activity for function; consequently, induction of actin polymerization may be kinetically favored and, thus, be more extensive and sustained. F-
actin produced would be anticipated to stimulate directly and indirectly (by depleting intracellular levels of G-actin) both gonococcal and cervical cell PLD activity, ultimately leading to membrane ruffles. Kusner et al. (2002) have demonstrated that actin binding to PLD occurs through the conserved region of this protein, which is found in all PLDs (including NgPLD), but have also suggested that heterogeneic regions may modulate this interaction. In this regard, it is of interest that PLD homologs exhibiting the highest similarity to NgPLD are found in other bacterial species (i.e., Salmonella, Shigella, Escherichia) capable of eliciting extensive cytoskeletal rearrangements in their respective target cells.
Example 11 Gonococcal Phospholipase D Modulates the Expression and Function of Complement Receptor 3 in Primary Cervical Epithelial Cells Complement receptor 3 (CR3)-mediated endocytosis is a primary mechanism by which N. gonorrhoeae elicits membrane ruffling and cellular invasion ofthe cervical epithelia. Data disclosed herein indicate that, upon infection of cervical epithelia, N. gonorrhoeae specifically release proteins, including a phospholipase D (PLD) homolog, which facilitate membrane ruffling. To elucidate the function of gonococcal PLD in infection ofthe cervical epithelia, aN. gonorrhoeae PLD mutant was constructed. By comparative association and/or invasion assays, the PLD mutant gonococci were found to be impaired in their ability to adhere to and to invade primary cervical cells. This defect was rescued by the addition of supernatants obtained from wildtype-infected cell monolayers, but not by exogenously added Streptomyces PLD. The decreased level of total cell association (i.e., adherence and invasion) observed for mutant gonococci is, in part, attributed to the inability of these bacteria to recruit CR3 to the cervical cell surface with extended infection. Using electron microscopy, it was demonstrated that gonococcal PLD may be necessary to potentiate membrane ruffling and clustering of gonococci on the cervical cell surface. Data herein indicate that PLD augments CR3- mediated gonococcus invasion of, and survival within, cervical epithelia.
Introduction Neisseria gonorrhoeae is a strict human pathogen causing the sexually transmitted disease gonorrhea. N. gonorrhoeae possesses multiple mechanisms by which it is able to colonize its human host and which are dependent upon the particular microenvironment ofthe infection site. In this respect, the gonococcus is unique in that it senses its particular microenvironment and adjusts its mode of pathogenicity accordingly. Several gonococcal constituents have been implicated in its pathogenicity including lipooligosaccharide (LOS), porin, pilus, and the opacity-associated (Opa) outer membrane proteins. Invasion of male urethral epithelial cells is mediated by LOS, the terminal galactose of which serves as a ligand for the asialoglycoprotein receptor (ASGP-R) (Harvey et al., 2001). An intimate association between the gonococcal and host cell membranes precedes clathrin-dependent endocytosis (Harvey et al., 2001). In contrast, complement (C) receptor type 3 (CR3)-mediated endocytosis is a primary mechanism by which N. gonorrhoeae invade primary human cervical epithelial cells (Edwards et al., 2001). This process is dependent upon the cooperative binding of (gonococcal-bound, host-derived) iC3b, gonococcal porin, and gonococcal pilus to the I-domain of CR3 (Edwards and Apicella, 2002; Edwards et al., 2002). Engagement of CR3 results in membrane ruffling (Edwards et al., 2001) and internalization of gonococci in macropinosomes (Edwards et al., 2000). Ruffling induced by gonococci during cervical cell infection is delayed from the onset of infection by 60 to 90 minutes (Edwards et al., 2000). The onset of ruffling can be accelerated to 30 minutes by the addition of filtered, pre-conditioned (i.e., derived from a previous infection) media. Factors responsible for expediting the cytoskeltetal changes induced by gonococcal infection were sought. Herein is disclosed the identification of gonococcal phospholipase D (PLD), which is specifically released upon infection of cervical epithelial. Gonococcal PLD (ΝgPLD) was found to play a role in membrane ruffling, CR3 recruitment to the cervical cell surface, and, consequently, in gonococcal invasion ofthe cervical epithelia. This secreted protein is a novel, neisserial virulence factor, capable of modulating effector functions within host cells.
Experimental Procedures
Cell Culture. Surgical biopsies derived from the ecto- and the endocervix that were used to seed primary cervical epithelial cell systems were procured and maintained as described previously (Edwards et al., 2000) in Defined Keratinocyte Serum Free Medium (dk-SFM) (Life Technologies, Rockville, MD). The primary (uec) (Harvey et al., 1997) and immortal (tuec) (Harvey et al., 2002), male urethral epithelial cells used in these studies have been described and were maintained according to the methods of Harvey et al. (Harvey et al., 2001; Harvey et al., 1997). Pharmacological agents used, as described in the studies outlined below, were not cytotoxic at the indicated concentrations as determined by trypan blue exclusion.
Bacteria and Infection Studies. N. gonorrhoeae strains 1291 (Apicella, 1974; Dudas and Apicella, 1988), FA1090 (Cohen et al., 1994), and MSI 1 (Schoolnik et al., 1984; Segal et al., 1985) were used in the infection studies outlined below, which were performed as previously described (Edwards et al., 2000). Briefly, overnight cultures of gonococci were harvested from GC-IsoVitaleX agar plates and suspended in sterile physiological saline. Optical density ofthe bacterial suspension was determined spectrophotometrically where an optical density of 1 at 600 nm was equivalent to 109 bacteria ml"1. 107 gonococci were used to infect cervical cell monolayers at a multiplicity of infection of 100. Primary cervical cells were challenged with gonococci for variable time-periods (as noted) after which the infection medium was removed, and the cell monolayers were extensively washed with phosphate-buffered saline (PBS). Uninfected control cell monolayers were simultaneously processed with challenged cell monolayers. Infected and uninfected (control) cell monolayers were subsequently harvested for cellular fractionation, quantitative association (i.e., adherence and invasion) or invasion assays, or they were processed for microscopic analyses. Alternatively (as noted), infection supernatants were harvested, immediately transferred to ice, and gonococci were removed by filtration through a 0.22 μm low protein-binding syringe filter. For PLD activity assays, supernatants depleted of gonococci were filtered using Centricon YM-30 centrifugal filter units (Millipore Coφoration, Bedford, MA). Protein products were then collected with an equal volume of PLD assay buffer.
