WO2001070267A1 - Cross-reactive displacing antibodies from collagen-binding proteins and method of identification and use - Google Patents
Cross-reactive displacing antibodies from collagen-binding proteins and method of identification and use Download PDFInfo
- Publication number
- WO2001070267A1 WO2001070267A1 PCT/US2001/008554 US0108554W WO0170267A1 WO 2001070267 A1 WO2001070267 A1 WO 2001070267A1 US 0108554 W US0108554 W US 0108554W WO 0170267 A1 WO0170267 A1 WO 0170267A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- collagen
- bacteria
- aureus
- cna19
- Prior art date
Links
- 238000000034 method Methods 0.000 title claims abstract description 54
- 102000021124 collagen binding proteins Human genes 0.000 title description 7
- 108091011142 collagen binding proteins Proteins 0.000 title description 7
- 229920001436 collagen Polymers 0.000 claims abstract description 156
- 102000008186 Collagen Human genes 0.000 claims abstract description 125
- 108010035532 Collagen Proteins 0.000 claims abstract description 125
- 230000027455 binding Effects 0.000 claims abstract description 106
- 241000894006 Bacteria Species 0.000 claims abstract description 96
- 102100035348 Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform Human genes 0.000 claims abstract description 47
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 40
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 40
- 208000015181 infectious disease Diseases 0.000 claims abstract description 37
- 241000191963 Staphylococcus epidermidis Species 0.000 claims abstract description 33
- 238000006073 displacement reaction Methods 0.000 claims abstract description 28
- 230000000694 effects Effects 0.000 claims abstract description 21
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 claims abstract description 15
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 claims abstract description 15
- 210000002744 extracellular matrix Anatomy 0.000 claims abstract description 10
- 210000004027 cell Anatomy 0.000 claims description 60
- 241001465754 Metazoa Species 0.000 claims description 25
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 19
- 102000018697 Membrane Proteins Human genes 0.000 claims description 15
- 108010052285 Membrane Proteins Proteins 0.000 claims description 15
- 230000002401 inhibitory effect Effects 0.000 claims description 13
- 238000001990 intravenous administration Methods 0.000 claims description 7
- 239000008194 pharmaceutical composition Substances 0.000 claims description 6
- 239000003153 chemical reaction reagent Substances 0.000 claims description 4
- 238000002372 labelling Methods 0.000 claims description 4
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 3
- 238000007920 subcutaneous administration Methods 0.000 claims description 3
- 230000001939 inductive effect Effects 0.000 claims description 2
- 238000009007 Diagnostic Kit Methods 0.000 claims 3
- 238000003306 harvesting Methods 0.000 claims 2
- 230000028993 immune response Effects 0.000 claims 1
- 239000007787 solid Substances 0.000 claims 1
- 206010041925 Staphylococcal infections Diseases 0.000 abstract description 15
- 238000011282 treatment Methods 0.000 abstract description 9
- 241000894007 species Species 0.000 abstract description 7
- 241000191967 Staphylococcus aureus Species 0.000 abstract description 6
- 230000002265 prevention Effects 0.000 abstract description 3
- 108010077805 Bacterial Proteins Proteins 0.000 abstract 1
- 235000018102 proteins Nutrition 0.000 description 30
- 239000000203 mixture Substances 0.000 description 22
- 238000002965 ELISA Methods 0.000 description 20
- 239000002953 phosphate buffered saline Substances 0.000 description 20
- 241000699670 Mus sp. Species 0.000 description 18
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 18
- 210000004899 c-terminal region Anatomy 0.000 description 15
- 239000013615 primer Substances 0.000 description 15
- 230000009257 reactivity Effects 0.000 description 15
- 239000003446 ligand Substances 0.000 description 14
- 230000001580 bacterial effect Effects 0.000 description 13
- 230000005764 inhibitory process Effects 0.000 description 13
- 238000003752 polymerase chain reaction Methods 0.000 description 13
- 230000001965 increasing effect Effects 0.000 description 12
- 239000006228 supernatant Substances 0.000 description 12
- 241000588724 Escherichia coli Species 0.000 description 11
- 238000006243 chemical reaction Methods 0.000 description 11
- 102000004196 processed proteins & peptides Human genes 0.000 description 11
- 150000001413 amino acids Chemical class 0.000 description 10
- 210000004408 hybridoma Anatomy 0.000 description 10
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 9
- 238000005119 centrifugation Methods 0.000 description 9
- 239000012634 fragment Substances 0.000 description 9
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 8
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 8
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 8
- 239000002671 adjuvant Substances 0.000 description 8
- 229940098773 bovine serum albumin Drugs 0.000 description 8
- 238000002474 experimental method Methods 0.000 description 8
- 239000002609 medium Substances 0.000 description 8
- 239000008188 pellet Substances 0.000 description 8
- 239000000523 sample Substances 0.000 description 8
- 239000000126 substance Substances 0.000 description 8
- 238000012360 testing method Methods 0.000 description 8
- 229960005486 vaccine Drugs 0.000 description 8
- 238000012286 ELISA Assay Methods 0.000 description 7
- 241000699666 Mus <mouse, genus> Species 0.000 description 7
- 241000295644 Staphylococcaceae Species 0.000 description 7
- 235000001014 amino acid Nutrition 0.000 description 7
- 210000004369 blood Anatomy 0.000 description 7
- 239000008280 blood Substances 0.000 description 7
- 230000009260 cross reactivity Effects 0.000 description 7
- 238000011534 incubation Methods 0.000 description 7
- 230000003993 interaction Effects 0.000 description 7
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 241000283973 Oryctolagus cuniculus Species 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 239000000427 antigen Substances 0.000 description 6
- 102000036639 antigens Human genes 0.000 description 6
- 108091007433 antigens Proteins 0.000 description 6
- 238000003556 assay Methods 0.000 description 6
- 238000010790 dilution Methods 0.000 description 6
- 239000012895 dilution Substances 0.000 description 6
- 102000037865 fusion proteins Human genes 0.000 description 6
- 108020001507 fusion proteins Proteins 0.000 description 6
- 238000013507 mapping Methods 0.000 description 6
- 238000002360 preparation method Methods 0.000 description 6
- 238000000746 purification Methods 0.000 description 6
- 238000001262 western blot Methods 0.000 description 6
- 208000035143 Bacterial infection Diseases 0.000 description 5
- 101710196256 Collagen adhesin Proteins 0.000 description 5
- 125000000539 amino acid group Chemical group 0.000 description 5
- 208000022362 bacterial infectious disease Diseases 0.000 description 5
- 230000000903 blocking effect Effects 0.000 description 5
- 238000010367 cloning Methods 0.000 description 5
- 238000010494 dissociation reaction Methods 0.000 description 5
- 230000005593 dissociations Effects 0.000 description 5
- 210000001503 joint Anatomy 0.000 description 5
- 230000002829 reductive effect Effects 0.000 description 5
- 230000004083 survival effect Effects 0.000 description 5
- 210000001519 tissue Anatomy 0.000 description 5
- 238000005406 washing Methods 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- 102100027287 Serpin H1 Human genes 0.000 description 4
- 108050008290 Serpin H1 Proteins 0.000 description 4
- 241000191940 Staphylococcus Species 0.000 description 4
- 210000000845 cartilage Anatomy 0.000 description 4
- 238000012512 characterization method Methods 0.000 description 4
- 238000002983 circular dichroism Methods 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- UQLDLKMNUJERMK-UHFFFAOYSA-L di(octadecanoyloxy)lead Chemical compound [Pb+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O UQLDLKMNUJERMK-UHFFFAOYSA-L 0.000 description 4
- UVCJGUGAGLDPAA-UHFFFAOYSA-N ensulizole Chemical compound N1C2=CC(S(=O)(=O)O)=CC=C2N=C1C1=CC=CC=C1 UVCJGUGAGLDPAA-UHFFFAOYSA-N 0.000 description 4
- 239000007943 implant Substances 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- 239000003112 inhibitor Substances 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 238000002955 isolation Methods 0.000 description 4
- 238000005259 measurement Methods 0.000 description 4
- 229920009537 polybutylene succinate adipate Polymers 0.000 description 4
- 239000000047 product Substances 0.000 description 4
- 238000011160 research Methods 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 238000010186 staining Methods 0.000 description 4
- 239000000725 suspension Substances 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- 102000000503 Collagen Type II Human genes 0.000 description 3
- 108010041390 Collagen Type II Proteins 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 3
- 241001529936 Murinae Species 0.000 description 3
- 241000276498 Pollachius virens Species 0.000 description 3
- 208000027418 Wounds and injury Diseases 0.000 description 3
- 238000000246 agarose gel electrophoresis Methods 0.000 description 3
- 230000000890 antigenic effect Effects 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 229960002685 biotin Drugs 0.000 description 3
- 239000011616 biotin Substances 0.000 description 3
- 239000006161 blood agar Substances 0.000 description 3
- 210000000988 bone and bone Anatomy 0.000 description 3
- 238000010276 construction Methods 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 230000029087 digestion Effects 0.000 description 3
- 231100000673 dose–response relationship Toxicity 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 238000002649 immunization Methods 0.000 description 3
- 230000003053 immunization Effects 0.000 description 3
- 238000007918 intramuscular administration Methods 0.000 description 3
- 230000004807 localization Effects 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 3
- 229920000053 polysorbate 80 Polymers 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 108091008146 restriction endonucleases Proteins 0.000 description 3
- 238000012163 sequencing technique Methods 0.000 description 3
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 3
- 210000002435 tendon Anatomy 0.000 description 3
- 230000009466 transformation Effects 0.000 description 3
- 230000002792 vascular Effects 0.000 description 3
- 229920001817 Agar Polymers 0.000 description 2
- 206010053555 Arthritis bacterial Diseases 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 238000001712 DNA sequencing Methods 0.000 description 2
- 241000194032 Enterococcus faecalis Species 0.000 description 2
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 108060003951 Immunoglobulin Proteins 0.000 description 2
- 208000004575 Infectious Arthritis Diseases 0.000 description 2
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 2
- 241000186660 Lactobacillus Species 0.000 description 2
- 239000006142 Luria-Bertani Agar Substances 0.000 description 2
- 206010031252 Osteomyelitis Diseases 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- 108010076504 Protein Sorting Signals Proteins 0.000 description 2
- 239000012980 RPMI-1640 medium Substances 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 2
- 241000607447 Yersinia enterocolitica Species 0.000 description 2
- 230000001464 adherent effect Effects 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 239000008272 agar Substances 0.000 description 2
- 229960000723 ampicillin Drugs 0.000 description 2
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- 239000012620 biological material Substances 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 238000001142 circular dichroism spectrum Methods 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 239000006071 cream Substances 0.000 description 2
- 239000013078 crystal Substances 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000005538 encapsulation Methods 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 229940032049 enterococcus faecalis Drugs 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 239000012595 freezing medium Substances 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 210000003709 heart valve Anatomy 0.000 description 2
- 108010037896 heparin-binding hemagglutinin Proteins 0.000 description 2
- 238000003018 immunoassay Methods 0.000 description 2
- 102000018358 immunoglobulin Human genes 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 102000006495 integrins Human genes 0.000 description 2
- 108010044426 integrins Proteins 0.000 description 2
- 230000002452 interceptive effect Effects 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 108020004999 messenger RNA Proteins 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- 230000010399 physical interaction Effects 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 201000001223 septic arthritis Diseases 0.000 description 2
- 210000003491 skin Anatomy 0.000 description 2
- DAEPDZWVDSPTHF-UHFFFAOYSA-M sodium pyruvate Chemical compound [Na+].CC(=O)C([O-])=O DAEPDZWVDSPTHF-UHFFFAOYSA-M 0.000 description 2
- 210000000952 spleen Anatomy 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- 239000001974 tryptic soy broth Substances 0.000 description 2
- 108010050327 trypticase-soy broth Proteins 0.000 description 2
- 230000001018 virulence Effects 0.000 description 2
- 238000003260 vortexing Methods 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- ALSTYHKOOCGGFT-KTKRTIGZSA-N (9Z)-octadecen-1-ol Chemical compound CCCCCCCC\C=C/CCCCCCCCO ALSTYHKOOCGGFT-KTKRTIGZSA-N 0.000 description 1
- FJQZXCPWAGYPSD-UHFFFAOYSA-N 1,3,4,6-tetrachloro-3a,6a-diphenylimidazo[4,5-d]imidazole-2,5-dione Chemical compound ClN1C(=O)N(Cl)C2(C=3C=CC=CC=3)N(Cl)C(=O)N(Cl)C12C1=CC=CC=C1 FJQZXCPWAGYPSD-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- NKDFYOWSKOHCCO-YPVLXUMRSA-N 20-hydroxyecdysone Chemical compound C1[C@@H](O)[C@@H](O)C[C@]2(C)[C@@H](CC[C@@]3([C@@H]([C@@](C)(O)[C@H](O)CCC(C)(O)C)CC[C@]33O)C)C3=CC(=O)[C@@H]21 NKDFYOWSKOHCCO-YPVLXUMRSA-N 0.000 description 1
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 1
- 108010042708 Acetylmuramyl-Alanyl-Isoglutamine Proteins 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 108010032595 Antibody Binding Sites Proteins 0.000 description 1
- 240000003291 Armoracia rusticana Species 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 238000011725 BALB/c mouse Methods 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical class OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 239000003155 DNA primer Substances 0.000 description 1
- 102000004237 Decorin Human genes 0.000 description 1
- 108090000738 Decorin Proteins 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 102100031780 Endonuclease Human genes 0.000 description 1
- 102000016359 Fibronectins Human genes 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 241000192125 Firmicutes Species 0.000 description 1
- 208000010412 Glaucoma Diseases 0.000 description 1
- HVIBGVJOBJJPFB-OFQRNFBNSA-N Gly-Pro-Hyp Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)C(O)CC1 HVIBGVJOBJJPFB-OFQRNFBNSA-N 0.000 description 1
- OOCFXNOVSLSHAB-IUCAKERBSA-N Gly-Pro-Pro Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 OOCFXNOVSLSHAB-IUCAKERBSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 241000588747 Klebsiella pneumoniae Species 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- 229930182816 L-glutamine Natural products 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 239000012807 PCR reagent Substances 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 108010002747 Pfu DNA polymerase Proteins 0.000 description 1
- 108010053210 Phycocyanin Proteins 0.000 description 1
- 108010004729 Phycoerythrin Proteins 0.000 description 1
- 206010035664 Pneumonia Diseases 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 102000006382 Ribonucleases Human genes 0.000 description 1
- 108010083644 Ribonucleases Proteins 0.000 description 1
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 241000194026 Streptococcus gordonii Species 0.000 description 1
- 241000194019 Streptococcus mutans Species 0.000 description 1
- 241001505901 Streptococcus sp. 'group A' Species 0.000 description 1
- 108060008245 Thrombospondin Proteins 0.000 description 1
- 102000002938 Thrombospondin Human genes 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 206010048038 Wound infection Diseases 0.000 description 1
- UZQJVUCHXGYFLQ-AYDHOLPZSA-N [(2s,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-4-[(2r,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-3,5-dihydroxy-6-(hydroxymethyl)-4-[(2s,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]oxy-3,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-3,5-dihydroxy-6-(hy Chemical compound O([C@H]1[C@H](O)[C@@H](CO)O[C@H]([C@@H]1O)O[C@H]1[C@H](O)[C@@H](CO)O[C@H]([C@@H]1O)O[C@H]1CC[C@]2(C)[C@H]3CC=C4[C@@]([C@@]3(CC[C@H]2[C@@]1(C=O)C)C)(C)CC(O)[C@]1(CCC(CC14)(C)C)C(=O)O[C@H]1[C@@H]([C@@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O[C@H]4[C@@H]([C@@H](O[C@H]5[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O5)O)[C@H](O)[C@@H](CO)O4)O)[C@H](O)[C@@H](CO)O3)O)[C@H](O)[C@@H](CO)O2)O)[C@H](O)[C@@H](CO)O1)O)[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O UZQJVUCHXGYFLQ-AYDHOLPZSA-N 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 239000002250 absorbent Substances 0.000 description 1
- 230000002745 absorbent Effects 0.000 description 1
- 230000004308 accommodation Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 239000000853 adhesive Substances 0.000 description 1
- 230000001070 adhesive effect Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 108010004469 allophycocyanin Proteins 0.000 description 1
- 229940037003 alum Drugs 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- 229960003896 aminopterin Drugs 0.000 description 1
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 238000002399 angioplasty Methods 0.000 description 1
- 210000002159 anterior chamber Anatomy 0.000 description 1
- 238000011091 antibody purification Methods 0.000 description 1
- 238000000376 autoradiography Methods 0.000 description 1
- 230000029586 bacterial cell surface binding Effects 0.000 description 1
- 244000052616 bacterial pathogen Species 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- RIIWUGSYXOBDMC-UHFFFAOYSA-N benzene-1,2-diamine;hydron;dichloride Chemical compound Cl.Cl.NC1=CC=CC=C1N RIIWUGSYXOBDMC-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- 230000008033 biological extinction Effects 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 238000010805 cDNA synthesis kit Methods 0.000 description 1
- 244000309466 calf Species 0.000 description 1
- 235000011089 carbon dioxide Nutrition 0.000 description 1
- 230000000747 cardiac effect Effects 0.000 description 1
- 230000021164 cell adhesion Effects 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000012292 cell migration Effects 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 238000004891 communication Methods 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 230000001268 conjugating effect Effects 0.000 description 1
- 239000012050 conventional carrier Substances 0.000 description 1
- 238000003235 crystal violet staining Methods 0.000 description 1
- 238000002425 crystallisation Methods 0.000 description 1
- 230000008025 crystallization Effects 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 210000005220 cytoplasmic tail Anatomy 0.000 description 1
- 239000001064 degrader Substances 0.000 description 1
- 210000000852 deltoid muscle Anatomy 0.000 description 1
- 239000004053 dental implant Substances 0.000 description 1
- 230000014670 detection of bacterium Effects 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 238000013104 docking experiment Methods 0.000 description 1
- 239000006196 drop Substances 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 239000003221 ear drop Substances 0.000 description 1
- 229940047652 ear drops Drugs 0.000 description 1
- 239000003974 emollient agent Substances 0.000 description 1
- 206010014665 endocarditis Diseases 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 1
- 229960005542 ethidium bromide Drugs 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 238000013401 experimental design Methods 0.000 description 1
- 239000003889 eye drop Substances 0.000 description 1
- 229940012356 eye drops Drugs 0.000 description 1
- 230000001815 facial effect Effects 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- 238000001730 gamma-ray spectroscopy Methods 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 108010017349 glycyl-prolyl-hydroxyproline Proteins 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 238000010820 immunofluorescence microscopy Methods 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 230000009851 immunogenic response Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 239000002054 inoculum Substances 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- 210000000867 larynx Anatomy 0.000 description 1
- 238000013147 laser angioplasty Methods 0.000 description 1
- 239000004816 latex Substances 0.000 description 1
- 229920000126 latex Polymers 0.000 description 1
- 231100000518 lethal Toxicity 0.000 description 1
- 230000001665 lethal effect Effects 0.000 description 1
- 210000003041 ligament Anatomy 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 230000004784 molecular pathogenesis Effects 0.000 description 1
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 1
- 239000002324 mouth wash Substances 0.000 description 1
- 229940051866 mouthwash Drugs 0.000 description 1
- BSOQXXWZTUDTEL-ZUYCGGNHSA-N muramyl dipeptide Chemical compound OC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@H]1[C@H](O)[C@@H](CO)O[C@@H](O)[C@@H]1NC(C)=O BSOQXXWZTUDTEL-ZUYCGGNHSA-N 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 210000000492 nasalseptum Anatomy 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 150000007523 nucleic acids Chemical group 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 239000003883 ointment base Substances 0.000 description 1
- 229940055577 oleyl alcohol Drugs 0.000 description 1
- XMLQWXUVTXCDDL-UHFFFAOYSA-N oleyl alcohol Natural products CCCCCCC=CCCCCCCCCCCO XMLQWXUVTXCDDL-UHFFFAOYSA-N 0.000 description 1
- 238000010915 one-step procedure Methods 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 229920000515 polycarbonate Polymers 0.000 description 1
- 239000004417 polycarbonate Substances 0.000 description 1
- 229940057838 polyethylene glycol 4000 Drugs 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 239000003725 proteoliposome Substances 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 239000001397 quillaja saponaria molina bark Substances 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000011552 rat model Methods 0.000 description 1
- 230000003252 repetitive effect Effects 0.000 description 1
- 230000002207 retinal effect Effects 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 102200154559 rs587776904 Human genes 0.000 description 1
- 210000003296 saliva Anatomy 0.000 description 1
- 229930182490 saponin Natural products 0.000 description 1
- 150000007949 saponins Chemical class 0.000 description 1
- 238000013341 scale-up Methods 0.000 description 1
- 238000003345 scintillation counting Methods 0.000 description 1
- 238000007790 scraping Methods 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 239000012679 serum free medium Substances 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 239000007974 sodium acetate buffer Substances 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229940054269 sodium pyruvate Drugs 0.000 description 1
- 159000000000 sodium salts Chemical class 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 238000011895 specific detection Methods 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 208000010110 spontaneous platelet aggregation Diseases 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000012916 structural analysis Methods 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- MPLHNVLQVRSVEE-UHFFFAOYSA-N texas red Chemical compound [O-]S(=O)(=O)C1=CC(S(Cl)(=O)=O)=CC=C1C(C1=CC=2CCCN3CCCC(C=23)=C1O1)=C2C1=C(CCC1)C3=[N+]1CCCC3=C2 MPLHNVLQVRSVEE-UHFFFAOYSA-N 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 210000000515 tooth Anatomy 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 239000012049 topical pharmaceutical composition Substances 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 230000002485 urinary effect Effects 0.000 description 1
- 238000002255 vaccination Methods 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 230000002861 ventricular Effects 0.000 description 1
- 230000007923 virulence factor Effects 0.000 description 1
- 239000000304 virulence factor Substances 0.000 description 1
- 108010047303 von Willebrand Factor Proteins 0.000 description 1
- 102100036537 von Willebrand factor Human genes 0.000 description 1
- 229960001134 von willebrand factor Drugs 0.000 description 1
- 238000002424 x-ray crystallography Methods 0.000 description 1
- 229940098232 yersinia enterocolitica Drugs 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/12—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria
- C07K16/1267—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria from Gram-positive bacteria
- C07K16/1271—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria from Gram-positive bacteria from Micrococcaceae (F), e.g. Staphylococcus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/085—Staphylococcus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56911—Bacteria
- G01N33/56938—Staphylococcus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/195—Assays involving biological materials from specific organisms or of a specific nature from bacteria
- G01N2333/305—Assays involving biological materials from specific organisms or of a specific nature from bacteria from Micrococcaceae (F)
- G01N2333/31—Assays involving biological materials from specific organisms or of a specific nature from bacteria from Micrococcaceae (F) from Staphylococcus (G)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/78—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin, cold insoluble globulin [CIG]
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
Definitions
- the present invention relates in general to displacing antibodies which can inhibit collagen binding to Staphylococcus aureus bacteria and to methods for developing and utilizing displacing antibodies, and in particular to antibodies to CNA, the collagen adhesin of Staphylococcus aureus, and its subregions, which are cross-reactive to multiple strains of S. aureus and to S. epidermidis, and which can be used to inhibit collagen binding to S. aureus and in a variety of compositions and methods for the therapeutic or preventive treatment of infections from S. aureus and S. epidermidis.
