WO2004102199A2 - Method for selecting and producing vaccine components and vaccines based thereon - Google Patents

Method for selecting and producing vaccine components and vaccines based thereon Download PDF

Info

Publication number
WO2004102199A2
WO2004102199A2 PCT/NL2004/000338 NL2004000338W WO2004102199A2 WO 2004102199 A2 WO2004102199 A2 WO 2004102199A2 NL 2004000338 W NL2004000338 W NL 2004000338W WO 2004102199 A2 WO2004102199 A2 WO 2004102199A2
Authority
WO
WIPO (PCT)
Prior art keywords
protein
vaccine
antibody
antibodies
microorganism
Prior art date
Application number
PCT/NL2004/000338
Other languages
French (fr)
Other versions
WO2004102199A3 (en
Inventor
Cornelis Johannes Leenhouts
Ronald De Groot
Peter Wilhelmus Maria Hermans
Original Assignee
Erasmus Universitair Medisch Centrum
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Erasmus Universitair Medisch Centrum filed Critical Erasmus Universitair Medisch Centrum
Priority to NZ543662A priority Critical patent/NZ543662A/en
Priority to US10/556,733 priority patent/US8142789B2/en
Priority to AU2004239596A priority patent/AU2004239596B2/en
Priority to DK04733500.5T priority patent/DK1625393T3/en
Priority to DE602004029565T priority patent/DE602004029565D1/en
Priority to EP04733500A priority patent/EP1625393B1/en
Priority to CA2525766A priority patent/CA2525766C/en
Priority to AT04733500T priority patent/ATE484744T1/en
Publication of WO2004102199A2 publication Critical patent/WO2004102199A2/en
Publication of WO2004102199A3 publication Critical patent/WO2004102199A3/en
Priority to US13/397,354 priority patent/US9549974B2/en