N. gonorrhoeae strain 1291ΔPLD was constructed by the insertion of a kanamycin-resistance cassette using the EZ::TN <KAN-2> Insertion Kit (EPICENTRE, Madison, WI). Polymerase chain reaction (PCR) of full-length NgPLD, using the primer pair of 5'-GGT GGT CAT ATG ATG CAT ACA GAC CCC AAA AT- 3' (SEQ LD NO:22) and 5'-GGT GGT TGCTCT TCC GCA TAA TAA ACC TTC TTC GAT GGG CAG-3' (SEQ LD NO:23), suggested the insertion ofthe kanamycin-resistance cassette within the pld gene, which was then confirmed by sequence analysis performed at the University of Iowa DNA Sequencing Facility (Iowa City, IA). Radiolabeling and Collection of Gonococcal Products Released with Infection of Primary Cervical Cells. Gonococci allowed to grow overnight on GC agar were harvested with a sterile swab and used to inoculate 5 ml cultures of Morse's Defined Medium (MDM) (Morse and Barenstein, 1980). MDM was prepared such that half the recommended methionine and cysteine was replaced with 125 μCi Redivue Pro-mix L- [35S] in vitro cell labeling mix (Amersham Pharmacia Biotech Inc, Piscataway, NJ). After approximately 4 hours, gonococci were collected by centrifugation (4000 φm, 5 minutes), rinsed with sterile physiological saline to remove excess label, and resuspended in cold MDM such that a culture density of 107 bacteria ml"1 was obtained. MDM containing the 35S-labeled gonococci was then used to infect approximately 105 primary, human, ecto- (pex) and endocervical (pen) cells or 35mm tissue culture dishes devoid of cervical cells. Alternatively, gonococci were labeled during the course of infection by a 30-minute pulse with 35S-MDM at 1 hour and 2.5 hours post-infection. Before infection pex and pen cells were treated (30 minutes, 37° C) with 250 μM cycloheximide to inhibit cervical cell protein synthesis. Cycloheximide was maintained in the culture medium through out the course ofthe infection. Cervical cells and tissue culture plates lacking cervical cells were challenged with gonococci for 90 minutes and 3 hours after which the culture supernatants were collected. Gonococci were removed from the culture supernatants by filtration through low-protein binding 0.22 μm syringe filter units. Supernatant filtrates were concentrated using Centricon YM-3 centrifugal filter units (Millipore) before suspension in OJM Tris-0.1% SDS. Concentrated supernatants were separated on a SDS 4% to 12% polyacrylamide gel before autoradiography or gel- extraction for mass spectrometry at the Mass Spectometry Facility located at the
University of California (San Francisco, CA). Analysis of mass data was performed using the Protein Prospector (University of California San Francisco, CA) and the ProFound (Rockefeller University, NY) mass analysis databases. Western Blot Analysis. Infection supernatants depleted of gonococci (as described above) were separated on 4% to 12% denaturing polyacrylamide gradient gels and transferred to Immobilon-P membranes (Millipore). Membranes were incubated (2 hours, 37° C) with 50 μU/ml neuraminidase (Roche Diagnostics, Indianapolis, IN) prior to immunodetection. Western blotting was subsequently performed according to standard protocols using the anti-lipooligosaccharide (LOS) monoclonal antibody, 6B4. This antibody recognizes the conserved Gal(β 1 -4)GlcNac epitope of gonococcal LOS. Chemiluminescent detection was used to visualize labeled LOS. Determination of PLD Activity. PLD activity was accessed using the Amplex™ Red Phospholipase D Assay Kit (Molecular Probes, Eugene OR). Wild-type and PLD mutant gonococci were suspended in PLD assay buffer to a final concentration of 107 bacteria ml" l, and activity was determined according to the manufacturer's protocol. Assessment of gonococcal PLD activity at acidic pH was determined in a two-step assay according to the manufacturer's protocol. For the first step, 108 gonococci were suspended in PBS with the pH adjusted to 3.0, 4.5, or 6.0. Gonococcal suspensions were diluted 10-fold in PLD assay buffer for the second step ofthe reaction. Cervical cell fractions were prepared as outlined below and PLD activity was assessed at neutral pH according to the manufacturer's protocol.
Fractionation of Primary Cervical Cells. Uninfected (control) and infected cervical cell monolayers were lysed in buffer A (50 mM tris, pH 7.5; 10 mM NaCl, 1 mM KC1; 2 mM MgCl2, 1 mM PMSF) by scraping cervical cells from tissue culture dishes placed on ice. The cell lysate was sonicated (two bursts of 20 seconds each). Cells that did not lyse and the nuclear fraction were removed by centrifugation (750 X g, 10 minutes), and the supernatant from this spin was then subjected to filtration through a low-protein binding 0.22 μm syringe filter to ensure removal of gonococci. Sucrose was added to the resulting gonococcus-depleted supernatant (Sl) to a final concentration of 300 mM. Ultracentrifugation (150,000 X g, 90 minutes) was then performed to produce the plasma membrane- (pellet) and cytosol (supernatant 2, S2)-enriched fractions. The membrane-
enriched fraction was resuspended in PLD assay buffer (50 mM Tris, 5 mM CaCl2, pH 8.0). S2 was concentrated by filtration through Centricon YM-30 centrifugal filter units (Millipore) after which cytosolic constituents were recovered in PLD assay buffer. Where indicated, prior to infection studies, primary pex and pen cell monolayers were treated with 300 nM wortmannin (Sigma) (2 hours, 37°C) or 1 μM cytochalasin D
(Sigma) (30 minutes, 37° C) to inhibit macropinocytosis of gonococci. Wortmannin and cytochalasin D were maintained in cervical cell cultures during the course of infection. RNA Isolation and RT-PCR of Primary, Human, Cervical Epithelial Cells. Primary, pex and pen cell monolayers were challenged with N gonorrhoeae 1291 or 1291 ΔPLD, or they were left uninfected. After 3 hours, infection supernatants were removed and cell monolayers were extensively rinsed with PBS. Total RNA (intracellular gonococcal and cervical cell RNA) was isolated using the RNAqueous-4PCR kit (Ambion, Inc., Austin, TX) according to the manufacturer's protocol. Ribosomal RNA was removed from the total RNA using the MICROBExpress kit (Ambion) according to the manufacturer's protocol, yielding message-enriched bacterial and cervical cell RNA. Cervical cell RNA was then separated from intracellular bacterial RNA using the Poly(A)Purist kit (Ambion) according to the manufacturer's protocol with slight modification. Supernatants from the capture and wash steps, which contained gonococcal RNA, were saved and pooled. Gonococcal RNA was recovered by ethanol precipitation. cDNA was synthesized using RETROscript™ First Strand Synthesis Kit for RT-PCR (Ambion); reactions lacking the reverse transcriptase (RT) (negative control) were run simultaneously with reactions containing RT. PCR analysis of reverse-transcribed and of mock reactions using primers to β-actin and to gonococcal reduction modifiable protein (Rmp) demonstrated the absence of contaminating DNA and of gonococcal DNA and RNA in the isolated cervical cell RNA. PCR of reverse-transcribed cervical cell RNA was performed using the primer pairs 5'-TCC ATG CAA GAA TCT GGT TTC-3' (SEQ JD NO:28) and 5'-CGA CAA TGA GCA CAG ACT CAC A-3' (SEQ JD NO:29) for human PLD1 to yield a 462 bp product and 5'-CCT TCA GGA TTC TGT CCA CAA-3' (SEQ LD NO:30) and 5'-CCT CTC TCA CAA CCA ATT CTT C-3' (SEQ TD NO:31) for human PLD2 to yield a 508 bp product.