- Staphylococcus aureus is a bacterial pathogen that is capable of colonizing a wide range of host tissues and causing infections such as endocarditis, wound infections, pneumonia, osteomyelitis and septic arthritis. The initial attachment and colonization on host tissues is thought to be the first crucial step in the disease development.
- Staphylococci produce a family of surface proteins named MSCRAMMs (Microbial Surface Component Recognizing Adhesive Matrix Molecules) that mediate adherence to extracellular matrix (ECM) proteins.
- ECM extracellular matrix
- Collagen is a major ECM protein and is the main component of tissues such as skin, bone, tendon, cartilage and teeth. It is conceivable that the S. aureus developed strategies to utilize collagen as a way to colonize host tissues.
- collagen-adhesins include certain strains of Escherichia coli (5), Yersinia enterocolitica (6-8), Klebsiella pneumoniae (9), Streptococcus mutans (10,11), group A streptococci (12), Streptococcus gordonii (11 ,13), Enterococcus faecalis (14), Lactobacilli reuteri (15) and Lactobacilli crispatus (T. K. Korhonen, personal communication).
- the collagen-adhesin YadA was shown to contribute to the arthritogenicity of Y. enterocolitica in a rat model (16).
- CNA recognized triple helical collagen as well as some synthetic peptides that formed a collagen-like triple helix (18).
- CNA was found to contain typical elements of surface proteins of gram- positive bacteria. It consists of a signal peptide, a non-repetitive A domain, several repeats (B domains), followed by a cell-wall anchor region, a transmembrane segment and a short cytoplasmic tail.
- the A domain of CNA (CNA55) was found to be fully responsible for the collagen-binding activity of CNA (19).
- the minimum binding domain was localized to a 19 kDa fragment, CNA19 (formerly designated CBD (151-318)), within CNA55 (19).
- CBD 151-318
- the N-terminal truncate contains all but 6 of the residues in the trench and the C-terminal truncate contains all the residues, suggesting that the intact CNA19 molecule is important in presenting the trench in an active collagen-binding
- using a trench structure as the site of interaction for collagen may be a general theme.
- ACE collagen-adhesin
- monoclonal antibodies that were capable of inhibiting the binding of staphylococcal bacteria to host cells are provided, and in addition, antibodies to CNA19 which can recognize S. aureus as well as S. epidermidis are provided in accordance with the invention.
- the present invention since it was shown that recognition was conformation-dependent, the present invention includes chimeric proteins between CNA19 and a segment of the ACE A domain that were generated and used successfully to map epitopes within CNA19 which were functionally relevant.
- CNA19 mAbs have inhibitory effects on an S. aureus strain binding to soluble collagen as well as attachment to immobilized collagen.
- some of these antibodies have exhibited displacing behavior and thus these antibodies could effectively release S. aureus from preformed collagen-bacteria complexes as well as detach S. aureus from the surface of immobilized collagen.
- a model of the interactions between collagen and the different conformational states of CNA19 and contemplated clinical applications of these displacing mAbs as therapeutic agents is also provided in accordance with the invention.
- murine monoclonal antibodies generated against CNA19 from S. aureus in accordance with the present invention have been shown to be cross-reactive in that they recognized 5 different clinical isolates of S. epidermidis and thus may be useful in developing antibody compositions that are effective in preventing or treating infections from more than one species of Staphylococcal bacteria.
- the present invention relates to the discovery of a class of displacing antibodies which can be isolated and utilized in methods of treating or preventing bacterial infection.
- the invention provides a method for identifying and isolating displacing antibodies and for antibodies identified and isolated by the present method.
- antibodies raised against the CNA19 region of the collagen binding domain are provided and can be utilized in cross-reactive methods of treating or preventing bacterial infections from more than one species of bacteria, such as S. aureus and S. epidermidis, along with compositions containing said antibodies, diagnostic test kits which contain the appropriate antibodies or antisera raised against CNA19 or other regions of the collagen binding protein which can enable one to identify these bacteria in infections.
- FIG. 2A Sequence alignment of CNA19 and ACE19. ClustalW with default parameters was used. Shaded amino acid residues were identical
- ⁇ -strands A, B, a part of D, E and H are the ones that
- FIG. 2B Schematic illustration of the chimeras. CNA19 sequences were represented by shaded bars while ACE 19 by blank bars. Dark-shaded
- FIG. 1 Summary of the localization of CNA19 epitopes recognized by the mAbs. Horizontal lines beneath CNA19 represent regions where various mAbs were mapped, numbers above each line indicate number of mAbs in the region. The number for the central region includes 16H9, but does not include anti-His tag mAb 7E8.
- FIG. 4 Effect of anti-CNA19 mAbs on 125 l-collagen binding to S. aureus Cowan 1.
- S. aureus Cowan 1 (5 x 10 8 cells) were pre-incubated with the indicated amounts of each mAb prior to the addition of 1 5 l-collagen (5x10 4 cpm). Collagen binding was quantitated as described under "Experimental Procedures”. Values are expressed as percentage of the ligand binding in the absence of mAb. Results are expressed as mean ⁇ standard deviation of duplicate measurements.
- Figure 7 Displacement of 125 l-collagen from collagen-bacteria complex.
- S. aureus Cowan I cells (5x10 8 ) were pre-incubated with 125 l-collagen (5x10 4 cpm) for 1 h. After centrifugation, bacteria-collagen complex was resuspended, and the indicated amounts of each mAb were added to the suspension and further incubated for 1 h. The amount of the residual
- FIG 8A Dose-dependent displacement of 125 l-collagen from collagen-staphylococci complex by mAbs. S. aureus cells were pre- incubated with 125 l-collagen as reported in Figure 7. Increasing amounts of indicated mAb were added to the bacteria-collagen complexes and incubated for 1 h. Residual 125 l-collagen associated with bacteria was
- FIG 8B Displacement of S. aureus cells adherent to immobilized collagen by mAbs.
- S. aureus Cowan 1 cells were allowed to adhere to collagen coated plates. After washing, the indicated amounts of mAbs were added to the wells and incubated for 2 h. After extensive washing, the number of residual attached bacteria was quantitated by using peroxidase- conjugated rabbit anti-mouse IgG as reported in "Experimental Procedures". Data are expressed as percentage of attached bacteria in the absence of mAbs. The values are averages of incubations performed in duplicate.
- FIG. 9 Cross-reactivity of monoclonal antibodies generated against S. aureus CNA19.
- Cross-reactivity of monoclonal antibodies raised against S. aureus CNA19 was established via ELISA screening showing recognition of intact S. epidermidis.
- the graphs in this figure reflect this recognition by measuring binding of monoclonal antibodies generated against CNA19 to the five S. epidermidis strains.
- Mab 11H11 recognized 5 different clinical isolates of S. epidermidis.
- Figure 10 Survival plot for animals treated with the 9G3 monoclonal antibody in accordance with the present invention versus untreated animals.
- FIG. 11 Survival plot for animals treated with the 3B12 monoclonal antibody in accordance with the present invention versus untreated animals.
- Figures 12A and 12B Inhibition of S. aureus cells adherence to immobilized collagen by mAbs generated against CNA19 (CBD 151-318).
- Figure 13 Displacement of 125 l-collagen from S. aureus cells by mAbs generated against CNA19 (CBD 151-318).
- FIGS 14A-14C Displacement of S. aureus cells bound to immobilized collagen by mAbs generated against CNA19 (CBD 151-318).
- FIG. 15A ELISA analysis of immobilized GST-CNA fusion protein derivatives with mAbs 2B8 and 16H9 and a polyclonal antibody raised against CBD (151-318).
- Figure 15B Mapping of epitope for mAbs 2B8 and 16H9 by using chimeras consisting of segments of ACE19 (174-319) and CNA19 (151-318).
- Figure 15C Inhibitory activity of mAbs generated against CBD (30-529) on the collagen binding to S. aureus Cowan 1.
- Figure 15D Displacement of 125 l-collagen from S. aureus Cowan 1 by mAbs 1A11 and 2B8.
- Figure 15E Inhibition of 125 l-collagen from S. aureus Cowan 1 by mAbs 1A11 and 2B8.
- Figures 16A-16D are histogram representations which illustrate the staining profiles reflecting recognition of four different strains by monoclonal antibody designated 3B12 at 3hr and overnight culture time points with each monoclonal.
- the CNA protein in staphylococcal bacteria is a collagen-binding adhesin that allows the bacteria to target and bind to collagen in the extracellular matrix of host cells, and is thus a very important protein with regard to the colonization and multiplication of bacteria cells that can infect human and animal patients, and even colonize and affect medical instruments and prosthetic devices.
- the protein sequence of CNA which is expressed by 60% of staphylococcal bacteria, is virtually identical across the great range of strains that express this protein, and there is little or no variation among the various strains with regard to CNA sequence.
- a monoclonal antibody generated to the CNA protein will be of tremendous value since unlike many other monoclonals which are very specific to a particular antigen and its sequence, a monoclonal antibody generated against the CNA protein will be extremely versatile in that it will recognize and protect
- the present invention relates to an isolated and/or
- CNA protein of S. aureus will be useful in the prevention and treatment of
- antibodies to CNA19 these antibodies may be generated against natural
- isolated and purified CNA19 may be generated against
- aureus strains such as S. aureus strain Cowan I, or any of those strains
- S. aureus strain utilized in accordance with the invention be one which is known to bind to collagen.
- antibodies to the CNA19 motif of the CNA protein's collagen binding domain may be prepared in a number of suitable ways that would be well known in the art, such as the well-established Kohler and Milstein method (29) which can be utilized to generate monoclonal antibodies to CNA19.
- mice are injected intraperitoneally once a weeks for a prolonged period with a purified recombinant CNA19 domain, followed by a test of blood obtained from the immunized mice to determine reactivity to the purified CNA19 peptide.
- lymphocytes isolated from mouse spleens are fused to mouse myeloma cells to produce hybridomas positive for the antibodies against CNA19 which are then isolated and cultured, following by purification and isotyping.
- monoclonal antibodies in accordance with the invention, it is preferred that these be generated using recombinantly prepared CNA19 peptides in conventional methods well known in the art.
- one such method employs the use of E. coli strain JM101 as a host and pQE-30 as an expression vector for cloning and expressing recombinant proteins and peptides.
- DNA preparation, purification, restriction digestion, agarose gel electrophoresis and ligation may be performed using standard methods, and the resulting recombinant CNA19 segments may be isolated and purified and then utilized to generate monoclonal antibodies in the manner described above.
- polyclonal antibodies from CNA19 as well.
- Such polyclonal antibodies may be generated in any of a number of suitable ways well known in the art, such as the introduction of a purified CNA19 peptide into a suitable animal host, followed by isolation and purification of the generated antibodies produced in the host animal.
- antibodies may be generated from natural isolated and purified CNA19 as well, and monoclonal or polyclonal antibodies can be generated using the natural CNA19 in the same manner as described above to obtain such antibodies.
- numerous other ways to generate the antibodies in accordance with the invention are possible, including expressing the whole CNA protein recombinantly and then isolating the CNA19 region from the isolated CNA protein. Still other conventional ways would be available to generate the CNA19 antibodies of the present invention using recombinant or natural purified CNA19, as would be recognized by one of ordinary skill in this art.
- the antibodies of the present invention may also be formed into suitable pharmaceutical compositions for administration to a human or animal patient in order to treat or prevent an infection caused by staphylococcal bacteria such as S. aureus or S. epidermidis.
- Pharmaceutical compositions containing the antibodies of the present invention, or effective fragments thereof, may be formulated in combination with any suitable pharmaceutical vehicle, excipient or carrier that would commonly be used in this art, including such as saline, dextrose, water, glycerol, ethanol, other therapeutic compounds, and combinations thereof.
- any pharmaceutical composition disclosed in this application include, but are not limited to, topical, oral, anal, vaginal, intravenous, intraperitoneal, intramuscular, subcutaneous, intranasal and intradermal administration.
- the composition is formulated in the form of an ointment, cream, gel, lotion, drops (such as eye drops and ear drops), or solution (such as mouthwash). Wound or surgical dressings, sutures and aerosols may be impregnated with the composition.
- the composition may contain conventional additives, such as preservatives, solvents to promote penetration, and emollients. Topical formulations may also contain conventional carriers such as cream or ointment bases, ethanol, or oleyl alcohol.
- the antibody compositions of the present invention which are generated against the CNA19 or minimal collagen binding region of the CNA protein of S. aureus, yet which are also effective against S. epidermidis, may also be administered with a suitable adjuvant in an amount effective to enhance the immunogenic response against the conjugate.
- a suitable adjuvant in an amount effective to enhance the immunogenic response against the conjugate.
- the only adjuvant widely used in humans has been alum (aluminum phosphate or aluminum hydroxide).
- Saponin and its purified component Quil A, Freund's complete adjuvant and other adjuvants used in research and veterinary applications have toxicities which limit their potential use in human vaccines.
- the antibody compositions of the present invention will thus be useful for interfering with, modulating, inhibiting binding interactions between staphylococcal bacteria and collagen on host cells, or in displacing staphylococcal bacteria which has become bound to the collagen on host cells.
- methods for preventing or treating a staphylococcal infection which comprise administering an effective amount of an antibody to CNA19 as described above in amounts effective to treat or prevent the infection.
- the CNA19 antibodies have been observed to exhibit an ability to displace S. aureus bacteria that are bound to collagen, such as the collagen in the extracellular matrix of host cells, and thus one of the advantageous aspects of the present invention is the provision of a method and a composition which can be utilized to fight a standing infection of staphylococcal bacteria such as S. aureus and S. epidermidis because the CNA19 antibodies of the present invention will displace the bacteria from collagen in the host cells.
- administering in any of the conventional ways described above (e.g., topical, parenteral, intramuscular, etc.) will be useful in displacing staphylococcal infections in a manner not heretofore possible, and will thus provide an extremely useful method of treating staphylococcal infections in human or animal patients.
- effective amount is meant that level of antibody titer that will be sufficient to either inhibit binding of staph bacteria to host cells, or, in the case of a prior infection, that amount that will be sufficient to displace bacteria from the host cells so as to treat the infection.
- the level of antibody titer needed to be effective in treating or preventing staphylococcal infection will vary depending on the nature and condition of the patient, and/or the severity of the pre-existing staphylococcal infection.
- the isolated antibodies in accordance with the present invention which show displacing activity to binding sites such that they will displace proteins already bound to such sites can thus be administered to humans or animals, either alone or in combination with an adjuvant, in a number of suitable ways conventionally used to treat or prevent a staphylococcal infection.
- the present invention contemplates the use of these antibodies in a variety of ways, including the detection of the presence of Staphylococcal bacteria such as S. aureus or S. epidermidis and thus using antibodies to diagnose a staph infection, whether in a patient or on medical equipment which may also become infected.
- a preferred method of detecting the presence of staph infections involves the steps of obtaining a sample suspected of being infected by one or more staphylococcal bacteria species or strains, such as a sample taken from an individual, for example, from one's blood, saliva, tissues, bone, muscle, cartilage, or skin.
- the cells can then be lysed, and the DNA extracted, precipitated and amplified.
- diagnostic assays utilizing the antibodies of the present invention may be carried out to detect the present of staph bacteria, including S. aureus or S. epidermidis, and such assay techniques for determining such presence in a sample are well known to those skilled in the art and include methods such as radioimmunoasssay, Western blot analysis and ELISA assays.
- antibodies in accordance with the invention may be used for the specific detection of staphylococcal collagen-binding proteins, for the prevention of infection from staph bacteria, for the treatment of an ongoing infection, or for use as research tools.
- the term "antibodies” as used herein includes monoclonal, polyclonal, chimeric, single chain, bispecific, simianized, and humanized or primatized antibodies as well as Fab fragments, including the products of an Fab immunoglobulin expression library. Generation of any of these types of antibodies or antibody fragments is well known to those skilled in the art.
- polyclonal antiserum against CNA19 has been generated which reacts with CNA19 in Western immunoblots and ELISA assays and interferes with binding to collagen.
- Any of the above described antibodies may be labeled directly with a detectable label for identification and quantification of staph bacteria.
- Labels for use in immunoassays are generally known to those skilled in the art and include enzymes, radioisotopes, and fluorescent, luminescent and chromogenic substances, including colored particles such as colloidal gold or latex beads.
- Suitable immunoassays include enzyme-linked immunosorbent assays (ELISA).
- the antibody may be labeled indirectly by reaction with labeled substances that have an affinity for immunoglobulin.
- the antibody may be conjugated with a second substance and detected with a labeled third substance having an affinity for the second substance conjugated to the antibody.
- the antibody may be conjugated to biotin and the antibody-biotin conjugate detected using labeled avidin or streptavidin.
- the antibody may be conjugated to a hapten and the antibody- hapten conjugate detected using labeled anti-hapten antibody.
- Antibodies to the collagen-binding protein domain CNA19 may also be used in production facilities or laboratories to isolate additional quantities of the proteins, such as by affinity chromatography.
- the antibodies of the invention may also be utilized to isolate additional amounts of collagen.
- the isolated antibodies of the present invention may also be utilized in the development of vaccines for passive immunization against staph infections.
- the antibodies of the present invention when administered as pharmaceutical composition to a wound or used to coat medical devices or polymeric biomaterials in vitro and in vivo, the antibodies of the present invention, since they exhibit displacing behavior, are especially useful in those cases where there is a previous staph infection already present since these antibodies will function to displace this bacterial infection.
- the antibody may be modified as necessary so that, in certain instances, it is less immunogenic in the patient to whom it is administered.
- the antibody may be "humanized” by transplanting the complimentarity determining regions of the hybridoma-derived antibody into a human monoclonal antibody as described, e.g., by Jones et al., Nature 321 :522-525 (1986) or Tempest et al. Biotechnology 9:266-273 (1991).
- Medical devices or polymeric biomaterials to be coated with the antibodies, proteins and active fragments described herein include, but are not limited to, staples, sutures, replacement heart valves, cardiac assist devices, hard and soft contact lenses, intraocular lens implants (anterior chamber or posterior chamber), other implants such as corneal inlays, kerato-prostheses, vascular stents, epikeratophalia devices, glaucoma shunts, retinal staples, scleral buckles, dental prostheses, thyroplastic devices, laryngoplastic devices, vascular grafts, soft and hard tissue prostheses including, but not limited to, pumps, electrical devices including stimulators and recorders, auditory prostheses, pacemakers, artificial larynx, dental implants, mammary implants, penile implants, cranio/facial tendons, artificial joints, tendons, ligaments, menisci, and disks, artificial bones, artificial organs including artificial pancreas, artificial hearts, artificial limbs, and heart valves;
- coated means to apply the antibody or active fragment, or pharmaceutical composition derived therefrom, to a surface of the device, preferably an outer surface that would be exposed to streptococcal bacterial infection.