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/02—Bacterial antigens
    • A61K39/09—Lactobacillales, e.g. aerococcus, enterococcus, lactobacillus, lactococcus, streptococcus
    • A61K39/092—Streptococcus
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04—Antibacterial agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A61P37/04—Immunostimulants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/12—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria
    • C07K16/1267—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria from Gram-positive bacteria
    • C07K16/1275—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria from Gram-positive bacteria from Streptococcus (G)
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56911—Bacteria
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the invention relates to the field of biology, more specifically to the field of immunology and microbiology.
  • the invention further relates to the field of vaccines against microbial infections and more in particular bacterial vaccines such as pneumococcal vaccines. More in particular, the invention relates to means and methods to identify, select and isolate a vaccine component to produce a vaccine for passive and/or active immunization against a microorganism that can be recognized and preferably taken up and more preferably killed by opsonophagocytic cells.
  • Streptococcus pneumoniae is the leading etiological agent of severe infections such as pneumonia, septicemia, meningitis and otitis media, and causes over three million deaths per year worldwide, of which a million are children.
  • the problem of antimicrobial resistance in Streptococcus pneumoniae has been enhanced by the successful spread of a limited number of internationally recognized multi-resistant strains. These strains have complicated the treatment of pneumococcal disease, and this has further emphasized the need for vaccination as an alternative means of preventing the large-scale morbidity and mortality associated with pneumococcal infection.
  • this vaccine covers only 7 out of 90 of the known pneumococcal capsule serotypes, and clinical data from phase three trials conducted in the USA, Israel, and South Africa have shown that the use of this vaccine causes a shift in colonization by non-vaccine serotypes in place of vaccine serotypes (1, 2, 3, 4, 5).
  • This apparent weakness associated with narrow spectrum polysaccharide based antigens attention has been focused on the non- polys accharide capsule related pneumococcal proteins, many of which are involved in the pathogenesis of infections. These proteins are considered to be interesting components for future vaccines, since they cover all serotypes of pneumococci.
  • the protein loci are less variable than those encoding the genes for capsular polysaccharide production, and they are more likely to be able to elicit an immune response in children (6, 7, 8, 9).
  • vaccines that have been developed thus far are systemic vaccines, i.e. vaccines that have to be injected.
  • a mucosal vaccine that could e.g. be administered intranasally would be preferred for ease of administration, especially in children.
  • Opsonization is the process of making a microorganism more susceptible for the uptake by a phagocyte. In said process, opsonizing antibodies and/or proteins bind to said microorganism, thereby facilitating the uptake of said microorganism by said phagocyte.
  • Opsonophagocytosis is measured in living phagocytic cells and comprises measuring the uptake by phagocytic cells of microorganisms pretreated with opsonizing antibodies.
  • surface antigens i.e. antigens naturally or artificially associated with the surface of a microorganism that specifically induce opsonophagocytosis.
  • surface antigens with opsonophagocytosis inducing ability can be selected from a collection of surface proteins. This typically implies that said surface proteins are isolated from microorganisms and subsequently are purified and tested.
  • mice active and passive immunization procedures with said recombinant protein or with antibodies against said protein are performed to test the opsonizing potential of said recombinant protein.
  • Protective ability of the selected protein or part thereof may be measured in a vaccination challenge experiment.
  • three proteins have been identified as possible phagocytosis inducing vaccine components and are disclosed herein.
  • One of said proteins is a protein called pneumococcal IgAl protease (IgAl proteinase), a protease that can convert human dimer IgA molecules into monomers.
  • Another protein is a peptidyl prolyl isomerase, which we named streptococcal lipoprotein rotamase A (SlrA).
  • Yet another protein is pneumococcal surface adhesion protein A (PsaA)
  • PpmA protein has been classified as an isomerase enzyme.
  • SlrA protein with a peptidyl prolyl isomerase activity
  • SlrA although belonging to another family of proteins than PpmA also appeared to be an opsonophagocytosis-inducing antigen.
  • abovementioned proteins have not been identified by any other method as being opsonophagocytosis enhancing proteins.
  • antibodjr titers against SlrA, or IgAlproteinase and the first episode of acute otitis media (middle ear infection) in children in a large serological survey in Finland as is described in example one. In the absence of such a correlation, these proteins were not considered to be important for the defense against streptococcal infection.
  • a method to identify an opsonophagocytosis inducing antigen as a vaccine component for immunization against a microorganism comprising selecting (in silico) via a molecule associated with the surface of a microorganism such as a membrane anchoring motif and/or a cell wall binding domain, a nucleotide sequence encoding at least part of a bacterial protein, and producing at least part of said protein, and contacting a collection of antibodies to said protein and testing for binding between at least one antibody and at least one antigen, and measuring the opsonizing ability of said binding antibody for a microorganism having such an antigen.
  • motifs which can be used for the in silico selection comprise, for example, a lipobox (anchoring to membrane via a lipid group), a peptidoglycan binding domain(PBD), a choline binding domain (CBD) or a LPxTG motief (cell wall binding domain).
  • a lipobox anchoring to membrane via a lipid group
  • PBD peptidoglycan binding domain
  • CBD choline binding domain
  • LPxTG motief cell wall binding domain
  • said collection of antibodies can be produced by raising antibodies in an animal, by immunizing for example a rabbit or a mouse or a rat or another animal with at least part of said selected protein of said microorganism. Therefore, this application also teaches a method to identify an opsonophagocytosis inducing antigen as a vaccine component for immunisation against a microorganism as described above wherein said collection of antibodies is raised by immunizing an animal with at least one antigen of said microorganism.
  • Antibodies against said proteins may also be selected from pre-existing collections of antibodies or functional parts, derivatives or analogues thereof. This method can be applied to any microorganism for which the defence by the immune system depends on opsonophagocytosis.
  • the application teaches a method to identify an opsonophagocytosis inducing antigen as a vaccine component for immunisation against a microorganism as described, wherein said microorganism is for example a member of the genus Streptococcus, for example a member of the species of Streptococcus pneumoniae, or Streptococcus viridans, or Streptococcus canis, or Streptococcus suis, or a member of the genus Staphylococcus, for example a member of the species Staphylococcus aureus, or Staphylococcus epidermidis, or a coagulase negative Staphylococcus, or a member of the species Moraxella catarrhalis, or Neisseria meningitidis, or Neisseria ghonorrhoeae, or Helicobacter pylori, or Haemophilus influenzae or Campylobacter jejuni, or
  • said partially homologous protein or a part thereof is recombinantly produced and tested for its capability to induce opsonophagocytosis. Therefore, this application also teaches a nucleotide sequence at least encoding for a functional part of a protein, said protein inducing opsonophagocytosis of a microorganism having such a protein, wherein said protein is partially homologous with a protein selected by the method as described above. Said nucleotide sequence can be incorporated into a recombinant vector and herewith, recombinant cells can be provided.
  • Said recombinant cell produces protein based on said nucleotide sequence
  • this application teaches a recombinant vector comprising a nucleotide sequence at least encoding for a functional part of a protein, said protein inducing opsonophagocytosis of a microorganism having such a protein, wherein said protein is partially homologous with a protein selected by the method as described above.
  • the application also teaches a recombinant cell expressing at least part of a nucleotide, and a purified protein, produced by said recombinant cell.
  • Said antigen or protein or a part thereof can be used as a vaccine component for immunisation against a microorganism, therefore this application teaches a vaccine component for immunisation against a micro organism which can be killed by opsonophagocytic cells, said vaccine component comprising said protein, and/or an antigenic part thereof.
  • said vaccine component may comprise at least a functional part of streptococcal lipoprotein rotamase A (SlrA) of Streptococcus pneumoniae. Therefore, this patent application discloses said vaccine component, comprising at least a functional part of streptococcal lipoprotein rotamase A (SlrA) of Streptococcus pneumoniae.
  • said vaccine component may comprise at least a functional part of pneumococcal IgAl protease (IgAl) of Streptococcus pneumoniae. Therefore, this patent application discloses said vaccine component, comprising at least a functional part of pneumococcal IgAl protease (IgAl) of Streptococcus pneumoniae.
  • said vaccine component may comprise at least a functional part of pneumococcal surface adhesion protein A (PsaA) of Streptococcus pneumoniae. Therefore, this patent application discloses said vaccine component, comprising at least a functional part of pneumococcal surface adhesion protein A (PsaA) of Streptococcus pneumoniae.
  • PsaA pneumococcal surface adhesion protein A
  • a functional part of a protein it is meant that the minimal amount of amino acid is taken which is still able to raise an immune response in the vaccinate subject.
  • antigenic part is used in this specification to identify such a functional part of a protein. Generally, such parts will at least be more than 10 amino acids, and preferably about 50-100 amino acids.
  • said vaccine component may also comprise at least an antigenic part of pneumococcal maturation protein A (PpmA) of Streptococcus pneumoniae or another protein.
  • PpmA pneumococcal maturation protein A
  • a vaccine may be produced for the treatment of an infection by a microorganism, which can be killed by opsonophagocytic cells.
  • this application teaches a vaccine comprising at least one of said vaccine components and/or a homologous and/or functionally homologous protein or protein fragment thereof for the treatment of an infection by a microorganism that can be killed by opsonophagocytic cells.
  • a pharmaceutically acceptable carrier and/or adjuvant comprises cell wall material of Gram positive bacteria, more preferable it comprises co-called ghosts (empty bacterial cells, which still have an intact cell wall structure). It is further preferable to couple the antigens to such ghosts, for example by using protein anchors, such as the AcmA protein anchor.
  • Other adjuvants may be chosen from adjuvant preparations known in the art, such as emulsions with vitamin E. Therefore, this application also teaches said vaccine, also comprising a pharmaceutically acceptable carrier and/or adjuvant.
  • antibody refers to monoclonal antibodies, multispecific antibodies (e.g., bi-specific), human antibodies, humanized antibodies, camelised antibodies, chimeric antibodies, single-chain Fvs (scFv), single chain antibodies, synthetic antibodies, single domain antibodies, Fab fragments, F(ab) fragments, disulfide -linked Fvs (sdFv), and anti-idiotypic (anti-Id) antibodies, and epitope -binding fragments of any of the above.
  • antibodies include immunoglobulin molecules and imniunologically active fragments of immunoglobulin molecules, i.e., molecules that contain an antigen binding site.
  • Immunoglobulin molecules can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2) or subclass.
  • Antibodies of the invention include, but are not limited to, monoclonal antibodies, multispecific antibodies, synthetic antibodies, human antibodies, humanized antibodies, chimeric antibodies, single-chain Fvs (scFv), single chain antibodies, Fab fragments, F(ab') fragments, disulfide-linked Fvs (sdFv), and anti-idiotypic (anti-Id) antibodies (including, e.g., anti-Id antibodies to antibodies of the invention), and epitope-binding fragments of any of the above.
  • antibodies of the present invention include immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site that immunospecifically binds to a vaccine component according to the invention.
  • the immunoglobulin molecules of the invention can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2) or subclass of immunoglobulin molecule.
  • the antibodies of the invention may be from any animal origin including birds and mammals (e.g., human, murine, donkey, sheep, rabbit, goat, guinea pig, camel, horse, or chicken).
  • the antibodies of the invention are human or humanized monoclonal antibodies.
  • human antibodies include antibodies having the amino acid sequence of a human immunoglobulin and include antibodies isolated from human immunoglobulin libraries (including, but not limited to, synthetic libraries of immunoglobulin sequences homologous to human immunoglobulin sequences) or from mice that express antibodies from human genes.
  • high potency antibodies can be used in the methods of the invention.
  • high potency antibodies can be produced by genetically engineering appropriate antibody gene sequences and expressing the antibody sequences in a suitable host. The antibodies produced can be screened to identify antibodies with, e.g., high kon values in a BIAcore assay (see below).
  • an antibody to be used with the methods of the present invention or fragment thereof has an affinity constant or Ka (kon/koff) of at least 102 M-1, at least 5 X 102 M-1, at least 103 M-1, at least 5 X 103 M-1, at least 104 M-1, at least 5 X 104 M-1, at least 105 M-1, at least 5 X 105 M-1, at least 106 M-1, at least 5 X 106 M-1, at least 107 M-1, at least 5 X 107 M-1, at least 108 M-1, at least 5 X 108 M-1, at least 109 M-1, at least 5 X 109 M-1, at least 1010 M-1, at least 5 X 1010 M-1, at least 1011 M-1, at least 5 X 1011 M-1, at least 1012 M-1, at least 5 X 1012 M-1, at least 1013 M-1, at least 5 X 1013 M-1, at least 1014 M-1, at least 5 X 1014 M-1, at least 5 X
  • an antibody to be used with the methods of the invention or fragment thereof has a dissociation constant or Kd (koff/kon) of less than 10-2 M, less than 5 X 10-2 M, less than 10-3 M, less than 5 X 10-3 M, less than 10-4 M, less than 5 X 10-4 M, less than 10-5 M, less than 5 X 10-5 M, less than 10-6 M, less than 5 X 10-6 M, less than 10-7 M, less than 5 X 10-7 M, less than 10-8 M, less than 5 X 10-8 M, less than 10-9 M, less than 5 X 10-9 M, less than 10-10 M, less than 5 X 10-10 M, less than 10-11 M, less than 5 X 10-11 M, less than 10-12 M, less than 5 X 10-12 M, less than 10-13 M, less than 5 X 10-13 M, less than 10-14 M, less than 5 X 10-14 M, less than 10-15 M, or less than 5 X 10-15 M.
  • Kd dissociation constant or Kd
  • an antibody to be used with the methods of the invention or fragment thereof that has a median effective concentration (EC50) of less than 0.01 nM, less than 0.025 nM, less than 0.05 nM, less than 0.1 nM, less than 0.25 nM, less than 0.5 nM, less than 0.75 nM, less than 1 nM, less than 1.25 nM, less than 1.5 nM, less than 1.75 nM, or less than 2 nM, in an in vitro microneutralization assay.
  • the median effective concentration is the concentration of antibody or antibody fragments that neutralizes 50% of the infective micro-organism in an in vitro microneutralization assay.
  • an antibody to be used with the methods of the invention or fragment thereof has an EC50 of less than 0.01 nM, less than 0.025 nM, less than 0.05 nM, less than 0.1 nM, less than 0.25 nM, less than 0.5 nM, less than 0.75 nM, less than 1 nM, less than 1.25 nM, less than 1.5 nM, less than 1.75 nM, or less than 2 nM, in an in vitro microneutralization assay.
  • the antibodies to be used with the methods of the invention include derivatives that are modified, i.e, by the covalent attachment of any type of molecule to the antibody.
  • the antibody derivatives include antibodies that have been modified, e.g., by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, synthesis in the presence of tunicamycin, etc. Additionally, the derivative may contain one or more non-classical amino acids.
  • the present invention also provides antibodies of the invention or fragments thereof that comprise a framework region known to those of skill in the art.
  • one or more framework regions, preferably, all of the framework regions, of an antibody to be used in the methods of the invention or fragment thereof are human.
  • the fragment region of an antibody of the invention or fragment thereof is humanized.
  • the antibody to be used with the methods of the invention is a synthetic antibody, a monoclonal antibody, an intrabody, a chimeric antibody, a human antibody, a humanized chimeric antibody, a humanized antibody, a glycosylated antibody, a multispecific antibody, a human antibody, a single-chain antibody, or a bispecific antibody.
  • the antibodies to be used with the invention have half-lives in a mammal, preferably a human, of greater than 12 hours, greater than 1 day, greater than 3 days, greater than 6 days, greater than 10 days, greater than 15 days, greater than 20 days, greater than 25 days, greater than 30 days, greater than 35 days, greater than 40 days, greater than 45 days, greater than 2 months, greater than 3 months, greater than 4 months, or greater than 5 months.
  • Antibodies or antigen-binding fragments thereof having increased in vivo half-lives can be generated by techniques known to those of skill in the art.
  • antibodies or antigen-binding fragments thereof with increased in vivo half-lives can be generated by modifying (e.g., substituting, deleting or adding) amino acid residues identified as involved in the interaction between the Fc domain and the FcRn receptor (see, e.g., PCT Publication No. WO 97/34631 and U.S.
  • Patent Application No.: 10/020,354 entitled “Molecules with Extended Half- Lives, Compositions and Uses Thereof, filed December 12, 2001, by Johnson et al., which are incorporated herein by reference).
  • Such antibodies or antigen- binding fragments thereof can be tested for binding activity to the vaccine components of the invention as well as for in vivo efficacy using methods known to those skilled in the art, for example, by immunoassays described herein.
  • antibodies or antigen-binding fragments thereof with increased in vivo half-lives can be generated by attaching to said antibodies or antibody fragments polymer molecules such as high molecular weight polyethyleneglycol (PEG).
  • PEG polymer molecules
  • PEG can be attached to said antibodies or antibody fragments with or without a multifunctional linker either through site-specific conjugation of the PEG to the N— or C- terminus of said antibodies or antibody fragments or via epsilon-amino groups present on lysine residues.
  • Linear or branched polymer derivatization that results in minimal loss of biological activity will be used.
  • the degree of conjugation will be closely monitored by SDS-PAGE and mass spectrometry to ensure proper conjugation of PEG molecules to the antibodies.
  • Unreacted PEG can be separated from antibody- PEG conjugates by, e.g., size exclusion or ion-exchange chromatography.
  • PEG- derivatizated antibodies or antigen-binding fragments thereof can be tested for binding activity to the vaccine components of the invention as well as for in vivo efficacy using methods known to those skilled in the art, for example, by immunoassays described herein.
  • the antibodies to be used with the methods of the invention are fusion proteins comprising an antibody or fragment thereof that immunospecifically binds to a vaccine component of the invention and a heterologous polypeptide.
  • the heterologous polypeptide that the antibody or antibody fragment is fused to is useful for targeting the antibody to cells which are prone to infection.
  • antibodies to be used with the methods of the invention or fragments thereof disrupt or prevent the interaction between an microbial antigen and its host cell receptor.
  • antibodies to be used with the methods of the invention are single-chain antibodies.
  • the design and construction of a single- chain antibody is described in Marasco et al, 1993, Proc Natl Acad Sci 90:7889- 7893, which is incorporated herein by reference.
  • the antibodies to be used with the invention bind to an intracellular epitope, i.e., are intrabodies.
  • An intrabody comprises at least a portion of an antibody that is capable of immunospecifically binding an antigen and preferably does not contain sequences coding for its secretion. Such antibodies will bind its antigen intracellularly.
  • the intrabody comprises a single -chain Fv ("sFv").
  • sFv are antibody fragments comprising the VH and VL domains of antibody, wherein these domains are present in a single polypeptide chain.
  • the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the sFv to form the desired structure for antigen binding.
  • the intrabody preferably does not encode an operable secretory sequence and thus remains within the cell (see generally Marasco, WA, 1998, "Intrabodies: Basic Research and Clinical Gene Therapy Applications” Springe :New York).
  • intrabodies are well-known to the skilled artisan and is described for example in U.S. Patent Nos. 6,004,940; 6,072,036; 5,965,371, which are incorporated by reference. Further, the construction of intrabodies is discussed in Ohage and Steipe, 1999, J. Mol. Biol. 291:1119-1128; Ohage et al., 1999, J. Mol. Biol. 291:1129-1134; and Wirtz and Steipe, 1999, Protein Science 8:2245-2250. Recombinant molecular biological techniques such as those described for recombinant production of antibodies (see below) may also be used in the generation of intrabodies.
  • intrabodies of the invention retain at least about 75% of the binding effectiveness of the complete antibody (i.e., having constant as well as variable regions) to the antigen. More preferably, the intrabody retains at least 85% of the binding effectiveness of the complete antibody. Still more preferably, the intrabody retains at least 90% of the binding effectiveness of the complete antibody. Even more preferably, the intrabody retains at least 95% of the binding effectiveness of the complete antibody.
  • polynucleotides encoding the variable region for both the VH and VL chains of interest can be cloned by using, for example, hybridoma mRNA or splenic mRNA as a template for PCR amplification of such domains (Huse et al., 1989, Science 246:1276).
  • the polynucleotides encoding the VH and VL domains are joined by a polynucleotide sequence encoding a linker to make a single chain antibody (sFv).
  • the sFv typically comprises a single peptide with the sequence VH -linker-VL or VL-linker-VH.
  • the linker is chosen to permit the heavy chain and light chain to bind together in their proper conformational orientation (see for example, Huston, et al., 1991, Methods in Enzym. 203:46-121).
  • the linker can span the distance between its points of fusion to each of the variable domains (e.g., 3.5 nm) to minimize distortion of the native Fv conformation.
  • the linker is a polypeptide of at least 5 amino acid residues, at least 10 amino acid residues, at least 15 amino acid residues, or greater.
  • the linker should not cause a steric interference with the VH and VL domains of the combining site.
  • the linker is 35 amino acids or less, 30 amino acids or less, or 25 amino acids or less.
  • the linker is between 15-25 amino acid residues in length.
  • the linker is hydrophilic and sufficiently flexible such that the VH and VL domains can adopt the conformation necessary to detect antigen. Intrabodies can be generated with different linker sequences inserted between identical VH and VL domains. A linker with the appropriate properties for a particular pair of VH and VL domains can be determined empirically by assess the degree of antigen binding for each. Examples of linkers include, but are not limited to, those sequences disclosed in Table IA. Table IA Sequence
  • intrabodies are expressed in the cytoplasm.
  • the intrabodies are localized to various intracellular locations.
  • specific localization sequences can be attached to the intranucleotide polypepetide to direct the intrabody to a specific location.
  • Intrabodies can be localized, for example, to the following intracellular locations: endoplasmic reticulum (Munro et al., 1987, Cell 48:899-907; Hangejorden et al., 1991, J. Biol. Chem. 266:6015); nucleus (Lanford et al., 1986, Cell 46:575; Stanton et al.,1986, PNAS 83:1772; Harlow et al., 1985, Mol. Cell Biol.
  • nucleolar region (Seomi et al., 1990, J. Virology 64:1803; Kubota et al., 1989, Biochem. Biophys. Res. Comm. 162:963; Siomi et al., 1998, Cell 55:197); endosomal compartment (Bakke et al., 1990, Cell 63:707-716); mitochondrial matrix (Pugsley, A. P., 1989, "Protein Targeting", Academic Press, Inc.); Golgi apparatus (Tang et al., 1992, J. Bio. Chem.
  • VH and VL domains are made up of the immunoglobulin domains that generally have a conserved structural disulfide bond.
  • the intrabodies are expressed in a reducing environment (e.g., the cytoplasm), such a structural feature cannot exist. Mutations can be made to the intrabody polypeptide sequence to compensate for the decreased stability of the immunoglobulin structure resulting from the absence of disulfide bond formation.
  • the VH and/or VL domains of the intrabodies contain one or more point mutations such that their expression is stabilized in reducing environments (see Steipe et al., 1994, J. Mol. Biol.
  • the antibodies to be used with the methods of the invention or fragments thereof can be produced by any method known in the art for the synthesis of antibodies, in particular, by chemical synthesis or preferably, by recombinant expression techniques.
  • Polyclonal antibodies to vaccine component of the invention can be produced by various procedures well known in the art.
  • an antigen according to the invention can be administered to various host animals including, but not limited to, rabbits, mice, rats, etc. to induce the production of sera containing polyclonal antibodies specific for the antigen.
  • adjuvants may be used to increase the immunological response, depending on the host species, and include but are not limited to, Freund's (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanins, dinitrophenol, bacterial ghosts, and potentially useful human adjuvants such as BCG (bacille Calmette-Guerin) and corynebacterium parvurn.
  • BCG Bacille Calmette-Guerin
  • corynebacterium parvurn Such adjuvants are also well known in the art.
  • the antigens are preferably coupled to the ghost, for instance through protein anchors, of which the AcmA protein anchor is especially preferred.
  • Monoclonal antibodies can be prepared using a wide variety of techniques known in the art including the use of hybridoma, recombinant, and phage display technologies, or a combination thereof.
  • monoclonal antibodies can be produced using hybridoma techniques including those known in the art and taught, for example, in Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988); Hammerling, et al., in: Monoclonal Antibodies and T-Cell Hybridomas 563-681 (Elsevier, N.Y., 1981).
  • the term “monoclonal antibody” as used herein is not limited to antibodies produced through hybridoma technology.
  • the term “monoclonal antibody” refers to an antibody that is derived from a single clone, including any eukaryotic, prokaryotic, or phage clone, and not the method by which it is produced.
  • a method of generating monoclonal antibodies comprises culturing a hybridoma cell secreting an antibody of the invention wherein, preferably, the hybridoma is generated by fusing splenocytes isolated from a mouse immunized with an antigen with myeloma cells and then screening the hybridomas resulting from the fusion for hybridoma clones that secrete an antibody able to bind said antigen.
  • Antibody fragments which recognize the specific antigens of the invention may be generated by any technique known to those of skill in the art.
  • Fab and F(ab')2 fragments of the invention may be produced by proteolytic cleavage of immunoglobulin molecules, using enzymes such as papain (to produce Fab fragments) or pepsin (to produce F(ab')2 fragments).
  • F(ab')2 fragments contain the variable region, the light chain constant region and the CHI domain of the heavy chain.
  • the antibodies to be used with the present invention can also be generated using various phage display methods known in the art.
  • phage display methods functional antibody domains are displayed on the surface of phage particles which carry the polynucleotide sequences encoding them.
  • DNA sequences encoding VH and VL domains are amplified from animal cDNA libraries (e.g., human or murine cDNA libraries of lymphoid tissues).
  • the DNA encoding the VH and VL domains are recombined together with an scFv linker by PCR and cloned into a phagemid vector (e.g., p CANTAB 6 or pComb 3 HSS).
  • the vector is electroporated in E. coli and the E. coli is infected with helper phage.
  • Phage used in these methods are typically filamentous phage including fd and M13 and the VH and VL domains are usually recombinantly fused to either the phage gene III or gene VIII.
  • Phage expressing an antigen binding domain that binds to an antigen of interest can be selected or identified with antigen, e.g., using labeled antigen or antigen bound or captured to a solid surface or bead. Examples of phage display methods that can be used to make the antibodies of the present invention include those disclosed in Brinkman et al., 1995, J. Immunol. Methods 182:41-50; Ames et al., 1995, J. Immunol.
  • the antibody coding regions from the phage can be isolated and used to generate whole antibodies, including human antibodies, or any other desired antigen binding fragment, and expressed in any desired host, including mammalian cells, insect cells, plant cells, yeast, and bacteria, e.g., as described below.
  • Techniques to recombinantly produce Fab, Fab' and F(ab')2 fragments can also be employed using methods known in the art such as those disclosed in PCT publication No.
  • PCR primers including VH or VL nucleotide sequences, a restriction site, and a flanking sequence to protect the restriction site can be used to amplify the VH or VL sequences in scFv clones.
  • VH constant region e.g., the human gamma 4 constant region
  • VL constant region e.g., human kappa or lamb a constant regions.
  • the vectors for expressing the VH or VL domains comprise an EF-l ⁇ promoter, a secretion signal, a cloning site for the variable domain, constant domains, and a selection marker such as neomycin.
  • the VH and VL domains may also cloned into one vector expressing the necessary constant regions.
  • the heavy chain conversion vectors and light chain conversion vectors are then co-transfected into cell lines to generate stable or transient cell lines that express full-length antibodies, e.g., IgG, using techniques known to those of skill in the art.
  • human or chimeric antibodies For some uses, including in vivo use of antibodies in humans and in vitro detection assays, it may be preferable to use human or chimeric antibodies. Completely human antibodies are particularly desirable for therapeutic treatment of human subjects.