Determination of CR3 Surface Expression on Primary Cervical Cells. Pex and pen cells were passed to 96-well microtiter plates and allowed to grow to confluence. Cervical cells were then challenged with wild-type or PLD mutant gonococci after which the infection medium was removed and cells were rinsed thrice with PBS. Cells were fixed with 2% paraformaldehyde. Prior to immuno-analysis of CR3 surface level expression, cells were again rinsed with PBS. Immunoassays were then performed according to standard ELISA protocols using the H5A4 anti-CDl lb (i.e., CR3) primary and peroxidase-conjugated secondary antibodies. Absorbance ofthe o-phenylenediamine dihydrochloride peroxidase substrate was determined spectrophotometrically at 495 nm. Primary antibody was omitted from one well, and the secondary antibody was omitted from a second well, which served as controls for non-specific binding and endogenous peroxidase activity, respectively. Where indicated gonococci-depleted supernatants collected from wild-type or PLD mutant infection studies were included in the infection studies, performed as outlined below. N. gonorrhoeae Attachment to and Invasion of Primary, Human, Cervical Cells.
Primary cervical cell monolayers were infected with wild-type or PLD mutant gonococci as outlined above. Variable concentrations of PtC (Sigma), ethanol, 2-butanol, or Streptomyces spp. PLD (SsPLD) (Sigma) were included in association (adherence and invasion) or invasion assays, as noted. PtC, ethanol, 2-butanol, or 10 units ml"1 SsPLD were added simultaneously with gonococci. In separate assays, infection supernatants were collected from wild-type or PLD mutant-infected cervical cell monolayers, gonococci were removed by filtration through a 0.22 μm syringe filter (to yield primed wild-type or mutant supernatants), which were then added to association and/or invasion assays, as noted. The ability of gonococci to adhere to and or invade pex and pen cells was quantitatively determined using standard gentimicin-resistance assays, performed as described previously (Edwards et al., 2000) and in which chemical or protein additives were included or excluded from the invasion assay as described above. The total association (i.e., adherence and invasion) of gonococci with pex and pen cells was quantitated by the omission of gentimicin from the above described invasion assay. Percent invasion of N. gonorrhoeae 1291 or 1291 ΔPLD in the presence or absence of experimental additives was determined as a function ofthe original inoculum and the
number of colonies formed with subsequent plating ofthe cellular lysate. Inhibition of gonococcal attachment and/or invasion by exogenous PtC, ethanol, or 2-butanol was determined as a normalized function ofthe ability of gonococci to attach to and/or invade primary cervical cells in the absence ofthe competimer inhibitor. A Kruskal-Wallis non- parametric analysis of variance was used to determine the statistical significance ofthe association and invasion assays described above.
Immunolabeling and Microscopy. Immunolabeling of N. gonorrhoeae 1291 or 1291 ΔPLD infected pex cell monolayers was performed as described previously (Edwards et al., 2000). Primary antibodies used for immunolabeling were specific for the CR3 β-subunit, CD 18 (anti-CD 18 CTB 104 (Santa Cruz Biotechnology, Santa Cruz, CA)) or for the gonococcal H.8 outer membrane protein (antibody 2C3). FITC- and TRITC- conjugated secondary antibodies were applied to cell monolayers, as noted. Infected and uninfected (control) cell monolayers were viewed using the Bio-Rad MRC-1024 Laser Scanning Confocal viewing system. Primary cervical cell monolayers were processed for SEM analyses (Edwards et al., 2000) and viewed using the Hitachi S-4000 scanning electron microscope. All the microscopes used in these studies are located at the Central
Microscopy Research Facility at the University of Iowa (Iowa City, IA).
Results
N. gonorrhoeae Specifically Release Protein Products upon Infection of Cervical Epithelia. Previous studies show that membrane ruffling of N. gonorrhoeae-infected primary human cervical cells occurs by approximately 90 minutes post-infection (Edwards et al., 2000). These same studies also demonstrate that the onset of membrane ruffling in response to gonococcal infection can be expedited by the use of a primed infection inoculum, that is, an inoculum derived from a previous infection. Based on these studies, it was reasoned that gonococcal products were being released upon infection that facilitated membrane ruffling. Autoradiography of infection supernatants demonstrated that gonococcal products were, in fact, being released with infection of primary, human, ecto- and endocervical epithelium. Release of these gonococcal products was not strain specific in that an identical protein pattern was observed with autoradiography of infection supernatants obtained from N. gonorrhoeae strains 1291- (FIG. 22), FA1090- (data not shown), or MSI 1 -infected primary cervical cells (data not
shown). In contrast, analysis of supernatants derived from an identical time course of infection of uec revealed that only a small amount of gonococcal products are released by 90 minute post-infection, and by 3 hours of infection no products could be detected (FIG. 22). Collectively, these data suggested that a small basal level of gonococcal products are released constitutively, but, also that the continued release of gonococcal products was specific to gonococcal cervicitis. Western Blot analysis of infection supernatants using the anti-LOS 6B4 antibody probe did not reveal the presence of gonococcal LOS. This indicated the release of gonococcal products with cervical cell infection was the result of bacterial secretion and not of bacterial lysis (FIG. 22). Characterization of a N. gonorrhoeae PLD Homolog. Using mass spectroscopy a subset of gonococcal products that are secreted upon cervical cell infection were identified. One secreted product, p55, was identified by mass analysis using Protein Prospector and Profound data bases as sharing significant homology to a Neisseria meningitidis hypothetical PLD homolog. Primers for PCR were designed based on the N. meningitidis serogroup B sequence and used to amplify ?/-/ from N. gonorrhoeae strains 1291, FA1090, and MSI 1. Sequences obtained from cloning ofthe PCR amplicons were then used in a BLAST search ofthe N. gonorrhoeae genome database to identify p55 as a N. gonorrhoeae PLD homolog (GenBank accession number AY307929). The p55 sequence was used to perform a BLAST search ofthe National Center for Biotechnology Information (NCBI) database, which revealed significant sequence homology of p55 to Neisseria meningitidis serogroups A and B hypothetical PLD homologs, hypothetical and/or putative synthases of Escherichia coli and Shigella flexneri, and a putative phospholipase of Salmonella. Further sequence analysis of p55 revealed that this protein contains two HKD (amino acids 184-201 and 422-439) motifs, which are required for PLD activity, and two regions of hydrophobicity (amino acids 24-34 and 217-231) that might serve as lipid association domains. Comparative assessment of PLD activity in N. gonorrhoeae strains 1291 and 1291 ΔPLD (performed at pH 7.4) demonstrated PLD activity in wild-type but not mutant gonococci (Table 10), indicating p55 functions as a phospholipase D. In separate assays, ΝgPLD exhibited characteristic PLD activity at pH 3.0, 4.5, and 6.0 (Table 10), consistent with the capability of this enzyme to function
within the lower female genital tract under normal conditions or during bacterial vaginosis and/or cervicitis.