- the surface of the device need not be entirely covered by the protein, antibody or active fragment.
- the antibodies may also be used as a passive vaccine which will be useful in providing suitable antibodies to treat or prevent a staphylococcal infection.
- a vaccine may be packaged for administration in a number of suitable ways, such as by parenteral (i.e., intramuscular, intradermal or subcutaneous) administration or nasopharyngeal (i.e., intranasal) administration. It is generally preferred that the vaccine be injected intramuscularly into the deltoid muscle, however, the particular mode of administration will depend on the nature of the bacterial infection to be dealt with and the condition of the patient.
- the vaccine is preferably combined with a pharmaceutically acceptable carrier to facilitate administration, and the carrier is usually water or a buffered saline, with or without a preservative.
- the vaccine may be lyophilized for resuspension at the time of administration or in solution.
- an "effective amount" of antibody or pharmaceutical agent to be used in accordance with the invention is intended to mean a nontoxic but sufficient amount of the agent, such that the desired prophylactic or therapeutic effect is produced.
- the exact amount of the antibody or a particular agent that is required will vary from subject to subject, depending on the species, age, and general condition of the subject, the severity of the condition being treated, the particular carrier or adjuvant being used and its mode of administration, and the like. Accordingly, the "effective amount" of any particular antibody composition will vary based on the particular circumstances.
- compositions in accordance with the invention contain from about 0.5 to 75 mg/kg of a CNA19 antibody in accordance with the invention, with about 5 to 30 mg/kg range being a more common desired range of level of antibody. Based on this range, equivalent dosages for heavier body weights can be determined.
- the dose should be adjusted to suit the individual to whom the composition is administered and will vary with age, weight and metabolism of the individual.
- the compositions may additionally contain stabilizers or pharmaceutically acceptable preservatives, such as thimerosal (ethyl(2- mercaptobenzoate-S)mercu ⁇ y sodium salt) (Sigma Chemical Company, St. Louis, MO).
- the monoclonal antibodies described herein are useful for purposes such as in vivo and in vitro diagnosis of staphylococcal infections or detection of staphylococcal bacteria. Laboratory research may also be facilitated through use of such antibodies.
- Various types of labels and methods of conjugating the labels to the antibodies of the invention are well known to those skilled in the art, such as the ones set forth below.
- the antibody can be conjugated to a radiolabel such as, but not restricted to, 32 P, 3 H, 14 C, 35 S, 125 l, or 131 l. Detection of a label can be by methods such as scintillation counting, gamma ray spectrometry or autoradiography.
- Bioluminescent labels such as derivatives of firefly luciferin, are also useful.
- the bioluminescent substance is covalently bound to the protein by conventional methods, and the labeled protein is detected when an enzyme, such as luciferase, catalyzes a reaction with ATP causing the bioluminescent molecule to emit photons of light.
- Fluorogens may also be used to label proteins. Examples of fluorogens include fluorescein and derivatives, phycoerythrin, allo-phycocyanin, phycocyanin, rhodamine, and Texas Red. The fluorogens are generally detected by a fluorescence detector.
- the location of a ligand in cells can be determined by labeling an antibody as described above and detecting the label in accordance with methods well known to those skilled in the art, such as immunofluorescence microscopy using procedures such as those described by Warren and Nelson (Mol. Cell. Biol., 7: 1326-1337, 1987).
- the monoclonal antibodies of the present invention are particularly useful for interfering with the initial physical interaction between a staphylococcal pathogen responsible for infection and a mammalian host, such as the adhesion of the bacteria to mammalian extracellular matrix proteins such as collagen, and this interference with the physical interaction may be useful both in treating patients and in preventing or reducing bacteria infection on in-dwelling medical devices to make them safer for use.
- a kit will typically include a suitable container for housing the antibodies in a suitable form along with a suitable immunodetection reagent which will allow identification of complexes binding to the CNA19 antibodies of the invention.
- the immunodetection reagent may comprise a suitable detectable signal or label, such as a biotin or enzyme that produces a detectable color, etc., which normally may be linked to the antibody or which can be utilized in other suitable ways so as to provide a detectable result when the antibody binds to the antigen.
- a suitable detectable signal or label such as a biotin or enzyme that produces a detectable color, etc.
- the antibodies of the present invention which bind to the CNA19 region of a collagen binding protein of staphylococcal bacteria, and which can displace the attachment of staphylococcal bacteria of more than one species to a host cell, are thus extremely useful in treating or preventing staphylococcal infections in human and animal patients and in medical or other in-dwelling devices.
- a method of identifying and isolating antibodies which exhibit displacing activity and which can be utilized to displace a bacteria that has become bound to a given site on a host cell.
- a medium comprising a known site for bacterial binding attachment such as surface protein of the extracellular matrix of a host cell (e.g., collagen, laminin, etc.) is first labeled with an appropriate detectable label, such as a radioactive label like 125 l.
- the labeled binding site medium such as labeled collagen or other protein, which may be in immobilized form
- the appropriate bacteria known to bind to it such as Staphylococcal bacteria including S. aureus and S. epidermidis
- the bacteria bound to the detectable label are preferably harvested, and then placed in a suitable medium wherein an antibody suspected of having displacement activity against the particular bacteria at that binding site can be introduced to the labeled bacteria.
- EXAMPLE 1 GENERATION OF MONOCLONAL ANTIBODIES AND
- CROSS-REACTIVITY Bacterial strains, plasmids and culture conditions - Escherichia coli strain JM101 was used as a host and pQE-30 (Qiagen Inc., Chatsworth, CA) as an expression vector for cloning and expressing recombinant proteins.
- Staphylococcus aureus strain Cowan I was a clinical isolate from the Instituto Seroterapico Milanese (Milan, Italy) (18).
- S. aureus strains 57, 72, 116, 175, 176, 180, 203, 205, 212, and 4046 were clinical isolates from China, Europe, Hong Kong, Singapore and the United States. All these S. aureus isolates bind collagen (data not shown).
- E. coli strains were grown in
- BHI Brain Heart Infusion
- antigen was emulsified with an equal volume of complete Freund's adjuvant for the first immunization, followed by three injections in incomplete adjuvant. The mice were bled and the sera were tested for reactivity to the purified CNA19 using ELISA and Western blot. For the final immunization the antigen was given in saline. Three days after, the lymphocytes isolated from spleens were fused with Spe/0 Ag.14 mouse myeloma cells at a ratio of 5:1 using 50% polyethyleneglycol 4000. The suspended cells were first grown and selected in high glucose DMEM/RPMI 1640 (1 :1) medium (Sigma, St.
- HAT hypoxantin/aminopterin/thymidine
- HAT 2% hypoxantin/aminopterin/thymidine
- the HAT medium was progressively replaced by culturing cloned hybridomas in a serum-free medium consisting of DMEM/RPMI 1640 supplemented with 1% (v/v) Nutridoma-SR (Boehringer Mannheim, Mannheim, Germany) and antibiotics.
- Supernatants of the cell cultures were screened by ELISA on day 10, and hybridomas positive for the antibodies against CNA19 were subcultured to a density of 1 cell per well by limiting dilution and further characterized by ELISA and Western blot. 16H9 was an mAb raised against CNA55 using the same method.
- 7E8 was an anti-His tag mAb generated using the same procedure.
- Antibody purification and isotyping Supernatants of hybridoma cells were collected and centrifuged. The antibodies were purified by using ammonium sulfate precipitation of the supernatant, followed by affinity chromatography on Protein A/G - Sepharose columns according to the recommendations ofthe manufacturer (Amersham Pharmacia Biotech).
- transformants The construct was confirmed by restriction enzyme digestions and further verified by DNA sequencing.
- PBS phosphate-buffered saline
- the pellets were thawed and lysed in a French press.
- the cell debris was removed by centrifugation and the supernatant filtered through a 0.45-
- Molar extinction coefficient of each protein was calculated using values of Pace et al. (32).
- Circular dichroism (CD) - Far-UV CD was performed as described (33) using a Jasco J720 spectropolarimeter. All sample concentrations were
- Enzyme-linked immunosorbent assay (ELISA).- Microtiter wells were
- mCi/ ⁇ g was from Amersham Pharmacia biotech. Collagen was labeled using the iodogen coated-tube technique as recommended by the manufacturer (Pierce, Rockford, III). The specific activity of the radiolabeled
- ligand was estimated to be 4x10 6 cpm/ ⁇ g.
- the pellet was analyzed for radioactivity in a ⁇ counter.
- Radioactivity recovered in the tubes incubated in the absence of bacteria was subtracted from that of the samples containing bacteria. Samples were run in duplicate.
- bacteria were pre-incubated with increasing amounts of each mAbs for 1 h before the addition of 125 l-collagen, and processed as above.
- bacteria were pre-incubated with 125 l-collagen for 1 hour.
- ACE domain of ACE was predominantly composed of ⁇ -sheets as determined by
- ACE 19 was cloned and the purified ACE 19 protein was tested for its reactivity with the 22 anti-CNA19 mAbs as well as 16H9 and 7E8 in ELISAs. It was found that except for 7E8, it did not react with any of the mAbs (Table 3). Thus, ACE19 was used as an "inert" template for constructing chimeric proteins with regions of CNA19 replaced by corresponding sequences from ACE19. These chimeras were then used to map the epitopes.
- chimeras N to X were constructed.
- the CNA19 sequence (from the N-terminal starting point of CNA19 sequence in chimera L towards the C-terminal end point of CNA19 sequence of chimera G) was gradually replaced by corresponding regions of ACE19.
- these chimeras showed varying degrees of poor solubility.
- Fig. 2B only chimera N (Fig. 2B) showed reactions with relatively reasonable number of mAbs and its reactivity was lower than those observed for chimeras G, I, J and L (Table 3).
- chimeras O to V were not further discussed.
- Chimera W and X were constructed to further map the epitopes mapped to the C- terminal quarter region of CNA19 (Fig. 2B) and they had good solubility. W showed reactivity with a large number of mAbs suggesting that it presented the epitopes properly (Table 3). Chimera X did not react with any of the mAbs, possibility due to a similar reason discussed for chimera E, that X contains very little CNA19 sequence. The results from chimera W fully supported the conclusions obtained from the results of chimera G, I, J and L.
- epitope(s) recognized by 10G5 was located at residue 187 to 207 ( ⁇ -strand
- the 22 inhibiting mAbs raised against CNA19 recognized conformationally-dependent epitopes and these epitopes were located throughout CNA19 (Figure 3). This suggested that the entire molecule was involved in its interaction with collagen, either by directly contacting specific residues in collagen, or by adopting the proper conformation necessary for the accommodation ofthe collagen triple helix.
- the 22 monoclonal antibodies inhibited collagen binding of S. aureus strain Cowan I - In order to see if the functionally relevant epitopes, mapped using the mAbs and the chimeras, were present in the full-length native protein displayed on S. aureus cell surface, we examined the ability of the mAbs to inhibit collagen binding of S.
- mAb 11 H11 recognized 5 different clinical isolates of S. epidermidis.
- mAbs including 3D3, 9A4, and 12H10, had lower but detectable binding. Accordingly, the cross- reactivity of antibodies raised against S. aureus so as to be useful against S. epidermidis has been shown, and thus the CNA19 antibodies discussed herein can be useful against a plurality of Staphylococcus bacteria. Displacement of S. aureus Cowan I from collagen by the mAbs -
- S. aureus Cowan I was incubated with 125 l-collagen for an hour to allow the formation of the complex.
- Various amounts of mAbs were then added to the washed complex, and the decrease of 125 l in the cell pellet was taken as indicating the dissociation of the collagen-bacteria complex.
- collagen with 1 ⁇ g antibody and at least 96% bound collagen with 5 ⁇ g
- Cowan I was first allowed to adhere to immobilized collagen and then increasing amount of the mAbs were added. Bacteria that remain attached were detected by using rabbit-anti mouse antibodies. The results were consistent with those from the displacement of soluble collagen from bacteria-collagen complexes. For example, 9G7 again showed strong displacing capability while 11 H11 and 8E6 remained to be moderate or poor displacers and 16H9 did not displace ( Figure 8B). The ability of mAb 9G7 to displace Cowan I from the surface of immobilized collagen was assayed again using a different type of secondary antibody (goat-anti rabbit), or crystal violet for the detection of bacteria. Similar results were obtained (data not shown).
- Hybridoma cells were grown in RPMI/DMEM, 1X Nutridoma-SP media containing 2mM sodium pyruvate, 4mM L-glutamine and 2X penicillin- streptomycin to 2-3 liter culture volumes. Hybridoma supernatants were then harvested by centrifugation. The supernatants were filtered through
- the monoclonal antibodies was eluted using 0.1 M glycine, pH 2.7 and immediately neutralized with one tenth volume of 2M Tris, pH 8.0.
- the purified IgG was then dialyzed against 1X D-phosphate buffered saline, pH 7.4. If needed, the purified antibody was concentrated and aliquots frozen.
- S. aureus strain Barnett was isolated from a patient with osteomyelitis.
- S. aureus bacterial cells from a frozen glycerol stock were streaked onto a single blood agar plate. Single colonies from the initial plate were then restreaked on approximately 30 blood agar plates and placed in the 37° C incubator for 24 hrs. The bacteria were scraped off the plates and placed in a 50ml tube containing 10 mis of sterile 1x PBS and gently vortexed to remove the bacteria from the scraper. After scraping all plates an additional 10 mis sterile 1X PBS was added and the bacterial suspension was vortexed vigorously to facilitate separation of any agar debris from the bacteria.
- the bacterial suspension was then centrifuged at 3500xg at 4°C for 10 minutes in the RC3C centrifuge. The supernatant was decanted and the bacterial pellet was resuspended in 20 mis of sterile 1X PBS. The pellet was washed twice with PBS. Finally, the bacterial pellet was resuspended in 10 mis freezing media (1x D-PBS, pH 7.4; 10% DMSO; 5% BSA) and then add the additional volume of freezing media for desired volume and 1 ml aliquots were snap frozen in ethanol/dry ice bath and placed in a -80 ° C freezer. On the day of injection, the frozen bacterial stock was thawed and diluted 1 :20 in sterile PBS. An aliquot of the challenge inoculum was plated on blood agar plates to determine the actual CFUs.
- mice Female Balb/C mice (5-6 weeks of age) were purchased from Taconic Quality Laboratory Animals and Services for Research (Germantown, NY). Animals were allowed to acclimate for at least 14 days prior to initiation of treatment. Upon arrival, the mice were examined, group housed (5 / cage) in polycarbonate shoe box cages with absorbent bedding. All mice were placed on a 12 hour light-dark cycle under the required husbandry standards found in the NIH Guide for the Care and Use of
- mice All animals were uniquely identified using tail tattoos prior to dosing. Prior to initiation of treatment, the animals were individually weighed and their health was evaluated. Mice were randomized and assigned to treatment groups using stratified body weights.
- CFU S. aureus were administered by a single IV injection (0.1 ml) to all animals via the tail vein.
- mice Twenty-four hours after IgG administration, the mice were challenged with a single intravenous (IV) injection of S. aureus (Strain Barnett). The mice were followed for 10 days at which point all remaining mice were sacrificed. Significant differences in the survival times between treatment groups were detected.
- IV intravenous
- the mice were followed for 10 days at which point all remaining mice were sacrificed. Significant differences in the survival times between treatment groups were detected.
- survived the bacterial challenge Figure 11
- Synthesis of first strand cDNA was accomplished using 5 ⁇ g of mRNA and reverse transcriptase in a cDNA synthesis kit (Novagen; catalog # 69001-3) containing 20 pmol of 3' oligonucleotide mouse-specific primers (Novagen; catalog #'s 69796 and 69812) for each variable heavy and variable light chain.
- PCR polymerase chain reaction
- radioactivity bound to the cells was determined in a ⁇ counter.
- this information highlights the clinical significance and the therapeutic value of the monoclonal antibodies to CNA19 in accordance with the present invention, particularly antibodies 3B12, 3D3, 7C2 and 9G7, which effectively inhibit and displace the ligand from bacteria.
- these antibodies will be useful both In prophylactic methods as well as methods of treating patients affected by S. aureus and S. epidermidis infections.
- the anti CBD (30-529) mAbs were examined for their effects on collagen binding to S. aureus cells. Binding inhibition assay was used in which bacteria and 125 l-collagen were incubated in the presence of each mAb. Only mAbs 2B8 and 1A11 inhibited binding of the ligand to staphylococci at some extent (Fig. 15C). MAbs 2B8 and 1A11 inhibited collagen binding to S. aureus up to 60% and, when combined together at highest concentrations, blocked ligand binding almost completely. The two mAbs also shared the property to moderately displace collagen from bacterial-collagen complexes (Fig. 15D).
- Bacterial Preparation - 10ml tryptic soy broth overnight cultures were prepared from a single colony off a streak plate prepared from frozen stocks. The following morning 10 ml of tryptic soy broth was inoculated with 50ul of overnight stock and grown for three hours. All cultures were stored on ice after growth period. All cultures were normalized to approximately the same OD.
- Staining Profiles The histogram representations of Figs. 16A-D illustrate the staining profiles of each strain at 3hr and overnight culture time points with each monoclonal.
- the apparent K D (dissociation constant) values were estimated from the concentration required for half-maximal signal.
Abstract
Antibodies to the CNA protein and to other regions from the collagen binding domain, including domain CNA19, are provided, and antibodies produced in this manner have been shown to be cross reactive to both Staphylococcus aureus and Staphylococcus epidermidis bacteria and which can thus be used in the prevention and treatment of infections caused by both of these types of bacteria. In addition, medical instruments can be treated using the antibodies of the invention in order to reduce or eliminate the possibility of their becoming infected or further spreading the infection. In particular, the proteins are advantageous because they are cross-reactive and may thus be administered to patients so as to reduce or prevent severe infection by staphylococcal bacteria of more than one species. Antibodies generated in this manner have also been shown to exibit displacement activity and can thus be utilized advantageously in mehtods wherein these antibodies will be administered to patients having pre-existing staphylococcal infections because of the ability to displace bacterial proteins from binding sites on the extracellular matrix. Finally, a method of identifying, isolating and utilizing displacing antibodies is also provided.
Description
CROSS-REACTIVE DISPLACING ANTIBODIES FROM COLLAGEN- BINDING PROTEINS AND METHOD OF IDENTIFICATION AND USE
Field of the Invention
The present invention relates in general to displacing antibodies which can inhibit collagen binding to Staphylococcus aureus bacteria and to methods for developing and utilizing displacing antibodies, and in particular to antibodies to CNA, the collagen adhesin of Staphylococcus aureus, and its subregions, which are cross-reactive to multiple strains of S. aureus and to S. epidermidis, and which can be used to inhibit collagen binding to S. aureus and in a variety of compositions and methods for the therapeutic or preventive treatment of infections from S. aureus and S. epidermidis.
Background of the Invention
Staphylococcus aureus is a bacterial pathogen that is capable of colonizing a wide range of host tissues and causing infections such as endocarditis, wound infections, pneumonia, osteomyelitis and septic arthritis. The initial attachment and colonization on host tissues is thought to be the first crucial step in the disease development. Staphylococci produce a family of surface proteins named MSCRAMMs (Microbial Surface Component Recognizing Adhesive Matrix Molecules) that mediate adherence to extracellular matrix (ECM) proteins. Collagen is a major ECM protein and is the main component of tissues such as skin, bone, tendon, cartilage and teeth. It is conceivable that the S. aureus developed strategies to utilize collagen as a way to colonize host tissues.
Several studies have supported this notion. For example, S. aureus cells retrieved from infected joints were shown to be predominantly attached to the cartilage (1 ). Switalski et al. demonstrated that a collagen-binding MSCRAMM, CNA, was necessary and sufficient for S. aureus to attach to cartilage in vitro (2). Furthermore, CNA was shown to be a virulence factor in experimental septic arthritis (3). CNA+ strains showed dramatically increased virulence compared with the isogenic CNA- strains as evaluated by the clinical symptoms and histopathological patterns of the joints. No viable S. aureus cells were recovered from the joints of mice injected with the CNA- strains, while significant numbers of S. aureus cells were isolated from the joints of those injected with the CNA+ strains. In addition, vaccination with a recombinant fragment of CNA protected mice from septic death against intravenous challenge with S. aureus (4).