  • Human antibodies can be made by a variety of methods known in the art including phage display methods described above using antibody libraries derived from human immunoglobulin sequences or synthetic sequences homologous to human immunoglobulin sequences. See also U.S. Patent Nos. 4,444,887 and 4,716,111; and PCT publications WO 98/46645, WO 98/50433, WO 98/24893, WO98/16654, WO 96/34096, WO 96/33735, and WO 91/10741.
  • Human antibodies can also be produced using transgenic mice which are incapable of expressing functional endogenous immunoglobulins, but which can express human immunoglobulin genes.
  • the human heavy and light chain immunoglobulin gene complexes may be introduced randomly or by homologous recombination into mouse embryonic stem cells.
  • the human variable region, constant region, and diversity region may be introduced into mouse embryonic stem cells in addition to the human heavy and light chain genes.
  • the mouse heavy and light chain immunoglobulin genes may be rendered non-functional separately or simultaneously with the introduction of human immunoglobulin loci by homologous recombination.
  • homozygous deletion of the JH region prevents endogenous antibody production.
  • the modified embryonic stem cells are expanded and microinjected into blastocysts to produce chimeric mice.
  • the chimeric mice are then be bred to produce homozygous offspring which express human antibodies.
  • the transgenic mice are immunized in the normal fashion with a selected antigen, e.g., all or a portion of a polypeptide of the invention.
  • Monoclonal antibodies directed against the antigen can be obtained from the immunized, transgenic mice using conventional hybridoma technology.
  • the human immunoglobulin transgenes harbored by the transgenic mice rearrange during B cell differentiation, and subsequently undergo class switching and somatic mutation.
  • Lonberg and Huszar (1995, Int. Rev. Immunol. 13:65-93).
  • this technology for producing human antibodies and human monoclonal antibodies and protocols for producing such antibodies see, e.g., PCT publication Nos.
  • companies such as Medarex, Inc. (Princeton, NJ), Abgenix, Inc. (Freemont, CA) and Genpharm (San Jose, CA) can be engaged to provide human antibodies directed against a selected antigen using technology similar to that described above.
  • a chimeric antibody is a molecule in which different portions of the antibody are derived from different immunoglobulin molecules such as antibodies having a variable region derived from a non-human (e.g., murine) antibody and a human immunoglobulin constant region.
  • Methods for producing chimeric antibodies are known in the art. See e.g., Morrison, 1985, Science 229:1202; Oi et al., 1986, BioTechniques 4:214; Gillies et al., 1989, J. Immunol. Methods 125:191-202; and U.S. Patent Nos. 5,807,715, 4,816,567, and 4,816,397.
  • Chimeric antibodies comprising one or more CDRs from human species and framework regions from a non-human immunoglobulin molecule can be produced using a variety of techniques known in the art including, for example, CDR-grafting (EP 239,400; PCT publication No. WO 91/09967; and U.S. Patent Nos. 5,225,539, 5,530,101, and 5,585,089), veneering or resurfacing (EP 592,106; EP 519,596; Padlan, 1991, Molecular Immunology 28(4/5):489-498; Studnicka et al., 1994, Protein Engineering 7(6):805-814; and Roguska et al., 1994, PNAS 91:969-973), and chain shuffling (U.S.
  • antibodies comprise one or more CDRs and human framework regions.
  • framework residues in the framework regions will be substituted with the corresponding residue from the CDR donor antibody to alter, preferably improve, antigen binding.
  • These framework substitutions are identified by methods well known in the art, e.g., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions.
  • Polynucleotides encoding antibodies to be used with the invention may be obtained, and the nucleotide sequence of the polynucleotides determined, by any method known in the art.
  • Such a polynucleotide encoding the antibody may be assembled from chemically synthesized oligonucleotides (e.g., as described in Kutmeier et al., 1994, BioTechniques 17:242)..
  • a polynucleotide encoding an antibody may be generated from nucleic acid from a suitable source. If a clone containing a nucleic acid encoding a particular antibody is not available, but the sequence of the antibody molecule is known, a nucleic acid encoding the immunoglobulin may be chemically synthesized or obtained from a suitable source (e.g., an antibody cDNA library, or a cDNA library generated from, or nucleic acid, preferably poly A+ RNA, isolated from, any tissue or cells expressing the antibody, such as hybridoma cells selected to express an antibody of the invention) by PCR amplification using synthetic primers hybridizable to the 3' and 5' ends of the sequence or by cloning using an oligonucleotide probe specific for the particular gene sequence to identify, e.g., a cDNA clone from a cDNA library that encodes the antibody. Amplified nucleic acids generated by PCR may then be
  • the nucleotide sequence of the antibody may be manipulated using methods well known in the art for the manipulation of nucleotide sequences, e.g., recombinant DNA techniques, site directed mutagenesis, PCR, etc. (see, for example, the techniques described in Sambrook et al., 1990, Molecular Cloning, A Laboratory Manual, 2d Ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, NY and Ausubel et al., eds., 1998, Current Protocols in Molecular Biology, John Wiley & Sons, NY), to generate antibodies having a different amino acid sequence, for example to create amino acid substitutions, deletions, and/or insertions.
  • methods well known in the art for the manipulation of nucleotide sequences e.g., recombinant DNA techniques, site directed mutagenesis, PCR, etc. (see, for example, the techniques described in Sambrook et al., 1990, Molecular Cloning, A Laboratory Manual, 2d Ed., Cold Spring Harbor Laboratory
  • one or more of the CDRs is inserted within framework regions using routine recombinant DNA techniques.
  • the framework regions may be naturally occurring or consensus framework regions, and preferably human framework regions (see, e.g., Chothia et al., 1998, J. Mol. Biol. 278: 457-479 for a listing of human framework regions).
  • the polynucleotide generated by the combination of the framework regions and CDRs encodes an antibodjr that specifically binds to a vaccine component of the invention.
  • one or more amino acid substitutions may be made within the framework regions, and, preferably, the amino acid substitutions improve binding of the antibody to its antigen.
  • Such methods may be used to make amino acid substitutions or deletions of one or more variable region cysteine residues participating in an intrachain disulfide bond to generate antibody molecules lacking one or more intrachain disulfide bonds.
  • Other alterations to the polynucleotide are encompassed by the present invention and within the skill of the art.
  • Recombinant expression of an antibody to be used with the methods of the invention, derivative or analog thereof, requires construction of an expression vector containing a polynucleotide that encodes the antibody.
  • the vector for the production of the antibody molecule may be produced by recombinant DNA technology using techniques well known in the art.
  • the expression vector is transferred to a host cell by conventional techniques and the fransfected cells are then cultured by conventional techniques to produce an antibody of the invention.
  • Antibodies according to the invention can not only be used for passive vaccination, but can also be used for diagnostic purposes and in assay systems to detect presence of bacteria and/or the antigens to which they are directed. Such a diagnosis is useful (for instance) to test material (such as food, pharmaceutical compositions or air filters) for the presence of bacteria. It is also possible to develop a test system which can detect the antibodies themselves to check for the presence or to calculate the titer of antibodies in the blood of subjects that have been immunized with a vaccine according to the invention.
  • a person skilled in the art is well able to generate analogous compounds of the opsonophagocytosis inducing proteins of the invention. This can for instance be done through screening of a peptide library and testing to binding to one or more of the antibodies described above. Such an analogue has essentially the same biological properties of said protein in kind, i.e. it is able to generate a similar immunological response, not necessarily in amount. It will also be possible genetically engineer analogous compounds starting from the sequences provided in this specification. Such analogous compounds will have a sequence identity of more than 50% compared to the sequences given in the specification. Sequence identity may be defined and determined by the TBLASTN or TBLASTP program for nucleic acid or amino acid sequences, respectively, of Altschul et al.
  • Sequence identity may be at the nucleotide sequence and/or encoded amino acid sequence level.
  • the nucleic acid and/or amino acid sequence shares at least 50%, or 60% sequence identity, most preferably at least about 70%, or 80% or 90% sequence identity with the sequences of the specification as provided hereunder.
  • orthologous proteins i.e. proteins from other organisms, be it closely related or not to Streptococcus pneumoniae D39 and/or Streptococcus pneumoniae TIGR4, such as other Streptococcus pneumoniae strains, or other Streptococcus species, or even Staphylococcus, Moraxella, Neisseria and other bacteria, or even non-bacterial organisms.
  • Orthologous proteins in this regard means proteins from other species which proteins have the same common ancestry, but are different in sequence as a result of (spontaneous) mutations. These sequences can easily been found, for instance by comparing the sequences of the invention to other sequences available in sequence databases such as GenBank or by isolating orthologous proteins from other organisms by PCR mediated amplification methods in which (degenerated) primers are designed based on the sequences of the specification. Such methods are known to the person skilled in the art.
  • proteins obtained by the above described methods should further be tested with respect to their opsonophagocytosis inducing properties. Any protein obtained through the above discussed methods which appears to be opsonophagocytosis inducing is considered to be a protein of the invention and is considered to be suitable for inclusion into the vaccines of the invention. Also parts of these proteins which have retained the functional characteristic of being able to induce opsonophagocytosis are considered to be comprised in the present invention.
  • Opsonophagocytosis inducing proteins as vaccine components can also be combined with other opsonophagocytosis inducing proteins and/or other proteins to result in a better vaccine.
  • This patent application discloses the use of SlrA, IgAl proteinase and PsaA and the combination of PpmA and/or other proteins with said proteins.
  • a vaccine according to the invention comprises two of more opsonophagocytosis inducing proteins, wherein the combination of PpmA and SlrA, whether or not in the presence of further antigens, is most preferred.
  • the invention is further explained in the examples.
  • Example 1 Correlation of antibody titers against Streptococcus pneumoniae surface proteins with occurrence of first acute otitis media. A cross sectional population survey in Finland.
  • the IgG titers against PpmA, SlrA, and IgAl proteinase are all lower than the titers against alpha-enolase of Streptococcus pneumoniae. Because of the absence of this correlation of antibody titer and protection, SlrA and IgAl proteinase were considered to have no added value for protective immunity, and hence would not be selected for use as a vaccine component.
  • mice CMl outbred female mice, purchased from Harlan Olac, Bicester, UK All mice were barrier reared and specified pathogen free.
  • the active immunisation protocol started with 6 week old mice (25-30g) and passive immunisation with 9 week old mice (30-35g).
  • Bacterial strains
  • Streptococcus pneumoniae D39, serotype 2 has been obtained from the National Collection of Type Cultures (NCTC 7466; Central Public Health Laboratory, London). Streptococcus pneumoniae TIGR4, serotype 4, has been obtained from The Institute for Genome Research. Bacteria are grown on Blood Agar Base Number 2 (Oxoid, Basingstoke, UK) plus 5% (vol/vol) defibrinated horse blood (BAB). Stock cultures are prepared by inoculating a sweep of 4-5 colonies into 25ml Brain-Heart Infusion broth (BHI, Oxoid). Cultures are grown statically at 37°C overnight before 1ml aliquots containing 15% sterile glycerol are frozen at -70°C until use.
  • BHI Brain-Heart Infusion broth
  • Strain validation is carried out by confirming sensitivity to the antibiotic Optochin (Difco, Detroit, USA). Serotype verification is performed by checking for the presence of type specific polysaccharide capsule using anti-type 2 or 4 capsule antiserum (Statens Seruminstitut, Copenhagen, Denmark).
  • Bacteria were harvested by centrifugation at 3,000 rpm for lOmin (Heraeus medifuge), resuspended in fresh BHI containing 20% v/v FCS and then incubated at 37°C until they reached mid-log phase (as judged by optical density). 1ml aliquots of the suspension were stored at -70°C, until required. After 24h at -70°C viability of the suspension was measured by viable counting and optochin sensitivity was confirmed. Viability was unaffected by storage at -70°C for at least 3 months.
  • mice were held with the nose held upright, and pneumococci were introduced intranasally by adding a series of small droplets of the 50 ⁇ L inoculum in to the nostril for the mice to involuntarily inhale. After inoculation the mice were laid on their backs until recovery and the viable count of the inoculum was re-determined. Mice were monitored frequently (at least 3 times a day) during the following 14 days for signs of infection. On reaching the pre-determined endpoint (moribund) mice were killed by cervical dislocation and the survival time noted.
  • Serum was complement inactivated by incubation at 56°C for 30 min and was used at a pre-determined dilution. 24h and Ih prior to infection, mice were vaccinated by intraperitoneal injection of 200 ⁇ l serum. Mice were then infected as previously described. Bacteria were opsonized by incubation in the diluted serum at 37°C for lhr prior to infection. Mice were monitored frequently (at least 3 times a day) during the following 14 days for signs of infection. On reaching the pre-determined endpoint (moribund) mice were sacrificed by cervical dislocation and the survival time noted.
  • mice were randomly arranged in groups of 6 and a blood sample was removed from the tail vein prior 24h prior to initial vaccination.
  • Vaccines were prepared in a 1:1 ratio in either Freunds complete adjuvant or incomplete adjuvant (Sigma) or Hunter's TiterMax (CytRx Corp., Norcross, GA) or Quill A (Accurate Chemical Scientific Corporation, Westbury, NY 11590) as per manufacturers instructions.
  • lOO ⁇ l of vaccine was injected subcutaneously per mouse. Nine days later a blood sample was removed from half of the mice fro a tail vein.
  • mice By staggering this bleed and the next we could bleed all mice prior to vaccination and prior to infection but still monitor immune response during vaccination protocol: this kept us in line with the restrictions on the total number of bleeds/ mouse (3) and the minimum time interval between bleeds (14 days).
  • 24h after sampling blood vaccination was repeated as previously but if using Freunds, FIA (Freunds incomplete adjuvant) was used. 9 days after boost, a blood sample was removed from those mice not bled before last boost. 24h later vaccination was repeated as previously. 28 days later a blood sample was removed from the tail vein of all mice. 24h later mice were infected as previously described with approximately 10 G CFU Streptococcus pneumoniae D39 or TIGR4. Mice were monitored at least 3 times daily for signs of infection. On reaching the pre-determined endpoint (moribund) mice were sacrificed by cervical dislocation. Preparation of mouse virulent inoculum
  • mice were used for the production of mouse virulent inocula.
  • the number of times that inocula must be prepared/passaged depended on the virulence and viability of the organisms after prolonged freezing at -80°C.
  • mice per group; challenged with wild virulent strain of Streptococcus pneumoniae and with a strain D39 deleted for PpmA.
  • mice IgAl proteinase elicited a good protective immune response in the mice, as is shown in table 5 and fig. 7
  • PsaA elicited a good protective immune response in the mice, as is shown in hg. 8.
  • Vaccinating with two antigenic proteins resulted in a better survival time in mice after challenge with virulent Streptococcus pneumoniae D39 as is shown in table 6, and in fig. 9.
  • mice were vaccinated (2x200 ⁇ l) with rabbit-pre immune serum
  • the nucleotide sequence of PpmA was determined to search databases for partial homology.
  • the gene for PpmA was amplified by PCR from Streptococcus pneumoniae D39 with the primers
  • the recombinant protein was purified by Ni + affinity chromatography with the HisTrap Kit (Amersham Pharmacia) according to the manufacturers recommendations.
  • the purified recombinant protein was dialysed against 10mM HEPES buffer, pH7.5, freeze dried, and stored at -20°C.
  • the gene for the active peptide of SlrA was amplified by PCR from Streptococcus pneumoniae D39 with the primers
  • the amplified DNA was cloned into a pETlla expression vector (Stratagene, LaJolla, CA) and electrotransformed into E. coli BL21(DE3).
  • the recombinant protein was purified by Ni + affinity chromatography with the HisTrap Kit (Amersham Pharmacia) according to the manufacturers recommendations.
  • the purified recombinant protein was dialysed against lO M HEPES buffer, pH7.5, freeze dried, and stored at -20°C.
  • a 3948bp gene fragment which encodes amino acids 671-1987 of the IgAl proteinase was amplified by PCR from Streptococcus pneumoniae TIGR4 with the primers 5'CAACATCACATATGGGACAAACAGAACCAGAG3'and 5 CTTAGATCTTAATGATGGTGGTGATGATGGGCTTTAAAGATTGCTC3 ' which incorporate flanking Nde ⁇ and Bgl ⁇ l restriction sites, and a C-terminal His 6 tag.
  • the amplified DNA was cloned into a pETlla expression vector (Stratagene, LaJolla, CA) and electrotransformed into E. coli BL21(DE3).
  • the cells are lysed by sonication 3x 30seconds on ice (1 min intervals to allow cooling). Place lysate on a rotating shaker at 4°C for 20min (to dissolve inclusion bodies).
  • the crude lysate is cleared by centrifugation (15,000rpm for 30min in a JA20 rotor).
  • wash buffer (20mM sodium phosphate buffer pH7.4, 0.5M
  • the second fraction should contain the IgAl proteinase.
  • the 2 nd fraction is then dialyzed overnight against 2L lOmM Hepes buffer pH7.4.
  • the protein will re-precipitate. Recover the protein by centrifugation, Freeze dry and store at -20°C.
  • Protein can be resolubilized in 8M urea and then diluted in PBS etc. It will remain soluble at high concentrations in 4M urea.
  • Immunoglobulin Al protease (iga) nucleotide sequence [Streptococcus pneumoniae TIGR4]
  • the gene for PsaA was amplified by PCR from Streptococcus pneumoniae D39 with the primers 5'CCATGGCTAGCCACCATCACCATCACCATgctacaaactcaatcatcgc 3' and 5'TTTCGGATCCTTATTTTGCCAATCCTTCAGC 3' which incorporate flanking Nhel and BamHI restriction sites, and a N-terminal His6 tag.
  • the amplified DNA was cloned into a pETlla expression vector (Stratagene, LaJolla, CA) and electrotransformed into E. coli BL21(DE3).
  • the recombinant protein was purified by Ni + affinity chromatography with the HisTrap Kit (Amersham Pharmacia) according to the manufacturers recommendations. To prevent the formation of inclusion bodies, 8M urea was added to all buffers throughout the purification process.
  • the purified recombinant protein was dialysed against lOmM HEPES buffer, pH7.5, free dried, and
  • IgG antibodies to Eno, Iga, PpmA and SlrA in serum of humans suffering from pneumococcus infection were measured by EIA.
  • Microtiter plates (Maxisorp; Nunc, Roskilde, Denmark) were coated with lOO ⁇ l/well, with a coating concentration of 5 ⁇ g/ml of antigen in PBS and incubated overnight at 37°C.
  • the plates were blocked with 1% bovine serum albumin (BSA) and 0.05% Tween 20 in PBS at 37°C for 1 h.
  • the samples were serially diluted (starting at 1:100) in the dilution buffer (1% BSA, 0.05% Tween 20 in PBS).
  • the serum endpoint antibody titer was interpolated from the intersection of the absorbance-versus-serum dilution curve at the background fluorescence plus four times the standard deviation. The end-point titer was then converted into antibody concentration (EIA units of immunoglobulin per milliliter) by comparison with a standard serum consisting of pooled healthy adult volunteers, and was considered to contain 100 U/mL of anti-a-enolase, Iga, PpmA or SlrA.
  • a logistic regression was used to evaluate the effects of the acute phase antibody concentration, age and the nature of pneumococcal contact on the antibody response and to evaluate antibody concentrations (logarithm base e of antibody concentration) as a risk factor for the involvement of pneumococci as a risk factor for the development of AOM.
  • Children were grouped into eight 3- month groups according to the age at which the acute serum was sampled. To determine whether there were any significant differences in relation to age, groups were analyzed by 1-way ANOVA followed by a Tukey's HSD test
  • Lactococcus lactis ghosts in combination with the AcmA cell-wall- binding domain can be used as a carrier/adjuvant system for mucosal and systemic delivery of antigens (WO 99/25836 and WO 02/101026).
  • immunogenicity and protective activity of a tri- valent ghost-protein vaccine (SlrA, Igalprt, PpmA) was tested as well as that of each of the monovalent ghost-protein vaccines after nasal administration of the vaccines and nasal challenge with virulent S. pneumoniae.
  • the aim of the experiments was: • To evaluate protective activity of an intranasal administered L.
  • SlrA ghost-protein anchor tri-valent
  • PpmA ghost- protein anchor mono-valent
  • Igalprt ghost-protein anchor mono-valent
  • Plasmid pPA32 specifying a fusion between the S. pneumoniae PpmA protein and the protein anchor ( Figure 12), was constructed by ligating an Ncol- and EcoRI-cleaved PCR-amplified fragment of CbpA into the Ncol and EcoRI sites of pPA3 (Steen et al. 2003. J. Biol. Chem. 278:23874- 23881).
  • the PpmA-specific fragment was amplified with the primers PpmA.l (cggtctcacatgtcgaaagggtcagaaggtgcagacc) and PpmA.2 (cggtctcgaattgcttcgtttgatgtactactgcttgag) with S. pneumoniae strain D39 chromosomal DNA as template.
  • the ligation mix was cut with EcoRI and Nhel before it was used for electroporation of . lactis PAlOOl (Kuipers et al. J. Biol. Chem. 2004 Mar 24 [Epub ahead of print]).
  • the final construct was designated pPA32.
  • Plasmid pPAl52 specifying a fusion between a fragment of the S. pneumoniae Igalprt protein (residues 672 to 1330) and the protein anchor ( Figure 13). Plasmid pPAl52 was constructed by ligating an Ncol- and EcoRI-cleaved PCR-amplified fragment of Igalprt into the corresponding sites of pPA3.
  • the Igalprt-specific fragment was amplified with the primers Igal.fw2 (cgtctcccatgggacaaacagaaccagagccatcaaacgg) and Igaltrunc2.rev (ccgtctcgaattctagccagtccagcatc) with ⁇ S. pneumoniae strain TIGR4 chromosomal DNA as template.
  • the ligation mix was cut with Nhel before it was used for electroporation of L. lactis PAlOOl.
  • the final construct was designated pPAl52.
  • Plasmid pPAl62 specifying a fusion between the 5. pneumoniae SlrA protein and the protein anchor ( Figure 14), was constructed by ligating an Esp3l-cleaved PCR-amplified fragment of SlrA into the Ncol and EcoRI sites of plasmid pPA3.
  • the SlrA-specific fragment was amplified with the primers SlrA.fw (ccgtctcccatggtccaacgcagtctgcgt) and SlrA.rev (ccgtctcgaattccagatttaaaatcgtagtctttcacca) with S.
  • L. lactis ghosts were produced as described in WO 02/101026. Each dosis representing the amount used for one nasal administration in mice, contained approximately 2.5x109 ghosts.
  • the yeast-based GLS mediu was used for production of the vaccine.
  • GLS contains 2% gistex (Gistex® LS Ferm Powder AGGL - 1027180, Strik Special Additives, The Netherlands), 3% ⁇ - glycerophosphate and 2% glucose. Glucose was sterilized as a separate solution and added to the broth when the strain was inoculated.
  • L. lactis PAlOOl containing plasmids pPAl52, pPA32 or pPA162 were grown in GLS supplemented with 5 ⁇ g/ml chloramphenicol.
  • the cultures were induced by adding 1 ml of the cell- free supernatant of a nisin producing L. lactis culture per litre of medium (1:1000; Kuipers et al. 1997. Tibtech. 15: 135-140).
  • the culture was left at 30°C overnight, after which the culture supernatants were concentrated with a VivaFlow tangential flow module (Vivascience VivaFlow 200; 10,000 Da cutoff).
  • the concentrate was sterilised through a 0.45 ⁇ m filter and stored at +4° C until binding.
  • the vaccines were produced as follows: ghost-SlrA::PA monovalent vaccine: 27.5 ml of a lOx concentrated supernatant of a SlrA::PA producing L. lactis culture was bound to 4.6 ml Ghost (46 units) on a blood suspension mixer for 30 minutes at room temperature. After washing, the pellet was resuspended in 920 ⁇ l PBS and 880 ⁇ l was divided in 4 vials (220 ⁇ l each). 3 vials for the monovalent vaccine and 1 vial for the trivalent vaccine.
  • One dosis (20 ⁇ l) of a nasal vaccine contains 2.5xl0 9 Ghost cells.
  • mice Female outbred CD-I mice were purchased from Harlan France. Mice were 6 week-old at the time of starting the study.
  • S. pneumoniae D39, serotype 2 was obtained from the National Collection of Type Cultures (NCTC 7466; Central Public Health Laboratory, London).
  • mice were immunized intranasally under light inhalation anaesthesia (isoflurane/O2/N2O) by pipeting 20 ⁇ l of the vaccine or control onto the nostrils. Complete immunization consisted of 3 doses given at 10 day-intervals.
  • mice (10 per group) received PBS as control.
  • the vaccines consisted of 2.5 x 10 9 ghosts and contained 5 ⁇ g Igalprt, 10 Dg PpmA and 50 ⁇ g SlrA per dose for the mono-valent vaccines, 2.5 x 10 9 ghosts with a third of the monovalent doses of each antigen for the tri-valent vaccine.
  • the following groups were used: 1. 20 ⁇ l PBS.
  • Scoring of health status Each animal was scored 44 h after infection according to the criteria given in Table 11. The maximum score per group of 10 animals is 40 (all animals dead). All animals healthy results in a score of 0. The disease index is the percentage of the maximum score.
  • Igalprotease was coated at 10 ⁇ g/ml in coating buffer.
  • rat anti-mouse kappa chain (BD Biosciences 559749, 0.5 mg/ml) was coated at 1/500 dilution in coating buffer. After incubation overnight at 4 °C, the plates were rinsed 3 times with wash buffer (0.02% Tween 20 in PBS). The plates were blocked by adding 100 ⁇ l blocking buffer (1% BSA, 0.02% Tween 20 in PBS) in each well. The plates were incubated for 1 hour at room temperature. All blood samples were diluted 1/100 with blocking buffer, and serial dilutions (1/3) of these samples were performed in 100 ⁇ l blocking buffer.
  • the trivalent vaccine was composed by mixing the monovalent vaccines in a ratio of 1:1:1 with the total number of ghost the same as in the monovalent vaccines (2.5 x 109) resulting in the following amounts of antigen: ghost-SlrA::PA: 17 ⁇ g/dose
  • Serum IgG response were determined by ELISA after 3 immunizations in pre-challenge blood.
  • Figure 19 shows the serum IgG antigen specific responses generated in the different vaccine groups.
  • the responses against SlrA, PpmA and Igalprt in the monovalent vaccines are similar to the responses to these antigens in the tri-valent vaccines, indicating that the amounts of antigen in the tri-valent vaccine are sufficient to elicit serum antibody' responses of this magnitude for these antigens.
  • the combined response to the three antigens in the tri-valent vaccine is needed to obtain the protective effect, since each of the individual responses in the monovalent vaccine groups did not provide sufficient protection.
  • Igalprt vaccine provided increased protection of the mice after challenge with S. pneumoniae.
  • McCool TL Gate TR, Moy G, Weiser JN.
  • Fig. 1 Titres of anti-pneumococcal IgG against PpmA in children and adults.
  • Fig. 2. Titres of anti-pneumococcal IgG against pneumolysin in children and adults.
  • Fig. 4. Titres of anti-pneumococcal IgG against alpha-enolase in children and adults.
  • Fig. 5. Titres of anti-pneumococcal IgG against SlrA in children and adults.
  • Fig. 9 Survival time of SlrA- and PpmA-vaccinated CD-I mice infected intranasally with Streptococcus pneumoniae D39.
  • Fig 10 Passive immunization of CD-I mice with pre-immune serum (PIS), anti-PpmA serum (APS) and challenged intranasally with Streptococcus pneumoniae D39 or a PpmA-negative knockout strain of Streptococcus pneumoniae.
  • PIS pre-immune serum
  • APS anti-PpmA serum
  • Fig 11. Survival of MF-1 mice passively vaccinated with anti-PpmA antiserum and intranasally infected with Streptococcus pneumoniae D39.
  • Fig 12.. Sequence of the secreted PpmA::PA fusion protein. Underlined are the aminoacids of Igalprt. Protein anchor (PA) amino acids are in italics.
  • Fig 13 Sequence of the secreted Igalprt::PA fusion protein. Underlined are the aminoacids of Igalprt. Protein anchor (PA) amino acids are in italics.
  • Fig 14. Sequence of the secreted SlrA::PA fusion protein. Underlined are the aminoacids of Igalprt. Protein anchor (PA) amino acids are in italics.
  • Fig 15. A CBB stained SDS-PAGE gel with the ghost-antigen vaccines and a BSA reference. SlrA, PpmA and Igal are samples from the vaccine groups. Each sample represents one dose (20 ⁇ l). In the five lanes on the right, the number represents the amount of BSA in micrograms. An estimate of the amount of bound antigen is made and shown in the lower right part of the Figure.
  • Fig 16. Health status of the mice at the time of ending experiment (t 44-h after infection). A score ranging from 0-4 was attributed to each mouse according to the parameters described in material and methods. The disease index was calculated as percentage of maximal score and presented as average + SEM for each group. A high score indicates that most animals are diseased. A low score indicates that most animals are healthy.
  • Fig 18. Bacterial counts 44-h post-challenge in the lungs (A), nose (B) and blood (C). Graphs show individual data (0) and the average (— ) for each group. High bacterial counts are an indication that animals are not protected. Fig 19. Antigen specific IgG in the serum after 3 immunizations but prior to challenge. The values are presented as average + SEM for each group.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Organic Chemistry (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Genetics & Genomics (AREA)
  • Biotechnology (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Analytical Chemistry (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Virology (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Cell Biology (AREA)
  • Food Science & Technology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The invention relates to the field of biology, more specifically to the field of immunology and microbiology. The invention further relates to the field of vaccines against microbial infections and especially bacterial vaccines, in particular to pneumococcal vaccines. More in particular, the invention relates to means and methods to identify, select and isolate a vaccine component for passive and/or active immunisation against a microorganism that can be killed by opsonophagocytic cells. The invention relates to a method to identify an opsonophagocytosis inducing antigen as a vaccine component for immunisation against a microorganism. The invention describes three pneumococcal proteins SlrA, IgA1 proteinase, and PsaA, and their use as a vaccine component with or without PpmA. The invention also discloses the use of antibodies against said proteins for passive immunization and diagnosis.