Table 10. PLD activity in N. gonorrhoeae cell lysates.
PLD activity was determined as described in the text. Values given are the mean va ues of three trials.
N. gonorrhoeae PLD Augments Gonococcal Infection of Cervical Epithelial Cells.
To determine if NgPLD plays a role in infection of cervical epithelia, quantitative association and/or invasion assays were performed using N. gonorrhoeae strains 1291 and 1291 ΔPLD. Association and invasion assays demonstrated a role for NgPLD in gonococcal cervicitis as indicated by the decreased levels of association and of invasion observed with infection of primary cervical cells with the PLD mutant upon comparison to the wild-type bacteria (Table 11). The addition of SsPLD to association and/or invasion assays performed using mutant gonococci could not rescue the decreased levels of association and of invasion observed in the absence of NgPLD. Although efforts to isolate NgPLD have, to date, been unsuccessful, the addition of primed wild-type supernatants to infection assays performed using mutant gonococci restored association and invasion to near-wildtype levels. However, the addition of primed mutant supernatants had no effect on the ability of PLD mutant gonococci to adhere to or to invade primary cervical cells (Table 11).
I ll
Table 11. Percent adherence to and/or invasion of primary cervical cells by gonococci in the presence or absence of primed media or exogenous PLD.
invasion) and the percent invasion were determined as a function ofthe original inoculum and the subsequent number of colony forming units formed with subsequent plating ofthe ecto- or endocervical cell lysates. Data given are the mean values obtained from at least three trials performed in triplicate, /^-values (noted parenthetically) were determined using a Kruskal-Wallis k-sample analysis of variance calculated for association and/or invasion of wild-type or mutant gonococci in the presence of wild-type (A) or PLD mutant (B) primed medium or 10 U/ml SsPLD (C) in comparison to the absence of primed medium or exogenous SsPLD, as outlines in the text.
Similar studies in which tuec were challenged with N. gonorrhoeae strains 1291 or 1291 ΔPLD revealed ΝgPLD does not play a role in the association of gonococci with the urethral epithelium but may promote the intracellular survival of these organisms. The association of 1291 ΔPLD with tuec was comparable to that of wild-type gonococci; whereas, invasion levels were decreased in the absence of ΝgPLD (Table 12).
Table 12. Percent adherence to and/or invasion of urethral epithelial cells by wild-type and PLD mutant gonococci
Values given are the mean values in which the percent total association (adherence and/or invasion) and the percent invasion were determined as a function ofthe original inoculum and the subsequent number of colony forming units formed with subsequent plating of TUEC lysates. Data given are the mean values obtained from at least three trials performed in triplicate, p-values (noted parenthetically) were determined using a Kruskal-Wallis k-sample analysis of variance calculated for association and/or invasion of mutant gonococci in comparison to wild-type gonococci.
N. gonorrhoeae PLD Plays a Role in CR3 recruitment to the Cervical Cell Surface.
CR3 serves as the primary receptor for gonococcal adherence to and invasion ofthe cervical epithelium (Edwards et al., 2001). Previous studies have also indicated that surface levels of CR3 increase with gonococcal infection (Edwards et al., 2001). Laser scanning confocal microscopy (LSCM) was performed to examine the gonococcus-CR3 association in mutant gonococci to determine if the decrease in gonococcal cervical cell association observed with use ofthe PLD mutant was because ofthe inability of mutant gonococci to recruit CR3 to the cervical cell surface. LSCM revealed that in comparison to wild-type infected pex cells, which exhibited abundant CR3 on the monolayer surface, pex cells infected with PLD mutant gonococci exhibited decreased fluorescence, indicative of a decreased level of CR3 on their cell surface (data not shown). To quantitate these findings an ELISA assay was developed to measure cervical cell surface expression of CR3 in uninfected pex and pen cells and cells challenged with N. gonorrhoeae strains 1291 and 1291 ΔPLD (Table 13). Immuno-analysis ofthe presence of CR3 on the surface of pex and pen cells confirmed our LSCM data. The amount of
CR3 present on the surface of wild-type infected cervical cells was significantly greater than levels of CR3 measured on either the PLD mutant infected or uninfected cervical cells. The addition of primed wild-type supernatants to PLD mutant infected and uninfected cells increased CR3 recruitment to the cervical cell surface. However, the addition of primed supernatants from the PLD mutant had no affect on CR3 recruitment to the cervical cell surface of PLD mutant infected or uninfected cells.
Table 13 Semi-quantitative immuno-analysis of CR3 expression on the surface of primary cervical cells
Values given are the mean values in which the presence of CR3 on the cervical cell surface was measured by an immuno-assay using the monoclonal antibody H5 A4 as outlined in the text.