Other bacteria that have been reported to express collagen-adhesins include certain strains of Escherichia coli (5), Yersinia enterocolitica (6-8), Klebsiella pneumoniae (9), Streptococcus mutans (10,11), group A streptococci (12), Streptococcus gordonii (11 ,13), Enterococcus faecalis (14), Lactobacilli reuteri (15) and Lactobacilli crispatus (T. K. Korhonen, personal communication). The collagen-adhesin YadA was shown to contribute to the arthritogenicity of Y. enterocolitica in a rat model (16). Substitution of two histidine residues in YadA with alanine abrogated collagen binding and cell adherence, and caused reduced virulence in mice (17), suggesting that these functions of YadA were related. Mammalian proteins that interact with collagen include extracellular matrix proteins (e.g.,
fibronectin, decorin, thrombospondin and von Willebrand factor) and cell
receptors (e.g., integrins α^ and a2 . Their interactions mediate
processes such as cell adhesion and migration, platelet aggregation, and tumor metastasis. Therefore, a deeper understanding of the interactions between collagen and the staphylococcal adhesin will not only contribute to our understanding of the molecular pathogenesis of staphylococcal infections but also provide insight of how collagen-binding proteins in general interact with this ligand.
Previous studies showed that CNA recognized triple helical collagen as well as some synthetic peptides that formed a collagen-like triple helix (18). CNA was found to contain typical elements of surface proteins of gram- positive bacteria. It consists of a signal peptide, a non-repetitive A domain, several repeats (B domains), followed by a cell-wall anchor region, a transmembrane segment and a short cytoplasmic tail. The A domain of CNA (CNA55) was found to be fully responsible for the collagen-binding activity of CNA (19). The minimum binding domain was localized to a 19 kDa fragment, CNA19 (formerly designated CBD (151-318)), within CNA55 (19). The crystal structure of CNA19 was solved (20). The structure was
composed of two antiparallel β-sheets and two short α-helices. β-strands A,
B, part of D, E and H form β-sheet I, and strands C, part of D, F, G, I and J
form β-sheet II. A trench was observed in β-sheet I into which a triple helical
collagen molecule fits as shown by docking experiments using theoretical collagen probes of [(Gly-Pro-Pro)4]3 or [(Gly-Pro-Hyp)4]3. Site-directed mutagenesis of some residues in the trench of CNA19 abolished collagen
binding (Y175K, R189A, F191A, N193K, and Y233A) or caused reduced binding affinity (N223K and N278K) (20,21), indicating that the trench was essential for binding. Two truncates of CNA19 that had the N-terminal 30 amino acids or the C-terminal 22 amino acids removed respectively were generated. The C-terminal truncate, CBD(151-297), did not bind collagen, while the N-terminus truncate was insoluble. The N-terminal truncate contains all but 6 of the residues in the trench and the C-terminal truncate contains all the residues, suggesting that the intact CNA19 molecule is important in presenting the trench in an active collagen-binding
conformation. Structural analysis on the I domains of integrins α1β1 and a2
the collagen binding domains, also indicated the presence of trench-like structures (22-24). Mutations of some residues along the wall of the trench
in the I domain of α2βι affected collagen binding (25-28). Thus, it seems that
using a trench structure as the site of interaction for collagen may be a general theme.
Recently, a collagen-adhesin (ACE) of Enterococcus faecalis was identified (14). ACE has similar domain organization as CNA, a signal peptide sequence, a collagen-binding region (A) followed by repeated segments (B repeats), and elements required for surface display. The A domain of ACE shares sequence similarity with the A domain of CNA in the corresponding segments and these parts of the two proteins appear to be structurally related as determined by far-UV circular dichroism analysis of the ACE A domain (14). This raised the possibility that there may also be a
trench structure in the ACE A domain and the trench may be the binding site for collagen.
However, with regard to Staphylococcal bacteria, it has still remained a problem to identify and utilize the information concerning the collagen binding site so as to develop methods of more efficiently preventing and/or treating staph infections. In addition, it has still been a goal of the study of the collagen binding activity of to develop methods and compositions which could be useful in treating or preventing infections from more than one type of staph infection. Finally, it is even further desirable in the field of infectious diseases to development compositions which are particularly successful not only in preventing staph infection, but in treating existing infection by displacing proteins already bound at sites on the extracellular matrix in cells of a human or animal patient.
Summary of the Invention
Accordingly, it is an object of the present invention to provide antibodies to the CNA19 minimal collagen binding region of S. aureus which is also cross-reactive so as to recognize the collagen binding region of both S. aureus and S. epidermidis. It is a further object of the present invention to provide an antibody to a collagen binding region which can be useful in inhibiting collagen binding by staphylococcal bacteria of more than one species.
It is a further object of the present invention to provide antibodies and antisera which will prevent the adherence of staphylococcal bacteria to the
extracellular matrix proteins such as collagen and which will also be capable of displacing MSCRAMMs that are already bound to sites on the extracellular matrix.
It is a further object of the present invention to provide passive vaccines which can be used in treating or preventing infection by Staphylococcal bacteria, including Staphylococcus aureus and epidermidis.
It is still further an object of the present invention to generate antisera and antibodies to the CNA protein and its collagen binding domains including CNA19 which can also be useful in developing methods of treatment which can inhibit binding of collagen to staphylococcal bacteria and thus be employed in order to treat or prevent staphylococcal infection.
It is a further object of the present invention to provide improved materials and methods for detecting and differentiating collagen-binding proteins in staphylococcal organisms in clinical and laboratory settings. It is a further object of the invention to provide nucleic acid sequences which code for the variable light sequence and the variable heavy sequences from the monoclonal antibodies of the present invention.
It is even further an object of the present invention to develop more effective and efficient ways of utilizing antibodies against collagen binding proteins in staphylococci so as to produce suitable compositions which can inhibit or displace the attachment of staphylococcal bacteria to collagen and which can thus be useful in improved therapeutic methods of treating of preventing staphylococcal infection.
These and other objects are provided by virtue of the present invention which comprises the isolation and use of monoclonal antibodies to the CNA protein and its subregions, including the CNA19 peptide, and monoclonal antibodies generated in this fashion have been shown to be cross-reactive with more than one Staphylococcus species of bacteria. In accordance with the present invention, monoclonal antibodies (mAbs) that were capable of inhibiting the binding of staphylococcal bacteria to host cells are provided, and in addition, antibodies to CNA19 which can recognize S. aureus as well as S. epidermidis are provided in accordance with the invention.
In another aspect of the present invention, since it was shown that recognition was conformation-dependent, the present invention includes chimeric proteins between CNA19 and a segment of the ACE A domain that were generated and used successfully to map epitopes within CNA19 which were functionally relevant.
Still further, characterizations of antibodies raised to the CNA19 peptide in accordance with the invention have indicated that CNA19 mAbs have inhibitory effects on an S. aureus strain binding to soluble collagen as well as attachment to immobilized collagen. Moreover, some of these antibodies have exhibited displacing behavior and thus these antibodies could effectively release S. aureus from preformed collagen-bacteria complexes as well as detach S. aureus from the surface of immobilized collagen. A model of the interactions between collagen and the different conformational states of CNA19 and contemplated clinical applications of
these displacing mAbs as therapeutic agents is also provided in accordance with the invention.
In addition, as indicated herein, murine monoclonal antibodies generated against CNA19 from S. aureus in accordance with the present invention have been shown to be cross-reactive in that they recognized 5 different clinical isolates of S. epidermidis and thus may be useful in developing antibody compositions that are effective in preventing or treating infections from more than one species of Staphylococcal bacteria.
Even further, the present invention relates to the discovery of a class of displacing antibodies which can be isolated and utilized in methods of treating or preventing bacterial infection. In addition, the invention provides a method for identifying and isolating displacing antibodies and for antibodies identified and isolated by the present method.
Accordingly, in accordance with the invention, antibodies raised against the CNA19 region of the collagen binding domain are provided and can be utilized in cross-reactive methods of treating or preventing bacterial infections from more than one species of bacteria, such as S. aureus and S. epidermidis, along with compositions containing said antibodies, diagnostic test kits which contain the appropriate antibodies or antisera raised against CNA19 or other regions of the collagen binding protein which can enable one to identify these bacteria in infections.
These embodiments and other alternatives and modifications within the spirit and scope of the disclosed invention will become readily apparent
to those skilled in the art from reading the present specification and/or the references cited herein.
BRIEF DESCRIPTION OF THE DRAWING FIGURES Figure 1. Inhibition of the binding of 125l-collagen to immobilized CNA19. CNA19 recombinant protein was immobilized onto microtiter wells
(1 μg in 100 μl) and probed with 125l-collagen (8x104 cpm) in the presence of
2 μg of each mAb. Binding of 125l-collagen to CNA19 in the absence of
antibody was set as 100% binding. Bars represent means ± standard deviations with duplicate testing.
Figure 2A. Sequence alignment of CNA19 and ACE19. ClustalW with default parameters was used. Shaded amino acid residues were identical
and similar residues. The β-strands and α-helices of CNA19 determined by
X-ray crystallography were indicated by dark bars above the corresponding
regions of CNA19. β-strands A, B, a part of D, E and H are the ones that
form the observed trench and are indicated by *.
Figure 2B. Schematic illustration of the chimeras. CNA19 sequences were represented by shaded bars while ACE 19 by blank bars. Dark-shaded
boxes represent β-strands and striped boxes α-helices of CNA19. "*"
indicates the β-strands that form the trench. The numbers indicate the
positions of the amino acid residues in CNA19.
Figure 3. Summary of the localization of CNA19 epitopes recognized by the mAbs. Horizontal lines beneath CNA19 represent regions where various mAbs were mapped, numbers above each line indicate number of mAbs in the region. The number for the central region includes 16H9, but does not include anti-His tag mAb 7E8.
Figure 4. Effect of anti-CNA19 mAbs on 125l-collagen binding to S. aureus Cowan 1. S. aureus Cowan 1 (5 x 108 cells) were pre-incubated with the indicated amounts of each mAb prior to the addition of 1 5l-collagen (5x104 cpm). Collagen binding was quantitated as described under "Experimental Procedures". Values are expressed as percentage of the ligand binding in the absence of mAb. Results are expressed as mean ± standard deviation of duplicate measurements.
Figure 5. Dose-dependent inhibition of 125l-collagen binding to S. aureus cells by mAbs. S. aureus Cowan I cells (5 x 108 cells) were pre- incubated with increasing concentrations of mAbs 9G7, 11 H11 , 8E6 and 16H9 before the addition of 125l-collagen. Values are expressed as the percentage of ligand binding to bacteria in the absence of antibody and represent the mean ± standard deviation of duplicate measurements.
Figure 6. Dose-dependent inhibition of S. aureus adherence to immobilized collagen by mAbs. Microtiter wells were coated with collagen type II as reported in the Examples section below. Bacterial ceils were pre-
incubated with increasing amounts of the indicated mAbs before being added to the wells. Adherence values are expressed as percentage of the adherence obtained in the absence of antibody. Bars represent means ± standard deviations. Each sample was done in duplicate.
Figure 7. Displacement of 125l-collagen from collagen-bacteria complex.
S. aureus Cowan I cells (5x108) were pre-incubated with 125l-collagen (5x104 cpm) for 1 h. After centrifugation, bacteria-collagen complex was resuspended, and the indicated amounts of each mAb were added to the suspension and further incubated for 1 h. The amount of the residual
collagen bound to bacteria was determined in a γ counter. Duplicate
samples were used for each data point.
Figure 8A. Dose-dependent displacement of 125l-collagen from collagen-staphylococci complex by mAbs. S. aureus cells were pre- incubated with 125l-collagen as reported in Figure 7. Increasing amounts of indicated mAb were added to the bacteria-collagen complexes and incubated for 1 h. Residual 125l-collagen associated with bacteria was
quantitated in a γ counter. Bars represent standard deviations from the
means of duplicate measurements.
Figure 8B. Displacement of S. aureus cells adherent to immobilized collagen by mAbs. S. aureus Cowan 1 cells were allowed to adhere to
collagen coated plates. After washing, the indicated amounts of mAbs were added to the wells and incubated for 2 h. After extensive washing, the number of residual attached bacteria was quantitated by using peroxidase- conjugated rabbit anti-mouse IgG as reported in "Experimental Procedures". Data are expressed as percentage of attached bacteria in the absence of mAbs. The values are averages of incubations performed in duplicate.
Figure 9. Cross-reactivity of monoclonal antibodies generated against S. aureus CNA19. Cross-reactivity of monoclonal antibodies raised against S. aureus CNA19 was established via ELISA screening showing recognition of intact S. epidermidis. The graphs in this figure reflect this recognition by measuring binding of monoclonal antibodies generated against CNA19 to the five S. epidermidis strains. As shown in this figure, Mab 11H11 recognized 5 different clinical isolates of S. epidermidis. Several other Mabs, including 3D3, 9A4, and 12H10, had lower but detectable binding.
Figure 10. Survival plot for animals treated with the 9G3 monoclonal antibody in accordance with the present invention versus untreated animals.
Figure 11. Survival plot for animals treated with the 3B12 monoclonal antibody in accordance with the present invention versus untreated animals.
Figures 12A and 12B. Inhibition of S. aureus cells adherence to immobilized collagen by mAbs generated against CNA19 (CBD 151-318).
Figure 13. Displacement of 125l-collagen from S. aureus cells by mAbs generated against CNA19 (CBD 151-318).
Figures 14A-14C. Displacement of S. aureus cells bound to immobilized collagen by mAbs generated against CNA19 (CBD 151-318).
Figure 15A. ELISA analysis of immobilized GST-CNA fusion protein derivatives with mAbs 2B8 and 16H9 and a polyclonal antibody raised against CBD (151-318).
Figure 15B. Mapping of epitope for mAbs 2B8 and 16H9 by using chimeras consisting of segments of ACE19 (174-319) and CNA19 (151-318).
Figure 15C. Inhibitory activity of mAbs generated against CBD (30-529) on the collagen binding to S. aureus Cowan 1.
Figure 15D. Displacement of 125l-collagen from S. aureus Cowan 1 by mAbs 1A11 and 2B8.
Figure 15E. Inhibition of 125l-collagen from S. aureus Cowan 1 by mAbs 1A11 and 2B8.
Figures 16A-16D. These are histogram representations which illustrate the staining profiles reflecting recognition of four different strains by monoclonal
antibody designated 3B12 at 3hr and overnight culture time points with each monoclonal.
DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS In accordance with the present invention, there is provided monoclonal antibodies to the CNA protein of S. aureus, as well as antibodies specific to the CNA19 region of the CNA collagen binding protein in staphylococcus bacteria which have been shown to be cross-reactive to both S. aureus and S. epidermidis. In addition, other antibodies generated to CNA19 have been shown to exhibit displacement behavior such that they may displace staph bacteria already bound to host cells.
The CNA protein in staphylococcal bacteria is a collagen-binding adhesin that allows the bacteria to target and bind to collagen in the extracellular matrix of host cells, and is thus a very important protein with regard to the colonization and multiplication of bacteria cells that can infect human and animal patients, and even colonize and affect medical instruments and prosthetic devices. Studies have actually shown that unlike many other proteins, the protein sequence of CNA, which is expressed by 60% of staphylococcal bacteria, is virtually identical across the great range of strains that express this protein, and there is little or no variation among the various strains with regard to CNA sequence. As a result, a monoclonal antibody generated to the CNA protein will be of tremendous value since unlike many other monoclonals which are very specific to a particular antigen and its sequence, a monoclonal antibody generated against the
CNA protein will be extremely versatile in that it will recognize and protect
against infection by a wide range of staphylococcal strains.
Accordingly, the present invention relates to an isolated and/or
purified monoclonal antibody generated to the CNA protein or CNA19
peptide which can be useful in methods of preventing and treating
staphylococcal infection when used in amounts effective to prevent or treat
such infections, and these monoclonal antibodies may be produced using,
e.g., the method of Kohler and Milstein (29), or in other suitable ways known
in the field. Still other useful antibodies may be generated to larger
segments of the A domain which will include the CNA19 region of the
collagen binding domain, as further described below. Antisera prepared
using monoclonal or polyclonal antibodies in accordance with the present
invention are also contemplated and may be prepared in any of a number of
suitable ways as would be recognized by one of ordinary skill in this art. It is
also contemplated that antibodies raised to the CNA19 peptide region of the
CNA protein of S. aureus will be useful in the prevention and treatment of
infection not only of S. aureus, but of S. epidermidis as well. With regard to
antibodies to CNA19, these antibodies may be generated against natural
isolated and purified CNA19, or, preferably, may be generated against
recombinant CNA19. The CNA19 peptides against which antibodies are
raised are preferably isolated from any of a wide variety of Staphylococcus
aureus strains, such as S. aureus strain Cowan I, or any of those strains
identified as 57, 72, 116, 175, 176, 180, 203, 205, 212 and 4046, which are
clinical isolates from various countries around the world. Generally, it is preferred that the S. aureus strain utilized in accordance with the invention be one which is known to bind to collagen.
In accordance with the present invention, antibodies to the CNA19 motif of the CNA protein's collagen binding domain (or CBD 151-318) may be prepared in a number of suitable ways that would be well known in the art, such as the well-established Kohler and Milstein method (29) which can be utilized to generate monoclonal antibodies to CNA19. In this method, mice are injected intraperitoneally once a weeks for a prolonged period with a purified recombinant CNA19 domain, followed by a test of blood obtained from the immunized mice to determine reactivity to the purified CNA19 peptide. Following identification of mice reactive to CNA19, lymphocytes isolated from mouse spleens are fused to mouse myeloma cells to produce hybridomas positive for the antibodies against CNA19 which are then isolated and cultured, following by purification and isotyping.
In order to generate monoclonal antibodies in accordance with the invention, it is preferred that these be generated using recombinantly prepared CNA19 peptides in conventional methods well known in the art. For example, one such method employs the use of E. coli strain JM101 as a host and pQE-30 as an expression vector for cloning and expressing recombinant proteins and peptides. DNA preparation, purification, restriction digestion, agarose gel electrophoresis and ligation may be performed using standard methods, and the resulting recombinant CNA19
segments may be isolated and purified and then utilized to generate monoclonal antibodies in the manner described above.
In addition to monoclonal antibodies, the present invention also contemplates generating polyclonal antibodies from CNA19 as well. Such polyclonal antibodies may be generated in any of a number of suitable ways well known in the art, such as the introduction of a purified CNA19 peptide into a suitable animal host, followed by isolation and purification of the generated antibodies produced in the host animal.
Although production of antibodies using recombinant forms of the CNA19 motif is preferred, antibodies may be generated from natural isolated and purified CNA19 as well, and monoclonal or polyclonal antibodies can be generated using the natural CNA19 in the same manner as described above to obtain such antibodies. In addition, numerous other ways to generate the antibodies in accordance with the invention are possible, including expressing the whole CNA protein recombinantly and then isolating the CNA19 region from the isolated CNA protein. Still other conventional ways would be available to generate the CNA19 antibodies of the present invention using recombinant or natural purified CNA19, as would be recognized by one of ordinary skill in this art. As would be recognized by one skilled in the art, the antibodies of the present invention may also be formed into suitable pharmaceutical compositions for administration to a human or animal patient in order to treat or prevent an infection caused by staphylococcal bacteria such as S. aureus or S. epidermidis. Pharmaceutical compositions containing the antibodies of
the present invention, or effective fragments thereof, may be formulated in combination with any suitable pharmaceutical vehicle, excipient or carrier that would commonly be used in this art, including such as saline, dextrose, water, glycerol, ethanol, other therapeutic compounds, and combinations thereof. As one skilled in this art would recognize, the particular vehicle, excipient or carrier used will vary depending on the patient and the patient's condition, and a variety of modes of administration would be suitable for the compositions of the invention, as would be recognized by one of ordinary skill in this art. Suitable methods of administration of any pharmaceutical composition disclosed in this application include, but are not limited to, topical, oral, anal, vaginal, intravenous, intraperitoneal, intramuscular, subcutaneous, intranasal and intradermal administration.
For topical administration, the composition is formulated in the form of an ointment, cream, gel, lotion, drops (such as eye drops and ear drops), or solution (such as mouthwash). Wound or surgical dressings, sutures and aerosols may be impregnated with the composition. The composition may contain conventional additives, such as preservatives, solvents to promote penetration, and emollients. Topical formulations may also contain conventional carriers such as cream or ointment bases, ethanol, or oleyl alcohol.
Additional forms of antibody compositions, and other information concerning compositions, methods and applications with regard to collagen binding proteins, are disclosed, for example, in U.S. Patent Application Serial No. 08/856,253, filed May 14, 1997, U.S. Patent Application Serial
No. 09/494,297, filed January 31 , 2000, and in U.S. Patent Application Serial No. 09/568,470, filed May 10, 2000, and the full specifications of these applications are incorporated herein by reference.
The antibody compositions of the present invention which are generated against the CNA19 or minimal collagen binding region of the CNA protein of S. aureus, yet which are also effective against S. epidermidis, may also be administered with a suitable adjuvant in an amount effective to enhance the immunogenic response against the conjugate. At this time, the only adjuvant widely used in humans has been alum (aluminum phosphate or aluminum hydroxide). Saponin and its purified component Quil A, Freund's complete adjuvant and other adjuvants used in research and veterinary applications have toxicities which limit their potential use in human vaccines. However, chemically defined preparations such as muramyl dipeptide, monophosphoryl lipid A, phospholipid conjugates such as those described by Goodman-Snitkoff et al. J. Immunol. 147:410-415 (1991 ) and incorporated by reference herein, encapsulation of the conjugate within a proteoliposome as described by Miller et al., J. Exp. Med. 176:1739- 1744 (1992) and incorporated by reference herein, and encapsulation of the protein in lipid vesicles such as Novasome™ lipid vesicles (Micro Vescular Systems, Inc., Nashua, NH) may also be useful.