Description

Title: Method for selecting and producing vaccine components and vaccines based thereon.
The invention relates to the field of biology, more specifically to the field of immunology and microbiology. The invention further relates to the field of vaccines against microbial infections and more in particular bacterial vaccines such as pneumococcal vaccines. More in particular, the invention relates to means and methods to identify, select and isolate a vaccine component to produce a vaccine for passive and/or active immunization against a microorganism that can be recognized and preferably taken up and more preferably killed by opsonophagocytic cells.
Streptococcus pneumoniae is the leading etiological agent of severe infections such as pneumonia, septicemia, meningitis and otitis media, and causes over three million deaths per year worldwide, of which a million are children. The problem of antimicrobial resistance in Streptococcus pneumoniae has been enhanced by the successful spread of a limited number of internationally recognized multi-resistant strains. These strains have complicated the treatment of pneumococcal disease, and this has further emphasized the need for vaccination as an alternative means of preventing the large-scale morbidity and mortality associated with pneumococcal infection. The initial attempt to develop an anti-pneumococcal vaccine that consisted of 23 out of 90 of the most prevalent capsular polysaccharides (Pneumovax 23©) was unsuccessful, since the vaccine polysaccharides were unable to elicit an immune response in people at most risk of pneumococcal infection: young children, immuno-compromised patients, and the elderly. Technical advances have allowed the linkage of capsular polysaccharides to highly immunogenic carrier proteins. The implementation of this technology using a vaccine consisting of tetanus toxoid linked to Haemophilus influenzae type B- polysaccharide has led to undetectable levels of carriage of Haemophilus influenzae type B, and an elimination of disease caused by this organism in vaccinated populations. Recently, a polys accharide conjugate pneumococcal vaccine (Prevnar©) has been licensed in the USA by Wyeth Lederle Vaccines. Prevnar© has been released in The Netherlands in 2001. The vaccine formulation is immunogenic in children, and consists of 7 of the most prevalent capsule polysaccharides conjugated to a highly immunogenic (non- pneumococcal) carrier protein. However, unlike the Haemophilus influenzae vaccine, this vaccine covers only 7 out of 90 of the known pneumococcal capsule serotypes, and clinical data from phase three trials conducted in the USA, Israel, and South Africa have shown that the use of this vaccine causes a shift in colonization by non-vaccine serotypes in place of vaccine serotypes (1, 2, 3, 4, 5). As a result of this apparent weakness associated with narrow spectrum polysaccharide based antigens, attention has been focused on the non- polys accharide capsule related pneumococcal proteins, many of which are involved in the pathogenesis of infections. These proteins are considered to be interesting components for future vaccines, since they cover all serotypes of pneumococci. The protein loci are less variable than those encoding the genes for capsular polysaccharide production, and they are more likely to be able to elicit an immune response in children (6, 7, 8, 9).
Further all the vaccines that have been developed thus far are systemic vaccines, i.e. vaccines that have to be injected. A mucosal vaccine that could e.g. be administered intranasally would be preferred for ease of administration, especially in children.
In our ongoing studies on the molecular epidemiology and pathogenesis of Streptococcus pneumoniae, we have developed a method for the extraction of surface associated pneumococcal proteins and the subsequent testing of said proteins for binding to antibodies. The antibody-antigen complex is identified, said antigen is isolated and characterized and antibodies, produced against said antigen, are subsequently tested for their opsonizing ability for the microorganism. The antigen, which is binding to an antibody with opsonizing ability for the microorganism having such an antigen on its surface, is identified by for example high-resolution two dimensional PAGE and mass spectrometric identification of the gel spots. This method has provided a means by which we isolated and identified a pneumococcal maturation protein (PpmA) with vaccine potential (10, 11).
The techniques used in the identification of surface-associated pneumococcal proteins, the sequence of ppmA and its protein product (PpmA) and its therapeutic potential are filed under European Patent application nr. 99202640.1.
Many microorganisms are characterized in that they are killed by a phagocytic cell after phagocytosis. Many microorganisms need to be opsonized by opsonins to enhance their phagocytosis. Opsonization is the process of making a microorganism more susceptible for the uptake by a phagocyte. In said process, opsonizing antibodies and/or proteins bind to said microorganism, thereby facilitating the uptake of said microorganism by said phagocyte. Opsonophagocytosis is measured in living phagocytic cells and comprises measuring the uptake by phagocytic cells of microorganisms pretreated with opsonizing antibodies. With this method a selection can be made for surface antigens i.e. antigens naturally or artificially associated with the surface of a microorganism that specifically induce opsonophagocytosis. Of course, surface antigens with opsonophagocytosis inducing ability can be selected from a collection of surface proteins. This typically implies that said surface proteins are isolated from microorganisms and subsequently are purified and tested.
In the present application we disclose a method for identifying surface proteins with opsonophagocytosis inducing ability that does not require the above described mixture of surface antigens as used in the patent application 99202640.1. We hereby disclose a method to combine selection, especially in silico selection with a functional test for opsonophagocytosis. By searching in silico for sequence motifs coding for a membrane anchor, or more preferably for a cell wall binding domain, a protein with opsonophagocytic potential is identified. Said in silico selection is followed by recombinant production of at least part of said selected protein. Said recombinant protein is subsequently used to immunize animals, and/or to contact a collection of antibodies. In mice, active and passive immunization procedures with said recombinant protein or with antibodies against said protein are performed to test the opsonizing potential of said recombinant protein. Protective ability of the selected protein or part thereof may be measured in a vaccination challenge experiment. With this method, three proteins have been identified as possible phagocytosis inducing vaccine components and are disclosed herein. One of said proteins is a protein called pneumococcal IgAl protease (IgAl proteinase), a protease that can convert human dimer IgA molecules into monomers. Another protein is a peptidyl prolyl isomerase, which we named streptococcal lipoprotein rotamase A (SlrA). Yet another protein is pneumococcal surface adhesion protein A (PsaA)
PpmA protein has been classified as an isomerase enzyme. In our search for other proteins with a homologous function on the surface of the microorganism, we found a protein with a peptidyl prolyl isomerase activity, SlrA. In this application, homologous is defined as sequential homology and/or functional homology.
SlrA, although belonging to another family of proteins than PpmA also appeared to be an opsonophagocytosis-inducing antigen. Surprisingly, abovementioned proteins have not been identified by any other method as being opsonophagocytosis enhancing proteins. For example, there was no correlation between antibodjr titers against SlrA, or IgAlproteinase and the first episode of acute otitis media (middle ear infection) in children in a large serological survey in Finland as is described in example one. In the absence of such a correlation, these proteins were not considered to be important for the defense against streptococcal infection.
Since the opsonophagocytic activity correlates with in vivo protection, these data show that SlrA, IgAl proteinase and PsaA have potential to elicit immune protection. Loss of virulence of microorganisms is often tested in vitro by investigating the replication of a microorganism missing said protein. The absence of SlrA, IgAlproteinase, or PsaA in recombinant strains of Streptococcus pneumoniae did not influence the in vitro characteristics of said microorganism. Therefore, said proteins would not have been selected as vaccine components by methods that are state of the art.
We disclose, in one embodiment, a method to identify an opsonophagocytosis inducing antigen as a vaccine component for immunization against a microorganism, comprising selecting (in silico) via a molecule associated with the surface of a microorganism such as a membrane anchoring motif and/or a cell wall binding domain, a nucleotide sequence encoding at least part of a bacterial protein, and producing at least part of said protein, and contacting a collection of antibodies to said protein and testing for binding between at least one antibody and at least one antigen, and measuring the opsonizing ability of said binding antibody for a microorganism having such an antigen.
The motifs which can be used for the in silico selection comprise, for example, a lipobox (anchoring to membrane via a lipid group), a peptidoglycan binding domain(PBD), a choline binding domain (CBD) or a LPxTG motief (cell wall binding domain). The above mentioned motifs are characterized as follows:
PBD: lΥ^-X^^-G-D-tSTJ-I LIAl-Xco.^-iyLIA] CBD: G-X(o,5)-G-X-|WYI]-[WYT]-[YVL]-[FV] Lipobox (+ signal peptide): <M-X(i,ι0)-[RK]-X-{DERK}(7α7)-[LVFTIMG]-
[ASTIVGMLCPFL] - [AGLIS VTFP] - C LPxTG: L-P-X-T-G
in which X denotes any naturally occurring amino acid, and in which the square brackets indicate one position which can be filled with any of the amino acids indicated between the square brackets. The numbers is subscript indicate that the corresponding amino acid is repeated the indicated number of times.
Of course, said collection of antibodies can be produced by raising antibodies in an animal, by immunizing for example a rabbit or a mouse or a rat or another animal with at least part of said selected protein of said microorganism. Therefore, this application also teaches a method to identify an opsonophagocytosis inducing antigen as a vaccine component for immunisation against a microorganism as described above wherein said collection of antibodies is raised by immunizing an animal with at least one antigen of said microorganism. Antibodies against said proteins may also be selected from pre-existing collections of antibodies or functional parts, derivatives or analogues thereof. This method can be applied to any microorganism for which the defence by the immune system depends on opsonophagocytosis. Therefore, the application teaches a method to identify an opsonophagocytosis inducing antigen as a vaccine component for immunisation against a microorganism as described, wherein said microorganism is for example a member of the genus Streptococcus, for example a member of the species of Streptococcus pneumoniae, or Streptococcus viridans, or Streptococcus canis, or Streptococcus suis, or a member of the genus Staphylococcus, for example a member of the species Staphylococcus aureus, or Staphylococcus epidermidis, or a coagulase negative Staphylococcus, or a member of the species Moraxella catarrhalis, or Neisseria meningitidis, or Neisseria ghonorrhoeae, or Helicobacter pylori, or Haemophilus influenzae or Campylobacter jejuni, or a member of the genus Pseudomonas, or the genus Bacillus.
Once identified, said partially homologous protein or a part thereof is recombinantly produced and tested for its capability to induce opsonophagocytosis. Therefore, this application also teaches a nucleotide sequence at least encoding for a functional part of a protein, said protein inducing opsonophagocytosis of a microorganism having such a protein, wherein said protein is partially homologous with a protein selected by the method as described above. Said nucleotide sequence can be incorporated into a recombinant vector and herewith, recombinant cells can be provided. Said recombinant cell produces protein based on said nucleotide sequence, therefore, this application teaches a recombinant vector comprising a nucleotide sequence at least encoding for a functional part of a protein, said protein inducing opsonophagocytosis of a microorganism having such a protein, wherein said protein is partially homologous with a protein selected by the method as described above. The application also teaches a recombinant cell expressing at least part of a nucleotide, and a purified protein, produced by said recombinant cell. Said antigen or protein or a part thereof can be used as a vaccine component for immunisation against a microorganism, therefore this application teaches a vaccine component for immunisation against a micro organism which can be killed by opsonophagocytic cells, said vaccine component comprising said protein, and/or an antigenic part thereof. In one embodiment, said vaccine component may comprise at least a functional part of streptococcal lipoprotein rotamase A (SlrA) of Streptococcus pneumoniae. Therefore, this patent application discloses said vaccine component, comprising at least a functional part of streptococcal lipoprotein rotamase A (SlrA) of Streptococcus pneumoniae. In another embodiment, said vaccine component may comprise at least a functional part of pneumococcal IgAl protease (IgAl) of Streptococcus pneumoniae. Therefore, this patent application discloses said vaccine component, comprising at least a functional part of pneumococcal IgAl protease (IgAl) of Streptococcus pneumoniae.
In yet another embodiment, said vaccine component may comprise at least a functional part of pneumococcal surface adhesion protein A (PsaA) of Streptococcus pneumoniae. Therefore, this patent application discloses said vaccine component, comprising at least a functional part of pneumococcal surface adhesion protein A (PsaA) of Streptococcus pneumoniae.
With the wording "at least a functional part" of a protein it is meant that the minimal amount of amino acid is taken which is still able to raise an immune response in the vaccinate subject. Also the term "antigenic part" is used in this specification to identify such a functional part of a protein. Generally, such parts will at least be more than 10 amino acids, and preferably about 50-100 amino acids.
We disclose in this patent application the protective ability of said proteins by active and passive immunization in a mouse model both with systemic vaccination and mucosal vaccination.
It may be advantageous to combine more than one surface protein or a functional part thereof in a vaccine, and also to combine at least one surface protein or functional part thereof with PpmA or with another protein to induce an even better immunity. Therefore, in another embodiment, said vaccine component may also comprise at least an antigenic part of pneumococcal maturation protein A (PpmA) of Streptococcus pneumoniae or another protein. With said vaccine components, a vaccine may be produced for the treatment of an infection by a microorganism, which can be killed by opsonophagocytic cells. Therefore, this application teaches a vaccine comprising at least one of said vaccine components and/or a homologous and/or functionally homologous protein or protein fragment thereof for the treatment of an infection by a microorganism that can be killed by opsonophagocytic cells. Of course, one may formulate said vaccine with a pharmaceutically acceptable carrier and/or adjuvant. Preferably said adjuvant comprises cell wall material of Gram positive bacteria, more preferable it comprises co-called ghosts (empty bacterial cells, which still have an intact cell wall structure). It is further preferable to couple the antigens to such ghosts, for example by using protein anchors, such as the AcmA protein anchor. Other adjuvants may be chosen from adjuvant preparations known in the art, such as emulsions with vitamin E. Therefore, this application also teaches said vaccine, also comprising a pharmaceutically acceptable carrier and/or adjuvant.
For passive immunization, specific antibodies against each of said proteins were administered to mice and the protection of said passive immunity against a challenge infection with virulent Streptococcus pneumoniae was measured. Of course, this method can now be applied to all microorganisms for which the immune response by the host is based on killing of said microorganism by phagocytes, for example but not restricted to for example a member of the genus Streptococcus, for example a member of the species of Streptococcus pneumoniae, or Streptococcus υiridans, or Streptococcus canis, or Streptococcus suis, or a member of the genus Staphylococcus, for example a member of the species Staphylococcus aureus, or Staphylococcus epidermidis, or a coagulase negative Staphylococcus, or a member of the species Moraxella catarrhalis, or Neisseria meningitidis, or Neisseria ghonorrhoeae, or Helicobacter pylori, or Haemophilus influenzae or Campylobacter jejuni, or a member of the genus Pseudomonas, or the genus Bacillus.
As used herein, the terms "antibody" and "antibodies" refer to monoclonal antibodies, multispecific antibodies (e.g., bi-specific), human antibodies, humanized antibodies, camelised antibodies, chimeric antibodies, single-chain Fvs (scFv), single chain antibodies, synthetic antibodies, single domain antibodies, Fab fragments, F(ab) fragments, disulfide -linked Fvs (sdFv), and anti-idiotypic (anti-Id) antibodies, and epitope -binding fragments of any of the above. In particular, antibodies include immunoglobulin molecules and imniunologically active fragments of immunoglobulin molecules, i.e., molecules that contain an antigen binding site. Immunoglobulin molecules can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2) or subclass.
Antibodies of the invention include, but are not limited to, monoclonal antibodies, multispecific antibodies, synthetic antibodies, human antibodies, humanized antibodies, chimeric antibodies, single-chain Fvs (scFv), single chain antibodies, Fab fragments, F(ab') fragments, disulfide-linked Fvs (sdFv), and anti-idiotypic (anti-Id) antibodies (including, e.g., anti-Id antibodies to antibodies of the invention), and epitope-binding fragments of any of the above. In particular, antibodies of the present invention include immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site that immunospecifically binds to a vaccine component according to the invention. The immunoglobulin molecules of the invention can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2) or subclass of immunoglobulin molecule. The antibodies of the invention may be from any animal origin including birds and mammals (e.g., human, murine, donkey, sheep, rabbit, goat, guinea pig, camel, horse, or chicken). Preferably, the antibodies of the invention are human or humanized monoclonal antibodies. As used herein, "human" antibodies include antibodies having the amino acid sequence of a human immunoglobulin and include antibodies isolated from human immunoglobulin libraries (including, but not limited to, synthetic libraries of immunoglobulin sequences homologous to human immunoglobulin sequences) or from mice that express antibodies from human genes. In certain embodiments, high potency antibodies can be used in the methods of the invention. For example, high potency antibodies can be produced by genetically engineering appropriate antibody gene sequences and expressing the antibody sequences in a suitable host. The antibodies produced can be screened to identify antibodies with, e.g., high kon values in a BIAcore assay (see below).
In certain embodiments, an antibody to be used with the methods of the present invention or fragment thereof has an affinity constant or Ka (kon/koff) of at least 102 M-1, at least 5 X 102 M-1, at least 103 M-1, at least 5 X 103 M-1, at least 104 M-1, at least 5 X 104 M-1, at least 105 M-1, at least 5 X 105 M-1, at least 106 M-1, at least 5 X 106 M-1, at least 107 M-1, at least 5 X 107 M-1, at least 108 M-1, at least 5 X 108 M-1, at least 109 M-1, at least 5 X 109 M-1, at least 1010 M-1, at least 5 X 1010 M-1, at least 1011 M-1, at least 5 X 1011 M-1, at least 1012 M-1, at least 5 X 1012 M-1, at least 1013 M-1, at least 5 X 1013 M-1, at least 1014 M-1, at least 5 X 1014 M-1, at least 1015 M-1, or at least 5 X 1015 M-1. In yet another embodiment, an antibody to be used with the methods of the invention or fragment thereof has a dissociation constant or Kd (koff/kon) of less than 10-2 M, less than 5 X 10-2 M, less than 10-3 M, less than 5 X 10-3 M, less than 10-4 M, less than 5 X 10-4 M, less than 10-5 M, less than 5 X 10-5 M, less than 10-6 M, less than 5 X 10-6 M, less than 10-7 M, less than 5 X 10-7 M, less than 10-8 M, less than 5 X 10-8 M, less than 10-9 M, less than 5 X 10-9 M, less than 10-10 M, less than 5 X 10-10 M, less than 10-11 M, less than 5 X 10-11 M, less than 10-12 M, less than 5 X 10-12 M, less than 10-13 M, less than 5 X 10-13 M, less than 10-14 M, less than 5 X 10-14 M, less than 10-15 M, or less than 5 X 10-15 M.
In certain embodiments, an antibody to be used with the methods of the invention or fragment thereof that has a median effective concentration (EC50) of less than 0.01 nM, less than 0.025 nM, less than 0.05 nM, less than 0.1 nM, less than 0.25 nM, less than 0.5 nM, less than 0.75 nM, less than 1 nM, less than 1.25 nM, less than 1.5 nM, less than 1.75 nM, or less than 2 nM, in an in vitro microneutralization assay. The median effective concentration is the concentration of antibody or antibody fragments that neutralizes 50% of the infective micro-organism in an in vitro microneutralization assay. In a preferred embodiment, an antibody to be used with the methods of the invention or fragment thereof has an EC50 of less than 0.01 nM, less than 0.025 nM, less than 0.05 nM, less than 0.1 nM, less than 0.25 nM, less than 0.5 nM, less than 0.75 nM, less than 1 nM, less than 1.25 nM, less than 1.5 nM, less than 1.75 nM, or less than 2 nM, in an in vitro microneutralization assay.
The antibodies to be used with the methods of the invention include derivatives that are modified, i.e, by the covalent attachment of any type of molecule to the antibody. For example, but not by way of limitation, the antibody derivatives include antibodies that have been modified, e.g., by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, synthesis in the presence of tunicamycin, etc. Additionally, the derivative may contain one or more non-classical amino acids.
The present invention also provides antibodies of the invention or fragments thereof that comprise a framework region known to those of skill in the art. In certain embodiments, one or more framework regions, preferably, all of the framework regions, of an antibody to be used in the methods of the invention or fragment thereof are human. In certain other embodiments of the invention, the fragment region of an antibody of the invention or fragment thereof is humanized. In certain embodiments, the antibody to be used with the methods of the invention is a synthetic antibody, a monoclonal antibody, an intrabody, a chimeric antibody, a human antibody, a humanized chimeric antibody, a humanized antibody, a glycosylated antibody, a multispecific antibody, a human antibody, a single-chain antibody, or a bispecific antibody. In certain embodiments of the invention, the antibodies to be used with the invention have half-lives in a mammal, preferably a human, of greater than 12 hours, greater than 1 day, greater than 3 days, greater than 6 days, greater than 10 days, greater than 15 days, greater than 20 days, greater than 25 days, greater than 30 days, greater than 35 days, greater than 40 days, greater than 45 days, greater than 2 months, greater than 3 months, greater than 4 months, or greater than 5 months. Antibodies or antigen-binding fragments thereof having increased in vivo half-lives can be generated by techniques known to those of skill in the art. For example, antibodies or antigen-binding fragments thereof with increased in vivo half-lives can be generated by modifying (e.g., substituting, deleting or adding) amino acid residues identified as involved in the interaction between the Fc domain and the FcRn receptor (see, e.g., PCT Publication No. WO 97/34631 and U.S.
Patent Application No.: 10/020,354, entitled "Molecules with Extended Half- Lives, Compositions and Uses Thereof, filed December 12, 2001, by Johnson et al., which are incorporated herein by reference). Such antibodies or antigen- binding fragments thereof can be tested for binding activity to the vaccine components of the invention as well as for in vivo efficacy using methods known to those skilled in the art, for example, by immunoassays described herein.
Further, antibodies or antigen-binding fragments thereof with increased in vivo half-lives can be generated by attaching to said antibodies or antibody fragments polymer molecules such as high molecular weight polyethyleneglycol (PEG). PEG can be attached to said antibodies or antibody fragments with or without a multifunctional linker either through site-specific conjugation of the PEG to the N— or C- terminus of said antibodies or antibody fragments or via epsilon-amino groups present on lysine residues. Linear or branched polymer derivatization that results in minimal loss of biological activity will be used. The degree of conjugation will be closely monitored by SDS-PAGE and mass spectrometry to ensure proper conjugation of PEG molecules to the antibodies. Unreacted PEG can be separated from antibody- PEG conjugates by, e.g., size exclusion or ion-exchange chromatography. PEG- derivatizated antibodies or antigen-binding fragments thereof can be tested for binding activity to the vaccine components of the invention as well as for in vivo efficacy using methods known to those skilled in the art, for example, by immunoassays described herein.
In certain embodiments, the antibodies to be used with the methods of the invention are fusion proteins comprising an antibody or fragment thereof that immunospecifically binds to a vaccine component of the invention and a heterologous polypeptide. Preferably, the heterologous polypeptide that the antibody or antibody fragment is fused to is useful for targeting the antibody to cells which are prone to infection. In certain embodiments, antibodies to be used with the methods of the invention or fragments thereof disrupt or prevent the interaction between an microbial antigen and its host cell receptor.
In certain embodiments, antibodies to be used with the methods of the invention are single-chain antibodies. The design and construction of a single- chain antibody is described in Marasco et al, 1993, Proc Natl Acad Sci 90:7889- 7893, which is incorporated herein by reference.