N. gonorrhoeae PLD Plays a Role in Membrane Ruffling of the Cervical Epithelium.
PLD activation in mammalian cells is thought to occur early in the phagocytic process, before the onset of actin reorganization. To determine if gonococcal PLD plays a role in the cytoskeletal rearrangements leading to membrane ruffling ofthe cervical epithelium, scanning electron microscopy (SEM) was performed. SEM analysis demonstrated that
aberrant cytoskeletal rearrangements occur upon infection of cervical epithelia with PLD- mutant gonococci, when compared to infection with wild-type gonococci. At 15 minutes post-infection, no significant difference was observed between PLD mutant and wild-type infected pex cells (data not shown). Small bacterial clusters were evident as were microvilli/filopodia. However, by 3 hours post-infection, bacterial clusters and membrane ruffles were not readily evident on cell monolayers infected with mutant gonococci, but were characteristically prevalent on wild-type infected cell monolayers (FIG. 16). The addition of primed wild-type supernatants, but not primed PLD mutant supernatants, to N. gonorrhoeae 1291 ΔPLD infection studies restored bacterial clustering and membrane ruffling (FIG. 16), suggesting ΝgPLD plays a role in signal transduction events leading to CR3 clustering and membrane ruffling.
Activity and Subcellular Localization of N. gonorrhoeae PLD in Cervical Epithelia. To determine if PLD activity is increased in infected cervical cells, PLD activity was measured in infected and uninfected cervical cell lysates. Comparison of wild-type infected cervical cells to that ofthe PLD mutant infected or uninfected cells demonstrated that overall PLD activity is increased in wild-type infected pex and pen cells. There was no significant difference between uninfected cells and mutant infected cervical cells, suggesting that the observed increase in PLD activity is primarily due to gonococcal PLD. RT-PCR analysis of human PLD1 and PLD2 in pex and pen cells demonstrated that endogenous cervical cell PLD message levels are not up-regulated in cells infected with N. gonorrhoeae strains 1291 and 1291 ΔPLD when compared to uninfected cells (FIG. 23). These data support a role for ΝgPLD, rather than endogenous cervical cell PLD, in the observed increase in PLD activity described above. Analysis of PLD activity in infected and uninfected cervical cell fractions revealed a significant portion of gonococcal and cervical cell PLD activity lies within the membrane-enriched portion of cervical cell lysates. However, PLD activity was also observed in the cytosolic-enriched cell fraction. No significant difference was observed between PLD activity in uninfected cervical cells and the PLD mutant infected cells. Membrane ruffling followed by macropinocytosis of gonococci serves as a primary mechanism by which these bacteria invade the cervical epithelium. To determine if NgPLD non-specifically gains access to the cervical cell cytosol during
macropinocytosis of gonococci, cell fractionation studies were performed of infected and uninfected pex cells treated or untreated with wortmannin or cytochalasin D (Table 14). PLD activity was significantly reduced in membrane- and cytosol-enriched cell fractions when wortmannin and cytochalasin D were included in wild-type infection studies. No significant difference was observed in PLD activity in uninfected or 1291 ΔPLD infected pex cells when these same cytoskeletal inhibitors were included or excluded from the assay. Collectively, these data indicate that macropinocytosis of invasive gonococci allows NgPLD to enter primary cervical cells.
Table 14. PLD activity in cervical cells treated with cytoskeletal inhibitors.
Cellular fractionation and PLD activity were assayed as described in the text. Data given are the mean values obtained from three trials in which gonococci were removed by filtration through a 0.22 μm syringe filter (see materials and methods).
Gonococcal PLD Acts at Multiple Levels in Cervical Cell Infection. Studies using Streptomyces PLD have indicated that the exogenous addition of PLD to vascular smooth muscle cells mimics endogenous PLD activity within these cells (Kondo et al., 1992). Consequently, it was determined if exogenously added PLD substrates could compete with cervical cell constituents for NgPLD activity and in doing so interfere with the role of NgPLD in gonococcal invasion. The addition of 10, 1, 0J, or 0.01 μg/ml of phosphatidylcholine (PtC) or 1.0, 0J, or 0.01 percent ethanol to infection studies impaired the ability of gonococci to invade pex cells in a dose-dependent manner (Table 15). In contrast, no effect was observed in gonococcal association with and/or their invasion of primary cervical cells in the presence of 1.0, 0J, or 0.01 percent 2-butanol (Table 15), which can not serve as a substrate in PLD-catalyzed transphosphatidylation. There was no significant difference in survival observed between gonococci incubated in the presence or absence of 1.0, 0J, or 0.01 percent ethanol or 2-butanol in the absence of cervical cells (data not shown). These data suggest a role for gonococcal PLD in modulating cervical cell signaling events (e.g., through phosphatidic acid (PA) generation) and suggest that NgPLD may function at several different levels in gonococcal invasion of cervical epithelia.
Table 15 Percent adherence to and/or invasion of primary cervical cells by gonococci in the presence or absence of PLD substrate competimers
B.
Values given are the mean values in which the percent invasion was determined as a function ofthe original inoculum and the subsequent number of colony forming units formed with subsequent plating ofthe ecto- or endocervical cell lysates. Inhibition values
given were determined as a normalized function ofthe ability ofthe gonococcus to invade primary ectocervical cells in the presence of, in comparison to the absence of, an alcohol and phosphatidylcholine competimers as outlined in the text. Data given are the mean values obtained from at least three trials performed in triplicate. Variances are noted parenthetically. R-values were determined using a Kruskal-Wallis k-sample analysis of variance.
NA - Not applicable ND - Not determined
1 - (-values were calculated for wild-type gonococci in the presence of competimer compared to the absence ofthe competimer
2 -p-values were calculated for PLD mutant gonococci in the presence of competimer as compared to the absence ofthe competimer
Discussion Phopholipases are a diverse group of hydrolytic enzymes, which are classified by the specificity they exert for the site of phospholipid cleavage. In eukaryotic systems, homologs of PLD can be activated by a variety of stimuli (e.g., hormones and growth factors) after which they catalyze the hydrolysis of PtC to choline (Cho) and PA (Exton, 1997; Jones et al., 1999; Waite, 1999). PLDs belong to a large superfamily of proteins, which can be divided into eight classes (Ponting and Kerr, 1996). Included in the PLD superfamily are prokaryotic and eukaryotic PLDs, cardiolipin and phosphatidylserine synthases, Vaccinia and Fowlpox viral proteins of unknown function, an Escherichia coli nuclease and an E. coli helicase (Ponting and Kerr, 1996). All members ofthe PLD superfamily contain (usually) two HKD motifs, which are thought to associate to form a catalytic center. However, unique to PLD is the ability to catalyze a transphosphatidylation reaction in which a primary alcohol preferentially serves as a nucleophilic acceptor instead of water, resulting in the near-exclusive production of a phosphatidylalcohol (PtOH) at the expense of PA. The resulting PtOH is metabolically stable and, thus, serves as a specific indicator of PLD activity. Although eukaryotic PLDs have been well studied, much less is known about bacterial PLDs, and, in fact, only a handful have been identified. Some bacterial PLDs are associated with virulence, e.g., the Yersinia murine toxin (Ymt) (Hinnebusch et al., 2002) and PLDs of Corynebacterium spp. (McNamara et al., 1995), pathogens of humans and domestic animals. It is demonstrated in Corynebacterium pseudotuberculosis that PLD mutation results in the attenuation of this microbe (Hodgson et al., 1992; Simmons et al., 1998).