In any event, the antibody compositions of the present invention will thus be useful for interfering with, modulating, inhibiting binding interactions between staphylococcal bacteria and collagen on host cells, or in displacing
staphylococcal bacteria which has become bound to the collagen on host cells.
In accordance with the present invention, methods are provided for preventing or treating a staphylococcal infection which comprise administering an effective amount of an antibody to CNA19 as described above in amounts effective to treat or prevent the infection. As also indicated above, the CNA19 antibodies have been observed to exhibit an ability to displace S. aureus bacteria that are bound to collagen, such as the collagen in the extracellular matrix of host cells, and thus one of the advantageous aspects of the present invention is the provision of a method and a composition which can be utilized to fight a standing infection of staphylococcal bacteria such as S. aureus and S. epidermidis because the CNA19 antibodies of the present invention will displace the bacteria from collagen in the host cells. Accordingly, in accordance with the invention, administration of the antibodies of the present invention in any of the conventional ways described above (e.g., topical, parenteral, intramuscular, etc.) will be useful in displacing staphylococcal infections in a manner not heretofore possible, and will thus provide an extremely useful method of treating staphylococcal infections in human or animal patients. By effective amount is meant that level of antibody titer that will be sufficient to either inhibit binding of staph bacteria to host cells, or, in the case of a prior infection, that amount that will be sufficient to displace bacteria from the host cells so as to treat the infection. As would be recognized by one of ordinary skill in this art, the level of antibody titer needed to be effective in treating or
preventing staphylococcal infection will vary depending on the nature and condition of the patient, and/or the severity of the pre-existing staphylococcal infection.
The isolated antibodies in accordance with the present invention which show displacing activity to binding sites such that they will displace proteins already bound to such sites can thus be administered to humans or animals, either alone or in combination with an adjuvant, in a number of suitable ways conventionally used to treat or prevent a staphylococcal infection. In addition to the use of antibodies to CNA19 as described above, the present invention contemplates the use of these antibodies in a variety of ways, including the detection of the presence of Staphylococcal bacteria such as S. aureus or S. epidermidis and thus using antibodies to diagnose a staph infection, whether in a patient or on medical equipment which may also become infected. In accordance with the invention, a preferred method of detecting the presence of staph infections involves the steps of obtaining a sample suspected of being infected by one or more staphylococcal bacteria species or strains, such as a sample taken from an individual, for example, from one's blood, saliva, tissues, bone, muscle, cartilage, or skin. The cells can then be lysed, and the DNA extracted, precipitated and amplified. Following isolation of the sample, diagnostic assays utilizing the antibodies of the present invention may be carried out to detect the present of staph bacteria, including S. aureus or S. epidermidis, and such assay techniques for determining such presence in a sample are well known to
those skilled in the art and include methods such as radioimmunoasssay, Western blot analysis and ELISA assays.
Accordingly, antibodies in accordance with the invention may be used for the specific detection of staphylococcal collagen-binding proteins, for the prevention of infection from staph bacteria, for the treatment of an ongoing infection, or for use as research tools. The term "antibodies" as used herein includes monoclonal, polyclonal, chimeric, single chain, bispecific, simianized, and humanized or primatized antibodies as well as Fab fragments, including the products of an Fab immunoglobulin expression library. Generation of any of these types of antibodies or antibody fragments is well known to those skilled in the art. In the present case, specific polyclonal antiserum against CNA19 has been generated which reacts with CNA19 in Western immunoblots and ELISA assays and interferes with binding to collagen. Any of the above described antibodies may be labeled directly with a detectable label for identification and quantification of staph bacteria. Labels for use in immunoassays are generally known to those skilled in the art and include enzymes, radioisotopes, and fluorescent, luminescent and chromogenic substances, including colored particles such as colloidal gold or latex beads. Suitable immunoassays include enzyme-linked immunosorbent assays (ELISA).
Alternatively, the antibody may be labeled indirectly by reaction with labeled substances that have an affinity for immunoglobulin. The antibody may be conjugated with a second substance and detected with a labeled
third substance having an affinity for the second substance conjugated to the antibody. For example, the antibody may be conjugated to biotin and the antibody-biotin conjugate detected using labeled avidin or streptavidin. Similarly, the antibody may be conjugated to a hapten and the antibody- hapten conjugate detected using labeled anti-hapten antibody. These and other methods of labeling antibodies and assay conjugates are well known to those skilled in the art.
Antibodies to the collagen-binding protein domain CNA19 may also be used in production facilities or laboratories to isolate additional quantities of the proteins, such as by affinity chromatography. For example, the antibodies of the invention may also be utilized to isolate additional amounts of collagen.
The isolated antibodies of the present invention, or active fragments thereof, may also be utilized in the development of vaccines for passive immunization against staph infections. Further, when administered as pharmaceutical composition to a wound or used to coat medical devices or polymeric biomaterials in vitro and in vivo, the antibodies of the present invention, since they exhibit displacing behavior, are especially useful in those cases where there is a previous staph infection already present since these antibodies will function to displace this bacterial infection. In addition, the antibody may be modified as necessary so that, in certain instances, it is less immunogenic in the patient to whom it is administered. For example, if the patient is a human, the antibody may be "humanized" by transplanting the complimentarity determining regions of the hybridoma-derived antibody
into a human monoclonal antibody as described, e.g., by Jones et al., Nature 321 :522-525 (1986) or Tempest et al. Biotechnology 9:266-273 (1991).
Medical devices or polymeric biomaterials to be coated with the antibodies, proteins and active fragments described herein include, but are not limited to, staples, sutures, replacement heart valves, cardiac assist devices, hard and soft contact lenses, intraocular lens implants (anterior chamber or posterior chamber), other implants such as corneal inlays, kerato-prostheses, vascular stents, epikeratophalia devices, glaucoma shunts, retinal staples, scleral buckles, dental prostheses, thyroplastic devices, laryngoplastic devices, vascular grafts, soft and hard tissue prostheses including, but not limited to, pumps, electrical devices including stimulators and recorders, auditory prostheses, pacemakers, artificial larynx, dental implants, mammary implants, penile implants, cranio/facial tendons, artificial joints, tendons, ligaments, menisci, and disks, artificial bones, artificial organs including artificial pancreas, artificial hearts, artificial limbs, and heart valves; stents, wires, guide wires, intravenous and central venous catheters, laser and balloon angioplasty devices, vascular and heart devices (tubes, catheters, balloons), ventricular assists, blood dialysis components, blood oxygenators, urethral/ureteral/urinary devices (Foley catheters, stents, tubes and balloons), airway catheters (endotracheal and tracheostomy tubes and cuffs), enteral feeding tubes (including nasogastric, intragastric and jejunal tubes), wound drainage tubes, tubes used to drain the body cavities such as the pleural, peritoneal, cranial, and pericardial cavities,
blood bags, test tubes, blood collection tubes, vacutainers, syringes, needles, pipettes, pipette tips, and blood tubing.
It will be understood by those skilled in the art that the term "coated" or "coating", as used herein, means to apply the antibody or active fragment, or pharmaceutical composition derived therefrom, to a surface of the device, preferably an outer surface that would be exposed to streptococcal bacterial infection. The surface of the device need not be entirely covered by the protein, antibody or active fragment.
In a preferred embodiment, the antibodies may also be used as a passive vaccine which will be useful in providing suitable antibodies to treat or prevent a staphylococcal infection. As would be recognized by one skilled in this art, a vaccine may be packaged for administration in a number of suitable ways, such as by parenteral (i.e., intramuscular, intradermal or subcutaneous) administration or nasopharyngeal (i.e., intranasal) administration. It is generally preferred that the vaccine be injected intramuscularly into the deltoid muscle, however, the particular mode of administration will depend on the nature of the bacterial infection to be dealt with and the condition of the patient. The vaccine is preferably combined with a pharmaceutically acceptable carrier to facilitate administration, and the carrier is usually water or a buffered saline, with or without a preservative. The vaccine may be lyophilized for resuspension at the time of administration or in solution.
The preferred dose for administration of an antibody composition in accordance with the present invention is that amount will be effective in
preventing of treating a staphylococcal infection, and one would readily recognize that this amount will vary greatly depending on the nature of the infection and the condition of a patient. As indicated above, an "effective amount" of antibody or pharmaceutical agent to be used in accordance with the invention is intended to mean a nontoxic but sufficient amount of the agent, such that the desired prophylactic or therapeutic effect is produced. As will be pointed out below, the exact amount of the antibody or a particular agent that is required will vary from subject to subject, depending on the species, age, and general condition of the subject, the severity of the condition being treated, the particular carrier or adjuvant being used and its mode of administration, and the like. Accordingly, the "effective amount" of any particular antibody composition will vary based on the particular circumstances.
However, an appropriate effective amount may be determined in each case of application by one of ordinary skill in the art using only routine experimentation. In this regard, it is generally preferred that compositions in accordance with the invention contain from about 0.5 to 75 mg/kg of a CNA19 antibody in accordance with the invention, with about 5 to 30 mg/kg range being a more common desired range of level of antibody. Based on this range, equivalent dosages for heavier body weights can be determined. The dose should be adjusted to suit the individual to whom the composition is administered and will vary with age, weight and metabolism of the individual. The compositions may additionally contain stabilizers or pharmaceutically acceptable preservatives, such as thimerosal (ethyl(2-
mercaptobenzoate-S)mercuιy sodium salt) (Sigma Chemical Company, St. Louis, MO).
When used with suitable labels or other appropriate detectable biomolecule or chemicals, the monoclonal antibodies described herein are useful for purposes such as in vivo and in vitro diagnosis of staphylococcal infections or detection of staphylococcal bacteria. Laboratory research may also be facilitated through use of such antibodies. Various types of labels and methods of conjugating the labels to the antibodies of the invention are well known to those skilled in the art, such as the ones set forth below. For example, the antibody can be conjugated to a radiolabel such as, but not restricted to, 32P, 3H, 14C, 35S, 125l, or 131l. Detection of a label can be by methods such as scintillation counting, gamma ray spectrometry or autoradiography. Bioluminescent labels, such as derivatives of firefly luciferin, are also useful. The bioluminescent substance is covalently bound to the protein by conventional methods, and the labeled protein is detected when an enzyme, such as luciferase, catalyzes a reaction with ATP causing the bioluminescent molecule to emit photons of light. Fluorogens may also be used to label proteins. Examples of fluorogens include fluorescein and derivatives, phycoerythrin, allo-phycocyanin, phycocyanin, rhodamine, and Texas Red. The fluorogens are generally detected by a fluorescence detector.
The location of a ligand in cells can be determined by labeling an antibody as described above and detecting the label in accordance with methods well known to those skilled in the art, such as immunofluorescence
microscopy using procedures such as those described by Warren and Nelson (Mol. Cell. Biol., 7: 1326-1337, 1987).
As indicated above, the monoclonal antibodies of the present invention, or active portions or fragments thereof, are particularly useful for interfering with the initial physical interaction between a staphylococcal pathogen responsible for infection and a mammalian host, such as the adhesion of the bacteria to mammalian extracellular matrix proteins such as collagen, and this interference with the physical interaction may be useful both in treating patients and in preventing or reducing bacteria infection on in-dwelling medical devices to make them safer for use.
In another embodiment of the present invention, a kit which may be useful in isolating and identifying staphylococcal bacteria and infection is provided which comprises the antibodies of the present invention in a suitable form, such as lyophilized in a single vessel which then becomes active by addition of an aqueous sample suspected of containing the staphylococcal bacteria. Such a kit will typically include a suitable container for housing the antibodies in a suitable form along with a suitable immunodetection reagent which will allow identification of complexes binding to the CNA19 antibodies of the invention. For example, the immunodetection reagent may comprise a suitable detectable signal or label, such as a biotin or enzyme that produces a detectable color, etc., which normally may be linked to the antibody or which can be utilized in other suitable ways so as to provide a detectable result when the antibody binds to the antigen.
In short, the antibodies of the present invention which bind to the CNA19 region of a collagen binding protein of staphylococcal bacteria, and which can displace the attachment of staphylococcal bacteria of more than one species to a host cell, are thus extremely useful in treating or preventing staphylococcal infections in human and animal patients and in medical or other in-dwelling devices.
In addition, in accordance with the present invention, there is provided a method of identifying and isolating antibodies which exhibit displacing activity and which can be utilized to displace a bacteria that has become bound to a given site on a host cell. In the preferred method in accordance with the invention, a medium comprising a known site for bacterial binding attachment, such as surface protein of the extracellular matrix of a host cell (e.g., collagen, laminin, etc.), is first labeled with an appropriate detectable label, such as a radioactive label like 125l. Next, the labeled binding site medium, such as labeled collagen or other protein, which may be in immobilized form, is placed in contact with the appropriate bacteria known to bind to it, such as Staphylococcal bacteria including S. aureus and S. epidermidis, and left in contact with the bacteria for a time sufficient so that the bacteria will bind to the protein or other appropriate material from a binding site. Followed sufficient time for binding, the bacteria bound to the detectable label are preferably harvested, and then placed in a suitable medium wherein an antibody suspected of having displacement activity against the particular bacteria at that binding site can be introduced to the labeled bacteria. Following this step, it will be a routine
matter to determine which of the bacteria have been displaced from their binding sites, or the proteins which make up those binding sites, and thus identify and isolate those antibodies which have been able to effect such displacement. This method may be used with surface proteins, or other proteins or materials to which it is known that bacteria will attach, and in each case, an antibody which recognizes the binding medium can be tested to determine its displacing activity for bacteria attached to the binding medium. Antibodies which are identified and/or isolated using the present method, such as the CNA19 antibody which exhibits such displacement activity, thus constitute an additional part of the present invention
EXAMPLES
The following examples are provided which exemplify aspects of the preferred embodiments of the present invention. It should be appreciated by those of skill in the art that the techniques disclosed in the examples which follow represent techniques discovered by the inventors to function well in the practice of the invention, and thus can be considered to constitute preferred modes for its practice. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the invention.
EXAMPLE 1 : GENERATION OF MONOCLONAL ANTIBODIES AND
DEMONSTRATION OF DISPLACEMENT EFFECTS AND
CROSS-REACTIVITY
Bacterial strains, plasmids and culture conditions - Escherichia coli strain JM101 was used as a host and pQE-30 (Qiagen Inc., Chatsworth, CA) as an expression vector for cloning and expressing recombinant proteins. Staphylococcus aureus strain Cowan I was a clinical isolate from the Instituto Seroterapico Milanese (Milan, Italy) (18). S. aureus strains 57, 72, 116, 175, 176, 180, 203, 205, 212, and 4046 were clinical isolates from China, Europe, Hong Kong, Singapore and the United States. All these S. aureus isolates bind collagen (data not shown). E. coli strains were grown in
Lennox L Broth (LB) (SIGMA, St. Louis, MO63178) or on LB agar at 37°C
overnight with antibiotics when appropriate. Staphylococci were grown in Brain Heart Infusion (BHI) (DIFCO, Detroit, Ml 48232-7058) broth or on BHI
agar at 37°C overnight.
Generation of monoclonal antibodies - Monoclonal antibodies against CNA19 were produced essentially as described by Kohler and Milstein (29) with minor modifications. BALB/c mice were injected intraperitoneally five
times at 1-week intervals with 50 μg of the purified recombinant protein. The
antigen was emulsified with an equal volume of complete Freund's adjuvant for the first immunization, followed by three injections in incomplete adjuvant. The mice were bled and the sera were tested for reactivity to the purified CNA19 using ELISA and Western blot. For the final immunization the antigen was given in saline. Three days after, the lymphocytes isolated from spleens were fused with Spe/0 Ag.14 mouse myeloma cells at a ratio of 5:1 using 50% polyethyleneglycol 4000. The suspended cells were first grown and selected in high glucose DMEM/RPMI 1640 (1 :1) medium
(Sigma, St. Louis, Mo.) containing 2% hypoxantin/aminopterin/thymidine (HAT) (Sigma), 2% glutamine, 2% penicillin and streptomycin. After 1 week, the HAT medium was progressively replaced by culturing cloned hybridomas in a serum-free medium consisting of DMEM/RPMI 1640 supplemented with 1% (v/v) Nutridoma-SR (Boehringer Mannheim, Mannheim, Germany) and antibiotics. Supernatants of the cell cultures were screened by ELISA on day 10, and hybridomas positive for the antibodies against CNA19 were subcultured to a density of 1 cell per well by limiting dilution and further characterized by ELISA and Western blot. 16H9 was an mAb raised against CNA55 using the same method.
7E8 was an anti-His tag mAb generated using the same procedure.
Antibody purification and isotyping - Supernatants of hybridoma cells were collected and centrifuged. The antibodies were purified by using ammonium sulfate precipitation of the supernatant, followed by affinity chromatography on Protein A/G - Sepharose columns according to the recommendations ofthe manufacturer (Amersham Pharmacia Biotech).
Isotyping of the produced monoclonal antibodies (mAbs) was performed using a Mouse-Typer sub-isotyping kit (Bio-rad, Richmond, CA). Routine DNA manipulation and transformation of E. coli - DNA preparation, purification, restriction digestion, agarose gel electrophoresis and ligation were performed using standard methods (30) or following the manufacturer's instructions unless otherwise stated. Restriction enzymes, T4 DNA ligase and calf intestine alkaline phosphatase were from Life Technologies, GIBCO BRL (Gaithersburg, MD 20884-9980). DNA for
sequencing was prepared using the QIAprep Spin Miniprep kit (Qiagen). Routine preparation of E. coli competent cells and transformation of DNA into E. coli were performed by a one-step procedure (31).
Cloning of ace19 - The amino acid sequences of CNA55 and ACE40 were compared using ClustalW with the default parameters. The region from amino acid 152-318 in ACE40 was used to construct ACE19. Primers were designed to PCR amplify the corresponding nucleotide sequence (Table 1A) using Pfu DNA polymerase (Stratagene, La Jolla, CA 92037) according to manufacturer's instructions. The primers were designed such that the PCR product contained a BamHl site at its 5' end and a stop codon followed by a Sal\ site at its 3' end. The PCR product was digested with SamHI and Sal\ and purified. It was then ligated to BamHl and Sail digested and dephosphatased pQE-30 (Qiagen, Chatsworth, CA). The ligation mixture was transformed into E. coli JM101 and the cells were incubated on LB agar
plates supplemented with 50 μg/ml ampicillin at 37°C overnight to select for
transformants. The construct was confirmed by restriction enzyme digestions and further verified by DNA sequencing.
Generation of constructs containing chimeric sequences between ACE19 and CNA19 - Overlapping PCR strategy was used for the construction. Primers that span each corresponding junction region between ACE19 and CNA19 were designed (Table 1A). PCR reactions were carried out using the proper combination of primers and templates (Table 1B). The construction of chimera L was used as an example. Briefly, the primer to the 5' end of ace19, ACE19 5', and ACE19I which spans the junction region
between ACE19 and CNA19 were used to amplify the N-terminal quarter segment from ACE19. The corresponding CNA19 primers, CNA19I and CNA19 3' were used to amplify the C-terminal three-quarters segment from CNA19. PCR reactions were as described above for the cloning of ACE19.
After the reactions, 1 μl of a 5-fold dilution of each reaction were mixed and
used as templates for the second round PCR with primers ACE19 5' and CNA19 3'. Each construct was confirmed by DNA sequencing.
Expression of recombinant proteins in E. coli and protein purification - Protein expression and purification were described previously (14,21 ).
Briefly, one liter of LB (supplemented with 50 μg/ml ampicillin) was
inoculated with 40 ml of an overnight culture of a recombinant E. coli strain
and grown at 37°C for 3 hours. Isopropyl-β-D-thiogalactoside was added
and the culture was grown for another 3 hours to allow protein expression. Bacteria were harvested by centrifugation, the cell pellets were resuspended
in phosphate-buffered saline (PBS), pH 7.4, and stored at -80°C.
The pellets were thawed and lysed in a French press. The cell debris was removed by centrifugation and the supernatant filtered through a 0.45-
μm membrane. The supernatant was applied to a 5 ml Ni2+ - charged HiTrap
chelating column (Amersham Pharmacia Biotech) and bound protein was eluted with a 200-ml linear gradient of 0 - 200 mM imidazole in 4 mM Tris- HCl, 100 mM NaCl, (pH 7.9), at a flow rate of 5 ml/min. Fractions corresponding to each recombinant protein, as determined by SDS-PAGE, were pooled and dialyzed against HBS buffer (10 mM HEPES, 150 mM NaCl, pH7.4) containing 3.4 mM EDTA. Protein concentration was
measured on a Beckman DU-70 UV-visible spectrophotometer at λ280^15.
Molar extinction coefficient of each protein was calculated using values of Pace et al. (32).