In certain embodiments, the antibodies to be used with the invention bind to an intracellular epitope, i.e., are intrabodies. An intrabody comprises at least a portion of an antibody that is capable of immunospecifically binding an antigen and preferably does not contain sequences coding for its secretion. Such antibodies will bind its antigen intracellularly. In one embodiment, the intrabody comprises a single -chain Fv ("sFv"). sFv are antibody fragments comprising the VH and VL domains of antibody, wherein these domains are present in a single polypeptide chain. Generally, the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the sFv to form the desired structure for antigen binding. For a review of sFv see Pluckthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds. Springer-Verlag, New York, pp. 269-315 (1994). In a further embodiment, the intrabody preferably does not encode an operable secretory sequence and thus remains within the cell (see generally Marasco, WA, 1998, "Intrabodies: Basic Research and Clinical Gene Therapy Applications" Springe :New York).
Generation of intrabodies is well-known to the skilled artisan and is described for example in U.S. Patent Nos. 6,004,940; 6,072,036; 5,965,371, which are incorporated by reference. Further, the construction of intrabodies is discussed in Ohage and Steipe, 1999, J. Mol. Biol. 291:1119-1128; Ohage et al., 1999, J. Mol. Biol. 291:1129-1134; and Wirtz and Steipe, 1999, Protein Science 8:2245-2250. Recombinant molecular biological techniques such as those described for recombinant production of antibodies (see below) may also be used in the generation of intrabodies.
In one embodiment, intrabodies of the invention retain at least about 75% of the binding effectiveness of the complete antibody (i.e., having constant as well as variable regions) to the antigen. More preferably, the intrabody retains at least 85% of the binding effectiveness of the complete antibody. Still more preferably, the intrabody retains at least 90% of the binding effectiveness of the complete antibody. Even more preferably, the intrabody retains at least 95% of the binding effectiveness of the complete antibody.
In producing intrabodies, polynucleotides encoding the variable region for both the VH and VL chains of interest can be cloned by using, for example, hybridoma mRNA or splenic mRNA as a template for PCR amplification of such domains (Huse et al., 1989, Science 246:1276). In one preferred embodiment, the polynucleotides encoding the VH and VL domains are joined by a polynucleotide sequence encoding a linker to make a single chain antibody (sFv). The sFv typically comprises a single peptide with the sequence VH -linker-VL or VL-linker-VH. The linker is chosen to permit the heavy chain and light chain to bind together in their proper conformational orientation (see for example, Huston, et al., 1991, Methods in Enzym. 203:46-121). In a further embodiment, the linker can span the distance between its points of fusion to each of the variable domains (e.g., 3.5 nm) to minimize distortion of the native Fv conformation. In such an embodiment, the linker is a polypeptide of at least 5 amino acid residues, at least 10 amino acid residues, at least 15 amino acid residues, or greater. In a further embodiment, the linker should not cause a steric interference with the VH and VL domains of the combining site. In such an embodiment, the linker is 35 amino acids or less, 30 amino acids or less, or 25 amino acids or less. Thus, in a most preferred embodiment, the linker is between 15-25 amino acid residues in length. In a further embodiment, the linker is hydrophilic and sufficiently flexible such that the VH and VL domains can adopt the conformation necessary to detect antigen. Intrabodies can be generated with different linker sequences inserted between identical VH and VL domains. A linker with the appropriate properties for a particular pair of VH and VL domains can be determined empirically by assess the degree of antigen binding for each. Examples of linkers include, but are not limited to, those sequences disclosed in Table IA. Table IA Sequence
(Gly Gly Gly Gly Ser) 3
Glu Ser Gly Arg Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Gly Lys Ser Ser Gly Ser Gly Ser Glu Ser Lys Ser Thr Glu Gly Lys Ser Ser Gly Ser Gly Ser Glu Ser Lys Ser Thr Gin Glu Gly Lys Ser Ser Gly Ser Gly Ser Glu Ser Lys Val Asp Gly Ser Thr Ser Gly Ser Gly Lys Ser Ser Glu Gly Lys Gly Lys Glu Ser Gly Ser Val Ser Ser Glu Gin Leu Ala Gin Phe Arg Ser Leu Asp Glu Ser Gly Ser Val Ser Ser Glu Glu Leu Ala Phe Arg Ser Leu Asp In one embodiment, intrabodies are expressed in the cytoplasm. In other embodiments, the intrabodies are localized to various intracellular locations. In such embodiments, specific localization sequences can be attached to the intranucleotide polypepetide to direct the intrabody to a specific location. Intrabodies can be localized, for example, to the following intracellular locations: endoplasmic reticulum (Munro et al., 1987, Cell 48:899-907; Hangejorden et al., 1991, J. Biol. Chem. 266:6015); nucleus (Lanford et al., 1986, Cell 46:575; Stanton et al.,1986, PNAS 83:1772; Harlow et al., 1985, Mol. Cell Biol. 5:1605); nucleolar region (Seomi et al., 1990, J. Virology 64:1803; Kubota et al., 1989, Biochem. Biophys. Res. Comm. 162:963; Siomi et al., 1998, Cell 55:197); endosomal compartment (Bakke et al., 1990, Cell 63:707-716); mitochondrial matrix (Pugsley, A. P., 1989, "Protein Targeting", Academic Press, Inc.); Golgi apparatus (Tang et al., 1992, J. Bio. Chem. 267:10122-6); liposomes (Letourneur et al., 1992, Cell 69:1183); and plasma membrane (Marchildon et al., 1984, PNAS 81:7679-82; Henderson et al., 1987, PNAS 89:339-43; Rhee et al., 1987, J. Virol. 61:1045-53; Schultz et al., 1984, J. Virol. 133:431-7; Ootsuya a et al., 1985, Jpn. J. Can. Res. 76:1132-5; Ratner et al., 1985, Nature 313:277-84). Examples of localization signals include, but are not limited to, those sequences disclosed in Table 2A.
Table 2A
Localization Sequence endoplasmic reticulum Lys Asp Glu Leu endoplasmic reticulum Asp Asp Glu Leu endoplasmic reticulum Asp Glu Glu Leu endoplasmic reticulum Gin Glu Asp Leu endoplasmic reticulum Arg Asp Glu Leu nucleus Pro Lys Lys Lys Arg Lys Val nucleus Pro Gin Lys Lys He Lys Ser nucleus Gin Pro Lys Lys Pro Localization Sequence nucleus Arg Lys Lys Arg nucleolar region Arg Lys Lys Arg Arg Gin Arg Arg
Arg Ala His Gin nucleolar region Arg Gin Ala Arg Arg Asn Arg Arg
Arg Arg Trp Arg Glu Arg Gin Arg nucleolar region Met Pro Leu Thr Arg Arg Arg Pro
Ala Ala Ser Gin Ala Leu Ala Pro Pro
Thr Pro endosomal Met Asp Asp Gin Arg Asp Leu He compartment Ser Asn Asn Glu Gin Leu Pro mitochondrial matrix Met Leu Phe Asn Leu Arg Xaa Xaa
Leu Asn Asn Ala Ala Phe Arg His
- Gly His Asn Phe Met Val Arg Asn
Phe Arg Cys Gly Gin Pro Leu Xaa plasma membrane GCVCSSNP plasma membrane GQTVTTPL plasma membrane GQELSQHE plasma membrane GNSPSYNP plasma membrane GVSGSKGQ plasma membrane GQTITTPL plasma membrane GQTLTTPL plasma membrane GQIFSRSA plasma membrane GQIHGLSP plasma membrane GARASVLS plasma membrane GCTLSAEE
VH and VL domains are made up of the immunoglobulin domains that generally have a conserved structural disulfide bond. In embodiments where the intrabodies are expressed in a reducing environment (e.g., the cytoplasm), such a structural feature cannot exist. Mutations can be made to the intrabody polypeptide sequence to compensate for the decreased stability of the immunoglobulin structure resulting from the absence of disulfide bond formation. In one embodiment, the VH and/or VL domains of the intrabodies contain one or more point mutations such that their expression is stabilized in reducing environments (see Steipe et al., 1994, J. Mol. Biol. 240:188-92; Wirtz and Steipe, 1999, Protein Science 8:2245-50; Ohage and Steipe, 1999, J. Mol. Biol. 291:1119-28; Ohage et al, 1999, J. Mol Biol. 291:1129-34).
METHODS FOR PRODUCING ANTIBODIES
The antibodies to be used with the methods of the invention or fragments thereof can be produced by any method known in the art for the synthesis of antibodies, in particular, by chemical synthesis or preferably, by recombinant expression techniques. Polyclonal antibodies to vaccine component of the invention can be produced by various procedures well known in the art. For example, an antigen according to the invention can be administered to various host animals including, but not limited to, rabbits, mice, rats, etc. to induce the production of sera containing polyclonal antibodies specific for the antigen. Various adjuvants may be used to increase the immunological response, depending on the host species, and include but are not limited to, Freund's (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanins, dinitrophenol, bacterial ghosts, and potentially useful human adjuvants such as BCG (bacille Calmette-Guerin) and corynebacterium parvurn. Such adjuvants are also well known in the art. In the case of ghosts the antigens are preferably coupled to the ghost, for instance through protein anchors, of which the AcmA protein anchor is especially preferred. Monoclonal antibodies can be prepared using a wide variety of techniques known in the art including the use of hybridoma, recombinant, and phage display technologies, or a combination thereof. For example, monoclonal antibodies can be produced using hybridoma techniques including those known in the art and taught, for example, in Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988); Hammerling, et al., in: Monoclonal Antibodies and T-Cell Hybridomas 563-681 (Elsevier, N.Y., 1981). The term "monoclonal antibody" as used herein is not limited to antibodies produced through hybridoma technology. The term "monoclonal antibody" refers to an antibody that is derived from a single clone, including any eukaryotic, prokaryotic, or phage clone, and not the method by which it is produced.
Methods for producing and screening for specific antibodies using hybridoma technology are routine and well known in the art. Ascites fluid, which generally contains high levels of antibodies, can be generated by immunizing mice with positive hybridoma clones.
In certain embodiments, a method of generating monoclonal antibodies comprises culturing a hybridoma cell secreting an antibody of the invention wherein, preferably, the hybridoma is generated by fusing splenocytes isolated from a mouse immunized with an antigen with myeloma cells and then screening the hybridomas resulting from the fusion for hybridoma clones that secrete an antibody able to bind said antigen.
Antibody fragments which recognize the specific antigens of the invention may be generated by any technique known to those of skill in the art. For example, Fab and F(ab')2 fragments of the invention may be produced by proteolytic cleavage of immunoglobulin molecules, using enzymes such as papain (to produce Fab fragments) or pepsin (to produce F(ab')2 fragments). F(ab')2 fragments contain the variable region, the light chain constant region and the CHI domain of the heavy chain. Further, the antibodies to be used with the present invention can also be generated using various phage display methods known in the art.
In phage display methods, functional antibody domains are displayed on the surface of phage particles which carry the polynucleotide sequences encoding them. In particular, DNA sequences encoding VH and VL domains are amplified from animal cDNA libraries (e.g., human or murine cDNA libraries of lymphoid tissues). The DNA encoding the VH and VL domains are recombined together with an scFv linker by PCR and cloned into a phagemid vector (e.g., p CANTAB 6 or pComb 3 HSS). The vector is electroporated in E. coli and the E. coli is infected with helper phage. Phage used in these methods are typically filamentous phage including fd and M13 and the VH and VL domains are usually recombinantly fused to either the phage gene III or gene VIII. Phage expressing an antigen binding domain that binds to an antigen of interest can be selected or identified with antigen, e.g., using labeled antigen or antigen bound or captured to a solid surface or bead. Examples of phage display methods that can be used to make the antibodies of the present invention include those disclosed in Brinkman et al., 1995, J. Immunol. Methods 182:41-50; Ames et al., 1995, J. Immunol. Methods 184:177-186; Kettleborough et al., 1994, Eur. J. Immunol. 24:952-958; Persic et al., 1997, Gene 187:9-18; Burton et al., 1994, Advances in Immunology 57:191-280; PCT application No. PCT/GB91/O1 134; PCT publication Nos. WO 90/02809, WO 91/10737, WO 92/01047, WO 92/18619, WO 93/1 1236, WO 95/15982, WO 95/20401, and WO97/13844; and U.S. Patent Nos. 5,698,426, 5,223,409, 5,403,484, 5,580,717, 5,427,908, 5,750,753, 5,821,047, 5,571,698, 5,427,908, 5,516,637, 5,780,225, 5,658,727, 5,733,743 and 5,969,108.
As described in the above references, after phage selection, the antibody coding regions from the phage can be isolated and used to generate whole antibodies, including human antibodies, or any other desired antigen binding fragment, and expressed in any desired host, including mammalian cells, insect cells, plant cells, yeast, and bacteria, e.g., as described below. Techniques to recombinantly produce Fab, Fab' and F(ab')2 fragments can also be employed using methods known in the art such as those disclosed in PCT publication No. WO 92/22324; Mullinax et al., 1992, BioTechniques 12(6) :864- 869; Sawai et al., 1995, AJRI 34:26-34; and Better et al., 1988, Science 240:1041-1043.
To generate whole antibodies, PCR primers including VH or VL nucleotide sequences, a restriction site, and a flanking sequence to protect the restriction site can be used to amplify the VH or VL sequences in scFv clones. Utilizing cloning techniques known to those of skill in the art, the PCR amplified VH domains can be cloned into vectors expressing a VH constant region, e.g., the human gamma 4 constant region, and the PCR amplified VL domains can be cloned into vectors expressing a VL constant region, e.g., human kappa or lamb a constant regions. Preferably, the vectors for expressing the VH or VL domains comprise an EF-lα promoter, a secretion signal, a cloning site for the variable domain, constant domains, and a selection marker such as neomycin. The VH and VL domains may also cloned into one vector expressing the necessary constant regions. The heavy chain conversion vectors and light chain conversion vectors are then co-transfected into cell lines to generate stable or transient cell lines that express full-length antibodies, e.g., IgG, using techniques known to those of skill in the art.
For some uses, including in vivo use of antibodies in humans and in vitro detection assays, it may be preferable to use human or chimeric antibodies. Completely human antibodies are particularly desirable for therapeutic treatment of human subjects. Human antibodies can be made by a variety of methods known in the art including phage display methods described above using antibody libraries derived from human immunoglobulin sequences or synthetic sequences homologous to human immunoglobulin sequences. See also U.S. Patent Nos. 4,444,887 and 4,716,111; and PCT publications WO 98/46645, WO 98/50433, WO 98/24893, WO98/16654, WO 96/34096, WO 96/33735, and WO 91/10741. Human antibodies can also be produced using transgenic mice which are incapable of expressing functional endogenous immunoglobulins, but which can express human immunoglobulin genes. For example, the human heavy and light chain immunoglobulin gene complexes may be introduced randomly or by homologous recombination into mouse embryonic stem cells.
Alternatively, the human variable region, constant region, and diversity region may be introduced into mouse embryonic stem cells in addition to the human heavy and light chain genes. The mouse heavy and light chain immunoglobulin genes may be rendered non-functional separately or simultaneously with the introduction of human immunoglobulin loci by homologous recombination. In particular, homozygous deletion of the JH region prevents endogenous antibody production. The modified embryonic stem cells are expanded and microinjected into blastocysts to produce chimeric mice. The chimeric mice are then be bred to produce homozygous offspring which express human antibodies. The transgenic mice are immunized in the normal fashion with a selected antigen, e.g., all or a portion of a polypeptide of the invention. Monoclonal antibodies directed against the antigen can be obtained from the immunized, transgenic mice using conventional hybridoma technology. The human immunoglobulin transgenes harbored by the transgenic mice rearrange during B cell differentiation, and subsequently undergo class switching and somatic mutation. Thus, using such a technique, it is possible to produce therapeutically useful IgG, IgA, IgM and IgE antibodies. For an overview of this technology for producing human antibodies, see Lonberg and Huszar (1995, Int. Rev. Immunol. 13:65-93). For a detailed discussion of this technology for producing human antibodies and human monoclonal antibodies and protocols for producing such antibodies, see, e.g., PCT publication Nos. WO 98/24893, WO 96/34096, and WO 96/33735; and U.S. Patent Nos. 5,413,923, 5,625,126, 5,633,425, 5,569,825, 5,661,016, 5,545,806, 5,814,318, and 5,939,598. In addition, companies such as Medarex, Inc. (Princeton, NJ), Abgenix, Inc. (Freemont, CA) and Genpharm (San Jose, CA) can be engaged to provide human antibodies directed against a selected antigen using technology similar to that described above.
A chimeric antibody is a molecule in which different portions of the antibody are derived from different immunoglobulin molecules such as antibodies having a variable region derived from a non-human (e.g., murine) antibody and a human immunoglobulin constant region. Methods for producing chimeric antibodies are known in the art. See e.g., Morrison, 1985, Science 229:1202; Oi et al., 1986, BioTechniques 4:214; Gillies et al., 1989, J. Immunol. Methods 125:191-202; and U.S. Patent Nos. 5,807,715, 4,816,567, and 4,816,397. Chimeric antibodies comprising one or more CDRs from human species and framework regions from a non-human immunoglobulin molecule can be produced using a variety of techniques known in the art including, for example, CDR-grafting (EP 239,400; PCT publication No. WO 91/09967; and U.S. Patent Nos. 5,225,539, 5,530,101, and 5,585,089), veneering or resurfacing (EP 592,106; EP 519,596; Padlan, 1991, Molecular Immunology 28(4/5):489-498; Studnicka et al., 1994, Protein Engineering 7(6):805-814; and Roguska et al., 1994, PNAS 91:969-973), and chain shuffling (U.S. Patent No. 5,565,332). In a preferred embodiment, antibodies comprise one or more CDRs and human framework regions. Often, framework residues in the framework regions will be substituted with the corresponding residue from the CDR donor antibody to alter, preferably improve, antigen binding. These framework substitutions are identified by methods well known in the art, e.g., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions.
(See, e.g., Queen et al., U.S. Patent No. 5,585,089; and Riechmann et al., 1988, Nature 332:323.)
Polynucleotides encoding antibodies to be used with the invention may be obtained, and the nucleotide sequence of the polynucleotides determined, by any method known in the art. Such a polynucleotide encoding the antibody may be assembled from chemically synthesized oligonucleotides (e.g., as described in Kutmeier et al., 1994, BioTechniques 17:242)..
Alternatively, a polynucleotide encoding an antibody may be generated from nucleic acid from a suitable source. If a clone containing a nucleic acid encoding a particular antibody is not available, but the sequence of the antibody molecule is known, a nucleic acid encoding the immunoglobulin may be chemically synthesized or obtained from a suitable source (e.g., an antibody cDNA library, or a cDNA library generated from, or nucleic acid, preferably poly A+ RNA, isolated from, any tissue or cells expressing the antibody, such as hybridoma cells selected to express an antibody of the invention) by PCR amplification using synthetic primers hybridizable to the 3' and 5' ends of the sequence or by cloning using an oligonucleotide probe specific for the particular gene sequence to identify, e.g., a cDNA clone from a cDNA library that encodes the antibody. Amplified nucleic acids generated by PCR may then be cloned into replicable cloning vectors using any method well known in the art.
Once the nucleotide sequence of the antibody is determined, the nucleotide sequence of the antibody may be manipulated using methods well known in the art for the manipulation of nucleotide sequences, e.g., recombinant DNA techniques, site directed mutagenesis, PCR, etc. (see, for example, the techniques described in Sambrook et al., 1990, Molecular Cloning, A Laboratory Manual, 2d Ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, NY and Ausubel et al., eds., 1998, Current Protocols in Molecular Biology, John Wiley & Sons, NY), to generate antibodies having a different amino acid sequence, for example to create amino acid substitutions, deletions, and/or insertions.
In a specific embodiment, one or more of the CDRs is inserted within framework regions using routine recombinant DNA techniques. The framework regions may be naturally occurring or consensus framework regions, and preferably human framework regions (see, e.g., Chothia et al., 1998, J. Mol. Biol. 278: 457-479 for a listing of human framework regions). Preferably, the polynucleotide generated by the combination of the framework regions and CDRs encodes an antibodjr that specifically binds to a vaccine component of the invention. In certain embodiments, one or more amino acid substitutions may be made within the framework regions, and, preferably, the amino acid substitutions improve binding of the antibody to its antigen. Additionally, such methods may be used to make amino acid substitutions or deletions of one or more variable region cysteine residues participating in an intrachain disulfide bond to generate antibody molecules lacking one or more intrachain disulfide bonds. Other alterations to the polynucleotide are encompassed by the present invention and within the skill of the art.
Recombinant expression of an antibody to be used with the methods of the invention, derivative or analog thereof, (e.g., a heavy or light chain of an antibody of the invention or a portion thereof or a single chain antibody of the invention), requires construction of an expression vector containing a polynucleotide that encodes the antibody. Once such a polynucleotide has been obtained, the vector for the production of the antibody molecule may be produced by recombinant DNA technology using techniques well known in the art. The expression vector is transferred to a host cell by conventional techniques and the fransfected cells are then cultured by conventional techniques to produce an antibody of the invention.
Antibodies according to the invention can not only be used for passive vaccination, but can also be used for diagnostic purposes and in assay systems to detect presence of bacteria and/or the antigens to which they are directed. Such a diagnosis is useful (for instance) to test material (such as food, pharmaceutical compositions or air filters) for the presence of bacteria. It is also possible to develop a test system which can detect the antibodies themselves to check for the presence or to calculate the titer of antibodies in the blood of subjects that have been immunized with a vaccine according to the invention.
A person skilled in the art is well able to generate analogous compounds of the opsonophagocytosis inducing proteins of the invention. This can for instance be done through screening of a peptide library and testing to binding to one or more of the antibodies described above. Such an analogue has essentially the same biological properties of said protein in kind, i.e. it is able to generate a similar immunological response, not necessarily in amount. It will also be possible genetically engineer analogous compounds starting from the sequences provided in this specification. Such analogous compounds will have a sequence identity of more than 50% compared to the sequences given in the specification. Sequence identity may be defined and determined by the TBLASTN or TBLASTP program for nucleic acid or amino acid sequences, respectively, of Altschul et al. (1990), which is in standard use in the art, or, and this may be preferred, the standard program BestFit, which is part of the Wisconsin Package, Version 8, September 1994, (Genetics Computer Group, 575 Science Drive, Madison, Wisconsin, USA, Wisconsin 53711). Sequence identity on nucleotide sequences can be calculated by using the BLASTN computer program (which is publicly available, for instance through the National Center for Biotechnological Information, accessible via the internet on http://www.ncbi.nlm.nih.gov/) using the default settings of 11 for wordlength (W), 10 for expectation (E), 5 as reward score for a pair of matching residues (M), -4 as penalty score for mismatches (N) and a cutoff of 100. Sequence identity may be at the nucleotide sequence and/or encoded amino acid sequence level. Preferably the nucleic acid and/or amino acid sequence shares at least 50%, or 60% sequence identity, most preferably at least about 70%, or 80% or 90% sequence identity with the sequences of the specification as provided hereunder. It is also possible to search for orthologous proteins, i.e. proteins from other organisms, be it closely related or not to Streptococcus pneumoniae D39 and/or Streptococcus pneumoniae TIGR4, such as other Streptococcus pneumoniae strains, or other Streptococcus species, or even Staphylococcus, Moraxella, Neisseria and other bacteria, or even non-bacterial organisms. Orthologous proteins in this regard means proteins from other species which proteins have the same common ancestry, but are different in sequence as a result of (spontaneous) mutations. These sequences can easily been found, for instance by comparing the sequences of the invention to other sequences available in sequence databases such as GenBank or by isolating orthologous proteins from other organisms by PCR mediated amplification methods in which (degenerated) primers are designed based on the sequences of the specification. Such methods are known to the person skilled in the art.
The proteins obtained by the above described methods should further be tested with respect to their opsonophagocytosis inducing properties. Any protein obtained through the above discussed methods which appears to be opsonophagocytosis inducing is considered to be a protein of the invention and is considered to be suitable for inclusion into the vaccines of the invention. Also parts of these proteins which have retained the functional characteristic of being able to induce opsonophagocytosis are considered to be comprised in the present invention.
Opsonophagocytosis inducing proteins as vaccine components can also be combined with other opsonophagocytosis inducing proteins and/or other proteins to result in a better vaccine. This patent application discloses the use of SlrA, IgAl proteinase and PsaA and the combination of PpmA and/or other proteins with said proteins. Preferably, a vaccine according to the invention comprises two of more opsonophagocytosis inducing proteins, wherein the combination of PpmA and SlrA, whether or not in the presence of further antigens, is most preferred. The invention is further explained in the examples.