PLD activity in N. gonorrhoeae is disclosed herein, as well as a role for this secreted protein in gonococcal pathogenesis of cervical epithelia. Characteristic PLD activity (i.e., removal of Cho by cleavage ofthe terminal phosphodiester bond of PtC) was observed in gonococcal whole cell lysates but was absent in gonococci in which/?/-/ was mutated by the insertion of a kanR cassette. PLD activity was observed over a pH range of 3.0 to 7.4, which is consistent with its ability to function as an effector protein within the lower female genital tract under normal (uninfected) or diseased states. The ability of ΝgPLD activity to promote gonococcal invasion of primary cervical cells was inhibited in the presence of PtC and ethanol (a primary alcohol) but not 2-butanol (a secondary alcohol). These data definitively demonstrate that this gonococcal protein does indeed exhibit characteristic PLD function and argue against a role for endogenous pex or pen cell phospholipase C (PLC) activity in CR3 -mediated invasion of cervical epithelia by gonococci. A BLAST search ofthe N. gonorrhoeae and Ν. meningitidis genomic databases using sequences to several bacterial PLCs failed to reveal the presence of this enzyme in the pathogenic Neisseria. Furthermore, these data indicate that the generation of PA or its catabolic products are required for CR3 -mediated macropinocytosis of gonococci. Recent evidence indicates that Ymt promotes the survival of Y. pestis within the flea midgut from a cytotoxic digestion product present in blood plasma and, consequently, promotes disease transmission (Hinnebusch et al., 2002). Data herein indicate that the presence of a functional ΝgPLD is essential for the survival of gonococci within primary cervical cells. Although an interaction with the ASGP-R does not appear to sustain ΝgPLD secretion in culture supernatants, ΝgPLD does play a role in gonococcal survival within urethral epithelial cells. The addition of SsPLD to association and invasion assays of N. gonorrhoeae ΔPLD infected cervical cells did not compensate for the absence of ΝgPLD, suggesting ΝgPLD exhibits unique effector functions in addition to sharing structural and functional properties with SsPLD. This is supported by the finding that, although all PLDs contain (usually) two HKD motifs, sequences outside these regions are not necessarily highly conserved and may confer specific effector functions to their respective proteins (Waite, 1999).
Total PLD activity was greater in infected pex and pen cells upon comparison to uninfected or PLD mutant infected cells, which was attributed to NgPLD and not endogenous PLD activity. NgPLD appears to modulate cervical cell function, either directly or indirectly in a cooperative manner with host cell effector molecules, to promote the appropriate targeting of gonococci to permissive host cells (i.e., CR3- expressing ecto- and endocervical cells) and to ensure their intracellular survival. The association with and invasion of primary cervical epithelia is impaired in the absence of NgPLD. CR3, the primary receptor by which gonococci invade the cervical epithelia, is not recruited to the cervical cell surface in the absence of NgPLD. Membrane ruffling is not evident in the absence of NgPLD with extended infection. Thus, NgPLD is unique among prokaryotic proteins identified to date. The ability of PLD to cause the release of secondary granules in neutrophils suggests that this molecule may play a role in the recruitment of CR3 to the surface of these cells. Additionally, products of PLD-catalyzed phospholipid hydrolysis serve as second messengers, eliciting a variety of cellular responses and are thought to function in complement (C')-mediated endocytosis (Fallman et al., 1992) and in cytoskeletal rearrangements (Colley et al., 1997; Ha and Exton, 1993; Jones et al., 1999). The absence of CR3 recruitment to the cell surface in N. gonorrhoeae ΔPLD infected primary cervical cells strongly suggests an early role for ΝgPLD in, directly or indirectly, modulating CR3 effector function. Studies using Streptomyces chromofuscus PLD (ScPLD) indicate that exogenous ScPLD can mimic endogenous PLD activity by triggering cytoskeletal rearrangements, DΝA synthesis, and cell proliferation (van Dijk et al., 1998; Kondo et al., 1992). These data provide a precedent for the observations herein demonstrating the ability of exogenous ΝgPLD, a secreted bacterial protein, to modulate CR3 effector function in primary cervical epithelial cells. Reorganization ofthe actin cytoskeleton is the result ofthe activation of a complex network of signal transduction pathways involving many effector molecules. Bacterial, plant, and human PLDs directly bind polymeric F-actin, which in turn increases PLD activity (Kusner et al., 2003). In contrast, monomeric G-actin inhibits PLD activity in a species-specific manner in that (Kusner et al., 2002), in vitro, G-actin-induced PLD inhibition is twenty-fold greater for human PLD1 than it is for SsPLD (Kusner et al.,
2003). The greatest degree of inhibition occurs upon the initiation of PLD activity in the presence of G-actin; less inhibition is observed when G-actin is added to previously activated PLD (Kusner et al., 2003). Phosphatidylinositol 4, 5-bisphosphate (PLP2) is a required co-factor in human PLD activity; in contrast, bacterial PLD activity does not exhibit a cofactor requirement. In resting cells, mammalian PLD resides in an inactive state because PLP2, which remains bound to actin-associated proteins (e.g., vinculin, - actinin, fodrin), is unavailable as a required co-factor (Lukowski et al., 1996). Cervical cells infected with the N. gonorrhoeae ΔPLD mutant failed to elicit membrane ruffling but did promote microvilli/filopodia formation, suggesting ΝgPLD might be required to potentiate the extensive cytoskeletal rearrangements necessary for ruffle formation. ΝgPLD may act in a synergistic or an additive manner with endogenous cervical cell PLD to potentiate membrane ruffling by stabilizing actin filaments in a manner similar to what is observed with phalloidin. Disclosed herein are studies that elucidate the signaling pathways that participate in the response of cervical epithelia to N. gonorrhoeae infection. In this respect, a novel gonococcal virulence factor, ΝgPLD, which modulates CR3 effector function in conjunction with cervical cell effector molecules to trigger alternative signal transduction pathways is identified. This secreted gonococcal product serves a critical role in ensuring appropriate targeting ofthe gonococcus to the ecto-and endocervical epithelium by recruiting CR3 to the cervical cell surface and promotes intracellular survival of gonococci following CR3-mediated macropinocytosis.