Circular dichroism (CD) - Far-UV CD was performed as described (33) using a Jasco J720 spectropolarimeter. All sample concentrations were
either at 5 or 10 μM in 0.5%PBS. Spectra were recorded at room
temperature in cylindrical 0.5 mm path length cuvettes.
Enzyme-linked immunosorbent assay (ELISA).- Microtiter wells were
coated overnight at 4°C with 100 μl of 10 μg/ml of each recombinant protein
in 50 mM sodium carbonate, pH 9.5. To block additional protein binding
sites, the wells were treated for 1 h at 22°C with 200 μl of PBS containing
2% bovine serum albumin (BSA) and then washed five times with PBST (PBS with 0.1 % Tween 20). Indicated amounts of each mAb dissolved in
100 μl PBS with 2% BSA were added to the wells and incubated for 2 h at 22°C. Plates were then extensively washed with PBST and incubated for 1 h with a rabbit anti-mouse IgG conjugated to horseradish peroxidase (1 :500 dilution) (Dako, Gostrup, Denmark). After washing, binding was quantitated using the substrate o-phenylenediamine dihydrochloride (Sigma) and measuring the absorbance at 492 nm in a microplate reader (Bio-Rad). The concentration required for half-maximal binding of the antibody to CNA19 was used to calculate the apparent KD of each mAb. lodination of collagen - Type II collagen was prepared from bovine nasal septum as described by Strawich and Nimmi (34). Carrier-free 125l (15
mCi/μg) was from Amersham Pharmacia biotech. Collagen was labeled
using the iodogen coated-tube technique as recommended by the manufacturer (Pierce, Rockford, III). The specific activity of the radiolabeled
ligand was estimated to be 4x106 cpm/μg.
Inhibition of the collagen binding of CNA19 by the mAbs. - Microtiter wells were coated with CNA19 as in ELISA described above and then incubated with 125l-collagen (8x104 cpm) in the presence of certain amount of each mAb for 1 h. After extensive washing, the radioactivity in each well was
measured in a γ counter. The amount of radioactivity in each well was
compared to that of the well with no mAb. All experiments were done in duplicates.
Binding of collagen to staphylococci and the inhibition and displacement effects of the mAbs - Binding of 125l-labeled collagen to S. aureus cells was quantitated as described previously (35). Briefly, 5x108 S. aureus Cowan I cells were incubated with 5x104 cpm of 125l-collagen in 0.5 ml of PBS containing 0.1 % BSA and 0.1% Tween 80. The mixture was rotated in an end-over-end mixer for 1 h at 22°C. The reaction was stopped by the addition of 2.5 ml of ice-cold PBS containing 0.1 % Tween 80, and the tubes were centrifuged at 1400x g for 10 min. After aspiration of the
supernatant, the pellet was analyzed for radioactivity in a γ counter.
Radioactivity recovered in the tubes incubated in the absence of bacteria (400-600 cpm) was subtracted from that of the samples containing bacteria. Samples were run in duplicate.
To examine the inhibition effect of the mAbs on the binding to soluble collagen, bacteria were pre-incubated with increasing amounts of each mAbs for 1 h before the addition of 125l-collagen, and processed as above. To examine the displacement effect of the mAbs on collagen binding, bacteria were pre-incubated with 125l-collagen for 1 hour. After centrifugation, the supernatant was removed, the bacteria-collagen pellet was washed and resuspended in PBS containing 0.1% BSA and 0.1% Tween 80 with certain amounts of each mAb, and incubated for another hour. The amount of residual collagen bound to bacteria was determined as above. Adherence of S. aureus cells to immobilized collagen substrates and the inhibition and displacement effects of the mAbs. - Microtiter wells were
incubated with 100 μl of 10 μg/ml of type II collagen in 50 mM sodium
carbonate, pH 9.5, overnight at 4°C, and then subjected to blocking with 200
μl of 2 % BSA for 1 h at 22°C. After washing with PBST, the wells were
incubated with 100 μl of a suspension of Cowan 1(1x107 cells/ml) at 22°C for
2 h, and then washed extensively with PBST. Adherent cells were detected by incubation of the wells for 1 h with 100 μl of a horseradish peroxidase-
conjugated rabbit anti-mouse IgG (1 :500 dilution). Color development and measurement was as described above. To study the inhibition of bacterial adherence to immobilized collagen by the mAbs, cells were pre-incubated for 30 min with the indicated amounts of each antibody. The cells were transferred to the collagen-coated wells, incubated for 2 h and processed as above.
In the displacement experiments, bacteria were first incubated with collagen coated wells and then incubated with increasing concentrations of the indicated mAbs for 2h. The bacteria remained attached to collagen were detected by the addition of horseradish peroxidase-conjugated rabbit anti- mouse IgG as described above. In one experiment, the bacteria were also detected using horseradish peroxidase-conjugated goat anti-rabbit IgG, as well as crystal violet staining described previously (36).
Cross-reactivity of monoclonal antibodies generated against S. aureus CNA19 - Murine monoclonal antibodies generated against CNA19 from S. aureus were screened by ELISA for their ability to recognize intact S. epidermidis. As shown in Figure 9, mAb 11H11 recognized 5 different clinical isolates of S. epidermidis. Several other mAbs, including 3D3, 9A4, and 12H10, had lower but detectable binding.
EXAMPLE 2: CHARACTERIZATION OF MONOLCONAL
ANTIBODIES AND MAPPING OF EPITOPES
Initial characterization of monoclonal antibodies - 22 monoclonal antibodies against CNA19 were isolated. The isotype of each of the 22 mAbs raised against CNA19 and 16H9, which was raised against the full- length A domain of CNA, CNA55, was determined (Table 2). The majority of the mAbs were of lgGrk type, six were of lgG2a-k (2B3, 3D3, 7C2, 8H10, 11 D5, and 11 H11 ), and one (1 6) was of lgG2b-k type.
ELISA assays were carried out to determine the apparent KD values for CNA19 of each of the 22 mAbs and 16H9 (Table 2). The majority of the mAbs showed similar KD value, at the 10"9 M range. 5G4 showed a slightly
lower affinity with a KD of 2.9 x 10"8 M and 8E6 a slightly higher affinity with a KD of 7.5 x 10"10 M.
The percentage binding of 125l-collagen to immobilized CNA19 after the addition of 2 μg of each mAb was shown in Figure 1. The 22 mAbs
against CNA19 showed inhibitory effects on collagen binding of CNA19. Drastically reduced binding was observed upon the addition of these mAbs, while an anti-His-tag mAb, 7E8, did not inhibit binding. Except for 7E2, the mAbs inhibited collagen binding of CNA19 by at least 80%. 7E2 reduced binding by 57%. It seemed that there was not a direct correlation between the affinity of an mAb as determined by ELISA and its inhibition potency. Interestingly, mAb 16H9 showed the ability to enhance CNA19 binding to collagen (Figure 1).
Mapping of epitopes recognized by blocking mAbs - To map the antigenic epitopes recognized by the 22 blocking mAbs, a set of overlapping synthetic peptides were made. Each of the peptides was 25-amino acids long and the whole set spanned the entire CNA19 sequence. However, none of the peptides reacted with any of the mAbs in ELISA assays (data not shown). This suggested that the mAbs recognized conformational epitopes. In order to make longer peptides that were more likely to adopt the conformations as in CNA19, a set of GST fusion constructs, each of which encoded a stretch of 50 to 55 amino acids of CNA19 sequence, were also constructed and the fusion peptides purified. None of the mAbs reacted with these fusion peptides (data not shown), suggesting that the GST-fusion
peptides were still not able to fold into conformations that could be recognized by the mAbs.
Previous study by our group (14) showed that the amino acid sequence similarity between CNA and ACE, a collagen adhesin of £. faecalis, was primarily in the CNA19 region. The A domain (the binding
domain) of ACE was predominantly composed of β-sheets as determined by
its far-UV CD spectrum. When the corresponding region in ACE was analyzed using SwissModel, the predicted structure showed highly similar backbone conformation as that of CNA19 determined by X-ray crystallization. The corresponding region in ACE was then designated ACE19. Figure 2A showed the result of ClustalW alignment of the amino acid sequences of CNA19 and ACE 19 using the default parameters. The two sequences had 29% overall identity and 40% overall similarity. Higher
homology was observed in regions correspond to CNA19 β-strands A, B,
and H, and their flanking residues (7 out of 8, 8 out of 9 and 8 out of 13 residues, respectively, were similar). This is noteworthy since these strands form a major part of the collage-binding trench on one surface of CNA19
(20). The N-terminal portion of β-strands C and D were also highly similar,
however, the remaining parts of these strands were less homologous. ACE 19 was cloned and the purified ACE 19 protein was tested for its reactivity with the 22 anti-CNA19 mAbs as well as 16H9 and 7E8 in ELISAs. It was found that except for 7E8, it did not react with any of the mAbs (Table 3). Thus, ACE19 was used as an "inert" template for constructing chimeric
proteins with regions of CNA19 replaced by corresponding sequences from ACE19. These chimeras were then used to map the epitopes.
Initially, five chimeras containing approximately the N-terminal quarter (E), the N-terminal three-quarters (G), the central region (I), the C-terminal quarter (J) and the C-terminal three-quarters (L) of CNA19 sequence were generated (Figure 2B). These chimeric proteins expressed well in the expression system and were soluble. Their far-UV CD spectra showed similar patterns to those of CNA19 and ACE 19, suggesting similarities in the overall folding of these molecules (data not shown). The chimeras were tested with the each of the 22 anti-CNA19 mAbs in ELISA assays. Except for chimera E, they showed good reactivity with some of the mAbs but not others (Table 3). All five chimeras, CNA19 and ACE19 reacted with 7E8, an anti-His-tag monoclonal antibody. We note that except for chimera E, the number of mAbs recognizing each chimera was approximately in proportion to the length of CNA19 sequence within each protein. This was taken as indicating that chimera G, I, J and L presented CNA19 epitopes in proper conformation.
Chimera G reacted with 17 mAbs (1 F6, 2B1 , 2B3, 3D3, 5G4, 7C2, 7E2, 7G2, 8E6, 8H10, 9A4, 9F11 , 9G3, 9G7, 10G5, 11D5 and 11H11), but not with the remaining five (1 H1 , 3B12, 5D12, 5H1 and 12H10). Since in chimera G, the C-terminal quarter sequence of CNA19 was replaced by the relevant region of ACE19, the results suggested that the former 17 mAbs recognized epitopes at the N-terminal three-quarters of CNA19 from amino acid residue 151 to 284, whereas the latter five recognized epitopes at the
C-terminal quarter from amino acid 285 to 318 (Fig. 2B). Chimera I reacted with 13 mAbs (1 F6, 2B3, 3D3, 5G4, 7C2, 7E2, 7G2, 8E6, 8H10, 9A4, 9G7, 11 D5 and 11 H11), but not the others, suggesting that the 13 mAbs recognized epitopes at the central region of CNA19 while the remaining 9 were either at the N- or the C-terminal quarter. Similar reasoning was applied to chimera J and L. When the ELISA data of chimera G, I, J and L were combined, we were able to map the epitopes to different regions of CNA19. Eleven of the mAbs (2B3, 3D3, 5G4, 7C2, 7E2, 7G2, 8H10, 9A4, 9G7, 11 D5, and 11 H11) reacted with chimeras G, I, and L but not J, and therefore they were mapped to the central region of CNA19 from amino acid residue 187 to 284. 8E6, 9G3 and 10G5 reacted with chimeras G and L, but did not react with I or J, and they were mapped to the central region based on the region being common between the two chimeras. 8E6 and 9G3 were shown to react with chimera G, L and weakly with I in Western blot analysis (data not shown), consistent with the ELISA results. One of the mAbs, 1F6, reacted with chimeras G, I, and L, but also with J. Its reactivity with J, however, was weaker than that with G, I and L. Thus 1 F6 was tentatively mapped to the central half. This was also confirmed by Western blot analysis using 1F6 with different chimeras (data not shown). In all, fifteen mAbs were found to recognize epitopes at the central region of CNA19 from
residue 187 to 284 (the second residue of β-strand B to the last second
residue of β-strand H).
Five mAbs (1 H1 , 3B12, 5D12, 5H1 and 12H10) reacted with chimeras J and L, but not with G or I, thus they were mapped to the C-terminal quarter
of CNA19 from residue 283 to 318 (the last second residue of β-strand H to
the 3' end). Based on reactions with chimera G, but not with I, J or L, mAbs 2B1 and 9F11 were mapped to the N-terminal quarter of CNA19 from residue 151 to 193. However, they did not react with chimera E. This could
be due to the high sequence similarity around β-strands A and B region
between CNA19 and ACE19, resulting in a chimeric protein that was predominantly ACE19, and therefore the epitopes at the N-terminus in chimera E may not be presented in proper conformation.
To further map the epitopes, a second set of chimeras (N to X) was constructed. In chimeras N to V, the CNA19 sequence (from the N-terminal starting point of CNA19 sequence in chimera L towards the C-terminal end point of CNA19 sequence of chimera G) was gradually replaced by corresponding regions of ACE19. However, these chimeras showed varying degrees of poor solubility. When they were tested with the mAbs, only chimera N (Fig. 2B) showed reactions with relatively reasonable number of mAbs and its reactivity was lower than those observed for chimeras G, I, J and L (Table 3). Thus chimeras O to V were not further discussed. Chimera W and X were constructed to further map the epitopes mapped to the C- terminal quarter region of CNA19 (Fig. 2B) and they had good solubility. W showed reactivity with a large number of mAbs suggesting that it presented the epitopes properly (Table 3). Chimera X did not react with any of the mAbs, possibility due to a similar reason discussed for chimera E, that X contains very little CNA19 sequence.
The results from chimera W fully supported the conclusions obtained from the results of chimera G, I, J and L. All the 15 mAbs mapped to the central region and the two to the N-terminal quarter reacted with chimera W, while none of the five mAbs to the C-terminal quarter did, confirming the mapping results. Furthermore, the results suggested that the five mAbs previously mapped to the C-terminal quarter, recognized epitopes located within the last 21 amino acid residues at the very C-terminal end of CNA19.
The results from chimera N were largely consistent with previous conclusions. It reacted with 14 of the 15 mAbs mapped to the central region and did not with the two to the N-terminal quarter. The mAb in the central region that did not react with N was 10G5, which did not react well with some other chimeras either. One possibility was that 10G5 was extremely sensitive to changes in the conformation of the relevant epitope(s), so that slight variations led to loss of the reactivity. The other possibility was that the
epitope(s) recognized by 10G5 was located at residue 187 to 207 (β-strand
B to middle of β-strand C). The five mAbs mapped to the C-terminus of
CNA19 did not react with chimera N, however, this was interpreted as due to improper folding of the relevant epitopes in chimera N, since the results from chimeras G, I, J, L and W clearly localized them to the C-terminus. 16H9, one of the mAbs that raised against CNA55, was found to react with CNA19, chimera G, I, L, N (weakly) and W. Thus, 16H9 was also
mapped to the central half of CNA19 (Table 3).
In conclusion, the 22 inhibiting mAbs raised against CNA19 recognized conformationally-dependent epitopes and these epitopes were
located throughout CNA19 (Figure 3). This suggested that the entire molecule was involved in its interaction with collagen, either by directly contacting specific residues in collagen, or by adopting the proper conformation necessary for the accommodation ofthe collagen triple helix. The 22 monoclonal antibodies inhibited collagen binding of S. aureus strain Cowan I - In order to see if the functionally relevant epitopes, mapped using the mAbs and the chimeras, were present in the full-length native protein displayed on S. aureus cell surface, we examined the ability of the mAbs to inhibit collagen binding of S. aureus strain Cowan I which expresses CNA, in liquid phase binding assays. All 22 mAbs inhibited Cowan I binding to soluble 25l-collagen, while 16H9 the anti-His-tag mAb, 7E8, did not (Figure 4), indicating that the epitopes were present on the surface of Cowan I. A rough correlation between the ability to inhibit CNA19 and Cowan I binding to collagen was observed. For example, mAbs 9G7 and 11H11 , two of the good inhibitors of CNA19, also inhibited Cowan I binding to collagen effectively (Figure 5), binding was almost completely
inhibited with 1 μg of the antibody. 8E6, a moderate inhibitor of CNA19,
inhibited collagen binding of Cowan I less effectively, binding was reduced
by only over 50% with 0.5 μg of 8E6, and greater inhibition was observed
with the use of over 2.5 μg antibody (Figure 5). 16H9 did not inhibit Cowan I
binding to soluble collagen (Figure 4).
To examine if the mAbs could inhibit the adherence of S. aureus, the inhibitory effect of several mAbs on Cowan I attachment to immobilized collagen was also examined (Figure 6). Of the ones tested, all showed
inhibitory activity although to various extent, and the results were consistent with those observed for soluble collagen. For example, 9G7 and 11H11 inhibited the attachment of Cowan I to collagen effectively, while 8E6 did poorly. 16H9 did not inhibit bacteria attachment as expected (Figure 6). Cross-reactivity of monoclonal antibodies generated against S. aureus CNA19 - As shown above, the cross-reactivity of murine monoclonal antibodies raised against S. aureus CNA19 was established by virtue of ELISA screening which tested the their ability to recognize intact S. epidermidis. As shown in Figure 9, mAb 11 H11 recognized 5 different clinical isolates of S. epidermidis. Several other mAbs, including 3D3, 9A4, and 12H10, had lower but detectable binding. Accordingly, the cross- reactivity of antibodies raised against S. aureus so as to be useful against S. epidermidis has been shown, and thus the CNA19 antibodies discussed herein can be useful against a plurality of Staphylococcus bacteria. Displacement of S. aureus Cowan I from collagen by the mAbs -
To test the possibility if the inhibiting mAbs could displace S. aureus from preformed collagen-bacteria complex, S. aureus Cowan I was incubated with 125l-collagen for an hour to allow the formation of the complex. Various amounts of mAbs were then added to the washed complex, and the decrease of 125l in the cell pellet was taken as indicating the dissociation of the collagen-bacteria complex.
All the mAbs were able to release collagen from collagen-bacteria complex to various extents, while anti-His tag antibody 7E8 and 16H9 were
not. The residual collagen binding after the addition of 1 μg and 5 μg of each
mAb was shown in Figure 7. mAbs 1F6, 1H1 , 2B1 , 3B12, 5D12, 5H1 , 7E2, 7G2, 9A4, 9G3, and 9G7 were able to release at least 86% of bound
collagen with 1 μg antibody, and at least 96% bound collagen with 5 μg
antibody. 9F11 and 12H10 were able to release 54% and 72% bound
collagen with 1 μg antibody and 95.3% and 95.5% collagen with 5 μg
antibody, respectively. The other mAbs were not as potent displacers as the ones mentioned above, 5G4, 8E6, 8H10, 10G5, 11D5 and 11H11 were able
to release 8%, 14%, 24%, 46%, 12%, and 36% collagen with 1 μg antibody,
50%, 50%, .79%, 71%, 48%, and 53% collagen with 5 μg antibody,
respectively. There was not a consistent correlation between the ability of the mAbs to release collagen from collagen-bacteria complex and the effectiveness of the mAbs to inhibit collagen binding. Among the good inhibitors, some (such as 3B12 and 9G7) were also good displacers, while others (such as 8H10 and 11 H11) were poor displacers. Poor inhibitors generally showed poor displacing activities. The displacing effects of 9G7, 11H11 , 8E6 and 16H9 at various concentrations were shown in Figure 8A.
To test whether the mAbs could detach S. aureus from the surface of immobilized collagen, several mAbs were examined. Cowan I was first allowed to adhere to immobilized collagen and then increasing amount of the mAbs were added. Bacteria that remain attached were detected by using rabbit-anti mouse antibodies. The results were consistent with those from the displacement of soluble collagen from bacteria-collagen complexes. For example, 9G7 again showed strong displacing capability while 11 H11 and 8E6 remained to be moderate or poor displacers and 16H9 did not
displace (Figure 8B). The ability of mAb 9G7 to displace Cowan I from the surface of immobilized collagen was assayed again using a different type of secondary antibody (goat-anti rabbit), or crystal violet for the detection of bacteria. Similar results were obtained (data not shown).
EXAMPLE 3: IN VITRO DEMONSTRATION OF MAB EFFICACY
Antibody Scale-up and Purification
Hybridoma cells were grown in RPMI/DMEM, 1X Nutridoma-SP media containing 2mM sodium pyruvate, 4mM L-glutamine and 2X penicillin- streptomycin to 2-3 liter culture volumes. Hybridoma supernatants were then harvested by centrifugation. The supernatants were filtered through
0.45 μM filters and the IgG was affinity purified using protein G
chromatography. The monoclonal antibodies was eluted using 0.1 M glycine, pH 2.7 and immediately neutralized with one tenth volume of 2M Tris, pH 8.0. The purified IgG was then dialyzed against 1X D-phosphate buffered saline, pH 7.4. If needed, the purified antibody was concentrated and aliquots frozen.