Example 1 Correlation of antibody titers against Streptococcus pneumoniae surface proteins with occurrence of first acute otitis media. A cross sectional population survey in Finland.
As is shown in figures 1-5 in people with first occurrence of otitis media, the IgG titers against PpmA, SlrA, and IgAl proteinase, are all lower than the titers against alpha-enolase of Streptococcus pneumoniae. Because of the absence of this correlation of antibody titer and protection, SlrA and IgAl proteinase were considered to have no added value for protective immunity, and hence would not be selected for use as a vaccine component.
Example 2
Immune protective potential of Streptococcus pneumoniae surface proteins
To determine the protective potential of Streptococcus pneumoniae surface proteins, both active and passive immunization/challenge experiments were performed.
METHODS Mouse strains Immunisation was carried out on MFl outbred female mice, purchased from Harlan Olac, Bicester, UK All mice were barrier reared and specified pathogen free. The active immunisation protocol started with 6 week old mice (25-30g) and passive immunisation with 9 week old mice (30-35g). Bacterial strains
Streptococcus pneumoniae D39, serotype 2, has been obtained from the National Collection of Type Cultures (NCTC 7466; Central Public Health Laboratory, London). Streptococcus pneumoniae TIGR4, serotype 4, has been obtained from The Institute for Genome Research. Bacteria are grown on Blood Agar Base Number 2 (Oxoid, Basingstoke, UK) plus 5% (vol/vol) defibrinated horse blood (BAB). Stock cultures are prepared by inoculating a sweep of 4-5 colonies into 25ml Brain-Heart Infusion broth (BHI, Oxoid). Cultures are grown statically at 37°C overnight before 1ml aliquots containing 15% sterile glycerol are frozen at -70°C until use. Strain validation is carried out by confirming sensitivity to the antibiotic Optochin (Difco, Detroit, USA). Serotype verification is performed by checking for the presence of type specific polysaccharide capsule using anti-type 2 or 4 capsule antiserum (Statens Seruminstitut, Copenhagen, Denmark).
For counting of CFU, serial dilutions of samples are prepared by the addition of 20μl to 180μl sterile PBS in sterile round -bottomed 96 well microtitre plates (Life Technologies, Paisley, UK). 20μl volumes of each dilution are spotted in triplicate on 2 separate BAB plates. The following equation is used to calculate the number of colony forming units per ml of sample: CFU per ml = Mean number of colonies per sector x 50 x Dilution Factor.
Preparation of inoculums lOOμl of sterile PBS containing approximately 105 CFU Streptococcus pneumoniae were injected into the peritoneal cavity of mice with an insulin syringe (F. Baker Scientific, Runcorn, UK). On development of lethargy, mice were killed by cervical dislocation, the chest cavity carefully opened up and a section of ribcage removed in order to provide access to the heart. A 23 gauge needle was inserted into the right ventricle and blood slowly collected into the attached syringe. 50μl of infected blood was used to grow passaged bacteria in 10ml BHI statically overnight at 37°C. Bacteria were harvested by centrifugation at 3,000 rpm for lOmin (Heraeus medifuge), resuspended in fresh BHI containing 20% v/v FCS and then incubated at 37°C until they reached mid-log phase (as judged by optical density). 1ml aliquots of the suspension were stored at -70°C, until required. After 24h at -70°C viability of the suspension was measured by viable counting and optochin sensitivity was confirmed. Viability was unaffected by storage at -70°C for at least 3 months.
Intranasal infection
Aliquots of standard inoculum were rapidly thawed. A 900μl sample was pelleted by centrifugation at 13,000rpm (Eppendorf centrifuge 5417C) and resuspended in 900μl sterile PBS. Bacteria were diluted in sterile PBS to give 1 x 106 CFU/50μl and this confirmed by viable counting (as described previously). Mice to be infected were lightly anaesthetized with 2.5% v/v isoflourane over oxygen (1.5 L/min) with NO2 (lL/min), administered using a calibrated vaporizer and anaesthesia confirmed by observing no pinch reflex reaction. Once anaesthetized the animals were held with the nose held upright, and pneumococci were introduced intranasally by adding a series of small droplets of the 50μL inoculum in to the nostril for the mice to involuntarily inhale. After inoculation the mice were laid on their backs until recovery and the viable count of the inoculum was re-determined. Mice were monitored frequently (at least 3 times a day) during the following 14 days for signs of infection. On reaching the pre-determined endpoint (moribund) mice were killed by cervical dislocation and the survival time noted.
Passive immunization
Serum was complement inactivated by incubation at 56°C for 30 min and was used at a pre-determined dilution. 24h and Ih prior to infection, mice were vaccinated by intraperitoneal injection of 200μl serum. Mice were then infected as previously described. Bacteria were opsonized by incubation in the diluted serum at 37°C for lhr prior to infection. Mice were monitored frequently (at least 3 times a day) during the following 14 days for signs of infection. On reaching the pre-determined endpoint (moribund) mice were sacrificed by cervical dislocation and the survival time noted.
Active immunization
Mice were randomly arranged in groups of 6 and a blood sample was removed from the tail vein prior 24h prior to initial vaccination. Vaccines were prepared in a 1:1 ratio in either Freunds complete adjuvant or incomplete adjuvant (Sigma) or Hunter's TiterMax (CytRx Corp., Norcross, GA) or Quill A (Accurate Chemical Scientific Corporation, Westbury, NY 11590) as per manufacturers instructions. Normally 50μg of protein was administered per mouse. lOOμl of vaccine was injected subcutaneously per mouse. Nine days later a blood sample was removed from half of the mice fro a tail vein. By staggering this bleed and the next we could bleed all mice prior to vaccination and prior to infection but still monitor immune response during vaccination protocol: this kept us in line with the restrictions on the total number of bleeds/ mouse (3) and the minimum time interval between bleeds (14 days). 24h after sampling blood, vaccination was repeated as previously but if using Freunds, FIA (Freunds incomplete adjuvant) was used. 9 days after boost, a blood sample was removed from those mice not bled before last boost. 24h later vaccination was repeated as previously. 28 days later a blood sample was removed from the tail vein of all mice. 24h later mice were infected as previously described with approximately 10G CFU Streptococcus pneumoniae D39 or TIGR4. Mice were monitored at least 3 times daily for signs of infection. On reaching the pre-determined endpoint (moribund) mice were sacrificed by cervical dislocation. Preparation of mouse virulent inoculum
During the course of these experiments, a maximum of 25 mice were used for the production of mouse virulent inocula. The number of times that inocula must be prepared/passaged depended on the virulence and viability of the organisms after prolonged freezing at -80°C.
Infection experiments
In order to optimize the pneumonia infection model in our laboratory, i.e. to establish the optimal number of organisms that will produce consistent pneumonia with the longest incubation period, we infected groups of 4 mice with 5 different dilutions of organisms from 103, to 107 cfu). We optimized the infection dose required for two heterogeneous strains of Streptococcus pneumoniae (D39 and TIGR4). These strains differ in their virulence and antigen characteristics. (4 x 5 x 2 = 40 mice).
Passive immunization
For passive immunization with rabbit polyclonal anti-sera, the following sera were tested.
Pre -immune serum PpmA Polyclonal serum PpmA
6 mice per group; challenged with wild virulent strain of Streptococcus pneumoniae and with a strain D39 deleted for PpmA.
Active immunization
Table 1. Time Schedule Active immunization
Figure imgf000035_0001
Table 2. Time Schedule Passive immunization
Figure imgf000036_0001
Table 3. Time Schedule for preparation of inoculum
Figure imgf000036_0002
Results:
Active immunization of CD-I mice with Streptococcus pneumoniae surface protein and infection with a wild type virulent strain of Streptococcus pneumoniae.
Immune protective potentials of SlrA
SlrA elicited a good protective immune response in the mice, as is shown in table 4 and fig. 6
Table 4. Survival time in hours after active immunization with SlrA n=12
Figure imgf000037_0001
Statistically, a significant difference was found between the vaccinated and the control group concerning the survival time of mice after challenge with virulent Streptococcus pneumoniae D39. Mann Whitney test
P value 0.0175
Gaussian Approximation P value.
P value summary
Medians are significantly different (P < 0.05)
One-tailed P value
Sum of ranks in column A,B 113 , 187
Mann- Whitney U 35.00
Immune protective potentials of IgAl proteinase
IgAl proteinase elicited a good protective immune response in the mice, as is shown in table 5 and fig. 7
Table 5. Survival time in hours after active immunization with IgAl proteinase (n=10)
Figure imgf000038_0001
Statistically, a significant difference was found between the vaccinated and the control group concerning the survival time of mice after challenge with virulent Streptococcus pneumoniae D39.
Mann Whitney test
P value 0.0474
Gaussian Approximation of P-value P value summary
Medians are significantly different (P < 0.05) One-tailed P value.
Sum of ranks in column A,B 69 , 121 Mann- Whitney U 24.00 Results are shown in fig. 7.
Immune protective potentials of PsaA
PsaA elicited a good protective immune response in the mice, as is shown in hg. 8.
Statistically, a significant difference was found between the vaccinated and the control group concerning the survival time after challenge with virulent Streptococcus pneumoniae D39.
Mann Whitney test
P value 0.0409
Gaussian Approximation of P value.
P value summary
Medians are significantly different (P < 0.05) Sum of ranks in column A,B 195.5 , 300.5
Mann- Whitney U 75.50
Combination experiments vaccinating with at least one surface protein.
Vaccinating with two antigenic proteins resulted in a better survival time in mice after challenge with virulent Streptococcus pneumoniae D39 as is shown in table 6, and in fig. 9.
Table 6. Survival time in hours after active immunization with PpmA and SlrA.
N=12
Figure imgf000041_0001
PpmA vs PpmA+SlrA Mann Whitney test
P value 0.0416
Gaussian Approximation of P value.
P value summary
Medians are significantly different (P < 0.05)
One-tailed P value.
Sum of ranks in column A,C 119.5 , 180.5
Mann- Whitney U 41.50
SlrA vs PpmA+SlrA Mann Whitney test P value 0.3325 Gaussian Approximation of P value.
P value summary ns
Medians are not significantly different. (P < 0.05)
One-tailed P value Sum of ranks in column B,C 142 , 158
Mann- Whitney U 64.00
Statistically, there was a significant difference between the PpmA and SlrA combined group and the PpmA alone. This shows that protective immunity as a result of vaccination with more than one protein or part thereof is superior to the immunity based on vaccination with only one antigen.
Passive immunization of CD-I mice with anti-PpmA serum and infection with a PpmA-ve control strain
Control — mice were vaccinated (2x200μl) with rabbit-pre immune serum
(PIS)
Experiment- mice vaccinated with (2x200μl) with polyclonal rabbit hyperimmune anti-rPpmA serum (APS).
Table 7. Survival time in hours after passive immunization with PpmA- antibodies (APS) or with normal pre -immune serum (PIS)
Figure imgf000043_0001
Passive immunization experiment
Mice infected intranasally with Streptococcus pneumoniae D39
Mann Whitney test P value 0.0376
Exact P value
P value summary *
Medians significantly different (P < 0.05)
One-tailed P value Sum of ranks in column A,B 81 , 129
Mann- Whitney U 26.00 Passive immunization experiment.
Mice infected intranasally with Streptococcus pneumoniae D39 ppmA-
Mann Whitney test P value 0.2644
Exact P value P value summary ns
Medians are not significantly different (P < 0.05) One-tailed P value Sum of ranks in column C,D 96 , 114 Mann- Whitney U 41.00
The results in table 7 and in Fig 10 clearly show the protective effect of passive immunization with anti PpmA antibodies against a challenge infection with virulent streptococcal strain D39. They also show that the protection is much less against a streptococcal strain that is deleted for PpmA. The ppmA- ve D39 strain has been previously shown to be less virulent than D39.
Table 8. Survival time in hours after passive immunization with Ppm A in MF- 1 mice
Treatment Survival times (h)
Normal rabbit serum (NRS) 41, 48, 48, 65, 72
Bacteria opsonised in NRS 48, 48, 65, 72, 89
Anti-PpmA anti-serum 71, 71, 113.5, 113.5, 137, 336, 336, 336, 336, 336
Bacteria opsonised in anti-PpmA 89, 143, 336, 336, 336
The results in table 8 and in Fig 11 clearly show the protection against challenge infection after a passive immunization.
Example 3 In silico search
The nucleotide sequence of PpmA was determined to search databases for partial homology.
The gene for PpmA was amplified by PCR from Streptococcus pneumoniae D39 with the primers
5'CCATGGCTAGCCACCATCACCATCACCATTCGAAAGGGTCAGAAGGTGC 3' and 5'TCATGGATCCGGACTATTCGTTTGATGTAC3' which incorporate flanking Nheϊ and BamΗI restriction sites, and a N-terminal His6 tag. The amplified DNA was cloned into a pETlla expression vector (Stratagene,
LaJolla, CA) and electrotransformed into E. coli BL21(DE3). The recombinant protein was purified by Ni+ affinity chromatography with the HisTrap Kit (Amersham Pharmacia) according to the manufacturers recommendations. The purified recombinant protein was dialysed against 10mM HEPES buffer, pH7.5, freeze dried, and stored at -20°C.
ppmA nucleotide sequence Streptococcus pneumoniae D39
ATGAAGAAAAAATTATTGGCAGGTGCCATCACACTATTATCAGTAGCAACTTTAGC AGCTTGTTCGAAAGGGTCAGAAGGTGCAGACCTTATCAGCATGAAAGGGGATGTCATTAC AGAACATCAATTTTATGAGCAAGTGAAAAGCAACCCTTCAGCCCAACAAGTCTTGTTAAAT ATGACCATCCAAAAAGTTTTTGAAAAACAATATGGCTCAGAGCTTGATGATAAAGAGGTTG ATGATACTATTGCCGAAGAAAAAAAACAATATGGCGAAAACTACCAACGTGTCTTGTCACA AGCAGGTATGACTCTTGAAACACGTAAAGCTCAAATTCGTACAAGTAAATTAGTTGAGTTG GCAGTTAAGAAGGTAGCAGAAGCTGAATTGACAGATGAAGCCTATAAGAAAGCCTTTGAT GAGTACACTCCAGATGTAACGGCTCAAATCATCCGTCTTAATAATGAAGATAAGGCCAAA GAAGTTCTCGAAAAAGCCAAGGCAGAAGGTGCTGATTTTGCTCAATTAGCCAAAGATAAT TCAACTGATGAAAAAACAAAAGAAAATGGTGGAGAAATTACCTTTGATTCTGCTTCAACAG AAGTACCTGAGCAAGTCAAAAAAGCCGCTTTCGCTTTAGATGTGGATGGTGTTTCTGATGT GATTACAGCAACTGGCACACAAGCCTACAGTAGCCAATATTACATTGTAAAACTCACTAAG AAAACAGAAAAATCATCTAATATTGATGACTACAAAGAAAAATTAAAAACTGTTATCTTGA CTCAAAAACAAAATGATTCAACATTTGTTCAAAGCATTATGGGAAAAGAATTGCAAGCAGC CAATATCAAGGTTAAGGACCAAGCCTTCCAAAATATCTTTACCCAATATATCGGTGGTGGA GATTCAAGCTCAAGCAGTAGTACATCAAACGAATAG
PpmA amino acid sequence
MKKKLLAGAIT LSVATLAACSKGSEGADLISMKGDVITEHQFYEQVKSNPSAQQV LLNMTIQKVFEKQYGSELDDKEVDDTIAEEKKQYGENYQRVLSQAGMTLETRKAQIRTSKL VEIAVKKVAEAELTDEAYKI^AFDEYTPDVTAQIIRLNNEDKAKEVLEKAKAEGADFAQLAK DNSTDEKTKENGGEITFDSASTEVPE VKI AAFALDVDGVSDVITATGTQAYSS YYIVKLT KKTEKSSNIDDYKEKLKTVILTQKQNDSTFV SIIGKELQAANIKVICDQAFQNIFTQYIGGG DSSSSSSTS E* Recombinant His tagged PpmA
MAHHHHHHSKGSEGADLISMKGDVITEHQFYEQVKSNPSAQQVLLNMTIQKVFEK QYGSELDDKEVDDTIAEEIQζQYGENYQRVLSQAGMTLETRKAQIRTSKLVE AVKKVAEA ELTDEAYKIζAFDEYTPDVTAQIIRLNNEDIζAKEVLEKAKAEGADFAQLAIΦNSTDEKTIffi NGGEITFDSASTEVPEQVKKAAFALDVDGVSDVITATGTQAYSSQYYIVKLTKIζTEKSSNID DYKEKLKTVILTQKQNDSTFVQSIIGKELQAANIKVIΦQAFQNIFT YIGGGDSSSSSSTSNE
SlrA
The gene for the active peptide of SlrA was amplified by PCR from Streptococcus pneumoniae D39 with the primers
5'TTTACTGCATATGCACCATCACCATCACCATAGCAGCGTCCAACGCAGT3 ' and 5'CATTAGGATCCAATCGCTGGGGAAGTG3'which incorporate flanking Ndel and BamHI restriction sites, and a N-terminal His6 tag. The amplified DNA was cloned into a pETlla expression vector (Stratagene, LaJolla, CA) and electrotransformed into E. coli BL21(DE3). The recombinant protein was purified by Ni+ affinity chromatography with the HisTrap Kit (Amersham Pharmacia) according to the manufacturers recommendations. The purified recombinant protein was dialysed against lO M HEPES buffer, pH7.5, freeze dried, and stored at -20°C.
SlrA
slrA nucleotide sequence Streptococcus pneumoniae D39 ATGAAAAAACTAGCAACCCTTCTTTTACTGTCTACTGTAGCCCTAGCTGGGTGTAG
CAGCGTCCAACGCAGTCTGCGTGGTGATGATTATGTTGATTCCAGTCTTGCTGCTGAAGA AAGTTCCAAAGTAGCTGCCCAATCTGCCAAGGAGTTAAACGATGCTTTAACAAACGAAAA CGCCAATTTCCCACAACTATCTAAGGAAGTTGCTGAAGATGAAGCCGAAGTGATTTTCCAC ACAAGCCAAGGTGATATTCGCATTAAACTCTTCCCTAAACTCGCTCCTCTAGCGGTTGAAA ATTTCCTCACTCACGCCAAAGAAGGCTACTATAACGGTATTACCTTCCACCGTGTCATCGA TGGCTTTATGGTCCAAACTGGAGATCCAAAAGGGGACGGTACAGGTGGTCAGTCCATCTG GCATGACAAGGATAAGACTAAAGACAAAGGAACTGGTTTCAAGAACGAGATTACTCCTTA TTTGTATAACATCCGTGGTGCTCTTGCTATGGCTAATACTGGTCAACCAAACACCAATGGC AGCCAGTTCTTCATCAACCAAAACTCTACAGATACCTCTTCTAAACTCCCTACAAGCAAGT ATCCACAGAAAATTATTGAAGCCTACAAAGAAGGTGGAAACCCTAGTCTAGATGGCAAAC ACCCAGTCTTTGGTCAAGTGATTGACGGTATGGATGTTGTGGATAAGATTGCTAAGGCCG AAAAAGATGAAAAAGACAAGCCAACTACTGCTATCACAATCGACAGCATCGAAGTGGTGA AAGACTACGATTTTAAATCTTAA
SlrA amino acid sequence
MIΩOATLLLLSTVALAGCSSVQRSLRGDDYVDSS AAEESSKVAAQSAI^ELNDALT NENANFPQLSKEVAEDEAEVIFHTSQGDIRIKLFPKLAPLAVENFLTHAKEGYYNGITFHRV IDGFMVQTGDPKGDGTGGQSIWHDKDKTKDKGTGFKNEITPYLYNIRGALAMANTGQPNT NGSQFFINQNSTDTSSKLPTSKYPQKIIEAYKEGGNPSLDGKHPVFGQVIDGMDWDKIAEA. EKDEKDKPTTAITIDSIEWKDYDFKS
Recombinant His tagged SlrA
MAHHHHHHSSVQRSLRGDDYVDSSLAAEESSKVAAQSAKELNDALTNENANFPQL SKEVAEDEAEVIFHTSQGDIRIKLFPKLAPLAVENFLTHAKEGYYNGITFHRVIDGFMVQTG DPKGDGTGGQSIWHDKDKTKDKGTGFKNEITPYLYNIRGALAMANTGQPNTNGS FFIN NSTDTSSKLPTSKYPQKIIEAYKEGGNPSLDGKHPVFGQVIDGMDWDKIAKAEKDEKDKP TTAITIDSIEWKDYDFKS
Expression and purification of His6rIgAl proteinase
A 3948bp gene fragment which encodes amino acids 671-1987 of the IgAl proteinase was amplified by PCR from Streptococcus pneumoniae TIGR4 with the primers 5'CAACATCACATATGGGACAAACAGAACCAGAG3'and 5 CTTAGATCTTAATGATGGTGGTGATGATGGGCTTTAAAGATTGCTCTC3 ' which incorporate flanking Ndeϊ and Bglϊl restriction sites, and a C-terminal His6 tag. The amplified DNA was cloned into a pETlla expression vector (Stratagene, LaJolla, CA) and electrotransformed into E. coli BL21(DE3).
Inoculate 200ml LB broth with 50μl/ml ampicillin and grow at 37°C overnight.
Transfer 20-30ml per liter of the overnight culture to prewarmed LB with
50μl/ml ampicillin and grow to an ODGOO between 0.6 and 1.0 (2-3 hours).
Expression is induced by the addition of ImM IPTG (10ml of a lOOmM stock /liter), and the cells were grown for a further 2-3hours.
Cells were harvested (lOmin @ 3000rpm) and resuspended in ice cold 20mM sodium phosphate buffer pH7.4 with 8M urea (15ml of buffer/ liter of culture).
The cells are lysed by sonication 3x 30seconds on ice (1 min intervals to allow cooling). Place lysate on a rotating shaker at 4°C for 20min (to dissolve inclusion bodies).
The crude lysate is cleared by centrifugation (15,000rpm for 30min in a JA20 rotor).
Place the cleared supernatant in a pre-boiled dialysis bag, and dialyze overnight against 2L ice cold 20mM sodium phosphate buffer pH7.4 with ImM
DTT.
Add ammonium sulfate to the dialyses supernatant to 20% saturation
(0.123g/ml), and stir at 4°C for 20min.
Spin precipitate at 10,000rpm for 15min in a JA20 rotor at 4°C. (IgAl proteinase will be recovered from the protein pellet). Redisolve protein pellet (5ml/litre culture) in start buffer (20mM sodium phosphate buffer pH7.4, 0.5M NaCl ,10mM imidazole 8M urea).
Filter through a .45μm filter.
Load 1ml column with Ni+ and equilibrate it with start buffer with urea. Pump the supernatant (15ml) through a Ni+ loaded 1ml HisTrap column
(Amersham Pharmacia).
Wash with 10ml wash buffer (20mM sodium phosphate buffer pH7.4, 0.5M
NaCl ,20mM imidazole 8M urea).
Elute in 1ml fractions with elution (20mM sodium phosphate buffer pH7.4; 0.5M NaCl; 400mM imidazole; 8M urea).
The second fraction should contain the IgAl proteinase.
The 2nd fraction is then dialyzed overnight against 2L lOmM Hepes buffer pH7.4.
Without the Urea, the protein will re-precipitate. Recover the protein by centrifugation, Freeze dry and store at -20°C.
Protein can be resolubilized in 8M urea and then diluted in PBS etc. It will remain soluble at high concentrations in 4M urea.
Immunoglobulin Al protease (iga) nucleotide sequence [Streptococcus pneumoniae TIGR4]
ATGGAAAAGTATTTTGGTGAAAAACAAGAGCGTTTTTCATTTAGAAAATTATCAGTAGGACTTGTATCTG CAACGATTTCAAGTTTATTTTTTATGTCTGTATTAGCTAGTTCATCTGTGGATGCTCAAGAAACTGCGGG AGTTCACTATAAATATGTGGCAGATTCAGAGCTATCATCAGAAGAAAAGAAGCAGCTTGTCTATGATATT CCGACATACGTGGAGAATGATGATGAAACTTATTATCTTGTTTATAAGTTAAATTCTCAAAATCAACTGG CGGAATTGCCAAATACTGGAAGCAAGAATGAGAGGCAAGCCCTAGTTGCTGGTGCTAGCTTAGCTGCTAT GGGAATTTTAATTTTTGCTGTTTCCAAGAAAAAGGTTAAGAATAAAACGGTATTACATTTAGTATTGGTT GCAGGGATAGGAAATGGTGTCTTAGTTTCAGTCCATGCTTTAGAAAATCATCTTTTGCTAAATTACAATA CGGACTATGAATTGACCTCTGGAGAAAAATTACCTCTTCCTAAAGAGATTTCAGGTTACACTTATATTGG ATATATCAAAGAGGGAAAAACGACTTCTGAGTCTGAAGTAAGTAATCAAAAGAGTTCAGTTGCCACTCCT ACAAAACAACAAAAGGTGGATTATAATGTTACACCGAATTTTGTAGACCATCCATCAACAGTACAAGCTA TTCAGGAACAAACACCTGTTTCTTCAACTAAGCCGACAGAAGTTCAAGTAGTTGAAAAACCTTTCTCTAC TGAATTAATCAATCCAAGAAAAGAAGAGAAACAATCTTCAGATTCTCAAGAACAATTAGCCGAACATAAG AATCTAGAAACGAAGAAAGAGGAGAAGATTTCTCCAAAAGAAAAGACTGGGGTAAΆTACATTAAATCCΆC AGGATGAAGTTTTATCAGGTCAATTGAACAAACCTGAACTCTTATATCGTGAGGAAACTATGGAGACAAA AATAGATTTTCAAGAAGAAATTCAAGAAAATCCTGATTTAGCTGAAGGAACTGTAAGAGTAAAACAAGAA GGTAAATTAGGTAAGAAAGTTGAAATCGTCAGAATATTCTCTGTAAACAAGGAAGAAGTTTCGCGAGAAA TTGTTTCAACTTCAACGACTGCGCCTAGTCCAAGAATAGTCGAAAAAGGTACTAAAAAAACTCAAGTTAT AAAGGAACAACCTGAGACTGGTGTAGAACATAAGGACGTACAGTCTGGAGCTATTGTTGAACCCGCAATT CAGCCTGΆGTTGCCCGAAGCTGTAGTAAGTGACAAAGGCGAACCΆGAAGTTCΆΆCCTACΆTTACCCGAAG CAGTTGTGACCGACAAAGGTGAGACTGAGGTTCAACCAGAGTCGCCAGATACTGTGGTAAGTGATAAAGG TGAACCΆGAGCAGGTAGCACCGCTTCCAGAATATAAGGGTAATATTGAGCAAGTAΆAACCTGAΆACTCCG GTTGAGAAGACCAAAGAACAAGGTCCAGAAAAAACTGAAGAAGTTCCAGTAAAACCAACAGAAGAAACAC CAGTAAATCCAAATGAAGGTACTACAGAAGGAACCTCAATTCAAGAAGCAGAAAATCCAGTTCAACCTGC AGAAGAATCAACAACGAATTCAGAGAAAGTATCACCAGATACATCTAGCAAAAATACTGGGGAAGTGTCC AGTAATCCTAGTGATTCGACAACCTCAGTTGGAGAATCAAATAAACCAGAACATAATGACTCTAAAAATG AAAATTCAGAAAAAACTGTAGAAGAAGTTCCAGTAAATCCAAATGAAGGCACAGTAGAAGGTACCTCAAA TCAAGAAACAGAAAAACCAGTTCAACCTGCAGAAGAAACACAAACAAACTCTGGGAAAATAGCTAACGAA AATACTGGAGAAGTATCCAATAAACCTAGTGATTCAAAACCACCAGTTGAAGAATCAAATCAACCAGAAA AAAACGGAACTGCAACAAAACCAGAAAATTCAGGTAATACAACATCAGAGAATGGACAAACAGAACCAGA ACCATCAAACGGAAATTCAACTGAGGATGTTTCAACCGAATCAAACACATCCAATTCAAATGGAAACGAA GAAΆTTAAACAΆGAAAATGAACTAGACCCTGATAAAAAGGTAGAAGAACCAGAGAAΆACACTTGAATTAA GAAATGTTTCCGACCTAGAGTTATACAGTTTGTCAAATGGTACTTATAAACAACACATTTCGTTAGAGCA AGTTCCAAGCAATCCAAATAGCTACTTTGTTAAAGTGAAATCTTCTTCATTCAAAGATGTATACCTACCA GTAGCATCAATATCAGAGGAAAGAAAAAATGATAAAATCCTTTATAAAATCACAGCAAAAGTAGAGAAGC TTCAGCAGGAGATAGAAAGCAGATATAAAGATAATTTTACCTTCTATCTAGCTAAGAAGGGAACAGAAGA AACAACAAACTTTACTTCCTTTAGTAATCTGGTCAAAGCTATAAACCAAAATCCCTCTGGAACCTATCAT TTAGCGGCCAGCCTGAATGCTAACGAAGTGGAGCTTGGTCCTGATGAAAGATCCTATATCAAGGACACCT TTACTGGTCGTTTAATCGGTGAAAAAGATGGCAAGAATTATGCTATCTATAATTTGAAAAAACCTCTGTT TGAAAACTTGAGTGGTGCTACAGTAGAAAAACTGAGTCTAAAAAATGTTGCTATTTCAGGGAAAGATGAT ATCGGTTCACTGGCAAATGAAGCTCAGAATAACACAAAAATTAAGCAAGTTCACGTCGATGGTGTTCTGG CTGGTGAACGTGGTATCGGTGGTTTGCTGGCTAAGGCTGAGCAATCAAGCATCACAGAGAGCAGTTTCAA GGGAAGAATTATCAACACTTATGAAACGACTGCTGCCTACAATATCGGTGGTATGGTCGGTCATTTGACA GGTGACAAGGCTTTACTTACTAAGTCAAAAGCGACAGTAGCCATTTCATCTAACACAAATACTTCAGATC AGACTGTGGGTGGACTTGCAGGCCTAGTAGACCGAGATGCACAGATCCAAGATAGCTATGCTGAAGGTGA TATCAACAATGTCAAGCACTTTGGTAGAGTCGCTGGAGTGGCAGGCAATTTGTGGGATCGAACTTCTGGT GATGTTAGGCATGCTGGAAGTTTGACCAATGTTCTCAGCGATGTTAATGTAACCAACGGAAATGCCATCA CTGGTTACCACTATAACGAAATGAAGGTAAAGGACACATTCAGCAGCAAGGCCAACAGAGTCTACAATGT CACCTTGGTCAAGGATGAGGTCGTCAGCAAGGAATCCTTTGAAGAAAGAGGAACAATGCTAGATGCTTCT CAAATTGCAAGCAAAAAAGCAGAAATCAATCCTCTCATTTTACCAACAGTGGAGCCACTTTCAACAAGTG GCAAAAAAGACAGTGATTTTTCTAAGGTGGCCTATTATCAAGCTAAGCGCAACTTGACTTATAAAAACAT TGAAAAATTGCTACCTTTCTACAACAAGGCAACCATCGTCAAATACGGAAACCTGGTCAATGAGAACAGT CTTTTATATCAAAAAGAACTCTTGTCAGCAGTCATGATGAAGGACAACCAAGTCATCACAGACATTGTTT CTAACAAACAGACTGCAAACAAACTCTTGCTTCACTACAAGGATGATTTATCTGAGAAGCTGGATCTCAA ATACCAGAATGATTTCGCCAAATTAGCAGAATATAGTCTGGGCAATACTGGACTTCTCTATACGCCAAAC CAATTCCTGTATGACCAAACCTCTATCATCAAGCAAGTCTTACCTGACTTACAAAAGGTTGACTATCATT CAGAAGCCATCAGAAAGACGCTGGGTATTTCTCCAAACGTCAAGCAAACTGAGCTCTATCTAGAAGACCA GTTCGCCAAAACAAAACAACAACTGGAAGACAGTTTGAAAAAACTCTTGTCAGCGGATGCTGGACTGGCT AGTGCTAACCCCGTCACTGAAGGTTATCTTGTAGATAAAATCAAACGCAACAAGGAAGCCTTGCTACTTG GCTTGACCTATCTGGAACGGTGGTATAACTTTAGCTATGGTCAGGTGAATGTCAAAGACCTAGTTCTGTA CCATTTGGACTTCTTTGGTAAGGGGAATGCTTCACCATTAGATACTCTGATTGAGTTGGGTAAATCTGGC TTTAACAATCTTCTAGCTAAGAATAATGTCGATACTTATGGTATCAGTCTTGCCAGTCAACATGGAACGA CAGATTTGTTTAGCΆCGCTGGAACΆTTACCGAAAAGTCTTTTTΆCCΆAATACAAGCAATAATGACTGGTT AAATCAGAGACTAΆGGCTTACATTGTCGAAGAAAAATCCACTATCGAAGAGGTGAΆΆACGAAGCAAGGG TTAGCTGGCACCAAGTATTCTATCGGTGTTTATGATCGTATCACGAGTGCCACATGGAAΆTACCGCAATA GGTCTTGCCTCTCCTGACCTTGCCAGAGAGATCCGTATTTGTCATCTCGACCΆTGTCTAGTCTAGGATT TGGAGCTTATGATCGCTACCGCAGTAGTGACCATAAAGCGGGCAAGGCTCTCAATGATTTTGTTGAAGAΆ AATGCGCGTGAAACAGCCAAACGTCAGCGAGATCACTACGATTATTGGTATCGTATTTTAGACGACAATG CACGTGAAAAACTTTATAGAAATATTTTGCTTTACGATGCTTATAAATTTGGCGATGATAATACCGTAGG GAAAGCTACAGAAGTGGCAGATTTTGATAATCCAAATCCTGCAATGCAACATTTCTTTGGACCTGTTGGA AATAAAGTTGGGCATAATCAACACGGTGCTTATGCTACAGGTGATGCAGTTTATTATATGGGTTATCGAA TGTTGGATAAGGATGGAGCTATTACTTATACGCATGAGATGACACATGACTCAGATCAGGACATTTATCT TGGAGGATATGGTCGAAGAAGTGGCTTGGGACCAGAGTTCTTTGCTAAAGGATTATTACAAGCACCAGAC CATCCAGATGATGCGACCATTACCATCAACTCCATCTTGAAACATTCAAAATCTGATAGTACAGAAAGTC GACGATTACAAGTACTTGATCCAACTACAAGATTTAATAATGCAGATGATTTGAAGCAATATGTCCACAA CATGTTTGACGTTGTTTATATGTTGGAATATCTCGAAGGAAATTCAATTCTTAAATTGGATACGAATCAA AAACAACAACTTCTTAGAAAAGTTACAAATGAGTACCATCCTGATCCTGATGGAAATAAGGTCTATGCAA CAAATGTTGTCAGAAATCTAACAGTAGAAGAAGTTGAAAGACTACGTTCATTCAATGATTTGATTGATAA TAATATTCTTTCGTCTAGGGAATATGCCTCAGGTAAATACGAAAGAAATGGCTACTTCACTATTAAGTTA TTTGCACCGATTTATGCTGCATTAAGTAATGATATAGGAACACCAGGTGACCTGATGGGACGTCGTATAG CCTATGAACTACTAGCTGCTAAAGGCTTTAAAGATGGTATGGTACCATATATCTCAAACCAATACGAAGA AGAAGCCAAACAAAAGGGCAAGACAATCAATCTCTACGGTAAAACAAGAGGTTTGGTTACAGATGACTTG GTTTTGGAAAAGGTATTTAATAACCAATATCATACTTGGAGTGAGTTTAAGAAAGCTATGTATCAAGAAC GACAAGATCAGTTTGATAGATTGAACAAAGTTACTTTTAATGATACAACACAGCCTTGGCAAACATTTGC CAAGAAAACTACAAGCAGTGTAGATGAATTACAGAAATTAATGGACGTTGCTGTTCGTAAGGATGCAGAA CACAATTACTACCATTGGAATAACTACAATCCAGACATAGATAGTGAAGTCCACAAGCTCAAGAGAGCAA TCTTTAAAGCCTATCTTGACCAAACAAATGATTTTAGAAGTTCAATTTTTGAGAATAAAAAATAG
Amino Acid sequence Iga