All publications, patents and patent documents are incoφorated by reference herein, as though individually incoφorated by reference. The invention has been described with reference to various specific and preferred embodiments and techniques. However, it should be understood that many variations and modifications may be made while remaining within the scope ofthe invention.
References
Alpuche-Aranda et al„ "J. Exp. Med.. 179, 601-608 (1994). Altieri, J. Immunol.. 147, 1891-1898 (1991). Apicella. J. Infect. Pis.. 130, 619-625 (1974). Becherer et al., Complement Inflamm., 6, 142-165 (1989). Bessen and Gotschlich, Infect. Imrnun.. 54(11),154-160 (1986). Bjerknes et al., Infect. Imrnun.. 63, 160-167 (1995). Caron and Hall, Science. 282. 1717-1720 (1998). Carrea et al.. Biochim. Biophys. Acta., 1255, 273-279 (1995). Chen et al., Infect. Imrnun.. 63, 1790-1795 (1995). Christodoulides et al., Mol. Microbiol., 35, 32-43 (2000). Clarke and Spudich, Ann. Rev. Biochem.. 46, 797-822 (1977). Clauser et al., Anal. Chem., 71_, 2871 (1999). Clerc, P. and P. J. Sansonetti, Infect. Imrnun., 55, 2681-2688 (1987). Cohen et al., J. Infect. Pis., 169, 532-537 (1994). Colley et al., Curr. Biol., 7, 191-201 (1997). Cooper, Immunol. Today, 12, 327-331 (1991). Dehio et al., Trends Microbiol., 6, 489-495 (1998). Densen. Clin. Microbiol. Rev.. 2. S11-S17 (1989). Densen et al., Infect. Imrnun., 38, 563-572 (1982). van Dijk et al., Curr. Biol.. 8, 386-392 (1998). Dillard, " A variable pathogenicity island associated with disseminated gonooccocal infection," Midwest Microbial Pathogenesis Group, Sixth Annual Midwest Microbial Pathogenesis Meeting, Milwaukee, WI (1999). DiPaolo et al., Crit. Rev. Oncogen.. 4, 337-360 (1993). Dramsi and Cossart, Ann. Rev. Cell Dev. Biol., 14, 137-166 (1998). Draper et al., Am. J. Obstet. Gvnecol.. 138, 818-826 (1980). Dudas and Apicella, Infect. Imrnun.. 56, 499-504 (1988). Edwards et al., Infect. Imrnun., 68, 5354-5363 (2000). Edwards et al., Cell. Microbiol.. 3, 611-622 (2001).
Edwards and Apicella, Cell. Microbiol.. 4, 584-598 (2002). Edwards et al., Cell. Microbiol., 4, 571-584 (2002). Edwards et al., "Gonococcal Phospholipase D Modulates the Expression and Function of Complement Receptor 3 in Primary Cervical Epithelial Cells," (manuscript submitted). Elemer and Edgington, J. Biol. Chem.. 269. 3159-3166 (1994). Erdei et al., Immun. Today, 12, 332-337 (1991). Evans, J. Infect. Pis., 136(2), 248-255 (1977). Exton, J. Biol. Chem.. 272. 15579-15582 (1997). Fallman et al., J. Biol. Chem., 267, 2656-2663 (1992). Finlay and Falkow, Microbiol. Mol. Biol. Rev.. 61, 136-169 (1997). Finlay and Ruschkowski, J. Cell Sci., 99, 283-296 (1991). Fluhmann, Obstet. Gvneco , 14, 133-148 (1959). Francis et al., Nature, 364, 639-642 (1993). Frank and Fries. Immunol. Today. 12. 322-326 (1991). Fukami et al., J. Biol. Chem., 269. 1518-1522 (1994). Gadzar et al., Int. J. Cancer, 78, 766-774 (1998). Garcia-del Portiilo and Finlay, Infect. Immun., 62, 4641-4645 (1994). Goeddel et al, Nucleic Acids Res.. 8, 4057 (1980). Grassme et al., Infect. Immun.. 64(5), 1621-1630 (1996). Griffin et al., J. Exp. Med.. 144, 788-809 (1976). Griffin et al., J. Exp. Med., 142, 1263-1282 (1975). Ha and Exton, J. Cell Biol.. 123, 1789-1796 (1993). Handsfield, Neisseria gonorrhoeae in Principles and Practice of Infectious Disease 3rd Ed. Mandell, G. L., R. G. Oouglas, Jr., and J. E. Bennett (eds) Churchill Livingstone, New York (1990). Harkness, Br. J. Vener. Pis., 24, 137-147 (1948). Harvey et al., Infect. Immun., 65, 2420-2427 (1997). Harvey et al., Mol. Microbiol.. 42, 659-672 (2001). Harvev et al„ Infect. Immun., 70. 5808-5815 f2002) Hauck et al., EMBO L, 17, 443-454 (1998).
Hayashi et al., Infect. Immun.. 65, 1211-1216 (1997). Hildreth and August, J. Immunol., 134. 3272-3280 (1985). Hinnebusch et al., Science, 296, 733-735 (2002). Hodgson et al., Infect. Immun., 60, 2900-2905 (1992). Hondalus et al., Infect. Immun., 61, 2919-2929 (1993). Hook and Handsfield, 1999. Gonococcal infections in the adult in Sexually Transmitted Diseases 3rd Ed. Holmes, K. K., P-A Mardh, P. F. Sparling, S. M. Lemon, W. E. Stamm, P. Piot, and J. N. Wasserheit (eds). McGraw-Hill, New York (1999). Hussain et al., Clin. Exp. ImunnoL, 102, 384-388 (1995). Hynes, Cell, 48, 549-554 (1987). Iglesias et al., Am. J. Pathol., 146, 944-952 (1995). Ingalls et al., Prog. Clin. Biol. Res.. 397, 107-117 (1998). Jarvis et al., Infect. Immun., 67, 1149-1156 (1999). Jerse and Jerse, Trends Microbiol.. 5, 217-221 (1997). Jones and Walker, J. Clin. Pathol: Mol. Pathol.. 52, 208-213 (1999). Jones et al., J. Biol. Chem., 273, 10556-10566 (1998). Jones et al., Biochim. Biophys. Acta.. 1439, 229-224 (1999). Jurianz et al., Mol. Immunol., 36, 929-939 (1999). Kallstrom et al., Mol. Micobiol., 25, 639-647 (1997). Kallstrom et al., Cell Microbiol.. 2, 341-351 (2000). Kaur and McOougall, J. Virol., 62, 1917-1924 (1988). Ketterer et al., Infect. Immun., 67(8), 4161-4170 (1999). Kishimoto et al., Adv. Immunol.. 46, 149-182 (1989). Kondo et al., J. Biol. Chem., 267. 23609-23616 (1992). Kondo et al., Electrophoresis. 17, 1638-1642 (1996). van Kooyk et al., J. Biol. Chem., 274, 26869-26877 (1999). Kragsbjerg et al., APMIS. 108. 276-282 (2000). Kusner et al., J. Biol. Chem., 277. 50683-50692 (2002). Kusner et al., Arch. Biochem. Biophvs.. 412. 231-241 (2003). Lawn et al. Nucleic Acids Res., 9. 6103 (1981). Lin et al., J. Clin. Endocrinol. Metab.. 79, 1483-1491 (1994).