S. aureus
S. aureus strain Barnett was isolated from a patient with osteomyelitis. S. aureus bacterial cells from a frozen glycerol stock were streaked onto a single blood agar plate. Single colonies from the initial plate were then restreaked on approximately 30 blood agar plates and placed in the 37° C incubator for 24 hrs. The bacteria were scraped off the plates and
placed in a 50ml tube containing 10 mis of sterile 1x PBS and gently vortexed to remove the bacteria from the scraper. After scraping all plates an additional 10 mis sterile 1X PBS was added and the bacterial suspension was vortexed vigorously to facilitate separation of any agar debris from the bacteria. The bacterial suspension was then centrifuged at 3500xg at 4°C for 10 minutes in the RC3C centrifuge. The supernatant was decanted and the bacterial pellet was resuspended in 20 mis of sterile 1X PBS. The pellet was washed twice with PBS. Finally, the bacterial pellet was resuspended in 10 mis freezing media (1x D-PBS, pH 7.4; 10% DMSO; 5% BSA) and then add the additional volume of freezing media for desired volume and 1 ml aliquots were snap frozen in ethanol/dry ice bath and placed in a -80 ° C freezer. On the day of injection, the frozen bacterial stock was thawed and diluted 1 :20 in sterile PBS. An aliquot of the challenge inoculum was plated on blood agar plates to determine the actual CFUs.
Animal Sex, Species, Number, Age and Source
Female Balb/C mice (5-6 weeks of age) were purchased from Taconic Quality Laboratory Animals and Services for Research (Germantown, NY). Animals were allowed to acclimate for at least 14 days prior to initiation of treatment. Upon arrival, the mice were examined, group housed (5 / cage) in polycarbonate shoe box cages with absorbent bedding. All mice were placed on a 12 hour light-dark cycle under the required husbandry standards found in the NIH Guide for the Care and Use of
Laboratory Animals.
Identification and Randomization
All animals were uniquely identified using tail tattoos prior to dosing. Prior to initiation of treatment, the animals were individually weighed and their health was evaluated. Mice were randomized and assigned to treatment groups using stratified body weights.
Experimental Design
On Day -1 , animals were treated with a single 0.5 ml IP injection of
monoclonal antibody 9G3, 3B12, or were untreated. On Day 0, « 7 X107
CFU S. aureus were administered by a single IV injection (0.1 ml) to all animals via the tail vein.
Twenty-four hours after IgG administration, the mice were challenged with a single intravenous (IV) injection of S. aureus (Strain Barnett). The mice were followed for 10 days at which point all remaining mice were sacrificed. Significant differences in the survival times between treatment groups were detected. In the first experiment sixty-seven percent (20/30) of the mice that received 9G3 (p=0.0002 vs. control; Mantel-Cox test for survival time) survived the bacterial challenge. Only 20% (4/18) of the untreated mice treated survived the entire study period (Figure 10). In the second experiment seventy percent (14/20) of the mice that received 3B12 (p=0.03 vs. control; Mantel-Cox test for survival time) survived the bacterial challenge (Figure 11). In contrast, only 27% of the control mice survived the ten day study. These results clearly indicate that MSCRAMM specific
monoclonal antibodies provide a significant level of protection against lethal infection of S. aureus.
EXAMPLE 4: SEQUENCE INFORMATION
Isolation and Sequencing of Variable Region Sequences:
Sequences for both the variable light chain and the variable heavy chain of a monoclonal antibody for CNA19 were determined as follows:
Messenger RNA was isolated from CNA 3B12 hybridoma cells using the Fast Track 2.0 kit (Invitrogen; catalog # K4500). Briefly, 1.4x108 hybridoma cells cultured in DMEM-10 medium with 10 % FBS were washed with PBS, pelleted by centrifugation then lysed in detergent containing Protein/RNase Degrader. PolyA* mRNA was isolated by affinity purification on oligo-dT cellulose. Synthesis of first strand cDNA was accomplished using 5 μg of mRNA and reverse transcriptase in a cDNA synthesis kit (Novagen; catalog # 69001-3) containing 20 pmol of 3' oligonucleotide mouse-specific primers (Novagen; catalog #'s 69796 and 69812) for each variable heavy and variable light chain. A portion (5 to 50 ng) of the cDNA was amplified by the polymerase chain reaction (PCR) using the PCR Reagent System (Life Technologies; catalog #10198-018) and a mouse variable heavy and light chain specific primer set (Novagen; catalog # 70081-3, 5 pmol each) for 30 cycles (94 C hot start, then cycles of 94 C for 1 min, 50 C for 1min and 72 C for 1min). PCR products were fractionated electrophoretically in a 1% ultra pure agarose gel in sodium acetate buffer and visualized by ethidium bromide staining. PCR fragments matching the
predicted size were excised from the gel and purified using BIO 101 Geneclean spin columns (catalog #1101-400) for ligation into the pCR2.1- TOPO (Invitrogen) plasmid, followed by transformation into competent TOP10 E. coli. (Invitrogen; catalog #K4500). After isolating plasmid DNA using QIAprep Spin Miniprep Kit (QIAGEN; catalog #27106), positive clones with inserts were identified by restriction endonuclease digestion and agarose gel electrophoresis, followed by sequencing on an ABI automated sequencer using M13 Forward and M13 Reverse primers. The resulting sequences were as follows:
3B12VLG-4 (variable light sequence)
GAAGTTGTGATGACCCAAACTCCACTCTCCCTGCCTGTCAGTCTTGGC GATCACGCCTCCATCTCTTGCAGATCTAGTCAGCGCCTTGTACACAGTA ATGAAAACACCTATTTACATTGGTATCTGCAGAAGCCAGGCCAGTCTCC AAAGCTCCTGATCTACAAAGTTTCCAACCGATTTTCTGGGGTCCCAGAC AGGTTCAGTGGCAGTGGATCAGGGACAGATTTCACACTCAAGATCAGC AGAGTGGAGGCTGAGGATCTGGGAGTTTATTTCTGCTCTCAAAGTACG CATGTTCCTCCCACGTTCGGAGGGGGGACCAGGCTGGAAATAAAA EVVMTQTPLSLPVSLGDHASISCRSSQRLVHSNENTYLHWYLQKPGQSPK LLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPP TFGGGTRLEIK
Amino acids representing a CDR are underlined
3B12VHB-1 (variable heavy sequence)
CAGGTTCAGCTGCAGCAGTCTGGAGCTGAGCTGATGAAGCCTGGGGC CTCAGTGAAGATCTCCTGCAAGGCTGCTGGCTACACATTCAGTCCCTAC TGGATAGAGTGGTTAAAGCAGAGGCCTGGACATGGCCTTGAGTGGATT GGAGAGATTTTACCTGGAAGTGGAAATATTAACTACAATGAGAAGTTCA AGGACAAGGCCACATTCACTGCTGATACATCCTCCAACACAGTTTACAT GCAAGTCAGCAGCCTGACATCTGAGGACTCTGCCGTCTATTACTGTGC AAGAGAGGAGGATGGTTACCCGGCCTGGTTTGCTTACTGGGGCCAAG GGACTCTGGTCACTGTCTCTGCA
QVQLQQSGAELMKPGASVKISCK GYTFSPYWΠΞWLKQRPGHGLEWIG
EILPGSGNINYNEKFKDKATFTADTSSNTVYMQVSSLTSEDSAVYYCARFF
DGYPAWFAYWGQGTLVTVSA
• Amino acids representing a CDR are underlined
EXAMPLE S: FURTHER CHARACTERIZATION OF mAb's
GENERATED AGAINST CNA19 A. Blocking activity of mAbs generated against CNA19 [CBD (151- 318)] on adherence of S. aureus to immobilized collagen.
As described above, all of the members of the mAbs raised against the CNA19 region, or residues 151-318 of the collagen binding domain (CBD), inhibited binding of 125l-collagen to cells of S. aureus Cowan I. When bacteria were assayed for the ability to attach to collagen in the presence of increasing concentrations of each mAb, it was found that the antibodies 3B12, 3D3, 8E6, 11 H11 , 12H10, 7C2, 9G7, and 5G4 blocked staphylococcal adherence. The inhibitory activity of mAbs 9G7, 7C2 and 3B12 appeared more effective as compared to the antibody 8E6, as indicated in Figures 12A and 12B.
B. Displacement of collagen complexed with S. aureus cells by mAbs.
To examine the role of each mAb in displacing collagen from the bacteria-collagen complex, 125l-labeled collagen was initially allowed to bind S. aureus cells. Bacteria were harvested by centrifugation and then added and incubated with increasing concentrations of each antibody. Finally, the
radioactivity bound to the cells was determined in a γ counter. In these
experimental conditions a large portion of the 125-l collagen bound to the
bacteria could be displaced from the cells by addition of each mAb. The monoclonal antibodies 1F6, 1 H1 , 2B1 , 3B12, 9A4 and 9G7 showed to be very effective displacers, whereas the mAbs 5G4, 8E6, 11 D5 and 11 H11 weakly affected dissociation of the ligand from the bacterial cells (see Figs. 12A, 12B, and 13).
The time course of the displacement reaction conducted with mAb 3B12 is shown in the inset of Fig. 13 inset. Bacteria were first incubated with 125l-labeled collagen. Subsequently, staphylococci were harvested by
centrifugation, added to 1 μg of the mAb 3B12 and incubated for increasing
periods of time. Following 5 min. incubation, a rapid displacement of the majority of the radiolabeled ligand was observed.
The dissociation of the bacteria-ligand complexes by the mAbs could also be demonstrated in an assay where staphylococci were allowed to adhere to immobilized collagen (Figs. 14A-C). When increasing concentrations of the mAbs 3B12, 3D3, 7C2, and 9G7 were added to S. aureus cells adhering to immobilized collagen, bacteria were promptly displaced from the wells. The antibodies 12H10 and 11H11 promoted a moderate displacement, wherein mAbs 8E6 and 5G4 poorly dissociate the complex. To gain further insights on the displacement reaction, the KD values for each mAb were determined as shown in Table 2. Mabs having a relatively low affinity for CBD (151-318) exhibited a strong displacement activity and vice versa. Thus, the efficiency with which each mAb displaces the ligand from the bacteria-collagen complex does not seem to correlate
with the KD values. Conversely, these data support the concept that CNA19 (CBD 151-318) may have low and high affinity conformational states and that "displacer antibodies" could, stabilize the low conformational state. However, it cannot be excluded that binding of "displacer antibody" to CNA19 induces a conformational change to the trench which results in a state incompatible with ligand binding.
Whatever the mechanism may be, this information highlights the clinical significance and the therapeutic value of the monoclonal antibodies to CNA19 in accordance with the present invention, particularly antibodies 3B12, 3D3, 7C2 and 9G7, which effectively inhibit and displace the ligand from bacteria. Thus it is contemplated in accordance with the present invention that these antibodies will be useful both In prophylactic methods as well as methods of treating patients affected by S. aureus and S. epidermidis infections.
EXAMPLE 6: ADDITIONAL FAMILIES OF CBD ANTIBODIES AND
REACTIVITY TO THE CNA19 REGION
A. Properties of mAbs against CBD (30-529).
A new family of mAbs against CBD (30-529) (or M55) was generated,
and eight stable hybridomas were obtained that produced and secreted antibodies which reacted with the recombinant A domain of CNA. The class of antibodies is reported in Table 4. The relative reactivity of the different mAbs to the antigen was assessed in an enzyme-linked immunosorbent assay (ELISA) where the full length A domain of CNA was coated in microtiter wells and incubated with increasing concentrations of each mAb. The amount of the antibody bound to the adsorbed antigen reached a
plateau and the apparent KD (dissociation constant) values for these interactions were estimated from the concentrations required for half- maximal signal (Table 5).
B. Localization of the epitopes recognized by the different mAbs. To localize the epitopes recognized by the generated mAbs, different segments of the A domain were tested for their ability to support antibody binding in ELISA and Western blot. As expected, the results of these experiments revealed that all the mAbs reacted with the native receptor (except the antibody 1C9) and CBD (50-329). Three mAbs, 2B8, 16H9 and 1C9, also reacted with CBD (61-343) and CBD (151-318) (CNA19). Moreover, 2B8 and, to a minor extent, 1C9, recognized the corresponding epitopes in CBD (151-297) (Table 6). To further locate the antigenic determinants for the mAbs which reacted with the CBD (151-318) CNA19 domain in the initial mapping, a series of GST-CNA derivatives spanning the CBD (151-318) segment of the collagen adhesin were constructed. None of the recombinant proteins obtained were recognized in ELISA by the mAbs 16H9 and 2H8 although they showed good reactivity toward a serum containing IgG raised against CBD (151-318), as shown in Fig. 15A. Together, these data suggest that these epitopes are conformational. To map conformational epitopes in CBD (151-318) for the mAbs 2B8 and 16H9, five chimeras consisting of segments of ACE19 (174-319) and CNA19 (151-318) were constructed. As shown in Fig. 15B, the reactivity of chimeras G, I and L for the antibody 16H9 suggests the localization of the antibody-binding site in the central half of CBD (151-318). The exclusive
recognition of chimera L by 2B8 indicates the epitope location in the central half of the fusion protein. Alternatively, the possibility cannot be ruled out that the antigenic determinant maps to the C-terminal end of CBD (151- 318). In both cases, a role of the flanking regions in inducing epitope formation seems to be required.
C. Effect on mAbs on ligand binding.
The anti CBD (30-529) mAbs were examined for their effects on collagen binding to S. aureus cells. Binding inhibition assay was used in which bacteria and 125l-collagen were incubated in the presence of each mAb. Only mAbs 2B8 and 1A11 inhibited binding of the ligand to staphylococci at some extent (Fig. 15C). MAbs 2B8 and 1A11 inhibited collagen binding to S. aureus up to 60% and, when combined together at highest concentrations, blocked ligand binding almost completely. The two mAbs also shared the property to moderately displace collagen from bacterial-collagen complexes (Fig. 15D).
EXAMPLE 7: MONOCLONAL ANTIBODY 3B12 RECOGNITION OF
NATIVE CNA EXPRESSED BY S. AUREUS CLINICAL ISOLATES.
Method Summary:
Bacterial Preparation - 10ml tryptic soy broth overnight cultures were prepared from a single colony off a streak plate prepared from frozen stocks. The following morning 10 ml of tryptic soy broth was inoculated with 50ul of
overnight stock and grown for three hours. All cultures were stored on ice after growth period. All cultures were normalized to approximately the same OD.
Blocking of Protein A - All cultures were incubated for 30 minutes on ice in 10ml of a 1 :100 dilution (0.116 mg/ml) of rabbit IgG in 1x PBS. Bacteria were washed once in 10 cold 1X PBS by centrifugation at 3000 rpm for 10 minutes. They were resuspended in 2.5% BSA in 1x PBS (PBSA) and stored on ice.
Antibody Preparation - 10mls of 8 μg/ml mAb in PBSA were prepared for
each antibody and supernatant. Solutions were stored on ice
Primary Ab Incubation - The assay was performed in 144 titertubes for
ease in handling. Using a multi-channel pipette, 20 μl of bacteria were
added each tube. 0.5ml of 8μg/ml Ab solution was then added to the
designated tubes. All tubes were vortexed and incubated on ice for 30 minutes. Following the incubation each tube was vortexed and then centrifuge in plate rotor at 3000 RPM for 10minutes. The supernatant was decanted by hand for each tube. The bacteria were washed twice in cold PBSA.
Secondary PE F(ab')2 Incubation - Each tube received 0.5ml of a 1 :200 dilution of secondary antibody. The bacteria were resuspended and mixed
by vortexing. The tubes were incubated on ice for 30 minutes vortexing twice at ten minute intervals. Following this incubation the bacteria were washed twice with a final resuspension in PBSA. The tubes were stored on ice until FACS analysis.
FACS Analysis - Each titertube (144) was transferred to a 12 x 75 mm flow tube. The instrument was calibrated and the FL-2 detector was adjusted so that the isotype control PE emission was detected in the first decade of the FL-2 histogram scale.
Staining Profiles - The histogram representations of Figs. 16A-D illustrate the staining profiles of each strain at 3hr and overnight culture time points with each monoclonal.
Results - These tests provided examples of recognition of native collagen MSCRAMM on S. aureus strains by mAb 3B12 in accordance with the present invention.
Table 1 A. Oligonucleotide primers used in this study.
Primers Sequence 5' - 3' #
CNA 19 5' GAAGGATCCATAACATCTGGGAATAAATC
CNA19 3' GTTGTCGACΓC 1 ATTGTGC AC AGTATG
ACE19 5' GAAGGATCCACAGCAACGGCGACTC
ACE19 3' GTTGTCGACTT ATTTTTAACCTGTGATG
ACE19E CATGTACGATGGTTTTTAAATGTGAAC
M19E ATTTAAAAACCATCGTACATGTGTCGTATC
M19G TTGGCCTGCTTCTGTGATTTTGGTTTTGTAGTTAAT
ACE19G ATT ACTACAAAACCAAAATCACAGAAGCAGGCCAA
M19I TCAAATCAAGTACGTTGGTTTTTAAATATTAAC
ACE19I GTTAATATTTAAAAACCAACGTACTTGATTTGA
M19J GTCCGTTACACTTCGACAATTACGAATGAACAGCAA
ACEI 9J TTGCTGTTCATTCGTAATTGTCGAAGTGTAACGGAC
M19N GAAGATATTTCAATTAAGGATCAGATTCAAGGTG
ACE19N TTGAATCTGATCCTTAATTGAAATATCTTCTGTG
M 19 W GTTTAGTTGATAATTAGCTTGTG AATTATTAACAA AC
ACE 19 AATAATTCAC AAGCTAATTATC AACTAAAC AATC AAG
M 19X AATAGTTATGACATCTGGTATC AAG AGCATGGTAAG
ACE 19X ATGCTCTTGATACCAGATGTCATAACTATTTTC
# Boldface letters indicate sequences from CNA 19, underlined letters and italicised letters indicate restriction sites and stop codons added for cloning purposes.
Table IB. Combination of primers and templates used for the construction of chimeras.
Chimeras First round PCR Second round PCR
Segment 1 Segment 2
Template Primers Template Primers Primers
ACE19 ACE19 5' CNA19 CNA19E ACE19 5'
ACE19E CNA19 3' CNA19 3 '
G CNA19 CNA19 5' ACE19 ACE19G CNAI9 5'
CNA19G ACE19 3 ' ACE19 3 :
ACE 19 ACE19 5' ChimeraG CNA 191 ACE19 5'
ACE 191 ACE19 3' ACE19 3' J ACE19 ACE19 5' CNA19 CNA19J ACE19 5'
ACE19J CNA19 3' CNA19 3' L ACE19 ACE19 5' CNA19 CNA19I ACE19 5'
ACE 191 CNA19 3' CNA19 3 ' N ACE19 ACE19 5' CNA19 CNA19N ACE19 5'
ACE19N CNA19 3' CNA19 3' W CNA19 CNA19 5' ACE19 ACE19W CNA19 5'
CNA19W ACE19 3' ACE19 3' X ACE19 ACE19 5' CNA19 CNA19X ACE19 5'
ACEI9X CNA19 3 ' CNA 19 3 '
Table 2. Summary ofthe isotypes and the apparent KD values ofthe mAbs.
Antibody Isotype KD(M)
1F6 IgG2b-k 6.7 x 10-9
1H1 IgG,-k 1.67 x 10"9
2B1 IgGrk ] χ l0'9
2B3 IgG2a-k 2.1 x 10"9
3B12 IgG.-k 4.5 x 10"9
3D3 IgG2a-k 1.2 x 10"9
5D12 IgG.-k 6.45 x 10"9
5G4 IgG.-k 2.9 x 10-8
5H1 IgG.-k 7.5 x 10-9
7C2 IgG2a-k 2.73 x 10"9
7E2 IgGrk 1.8 x 10"9
7G2 IgGrk 1.15 x 10"9
8E6 IgG.-k 7.5 xlO"10
8H10 IgG2a-k 1.3 lO"9
9A4 IgGrk 2x 10'9
9F11 IgGrk 1.28 x 10"9
9G3 IgGrk 1.02 x 10"9
9G7 IgGrk 1.03 x 10"9
10G5 IgG.-k 2.17 x 10"9
11D5 IgG2a-k 2.17 x 10'9
11H11 IgG2a-k 3x l0"9
12H10 IgG.-k 1.46 x 10 -9
16H9 IgGrk 5x 10 -9
Table 3. Reactivity of he mAbs against CNA 19, ACE 19 and the chimeras mAb CNA19 ACE19 E N W
7E8' + + + + + + + + + + 1F6 + 1H1 2B1 2B3 + + 3B12 + 3D3 + + + + 5D12 + + 5G4 + + + (+) 5H1 + + 7C2 + + + + 7E2 + + + + + + 7G2 + + + + + + 8E6 + + (+) + + +
8H10 + + + + + + 9A4 + + + + +
9F11 + 9G3 + (+) + 9G7 + + +
10G5 (+) (+)
11D5
11H11 + + + + + +
12H10 + + +
16H9 + + + + (+) +
Total number of reacting 24 19 16 7 22 16 19
mAbs
'The reactivities were determined using ELISA assays. 27E8 is an anti-His tag monoclonal antibody. The number includes positive reactions with 7E8. Parentheses indicate weak reactions in ELISA assays.