MEKYFGEKQERFSFRKLSVGLVSATISSLFFMSVLASSSVDAQETAGVHYI YVADS ELSSEEKKQLλ yDIPTYVENDDETYYLλπTKLNSQNQLAELPNTGSKNERQALVAGASLAAM GILIFAVSKKKVKNKTVLHLVLVAGIGNGVLVSVHALENHLLLNYNTDYELTSGEKLPLPK EISGYTYIGYIKEGKTTSESEVSNQKSSVATPTKQQKVDYNVTPNFVDHPSTVQAIQEQTPV SSTKPTEVQWEKPFSTELINPRKEEKQSSDSQEQLAEHKNLETKKEEIQSPKEKTGVNTL NPQDEVLSGQLNKPEL YREETMETmDFQEEIQENPDIAEGTVRVKQEGKLGKKVEIVRI FSVNKEEVSREIVSTSTTAPSPRIλ^EKGTKKTQVIICEQPETGVEHKDV SGAIVEPAIQPELP EAWSDKGEPEVQPTLPEAλ^VTDKGETEVQPESPDTWSDKGEPEQVAPLPEYKGNIEQVK PETPVEKTKEQGPEKTEEVPVKPTEETPVNPNEGTTEGTSIQEAENPVQPAEESTTNSEKV SPDTSSKNTGEVSSNPSDSTTSVGESNKPEHNDSKNENSEKTVEEVPVNPNEGTVEGTSNQ ETEKPVQPAEET TNSGKIANENTGEVSNKPSDSKPPVBESNQPEKNG ATKPENSGNTTS ENGQTEPEPSNGNSTEDVSTESNTSNSNGNEEIKQENELDPDKKVEEPEKTLELRNVSDLE LYSLSNGTYKQHISLE VPSNPNSYFλ ^VKSSSFKDVYLPVASISEERKNDKILYKITAKVEK LQQEIESRYKDNFTFYLAKKGTEETTNFTSFSNLVI AJNQNPSGTYHLAASLNANEVELGP DERSYIKDTFTGRLIGEKDGKNYAIYNLKKPLFEN SGATVEKLSLKNVAISGKDDIGSLAN EA NNTKIK VHVDGVLAGERGIGGLLAKAEQSSITESSFKGRIINTYETTAAYNIGGMVGH TGDKALLTKSKATVAISSNTNTSDQTVGGLAGL RDA I DSYAEGDINNVKHFGRVAG VAGNLWDRTSGDVRHAGSLTNV SDVNVTNGNAITGYHYNEMKVKDTFSSKANRVYNVT LVKDEVVSKESFEERGTMLDASQIASKI VEINPLILPTVEPLSTSGKKDSDFSKVAYYQAKR NLTYKNIEKLLPFYNEATIVI^YGNLVNENSLLYQKELLSAVMMKDN VITDIVSNK TANK LLLHYKDDLSEKLDLKYQNDFAKLAEYSLGNTGLLYTPNQFLYD TSIIKQVLPDLQKVDY HSEAIRKTLGISPNVKQTELYLEDQFAKTKQQLEDSLKKLLSADAGLASANPVTEGYLVDKI KRNKEALLLGLTY ERWYNFSYGQVNVKDLVLYHLDFFGKGNASPLDTLIELGKSGFNNL LAKNNVDTYGISLASQHGTTDLFSTLEHYRKVFLPNTSNNDWFKSETKAYIVEEKSTIEEV KTKQGLAGTKYSIGVYDRITSATWKYRNMV PLLTLPERSVFVISTMSSLGFGAYDRYRSSD HKAGKALNDFVEENARETAKRQRDHYDYWYRILDDNAREKLYRNILLYDAYKFGDDNTV GEA.TEVADFDNPNPAMQHFFGPVGNKVGHNQHGAYATGDAVYYMGYRMLDKDGAITYT HEMTHDSDQDIYLGGYGRRSGLGPEFFAKGLLQAPDHPDDATITINSILKHSKSDSTESRRL QVLDPTTRFNNADDLKQYVHNMFDλ^VYMLEYLEGNSILKLDTNQKQQLLRKVTNEYHPD PDGNKVYATNWRNLTVEEVERLRSFNDLIDNNILSSREYASGKYERNGYFTIKLFAPIYAA LSNDIGTPGDLMGRRIAYELLAAKGFKDGMVPYISNQYEEEAI^QKGKTINLYGKTRGLVTD DLVLEKVFNNQYHTWSEFKI^AMYQERQDQFDRLNKVTFNDTTQPWQTFAKKTTSSVDEL QKLMDVAVRKDAEHNYYHWNNYNPDIDSEVHKLKRAIFKAYLDQTNDFRSSIFENKK
Recombinant His Tagged Iga
MGQTEPEPSNGNSTEDVSTESNTSNSNGNEEIKQENELDPDKKVEEPEKTLELRN VSDLELYSLSNGTYKQHISLEQVPSNPNSYFVKVKSSSFKDVYLPVASISEERKNDKILYKIT AKVEKLQQEIESRYKDNFTFYLAKKGTEETTNFTSFSNLVKAINQNPSGTYHLAASLNANE VELGPDERSYIIΦTFTGRLIGEKDGKNYAIYNLKKPLFENLSGATVEIiLSLKNVAISGKDDI GSLANEAQNNTKIKQVHVDGVLAGERGIGGLLAI^AEQSSITESSFKGRIIN YETTAAYNIG GMVGHLTGDKALLTKSI^ATVAISSNTNTSDQTVGGLAGLVDRDAQIQDSYAEGDINNVKHF GRVAGVAGNLWDRTSGDVRHAGSLTNVLSDVNVTNGNAITGYHYNEMKVIΦTFSSKANR \^NVTLVKDEvYSKESFEERGTMLDASQIASKICAEINPLILPTVΕPLSTSGKKDSDFSKVAY YQAKRNLTΥK:NIEKLLPFYNIζATIVEYGNLVNENSLLYQKELLSAVMMKDNQVITDIVSNK TANKLLLHYKDDLSEKLDLI^YQNDFAK AEYSLGNTGLLYTPNQFLYDQTSIIK VLPDL QKVDYHSEAJRKTLGISPNVI^QTELYLEDQFAKTKQQLEDSLKKLLSADAGLASANPVTEG YLVDKIIOINKEALLLGLTYLERWYNFSYGQVNVKDLVLYHLDFFGKGNASPLDTLIELGKS GFNNLLAI NNVDTYGIS ASQHGTTDLFSTLEHYRKVFLPNTSNNDWFKSETKAYIVEEKS TIEEVI^TKQGLAGTKYSIGVYDRITSATWKYRNMVLPLLTLPERSVFVISTMSSLGFGAYDR YRSSDHKAGEA.LNDFVEENARETAKRQRDHYDYWYRILDDNAREKLYRNILLYDAYKFGD DNTVGKATEVADFDNPNPAMQHFFGPVGNKVGHNQHGAYATGDAVYYMGYRMLDKDGA ITYTHEMTHDSDQDIYLGGYGRRSGLGPEFFAKGLLQAPDHPDDATITINSILKHSKSDSTE SRRLQVLDPTTRFNNADDLKQYVHNMFDWYMLEYLEGNSILKLDTNQKQQLLRKVTNEY HPDPDGNKVYATNWRNLTVEEVERLRSFNDLIDNNILSSREYASGKYERNGYFTIKLFAPI YAALSNDIGTPGDLMGRRIAYELLAAKGFKDGMVPYISNQYEEEAKQKGKTINLYGKTRGL VTDDLVLEKVFNNQYHTWSEFKIζAMYQERQDQFDRLNKVTFNDTTQPWQTFAKKTTSSV DELQKLMDVAVRKDAEHNYYHWNNYNPDIDSEVHKLKRAIFKAHHHHHH
PsaA
The gene for PsaA was amplified by PCR from Streptococcus pneumoniae D39 with the primers 5'CCATGGCTAGCCACCATCACCATCACCATgctacaaactcaatcatcgc 3' and 5'TTTCGGATCCTTATTTTGCCAATCCTTCAGC 3' which incorporate flanking Nhel and BamHI restriction sites, and a N-terminal His6 tag. The amplified DNA was cloned into a pETlla expression vector (Stratagene, LaJolla, CA) and electrotransformed into E. coli BL21(DE3). The recombinant protein was purified by Ni+ affinity chromatography with the HisTrap Kit (Amersham Pharmacia) according to the manufacturers recommendations. To prevent the formation of inclusion bodies, 8M urea was added to all buffers throughout the purification process. The purified recombinant protein was dialysed against lOmM HEPES buffer, pH7.5, free dried, and stored at -20°C.
psaA nucleotide sequence Streptococcus pneumoniae D39
ATGAAAAAATTAGGTACATTACTCGTTCTCTTTCTTTCTGCAATCATTCTTGTAGCATGTGCTAGCGGAA AAAAAGATACAACTTCTGGTCAAAAACTAAAAGTTGTTGCTACAAACTCAATCATCGCTGATATTACTAA AAATATTGCTGGTGACAAAATTGACCTTCATAGTATCGTTCCGATTGGGCAAGACCCACACGAATACGAA CCACTTCCTGAAGACGTTAAGAAAACTTCTGAGGCTGATTTGATTTTCTATAACGGTATCAACCTTGAAA CAGGTGGCAΆTGCTTGGTTTACAAAATTGGTAGAAAATGCCAAGAΆAΆCTGAΆAACAAAGACTACTTCGC AGTCAGCGACGGCGTTGATGTTATCTACCTTGAAGGTCAAAATGAAAAΆGGAAAAGAAGACCCACACGCT TGGCTTAACCTTGAAAACGGTATTATTTTTGCTAAAAATATCGCCAAACAΆTTGAGCGCCΆAAGACCCTA ACAATAAAGAATTCTATGAAAAAAATCTCAAAGAATATACTGATAAGTTAGACAAACTTGATAAAGAΆΆG TAAGGATAAATTTAATAAGATCCCTGCTGAAAAG AACTCATTGTAΆCCAGCGAAGGAGCATTCAAATAC TTCTCTAAAGCCTATGGTGTTCCAAGTGCCTACATCTGGGAAATCAATACTGAΆGAAGAAGGAACTCCTG AACAAATCAAGACCTTGGTTGAAAAACTTCGCCAAACAAAAGTTCCATCACTCTTTGTAGAATCAAGTGT GGATGACCGTCCAATGAAAACTGTTTCTCAAGACACAAACATCCCAATCTACGCACAAATCTTTACTGAC TCTATCGCAGAACAAGGTAAAGAAGGCGACAGCTACTACAGCATGATGAAATACAACCTTGACAAGATTG CTGAAGGATTGGCAAAATAA
PsaA Amino acid sequence MKKLGTLLVLFLSAIILVACASGKKDTTSGQKLKWATNSIIADITKNIAGDKIDLHSI
VPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSD GVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKL DKLDKESKDKFNKIPAEKKLIVTSEGAFKYFSI^AYGVPSAYIWEINTEEEGTPEQIKTLVEK LRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTDSIAEQGKEGDSYYSMMKYNLDKIA EGLAK
Recombinant His tagged PsaA
MAHHHHHHTNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIF YNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLE NGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEG AFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQD TNIPIYAQIFTDSIAEQGKEGDSYYSMMKYNLDKIAEGLAK
ELISA test for antibodies
IgG antibodies to Eno, Iga, PpmA and SlrA in serum of humans suffering from pneumococcus infection were measured by EIA. Microtiter plates (Maxisorp; Nunc, Roskilde, Denmark) were coated with lOOμl/well, with a coating concentration of 5μg/ml of antigen in PBS and incubated overnight at 37°C. The plates were blocked with 1% bovine serum albumin (BSA) and 0.05% Tween 20 in PBS at 37°C for 1 h. The samples were serially diluted (starting at 1:100) in the dilution buffer (1% BSA, 0.05% Tween 20 in PBS). Duplicates (lOOμl/well) were incubated at 37°C for 2 h. Polyclonal alkaline phosphatase-conjugated antisera to human IgG (Sigma Chemicals, St. Louis) was diluted 1:3000 in the dilution buffer, pipetted at lOOμl/well, and incubated for 2 h at 37°C. Finally, lOOμywell of MUP (Sigma, CA1 M8883) substrate solution (0.2 mM 4-methylumbelliferyl phosphate, 0.05 M NaCO3, 0.05 mM MgC12) was added, and the plates were incubated for 1 h at 37°C. The fluorescence was measured with an excitation wavelength of 365nm, and an emission wavelength of 450 nm with a Molecular Devices SpectraMAX
(Sunnyvale, USA) microplate reader. The serum endpoint antibody titer was interpolated from the intersection of the absorbance-versus-serum dilution curve at the background fluorescence plus four times the standard deviation. The end-point titer was then converted into antibody concentration (EIA units of immunoglobulin per milliliter) by comparison with a standard serum consisting of pooled healthy adult volunteers, and was considered to contain 100 U/mL of anti-a-enolase, Iga, PpmA or SlrA. Samples with antibody concentrations below the detection limit (30 U/mL for Eno, 4 U/mL for Iga, 4 U/mL for SlrA, and 5 U/mL for PpmA) were assigned the values equivalent to half the detection limit. The results are shown in Table 9.
Statistical methods: We used SPSS software (SPSS, USA) for analysis of log- transformed data. The antibody concentrations in the groups of children are reported as geometric mean concentrations (GMC, units/ml) with 95% confidence intervals (95% CI) and compared by one way ANOVA followed by a LSD post hoc test. Statistical comparisons between antibody levels in acute and convalescent phase sera were carried out using a paired Student's t test. Fisher's exact test was used when the proportions of variables were compared. A logistic regression was used to evaluate the effects of the acute phase antibody concentration, age and the nature of pneumococcal contact on the antibody response and to evaluate antibody concentrations (logarithm base e of antibody concentration) as a risk factor for the involvement of pneumococci as a risk factor for the development of AOM. Children were grouped into eight 3- month groups according to the age at which the acute serum was sampled. To determine whether there were any significant differences in relation to age, groups were analyzed by 1-way ANOVA followed by a Tukey's HSD test
Table 9. Results of ELISA test
Figure imgf000057_0001
Figure imgf000057_0002
Figure imgf000057_0003
Figure imgf000057_0004
EXAMPLE 2
Mucosal vaccinations
Lactococcus lactis ghosts in combination with the AcmA cell-wall- binding domain (protein anchor) can be used as a carrier/adjuvant system for mucosal and systemic delivery of antigens (WO 99/25836 and WO 02/101026). In the present study immunogenicity and protective activity of a tri- valent ghost-protein vaccine (SlrA, Igalprt, PpmA) was tested as well as that of each of the monovalent ghost-protein vaccines after nasal administration of the vaccines and nasal challenge with virulent S. pneumoniae. The aim of the experiments was: • To evaluate protective activity of an intranasal administered L. lactis ghost-protein anchor tri-valent (SlrA, PpmA, Igalprt) vaccine and of ghost-protein anchor mono-valent (SlrA), ghost- protein anchor mono-valent (PpmA) and ghost-protein anchor mono-valent (Igalprt) vaccines. • To evaluate the immune response to intranasal administered antigens bound to ghost lactococci and compare the immune response to the antigens administered simultaneously or individually. • To evaluate correlation of bacterial load in lungs, blood and nasopharynx with protection and immune response after vaccination.
MATERIALS AND METHODS
Construction of vectors. Table 10 summarises the characteristics of the antigens used in the ghost protein-based S. pneumoniae vaccines. PpmA::PA fusion. Plasmid pPA32, specifying a fusion between the S. pneumoniae PpmA protein and the protein anchor (Figure 12), was constructed by ligating an Ncol- and EcoRI-cleaved PCR-amplified fragment of CbpA into the Ncol and EcoRI sites of pPA3 (Steen et al. 2003. J. Biol. Chem. 278:23874- 23881). The PpmA-specific fragment was amplified with the primers PpmA.l (cggtctcacatgtcgaaagggtcagaaggtgcagacc) and PpmA.2 (cggtctcgaattgcttcgtttgatgtactactgcttgag) with S. pneumoniae strain D39 chromosomal DNA as template. The ligation mix was cut with EcoRI and Nhel before it was used for electroporation of . lactis PAlOOl (Kuipers et al. J. Biol. Chem. 2004 Mar 24 [Epub ahead of print]). The final construct was designated pPA32.
Igalprt::PA fusion. Plasmid pPAl52, specifying a fusion between a fragment of the S. pneumoniae Igalprt protein (residues 672 to 1330) and the protein anchor (Figure 13). Plasmid pPAl52 was constructed by ligating an Ncol- and EcoRI-cleaved PCR-amplified fragment of Igalprt into the corresponding sites of pPA3. The Igalprt-specific fragment was amplified with the primers Igal.fw2 (cgtctcccatgggacaaacagaaccagagccatcaaacgg) and Igaltrunc2.rev (ccgtctcgaattctagccagtccagcatc) with <S. pneumoniae strain TIGR4 chromosomal DNA as template. The ligation mix was cut with Nhel before it was used for electroporation of L. lactis PAlOOl. The final construct was designated pPAl52.
SlrA::PA fusion. Plasmid pPAl62, specifying a fusion between the 5. pneumoniae SlrA protein and the protein anchor (Figure 14), was constructed by ligating an Esp3l-cleaved PCR-amplified fragment of SlrA into the Ncol and EcoRI sites of plasmid pPA3. The SlrA-specific fragment was amplified with the primers SlrA.fw (ccgtctcccatggtccaacgcagtctgcgt) and SlrA.rev (ccgtctcgaattccagatttaaaatcgtagtctttcacca) with S. pneumoniae strain D39 chromosomal DNA as template. The ligation mix was cut with Sphl before it was used for electroporation of L. lactis PAlOOl. The final construct was designated pPAl62. Production of Ghost cells. L. lactis Ghosts were produced as described in WO 02/101026. Each dosis representing the amount used for one nasal administration in mice, contained approximately 2.5x109 Ghosts.
Production of antigen. The yeast-based GLS mediu was used for production of the vaccine. GLS contains 2% gistex (Gistex® LS Ferm Powder AGGL - 1027180, Strik Special Additives, The Netherlands), 3% β- glycerophosphate and 2% glucose. Glucose was sterilized as a separate solution and added to the broth when the strain was inoculated. L. lactis PAlOOl containing plasmids pPAl52, pPA32 or pPA162 were grown in GLS supplemented with 5 μg/ml chloramphenicol. At OD600 levels of approximately 0.5 and 1.0 the cultures were induced by adding 1 ml of the cell- free supernatant of a nisin producing L. lactis culture per litre of medium (1:1000; Kuipers et al. 1997. Tibtech. 15: 135-140). The culture was left at 30°C overnight, after which the culture supernatants were concentrated with a VivaFlow tangential flow module (Vivascience VivaFlow 200; 10,000 Da cutoff). The concentrate was sterilised through a 0.45 μm filter and stored at +4° C until binding.
Production of the vaccines. The vaccines were produced as follows: Ghost-SlrA::PA monovalent vaccine: 27.5 ml of a lOx concentrated supernatant of a SlrA::PA producing L. lactis culture was bound to 4.6 ml Ghost (46 units) on a blood suspension mixer for 30 minutes at room temperature. After washing, the pellet was resuspended in 920 μl PBS and 880 μl was divided in 4 vials (220 μl each). 3 vials for the monovalent vaccine and 1 vial for the trivalent vaccine.
Ghost-PpmA::PA monovalent vaccine:
170 ml of a lOx concentrated supernatant of a PpmA::PA producing L. lactis culture was bound to 4.6 ml Ghost (46 units) on a blood suspension mixer for 30 minutes at room temperature. After washing, the pellet was resuspended in 920 μl PBS and 880 μl was divided in 4 vials (220 μl each). 3 vials for the monovalent vaccine and 1 vial for the trivalent vaccine.
Ghost-Igalprt::PA monovalent vaccine:
All concentrated supernatant (25-41x) of a Igalprt: :PA producing L. lactis culture was bound to 4.6 ml Ghost (46 units) on a blood suspension mixer for 30 minutes at room temperature. After washing, the pellet was resuspended in 920 μl PBS and 880 μl was divided in 4 vials (220 μl each). 3 vials for the monovalent vaccine and 1 vial for the trivalent vaccine.
Trivalent vaccine:
Three vials of monovalent vaccines were mixed and devided over 3 vials (220 μl each).
All vaccines were kept at -80 °C until the start of the immunizations.
One dosis (20μl) of a nasal vaccine contains 2.5xl09 Ghost cells.
Mice. Female outbred CD-I mice were purchased from Harlan France. Mice were 6 week-old at the time of starting the study.
Pneumococcal challenge strain. S. pneumoniae D39, serotype 2, was obtained from the National Collection of Type Cultures (NCTC 7466; Central Public Health Laboratory, London).
Immunization and treatment groups. Mice were immunized intranasally under light inhalation anaesthesia (isoflurane/O2/N2O) by pipeting 20 μl of the vaccine or control onto the nostrils. Complete immunization consisted of 3 doses given at 10 day-intervals.
Mice (10 per group) received PBS as control. The vaccines consisted of 2.5 x 109 ghosts and contained 5 μg Igalprt, 10 Dg PpmA and 50 μg SlrA per dose for the mono-valent vaccines, 2.5 x 109 ghosts with a third of the monovalent doses of each antigen for the tri-valent vaccine. The following groups were used: 1. 20μl PBS.
2. 2.5xl09 lactococcal ghosts -protein anchor-Sir A fusion (50 μg SlrA::PA) in 20 μl PBS.
3. 2.5xl09 lactococcal ghosts -protein anchor-PpmA fusion (10 μg PpmA::PA) in 20 μl PBS.
4. 2.5xl09 lactococcal ghosts -protein anchor-IgAprt fusion (IgAprtr.PA) in 20 μl PBS.
5. 2.5x10s lactococcal ghosts with bound protein anchor- Sir A /PpmA /Igalprt fusions (antigens individually bound as in groups 2, 3 and 4 and mixed in ratio 1:1:1) in 20μl PBS.
Challenge. Intranasal challenge was performed 4 weeks after the last immunization. Aliquots of inoculum were rapidly thawed and bacteria diluted in sterile PBS to 1 x 106 CFU/50 μl. Challenge was carried out under light anesthesia by pipeting 50 μl of the inoculum onto the nostrils of the mice. After inoculation were laid on their backs until recovery. Mice were weighted before challenge and at t:=44-h. Condition of the mice was monitored frequently (at least three times a day) and scored for the following criteria: hunched, starry coat, lethargic, moribund. After 44-h mice blood was collected under anesthesia and mice terminated by cervical dislocation. Nose washes and lungs were collected for quantitative microbiological culture.
Scoring of health status. Each animal was scored 44 h after infection according to the criteria given in Table 11. The maximum score per group of 10 animals is 40 (all animals dead). All animals healthy results in a score of 0. The disease index is the percentage of the maximum score.
Determination of bacterial load. Blood samples, lungs homogenates and nose washes were serially diluted and plated on agar with 5% sheep blood. Plates were incubated overnight at 37°C before counting the colonies. Statistical analyses were performed using GraphPad Instat. Difference between groups were assessed by unpaired student t-test with log values of bacterial. Loss of weight was assessed by paired t-test. Comparison of disease index was performed by Mann- Whitney analyse. A P-value < 0.05 is considered significant. ELISA. Antigens (SlrA, PpmA and Igalprotease), purified by making use of his-tag purification, were coated in 96 well plates (2 μg/ml) in coating buffer (50mM sodium carbonate, pH9.6). Only Igalprotease was coated at 10 μg/ml in coating buffer. For the calibration curve rat anti-mouse kappa chain (BD Biosciences 559749, 0.5 mg/ml) was coated at 1/500 dilution in coating buffer. After incubation overnight at 4 °C, the plates were rinsed 3 times with wash buffer (0.02% Tween 20 in PBS). The plates were blocked by adding 100 μl blocking buffer (1% BSA, 0.02% Tween 20 in PBS) in each well. The plates were incubated for 1 hour at room temperature. All blood samples were diluted 1/100 with blocking buffer, and serial dilutions (1/3) of these samples were performed in 100 μl blocking buffer. For the calibration curve a serial dilution of mouse IgGl kappa light chain (Sigma M7894) was made, starting with lμg/ml. All samples were tested in duplo. After incubation for 2 hours at room temperature, the plates were rinsed 3 times with wash buffer. Antigen specific antibodies were detected by using goat anti-mouse IgG (Fc)-alkaline phosphatase conjugate (Sigma A7434) diluted 1/5000 in blocking buffer. The plates were rinsed two times with washing buffer and two times with double distilled H2O and were developed with pNPP (Sigma N2765, 1 mg/ml in 50 mM sodium carbonate, 1 mM MgC12, pH9.6). After 30 minutes of incubation with pNPP, the reaction was stopped by addition of 50 μl NaOH (2M). The absorbance at 405 nm was recorded and the IgG concentration in the blood samples was determined by comparison with the calibration curve.
RESULTS Composition of the vaccine. The amounts of antigen-PA fusions in the different vaccines were determined using CBB -stained SDS-PAGE gels (example in Figure 15), containing samples from different Ghost-antigen groups and a BSA protein standard. The established amounts were for the monovalent vaccines: Ghost-SlrA::PA: 50 μg/dose
Ghost-PpmA::PA 10 μg/dose
Ghost-Igalprt::PA 5 μg/dose
The trivalent vaccine was composed by mixing the monovalent vaccines in a ratio of 1:1:1 with the total number of ghost the same as in the monovalent vaccines (2.5 x 109) resulting in the following amounts of antigen: Ghost-SlrA::PA: 17 μg/dose
Ghost-PpmA::PA 3.3 μg/dose
Ghost-Igalprt::PA 1.7 μg/dose The vaccines were formulated in PBS without additional adjuvant.
Vaccine efficacy.
Health status. Intranasal vaccination with the tri-valent ghost vaccine resulted in protection against a nasal challenge with virulent S. pneumoniae. The vaccinated mice remained healthy as reflected by a disease index significantly lower when compared to the mice that received PBS (Figure 16). No significant loss of weight was seen in this group (Figure 17), indicating a significant improvement in health. Of the monovalent vaccines, SlrA and PpmA did show minor protective effects (Figure 16). The PpmA monovalent vaccine group also showing no significant loss of weight (Figure 17), indicating a better overall health then in the PBS control group. However, overall the animals in the trivalent vaccine group clearly showed the best health status after challenge.
Bacterial counts (see Figure 18 and Table 12). In mice vaccinated with the tri-valent vaccine the number of bacteria in the lungs and nose was significantly reduced compared to the PBS control group (P -values < 0.05). This was not the case when the mice were immunized with each one of the monovalent vaccines. Also, comparison between the tri-valent vaccine group and the monovalent vaccine groups shows significant differences in the bacterial counts in nose, lung and blood. Again, clearly the tri-valent vaccine group performed best.
Immune response. Serum IgG response were determined by ELISA after 3 immunizations in pre-challenge blood. Figure 19 shows the serum IgG antigen specific responses generated in the different vaccine groups. The responses against SlrA, PpmA and Igalprt in the monovalent vaccines are similar to the responses to these antigens in the tri-valent vaccines, indicating that the amounts of antigen in the tri-valent vaccine are sufficient to elicit serum antibody' responses of this magnitude for these antigens. The combined response to the three antigens in the tri-valent vaccine is needed to obtain the protective effect, since each of the individual responses in the monovalent vaccine groups did not provide sufficient protection.
CONCLUSIONS: • Nasal (mucosal) vaccination with the tri-valent SlrA, PpmA,
Igalprt vaccine provided increased protection of the mice after challenge with S. pneumoniae.
• Nasal vaccination with the tri-valent vaccine resulted in significant reduction in the number of bacteria in lungs and nose. • Nasal immunization with the mono- and trivalent vaccines resulted in significant antigen specific IgG levels in the blood serum.
• Nasal vaccination with the mono-valent vaccines had no protective effect upon challenge with S. pneumoniae. Table 10. Overview of S. pneumoniae antigen characteristics. The segments that were used for the actual protein anchor fusions are indicated.
Figure imgf000065_0001
Figure imgf000066_0001
Table 11. Scoring overview of health status.
Figure imgf000066_0002
Table 12. Statistical comparisons between various vaccines. P values < 0.05 are considered significant (indicated in bold).
Figure imgf000066_0003
References
Obaro SK. The new pneumococcal vaccine. Clin Microbiol Infect 2002; 8(10): 623-33.
Darkes MJ, Plosker GL. Pneumococcal conjugate vaccine (Prevnar; PNCRM7): a review of its use in the prevention of Streptococcus pneumoniae infection. Paediatr Drugs 2002; 4(9):609-30.
Wuorimaa T, Kayhty H. Current state of pneumococcal vaccines. Scand J Immunol 2002; 56(2):lll-29.
Lee LH, Lee CJ, Frasch CE. Development and evaluation of pneumococcal conjugate vaccines: clinical trials and control tests. Crit Rev Microbiol 2002; 28(1):27-41.
Klugman KP. Efficacy of pneumococcal conjugate vaccines and their effect on carriage and antimicrobial resistance. Lancet Infect Dis 2001; 1(2):85-91.
Rapola S, Jantti V, Haikala R, Syrjanen R, Carlone GM, Sampson JS, Briles DE, Paton JC, Takala AK, Kilpi TM, Kayhty H. Natural development of antibodies to pneumococcal surface protein A, pneumococcal surface adhesin A, and pneumolysin in relation to pneumococcal carriage and acute otitis media. J Infect Dis 2000; 182(4):1146-52.
Rapola S, Kilpi T, Lahdenkari M, Makela PH, Kayhty H. Antibody response to the pneumococcal proteins pneumococcal surface adhesin A and pneumolysin in children with acute otitis media. Pediatr Infect Dis J 2001; 20(5):482-7. Zysk G, Bethe G, Nau R, Koch D, Grafin Von Bassewitz VC, Heinz HP, Reinert RR. Immune response to capsular polysaccharide and surface proteins of Streptococcus pneumoniae in patients with invasive pneumococcal disease.J Infect Dis 2003 Jan 15;187(2):330-3.
McCool TL, Gate TR, Moy G, Weiser JN. The immune response to pneumococcal proteins during experimental human carriage. J Exp Med 2002; 195(3):359-65.
Overweg K, Pericone CD, Verhoef GG, Weiser JN, Meiring HD, De Jong AP, De Groot R, Hermans PW. Differential protein expression in phenotypic variants of Streptococcus pneumoniae. Infect Immun 2000; 68(8):4604-10.
Overweg K, Kerr A, Sluijter M, Jackson MH, Mitchell TJ, de Jong AP, de Groot R, Hermans PW. The putative proteinase maturation protein A of Streptococcus pneumoniae is a conserved surface protein with potential to ehcit protective immune responses. Infect Immun 2000; 68(7):4180-8.
Legends to the figures
Fig. 1. Titres of anti-pneumococcal IgG against PpmA in children and adults. Fig. 2. Titres of anti-pneumococcal IgG against pneumolysin in children and adults.
Fig. 3. Titres of anti-pneumococcal IgG against IgAlproteinase in children and
Fig. 4. Titres of anti-pneumococcal IgG against alpha-enolase in children and adults. Fig 5. Titres of anti-pneumococcal IgG against SlrA in children and adults.
Fig. 6. Survival time of Sir A- vaccinated CD-I mice infected intranasally with
Streptococcus pneumoniae D39.
Fig. 7. Survival time of IgAl proteinase-vaccinated CD-I mice infected intranasally with Streptococcus pneumoniae D39. Fig. 8. Survival time of PsaA- vaccinated CD-I mice infected intranasally with
Streptococcus pneumoniae D39.
Fig. 9. Survival time of SlrA- and PpmA-vaccinated CD-I mice infected intranasally with Streptococcus pneumoniae D39.
Fig 10. Passive immunization of CD-I mice with pre-immune serum (PIS), anti-PpmA serum (APS) and challenged intranasally with Streptococcus pneumoniae D39 or a PpmA-negative knockout strain of Streptococcus pneumoniae.
Fig 11. Survival of MF-1 mice passively vaccinated with anti-PpmA antiserum and intranasally infected with Streptococcus pneumoniae D39. Fig 12.. Sequence of the secreted PpmA::PA fusion protein. Underlined are the aminoacids of Igalprt. Protein anchor (PA) amino acids are in italics.
Fig 13. Sequence of the secreted Igalprt::PA fusion protein. Underlined are the aminoacids of Igalprt. Protein anchor (PA) amino acids are in italics.
Fig 14. Sequence of the secreted SlrA::PA fusion protein. Underlined are the aminoacids of Igalprt. Protein anchor (PA) amino acids are in italics. Fig 15. A CBB stained SDS-PAGE gel with the Ghost-antigen vaccines and a BSA reference. SlrA, PpmA and Igal are samples from the vaccine groups. Each sample represents one dose (20μl). In the five lanes on the right, the number represents the amount of BSA in micrograms. An estimate of the amount of bound antigen is made and shown in the lower right part of the Figure.
Fig 16. Health status of the mice at the time of ending experiment (t=44-h after infection). A score ranging from 0-4 was attributed to each mouse according to the parameters described in material and methods. The disease index was calculated as percentage of maximal score and presented as average + SEM for each group. A high score indicates that most animals are diseased. A low score indicates that most animals are healthy.
Fig 17. Weight loss upon challenge. Mice were weighted prior infection and 44- h after challenge. Loss of weight is calculated as percentage of the initial weight and presented as average + SEM for each group. Loss of weight is an indication that animals are diseased.
Fig 18. Bacterial counts 44-h post-challenge in the lungs (A), nose (B) and blood (C). Graphs show individual data (0) and the average (— ) for each group. High bacterial counts are an indication that animals are not protected. Fig 19. Antigen specific IgG in the serum after 3 immunizations but prior to challenge. The values are presented as average + SEM for each group.