Lukowski et al., J. Biol. Chem.. 271. 24164-24171 (1996).
Lynch et al., Biophys. J„ 45, 104-107 (1984).
Maisner et al., J. Biol. Chem., 272, 20793-20799 (1997).
Maitra et al., Nature Med., 5, 459-463 (1999). McGee et al. et al., Rev. Infect. Pis., 5, S708-S714 (1983).
McGhee et al., Sem. HematoL. 30, 3-15 (1993).
McNamara et al., Gene. 156. 113-118 (1995).
McNeely, Sex. Trans. Pis., 16, 467-478 (1989).
McQuillen et al., J. Infect. Pis.. 179, 124-135 (1999). Mesri et al., J. Biol. Chem., 273, 744-748 (1998).
Meyer, Clin. Infect. Pis.. 28, 433-441 (1999).
Moll et al., Cell 3J_, 11-24 (1982).
Morse and Barenstein, Canadian J. Microbiol., 26, 13-20 (1980)
Mosser and Edelson, Nature, 327, 329-331 (1987). Moulder. Microbiol. Rev., 49. 298-337 (1985).
Mukherjee et al., Physiol. Rev.. 77, 759-803 (1997).
Nassif et al.. Mol. Microbiol.. 32. 1124-1132 (1999).
Nassif and So, Clin. Microbiol. Rev.. 8, 376-388 (1995).
Naumann et al., Curr. Opin. Microbiol.. 2, 62-70 (1999). Obermeier et al., EMBO J.. 17, 4328-4339 (1998).
Oelschlager et al., Proc. Natl. Acad. Sci.. 90, 6884-6888 (1993).
O'Gorman et al., Cancer Res.. 59, 5692-5694 (1999). de la Paz et al., Microbiol.. 141. 913-920 (1995).
Perlmann et al., J. Immunol.. 130, 2831-2836 (1983). Ponting and Kerr, Prot. Science. 5, 914-922 (1996).
Price and Boettcher, Fertil. Steril., 32, 61-66 (1979).
Rabinovitch, Trends Cell Biol.. 5, 85-88 (1995).
Ram et al., Mol. Immunol.. 36, 915-928 (1999).
Ram et al., J. Exp. Med., 187, 743-752 (1998). Ramos et al., J. Immunol.. 140, 1239-1243 (1988).
Ramos et al., Proc. Natl. Acad. Sci. USA. 82, 5470-5474 (1985).
Relman et al., Cell, 61_, 1375-1382 (1990). Richardson and Sadoff, Infect. Immun.. 56, 2512-2514 (1998). Robinson, Curr. Opin. Cell Biol.. 6, 538-544 (1994). Rosqvist et al.. EMBO J.. 14,4187-4195 (1995). Ross and Pensen. J. Infect. Pis., 151,33-41 (1985). Sandilands and Whaley, Methods in Complement for Clinical Immunolo gists, (1985). Sambrook and Russell, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY (3rd edition, 2001). Schmidt and Hall. Annu. Rev. Cell Pev. Biol. 14.305-338 (1998). Schoolnik et al., J. Exp. Med.. 159. 1351-1370 (1984). Segal et al., Cell, 40, 293-300 (1985). Sells et al., Curr. Biol.. 7..202-210 (1997). Seya et al.. J. Immunol., 145, 238-245 (1990). Silverstein et al.. Ann. Rev. Biochem.. 46, 669-722 (1997). Simmons et al., Infect. Immun.. 66, 474-479 (1998). Sizemore and Rorke. Cancer Res.. 53. 4511-4517 (1993). Skoudy et al., J. Cell Sci. 112, 2059-2068 (1999). Smedts et al., 1990. Am. J. Pathol.. 136, 657-668 (1990). Smedts et al., Am. J. Pathol., 141, 497-511 (1992). Stephens. Clin. Microbiol. Rev., 2. S104-S111 (1989). Stewart et al.. J. Immunol.. 156. 1810-1817 (1996). Stocks et al, J. Leuk. Biol.. 58, 40-48 (1995). Stocks et al., Eur. J. Immunol.. 2924-2932 (1996). Stryer, Biochemistry (2d edition) 14-15 (1981); Lehninger,. Biochemistry (2d ed.),
73-75 (1975). Sϋlz et al.. Hum. Reprod.. 13, 2916-2920 (1998). Sun et al.. Int. J. Cancer. 54, 656-662 (1993). Swanson and Baer. Trends Cell Biol.. 5. 89-93 (1995). Swanson and Watts, Trends Cell Biol., 5^ 424-428 (1995). Tran Van Mhieu and Sansonetti. Curr. Opin. Microbiol.. 2. 51-55 (1999).
Vandeφuye et al., Fertil. Immunol.. 27. 145-155 (1992).
Violette et al.. J. Immunol.. 155, 3092-3101 (1995).
Vogel and Frosch, Mol. Microbiol.. 32. 1133-1139 (1999).
Wahlin et al., J. Immunol.. 130, 2831-2836 (1983). Waite, Biochim. Biophys. Acta.. 1439. 187-197 (1999) .
Watarai et al., J. Exp. Med.. 183. 991-999 (1996).
Wen et al.. Biochem.. 39. 8638-8647 (2000).
Wetzler et al.. Infect. Immun., 60, 39-43 (1992).
Wright et al.. Proc. Natl. Acad. Sci. USA. 80. 5699-5703 (1983). Wϋrzner, Mol. Immunol.. 36. 249-260 (1999).
Zhang and Chait.. Anal. Chem.. 72. 2482-2489 (2000).
Zipfel et al.. Mol. Immunol.. 36. 241-248 (1999).
U.S. Patent No. 4,533,630.
U.S. Patent 4,554,101. EP 184187A, 2188638A.