Claims

Claims
1. A method to identify an opsonophagocytosis inducing antigen as a vaccine component for immunisation against a microorganism, comprising: a. Selecting in silico via a membrane anchoring motif and/or a cell wall binding domain a nucleotide sequence encoding at least part of a bacterial protein, and b. Producing at least part of said protein, and c. contacting a collection of antibodies to said protein and testing for binding between at least one antibody and at least one antigen, and d. measuring the opsonizing ability in vitro and/or in vivo of said binding antibody for a microorganism having such an antigen.
2. A method according to claim 1 wherein said collection of antibodies is raised by immunizing an animal with at least part of said protein of said microorganism.
3. A method according to claim 1 or 2 wherein said microorganism is a member of the species of Streptococcus pneumoniae.
4. A method according to claim 1 or 2 wherein said microorganism is a member of the species Moraxella catarrhalis.
5. A method according to claim 1 or 2 wherein said microorganism is a member of the genus Streptococcus, or a member of the genus Staphylococcus, or a member of the species Moraxella catarrhalis, αnd/or Neisseria meningitidis, and/or Neisseria ghonorrhoeae, and/ 'or Helicobacter pylori, and/or Haemophilus influenzae and/or Campylobacter jejuni, and/or a member of the genus Pseudomonas, and/or a member of the genus Bacillus.
6. A method according to any of claims 1 to 5 wherein the motif is chosen from the group consisting of:
PBD : [YVj -X(i-4)-G-D- [ST] - [VLIA] -X(o,2)- [VLIA]
CBD : G-X(0-5)-G-X- [WYI] - [WYT] - [YVL] - [FV]
Lipobox (+ signal peptide): <M-X(ι.ιo)-[RK]-X-{DERK}(7.i7)-[LVFTIMG]-
[ASTIVGMLCPFL] - [AGLIS VTFP] - C LPxTG: L-P-X-T-G in which X denotes any naturally occurring amino acid, and in which the square brackets indicate one position which can be filled with any of the amino acids indicated between the square brackets; and wherein the numbering in the subscript indicates that the corresponding amino acid is repeated the indicated number of times.
7. A nucleotide sequence at least encoding for an antigenic part of a protein, said protein inducing opsonophagocytosis of a microorganism having such a protein.
8. A nucleotide sequence according to claim 7, wherein said protein is partially homologous with a protein selected by the method according to claim l or 2
9. A recombinant vector comprising a nucleotide sequence according to claim 7 or 8.
10. A recombinant cell expressing at least part of a nucleotide sequence according to claim 8.
11. A purified protein, produced by a recombinant cell according to claim 10.
12. A vaccine component for immunisation against a micro organism which can be killed by opsonophagocytic cells, said vaccine component comprising a protein according to claim 11, and/or an antigen obtainable by a method according to claim 1 or 2
13. A vaccine component according to claim 12, comprising at least a functional part of streptococcal lipoprotein rotamase A (SlrA) of Streptococcus pneumoniae.
14. A vaccine component according to claim 12, comprising at least a functional part of pneumococcal IgAl protease (IgAl) of Streptococcus pneumoniae.
15. A vaccine component according to claim 12, comprising at least a functional part of pneumococcal surface adhesion protein A (PsaA) of Streptococcus pneumoniae.
16. A vaccine component according to any of claims 12-15, also comprising at least a functional part of pneumococcal maturation protein A (Ppm A) of Streptococcus pneumoniae.
17. A vaccine comprising at least a combination of at least a functional part of pneumococcal maturation protein A (PpmA) or a protein which has more than 50% sequence similarity with said protein PpmA and at least a functional part of pneumococcal surface adhesion protein A (PssA) or a protein which has more than 50% sequence similarity with said protein PssA
18. A vaccine comprising at least one vaccine component according to any of claims 12 to 16, and/or a homologous and/or functionally homologous protein or protein fragment thereof for the treatment of an infection by a microorganism which can be killed by opsonophagocytic cells.
19. A vaccine according to claim 17 or 18, also comprising a pharmaceutically acceptable carrier and/or adjuvant.
20. A vaccine according to claim 19 wherein said adjuvant is obtained from bacterial cell wall material, more preferably wherein said adjuvant are ghosts, more preferably ghosts from Lactobacillus lactis.
21. A vaccine according to claim 20, wherein the vaccine component according to any of claims 12 to 16 is coupled to the ghost, preferably wherein the coupling is effected by a protein anchor, more preferably wherein said protein anchor is AcmA.
22. A method to produce an antibody comprising contacting an immune cell with at least one vaccine component according to any of claims 12-18.
23. An isolated antibody or a functional part or derivative thereof, obtainable by the method according to claim 22.
24. Use of an antibody according to claim 23 for the manufacture of a medical preparation.
25. A pharmaceutical preparation comprising an antibody against vaccine components according to claim 23.
26. Use of a vaccine according to any of claims 17 to 21 and/or a pharmaceutical preparation according to claim 26 for the treatment of an infection by a microorganism which can be killed by opsonophagocytic cells.
PCT/NL2004/000338 2003-05-16 2004-05-17 Method for selecting and producing vaccine components and vaccines based thereon WO2004102199A2 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
NZ543662A NZ543662A (en) 2003-05-16 2004-05-17 Streptococcus pneumoniae vaccine comprising pneumococcal maturation protein A (PpmA)
US10/556,733 US8142789B2 (en) 2003-05-16 2004-05-17 Method for selecting and producing vaccine components and vaccines based thereon
AU2004239596A AU2004239596B2 (en) 2003-05-16 2004-05-17 Method for selecting and producing vaccine components and vaccines based thereon
DK04733500.5T DK1625393T3 (en) 2003-05-16 2004-05-17 Vaccines that provide protection against infection of Streptococcus pneumonia
DE602004029565T DE602004029565D1 (en) 2003-05-16 2004-05-17 Vaccines that protect against Streptococcus pneumonia infections.
EP04733500A EP1625393B1 (en) 2003-05-16 2004-05-17 Vaccines conferring protection to infection by Streptococcus pneumonia.
CA2525766A CA2525766C (en) 2003-05-16 2004-05-17 Method for selecting and producing vaccine components and vaccines based thereon
AT04733500T ATE484744T1 (en) 2003-05-16 2004-05-17 VACCINES THAT PROTECT AGAINST STREPTOCOCCUS PNEUMONIA INFECTIONS.
US13/397,354 US9549974B2 (en) 2003-05-16 2012-02-15 Method for selecting and producing vaccine components and vaccines based thereon

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP03076492A EP1477802A1 (en) 2003-05-16 2003-05-16 Method for selecting and producing vaccine components and vaccines based thereon
EP03076492.2 2003-05-16

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US10/556,733 A-371-Of-International US8142789B2 (en) 2003-05-16 2004-05-17 Method for selecting and producing vaccine components and vaccines based thereon
US13/397,354 Division US9549974B2 (en) 2003-05-16 2012-02-15 Method for selecting and producing vaccine components and vaccines based thereon

Publications (2)

Publication Number Publication Date
WO2004102199A2 true WO2004102199A2 (en) 2004-11-25
WO2004102199A3 WO2004102199A3 (en) 2005-02-24

Family

ID=33016944

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/NL2004/000338 WO2004102199A2 (en) 2003-05-16 2004-05-17 Method for selecting and producing vaccine components and vaccines based thereon

Country Status (10)

Country Link
US (2) US8142789B2 (en)
EP (2) EP1477802A1 (en)
CN (1) CN100523809C (en)
AT (1) ATE484744T1 (en)
AU (1) AU2004239596B2 (en)
CA (1) CA2525766C (en)
DE (1) DE602004029565D1 (en)
DK (1) DK1625393T3 (en)
NZ (1) NZ543662A (en)
WO (1) WO2004102199A2 (en)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1746103A1 (en) 2005-07-20 2007-01-24 Applied NanoSystems B.V. Bifunctional protein anchors
EP2298342A3 (en) * 2006-11-20 2011-04-20 Intercell AG Peptides protective against s. pneumoniae and compositions, methods and uses relating thereto
WO2013191591A1 (en) 2012-06-22 2013-12-27 Epitope Limited (Epitope Ltd) Chimeric protein vaccine against pneumonia caused by streptococcus pneumoniae

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2005332058B2 (en) * 2005-05-19 2011-12-01 The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services, Centers For Disease Control And Prevention Functional epitopes of Streptococcus pneumoniae PsaA antigen and uses thereof
AU2012201107B2 (en) * 2005-05-19 2012-11-29 The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services, Centers For Disease Control And Prevention Functional epitopes of Streptococcus pneumoniae PsaA antigen and uses thereof
EP2343319A1 (en) * 2010-01-07 2011-07-13 University of Ljubljana Genetically modified food grade microorganism for treatment of inflammatory bowel disease
EP3415160B1 (en) * 2014-03-04 2021-08-18 Klinikum der Universität München Polypeptides derived from enterococcus and their use for vaccination and the generation of therapeutic antibodies
CN105101456B (en) * 2014-04-24 2019-05-07 阿尔卡特朗讯 A kind of method, equipment and system for internet of things equipment triggering
CN105968213A (en) * 2016-06-14 2016-09-28 长春百克生物科技股份公司 Streptococcus pneumonia fusion protein and vaccine thereof
CA3142740A1 (en) * 2019-06-07 2020-12-10 Flugen, Inc. Influenza virus backbone
CN110551703A (en) * 2019-09-10 2019-12-10 天津大学 Preparation and application methods of novel material BEM
US12091694B2 (en) 2022-11-18 2024-09-17 Seismic Therapeutic, Inc. Fc fusion molecules and uses thereof

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5976542A (en) * 1996-09-23 1999-11-02 New England Medical Center Compositions and methods for treatment of streptococcus pneumoniae infection
WO2000076541A1 (en) * 1999-06-10 2000-12-21 Uab Research Foundation Pneumococcal surface protein combination vaccine
EP1075841A1 (en) * 1999-08-13 2001-02-14 Erasmus Universiteit Rotterdam Pneumococcal vaccines
GB0022742D0 (en) * 2000-09-15 2000-11-01 Smithkline Beecham Biolog Vaccine
GB0107658D0 (en) * 2001-03-27 2001-05-16 Chiron Spa Streptococcus pneumoniae
WO2002101026A2 (en) * 2001-06-11 2002-12-19 Applied Nanosystems B.V. Methods for binding acma-type protein anchor fusions to cell-wall material of micro-organisms

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
OVERWEG ET AL., INFECTION AND IMMUNITY, vol. 68, no. 7, 2000, pages 4180 - 4188
ZVSK ET AL., INFECTION AND IMMUNITY, vol. 68, no. 6, 2000, pages 3740 - 3743

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1746103A1 (en) 2005-07-20 2007-01-24 Applied NanoSystems B.V. Bifunctional protein anchors
US9011870B2 (en) 2005-07-20 2015-04-21 Applied Nanosystems B.V. Bifunctional protein anchors
EP2298342A3 (en) * 2006-11-20 2011-04-20 Intercell AG Peptides protective against s. pneumoniae and compositions, methods and uses relating thereto
WO2013191591A1 (en) 2012-06-22 2013-12-27 Epitope Limited (Epitope Ltd) Chimeric protein vaccine against pneumonia caused by streptococcus pneumoniae
US9345757B2 (en) 2012-06-22 2016-05-24 Epitope Limited Chimeric protein vaccine against pneumonia caused by Streptococcus pneumoniae

Also Published As

Publication number Publication date
CN1806172A (en) 2006-07-19
EP1625393A2 (en) 2006-02-15
US8142789B2 (en) 2012-03-27
EP1625393B1 (en) 2010-10-13
CA2525766C (en) 2016-06-28
EP1477802A1 (en) 2004-11-17
DK1625393T3 (en) 2011-01-31
DE602004029565D1 (en) 2010-11-25
AU2004239596B2 (en) 2011-03-03
NZ543662A (en) 2009-03-31
WO2004102199A3 (en) 2005-02-24
CA2525766A1 (en) 2004-11-25
US20070082003A1 (en) 2007-04-12
US20120301501A1 (en) 2012-11-29
US9549974B2 (en) 2017-01-24
AU2004239596A1 (en) 2004-11-25
ATE484744T1 (en) 2010-10-15
CN100523809C (en) 2009-08-05

Similar Documents

Publication Publication Date Title
US9549974B2 (en) Method for selecting and producing vaccine components and vaccines based thereon
Hamel et al. Prevention of pneumococcal disease in mice immunized with conserved surface-accessible proteins
Miyaji et al. Serotype-independent pneumococcal vaccines
Alexander et al. Immunization of mice with pneumolysin toxoid confers a significant degree of protection against at least nine serotypes of Streptococcus pneumoniae
US20100278740A1 (en) Streptococcus pneumoniae proteins and nucleic acid molecules
US20060078565A1 (en) Nucleic acids and proteins from Group B Streptococcus
JP2009148283A (en) Streptococcus pneumoniae proteins and nucleic acid molecules
US8795690B2 (en) Protective proteins of S. agalactiae, combinations thereof and methods of using the same
Cole et al. Human pathogenic streptococcal proteomics and vaccine development
EP1075841A1 (en) Pneumococcal vaccines
US20180140693A1 (en) Group A Streptococcus Pharmaceutical Compositions and Methods Thereof
JP2017088612A (en) Group A Streptococcus multivalent vaccine
EP1100920A2 (en) Nucleic acids and proteins from group b streptococcus
WO2020201985A1 (en) Compositions and methods for eliciting an immune response against clostridium difficile
US20130243779A1 (en) Peptides protective against e. faecalis, methods and uses relating thereto
US9650425B2 (en) Group A streptococcal M-related proteins and methods of use
Lebogo Pre-clinical evaluation of pneumococcal vaccine candidate molecules in a mouse pneumococcal pneumonia model
WO2008127102A1 (en) S. pnuemoniae transcytosis protein
McCabe B anes
JP2004321010A (en) New streptococcal protein antigen
JP2004504056A (en) protein

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
ENP Entry into the national phase

Ref document number: 2525766

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2004239596

Country of ref document: AU

Ref document number: 543662

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: 2004733500

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2004239596

Country of ref document: AU

Date of ref document: 20040517

Kind code of ref document: A

WWP Wipo information: published in national office

Ref document number: 2004239596

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 20048168399

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: 2004733500

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2007082003

Country of ref document: US

Ref document number: 10556733

Country of ref document: US

WWP Wipo information: published in national office

Ref document number: 10556733

Country of ref document: US