Table4. Isotyping of mAbs generated against CBD (30-529).
Table 5. Relative reactivity of monoclonal antibodies raised against CBD (30- 529).
The apparent KD (dissociation constant) values were estimated from the concentration required for half-maximal signal.
Table ύ'. Mapping ofthe epitopes for the monoclonal antibodies generated against CBD (30- 529).
References
1. Voytek, A., Gristina, A. G., Barth, E., Myrvik, Q., Switalski, L, Hook, M., and Speziale, P. (1988) Biomaterials 9, 107-110
2. Switalski, L, Patti, J. M., Butcher, W., Gristina, A. G., Speziale, P., and Hook, M. (1993) Mol. Microbiol. 7(1 ), 99-107
3. Patti, J. M., Bremell, T., Krajewska-Pietrasik, D., Abdelnour, A., Tarkowski, A., Ryden, C, and Hook, M. (1994) Infect. Immun. 62(1 ), 152-161
4. Nilsson, l.-M., Patti, J. M., Bremell, T., Hook, M., and Tarkowski, A. (1998) J. Clin. Invest. 101(12), 2640-2649
5. Carnoy, C, and Moseley, S. L. (1997) Mol. Microbiol. 23(2), 365-379
6. Schulze-Koops, H., Burkhardt, H., Heesemann, J., Mark, K. v. d., and Emmrich, F. (1992) Infect. Immun. 60(6), 2153-2159
7. Tamm, A., Tarkkanen, A.-M., Korhonen, T. K., Kuusela, P., Toivanen, P., and Skurnik, M. (1993) Mol. Microbiol. 10(5), 995-1011
8. Schulze-Koops, H., Burkhardt, H., Heesemann, J., Mark, K. v. d., and Emmrich, F. (1995) Arthritis & Rheumatism 38(9), 1283-1289
9. Sebghati, T. A. S., Korhonen, T. K., Homick, D. B., and Clegg, S. (1998) Infect. Immun. 66(6), 2887-2894 10. Switalski, L. M., Butcher, W. G., Caufield, P. C, and Lantz, M. S. (1993) Infect. Immun. 61(10), 4119-4125 11. Love, R. M., McMillan, M. D., and Jenkinson, H. F. (1997) Infect.
Immun. 65(12), 5157-5164
12. Podbielski, A., Woischnik, M., Leonard, B. A. B., and Schmidt, K.-H. (1999) Mol. Microbiol. 31 (4), 1051 -1064
13. Holmes, A. R., Gilbert, C, Wells, J. M., and Jenkinson, H. F. (1998) Infect. Immun. 66(10), 4633-4639 14. Rich, R. L., Kreikemeyer, B., Owens, R. T., LaBrenz, S., Narayana, S.
V. L., Weinstock, G. M., Murray, B. E., and Hook, M. (1999) J. Biol.
Chem. in press 15. Roos, S., Aleljung, P., Robert, N., Lee, B., Wadstrom, T., Lindberg,
M., and Jonsson, H. (1996) FEMS Microbiol. Lett. 144, 33-38 16. Gripenberg-Lerche, C, Skurnik, M., Zhang, L., Soderstrom, K.-O., and Toivanen, P. (1994) Infect. Immun. 62(12), 5568-5575
17. Roggenkamp, A., Neuberger, H.-R., Flugel, A., Schmoll, T., and Heesemann, J. (1995) Mol. Microbiol. 16(6), 1207-1219
18. Speziale, P., Raucci, G., Visai, L., Switalski, L. M., Timpl, R., and Hook, M. (1986) J. Bacteriol. 167(1), 77-81
19. Patti, J. M., Boles, J. O., and Hook, M. (1993) Biochemistry 32(42), 11428-11435
20. Symersky, J., Patti, J. M., Carson, M., House-Pompeo, K., Teale, M., Moore, D., Jin, L., Schneider, A., DeLucas, L. J., Hook, M., and Narayana, S. V. L. (1997) Nature structural biology 4(10), 833-838
21. Patti, J. M., House-Pompeo, K., Boles, J. O., Garza, N., Gurusiddappa, S., and Hook, M. (1995) J. Biol. Chem. 270(20), 12005-12011
22. Emsley, J., King, S. L., Bergelson, J. M., and Liddington, R. C. (1997) J. Biol. Chem. 272(45), 28512-28517
23. Nolte, M., Pepinsky, R. B., Venyaminov, S. Y., Koteliansky, V., Gotwals, P. J., and Karpusas, M. (1999) FEBS Lett. 452, 379-385 24. Rich, R. L., Deivanayagam, C. C. S., Owens, R. T., CCCarson, M., Hook, A., Moore, D., J.Symerski, Yang, V. W.-C, Narayana, S. V. L., and Hook, M. (1999) submitted 25. Kamata, T.r Liddington, R. C, and Takada, Y. (1999) J. Biol. Chem. 274(45), 32108-32111 26. Dickeson, S. K., Mathis, N. L., Rahman, M., Bergelson, J. M., and Santoro, S. (1999) J. Biol. Chem. 274(45), 32182-32191
27. Kapyla, J., Ivaska, J., Riikonen, R., Nykvist, P., Pentikainen, O., Johnson, M., and Heino, J. (2000) J. Biol. Chem. 275(5), 3348-3354
28. Smith, C, Estavillo, D., Emsley, J., Bankston, L. A., Liddington, R. C, and Cruz, M. A. (2000) J. Biol. Chem. 275(6), 4205-4209
29. Kolher, G., and Milstein, C. (1975) Nature 256(5517), 495-497
30. Sambrook, J., Fritsch, E. F., and Maniatis, T. (1989) Molecular cloning, a laboratory manual, 2nd Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY 31. Chung, C. T., Niemela, S. Z., and Miller, R. H. (1989) Proc. Natl. Acad. Sci. USA 86, 2172-2175 32. Pace, C. N., Vajdos, F., Fee, L, Grimsley, G., and Gray, T. (1995) Protein Science 4, 2411-2423
33. Rich, R. L., Demeler, B., Ashby, K., Deivanayagam, C. C. S., Petrich, J. W., Patti, J. M., Narayana, S. V. L., and Hook, M. (1998) Biochemistry 37(44), 15423-15433
34. Strawitch, E., and Nimni, M. E. (1971 ) Biochemistry 10(21), 3905- 3911
35. Switalski, L. M., Speziale, P., and Hook, M. (1989) J. Biol. Chem. 264(35), 21080-21086
36. Ni Eidhin, D., Perkins, S., Francois, P., Vaudaux, P., Hook, M., and Foster, T. J. (1998) Mol. Microbiol. 30(2), 245-257 37. Li, R., Rieu, P., Griffith, D. L, Scott, D., and Arnaout, M. A. (1998) J. Cell Biol. 143(6), 1523-1534 38. Oxvig, C, Lu, C, and Springer, T. A. (1999) Proc. Natl. Acad. Sci. USA 96, 2215-2220
Claims
1. An isolated antibody which recognizes the CNA19 peptide from S. aureus.
2. An antibody according to Claim 1, wherein said antibody is cross- reactive to both S. aureus and S. epidermidis.
3. An antibody according to Claim 1, wherein said antibody prevents S. aureus infection in a human or animal.
4. An antibody according to Claim 1, wherein said antibody prevents S. epidermidis infection in a human or animal.
5. An antibody according to Claim 1, wherein said antibody inhibits collagen binding of a staphylococcal bacteria selected from the group consisting of S. aureus and S. epidermidis.
6. An antibody according to Claim 1, wherein said antibody inhibits the binding of a both S. aureus and S. epidermidis to collagen.
7. An antibody according to Claim 1, wherein said antibody is suitable for parenteral, oral, intranasal, subcutaneous, or intravenous administration in a human or animal.
8. An antibody according to Claim 1 wherein the antibody is a monoclonal antibody.
9. An antibody according to Claim 1 wherein the antibody is a polyclonal antibody.
10. Isolated antisera containing an antibody according to Claim 1.
11. An isolated antibody according to Claim 1, wherein said antibody is capable of displacing S. aureus bound to an extracellular matrix protein.
12. An isolated antibody according to Claim 1 , wherein said antibody is capable of displacing S. aureus bound to collagen.
13. A diagnostic kit comprising an antibody according to Claim 1 and means for detecting binding by than antibody.
14. A pharmaceutical composition for treating or preventing an infection of S. aureus or S. epidermidis comprising an effective amount of the antibody of Claim 1 and a pharmaceutically acceptable vehicle, carrier or excipient.
15. A method of treating or preventing an infection of S. aureus or S. epidermidis comprising administering to a human or animal patient an effective amount of an antibody according to Claim 1.
16. A method of displacing S. aureus or S. epidermidis bound to collagen comprising administering to a human or animal patient an effective amount of an antibody according to Claim 1.
17. A method of inducing an immunological response comprising administering to a patient an isolated S. aureus CNA19 peptide.
18. A method of identifying antibodies capable of displacing bacteria bound to surface proteins on the extracellular matrix comprising the steps of labeling one or more surface proteins of the extracellular matrix, combining said labeled surface proteins with bacteria known to be capable of binding to said surface proteins for a time sufficient to ensure that said bacteria will bind to said labeled surface proteins, harvesting the bacteria bound to said labeled surface proteins, introducing antibodies suspected of having displacement activity to the bacteria bound to said labeled surface proteins, and identifying those antibodies which cause the displacement of the bacteria from the labeled surface proteins.
19. A method according to Claim 18 wherein the surface protein is collagen.
20. A method according to Claim 18 wherein an antibody is isolated which has the ability to displace S. aureus from host cells.
21. A method according to Claim 18 wherein the surface protein is immobilized on a solid carrier.
22. An isolated displacing antibody produced by the method of Claim 18.
23. An isolated cross-reactive antibody that is generated against region 151-318 of the collagen binding domain of the S. aureus CNA protein.
24. An antibody according to Claim 21 wherein said antibody is capable of inhibiting S. aureus bacteria from binding to a collagen binding site.
25. An antibody according to Claim 21 wherein said antibody is capable of inhibiting S. epidermidis bacteria from binding to a collagen binding
site.
26. Isolated antisera containing an antibody according to Claim 1.
7. A method of identifying antibodies capable of displacing bacteria that can attach themselves to specific proteins comprising the steps of labeling one or more proteins that are known to be bound by bacteria, combining said labeled proteins with bacteria known to be capable of binding to said proteins for a time sufficient to ensure that said bacteria will bind to said labeled surface proteins, harvesting the bacteria bound to said labeled proteins, introducing antibodies suspected of having displacement activity to the bacteria bound to said labeled proteins, and identifying those antibodies which cause the displacement of the bacteria from said proteins.
28. An isolated displacing antibody produced by the method of Claim 27.
29. A diagnostic kit for immunodetection comprising, in a suitable container, an antibody according to Claim 1 and an immunodetection reagent.
30. A diagnostic kit according to Claim 29 wherein said immunodetection reagent is a detectable label that is linked to said antibody.
31. An isolated monoclonal antibody raised against the CNA protein from S. aureus.
32. Isolated antisera containing an antibody according to Claim 31.
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA002403359A CA2403359A1 (en) | 2000-03-17 | 2001-03-19 | Cross-reactive displacing antibodies from collagen-binding proteins and method of identification and use |
| EP01930420A EP1267930A4 (en) | 2000-03-17 | 2001-03-19 | Cross-reactive displacing antibodies from collagen-binding proteins and method of identification and use |
| JP2001568463A JP2003527440A (en) | 2000-03-17 | 2001-03-19 | Cross-reactive displacement antibodies from collagen-binding proteins and identification methods and uses |
| AU2001256958A AU2001256958A1 (en) | 2000-03-17 | 2001-03-19 | Cross-reactive displacing antibodies from collagen-binding proteins and method of identification and use |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US18996800P | 2000-03-17 | 2000-03-17 | |
| US60/189,968 | 2000-03-17 | ||
| US19937000P | 2000-04-25 | 2000-04-25 | |
| US60/199,370 | 2000-04-25 | ||
| US22540200P | 2000-08-15 | 2000-08-15 | |
| US60/225,402 | 2000-08-15 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2001070267A1 true WO2001070267A1 (en) | 2001-09-27 |
Family
ID=27392662
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2001/008554 WO2001070267A1 (en) | 2000-03-17 | 2001-03-19 | Cross-reactive displacing antibodies from collagen-binding proteins and method of identification and use |
Country Status (6)
| Country | Link |
|---|---|
| US (1) | US7241592B2 (en) |
| EP (1) | EP1267930A4 (en) |
| JP (1) | JP2003527440A (en) |
| AU (1) | AU2001256958A1 (en) |
| CA (1) | CA2403359A1 (en) |
| WO (1) | WO2001070267A1 (en) |
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2003072607A1 (en) * | 2002-02-21 | 2003-09-04 | Università Degli Studi Di Pavia | Monoclonal antibodies that are cross-reactive against bacterial collagen binding proteins |
| EP1481011A1 (en) * | 2002-03-05 | 2004-12-01 | Inhibitex, Inc. | Monoclonal and polyclonal antibodies recognizing coagulase-negative staphylococcal proteins |
| WO2008089476A1 (en) * | 2007-01-19 | 2008-07-24 | Inhibitex, Inc. | Monoclonal antibodies recognizing the enterococcus faecium acm protein |
| WO2009013443A1 (en) * | 2007-07-23 | 2009-01-29 | Vaccine Research International Plc | Inactivated staphylococcal whole-cell vaccine |
| WO2010079464A1 (en) * | 2009-01-12 | 2010-07-15 | Novartis Ag | Cna_b domain antigens in vaccines against gram positive bacteria |
| EA018030B1 (en) * | 2006-06-06 | 2013-05-30 | Круселл Холланд Б.В. | Human binding molecules having killing activity against staphylococci and use thereof |
| US8758765B2 (en) | 2008-07-29 | 2014-06-24 | The University Of Chicago | Compositions and methods related to Staphylococcal bacterium proteins |
| US8840906B2 (en) | 2007-08-31 | 2014-09-23 | The University Of Chicago | Methods and compositions related to immunizing against Staphylococcal lung disease and conditions |
| US8945588B2 (en) | 2011-05-06 | 2015-02-03 | The University Of Chicago | Methods and compositions involving protective staphylococcal antigens, such as EBH polypeptides |
| US9181329B2 (en) | 2007-08-31 | 2015-11-10 | The University Of Chicago | Methods and compositions related to immunizing against Staphylococcal lung diseases and conditions |
| US9315554B2 (en) | 2010-07-02 | 2016-04-19 | The University Of Chicago | Compositions and methods related to protein A (SpA) variants |
| US9567379B2 (en) | 2009-04-03 | 2017-02-14 | The University Of Chicago | Compositions and methods related to protein A (SpA) variants |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9176135B2 (en) | 2010-08-22 | 2015-11-03 | University Of Rochester | Method for predicting and preventing cardiovascular disease |
| WO2017079681A1 (en) | 2015-11-05 | 2017-05-11 | The Texas A&M University System | Targeting of ligand binding sites in clfa |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1997043314A2 (en) * | 1996-05-16 | 1997-11-20 | The Texas A & M University System | Collagen binding protein compositions and methods of use |
-
2001
- 2001-03-19 AU AU2001256958A patent/AU2001256958A1/en not_active Abandoned
- 2001-03-19 US US09/810,428 patent/US7241592B2/en not_active Expired - Lifetime
- 2001-03-19 WO PCT/US2001/008554 patent/WO2001070267A1/en active Application Filing
- 2001-03-19 CA CA002403359A patent/CA2403359A1/en not_active Abandoned
- 2001-03-19 EP EP01930420A patent/EP1267930A4/en not_active Withdrawn
- 2001-03-19 JP JP2001568463A patent/JP2003527440A/en active Pending
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1997043314A2 (en) * | 1996-05-16 | 1997-11-20 | The Texas A & M University System | Collagen binding protein compositions and methods of use |
Non-Patent Citations (4)
| Title |
|---|
| FOSTER T.J. ET AL.: "Surface protein adhesion of Staphylococcus aureus", TREND IN MICROBIOLOGY, vol. 6, no. 12, 1998, pages 484 - 488, XP002942801 * |
| PATTI J.M.: "Critical Residues in the Ligand-binding site of the Staphylococcus aureus collagen-binding adhesion", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 270, no. 20, May 1995 (1995-05-01), pages 12005 - 12011, XP002942803 * |
| See also references of EP1267930A4 * |
| SYMERSKY J. ET AL.: "Structure of the Collagen-binding domain from a Staphylococcus aureus adhesin", NATURE STRUCTURAL BIOLOGY, vol. 4, no. 10, October 1997 (1997-10-01), pages 833 - 838, XP002942802 * |
Cited By (24)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1483292A1 (en) * | 2002-02-21 | 2004-12-08 | Universita' Degli Studi Di Pavia | Monoclonal antibodies that are cross-reactive against bacterial collagen binding proteins |
| EP1483292A4 (en) * | 2002-02-21 | 2006-05-17 | Univ Pavia | Monoclonal antibodies that are cross-reactive against bacterial collagen binding proteins |
| WO2003072607A1 (en) * | 2002-02-21 | 2003-09-04 | Università Degli Studi Di Pavia | Monoclonal antibodies that are cross-reactive against bacterial collagen binding proteins |
| EP1481011A1 (en) * | 2002-03-05 | 2004-12-01 | Inhibitex, Inc. | Monoclonal and polyclonal antibodies recognizing coagulase-negative staphylococcal proteins |
| EP1481011A4 (en) * | 2002-03-05 | 2007-05-30 | Inhibitex Inc | Monoclonal and polyclonal antibodies recognizing coagulase-negative staphylococcal proteins |
| EA018030B1 (en) * | 2006-06-06 | 2013-05-30 | Круселл Холланд Б.В. | Human binding molecules having killing activity against staphylococci and use thereof |
| WO2008089476A1 (en) * | 2007-01-19 | 2008-07-24 | Inhibitex, Inc. | Monoclonal antibodies recognizing the enterococcus faecium acm protein |
| CN101730543B (en) * | 2007-07-23 | 2014-02-12 | 疫苗研究国际有限公司 | Inactivated staphylococcal whole-cell vaccine |
| US8333977B2 (en) | 2007-07-23 | 2012-12-18 | Vaccine Research International Plc | Inactivated staphylococcal whole-cell vaccine |
| AU2007356845B2 (en) * | 2007-07-23 | 2013-03-07 | Vaccine Research International Plc | Inactivated staphylococcal whole-cell vaccine |
| WO2009013443A1 (en) * | 2007-07-23 | 2009-01-29 | Vaccine Research International Plc | Inactivated staphylococcal whole-cell vaccine |
| US11639379B2 (en) | 2007-08-31 | 2023-05-02 | The University Of Chicago | Methods and compositions related to immunizing against Staphylococcal lung diseases and conditions |
| US9181329B2 (en) | 2007-08-31 | 2015-11-10 | The University Of Chicago | Methods and compositions related to immunizing against Staphylococcal lung diseases and conditions |
| US8840906B2 (en) | 2007-08-31 | 2014-09-23 | The University Of Chicago | Methods and compositions related to immunizing against Staphylococcal lung disease and conditions |
| US8758765B2 (en) | 2008-07-29 | 2014-06-24 | The University Of Chicago | Compositions and methods related to Staphylococcal bacterium proteins |
| US9102740B2 (en) | 2009-01-12 | 2015-08-11 | Novartis Ag | Cna-B domain antigens in vaccines against gram positive bacteria |
| US8465751B2 (en) | 2009-01-12 | 2013-06-18 | Novartis Ag | Cna—B domain antigens in vaccines against gram positive bacteria |
| WO2010079464A1 (en) * | 2009-01-12 | 2010-07-15 | Novartis Ag | Cna_b domain antigens in vaccines against gram positive bacteria |
| US9567379B2 (en) | 2009-04-03 | 2017-02-14 | The University Of Chicago | Compositions and methods related to protein A (SpA) variants |
| US9315554B2 (en) | 2010-07-02 | 2016-04-19 | The University Of Chicago | Compositions and methods related to protein A (SpA) variants |
| US10464971B2 (en) | 2010-07-02 | 2019-11-05 | The University Of Chicago | Compositions and methods related to Protein A (SpA) Variants |
| US11059866B2 (en) | 2010-07-02 | 2021-07-13 | The University Of Chicago | Compositions and methods related to protein A (SpA) variants |
| US11939358B2 (en) | 2010-07-02 | 2024-03-26 | The University Of Chicago | Compositions and methods related to protein A (SpA) variants |
| US8945588B2 (en) | 2011-05-06 | 2015-02-03 | The University Of Chicago | Methods and compositions involving protective staphylococcal antigens, such as EBH polypeptides |
Also Published As
| Publication number | Publication date |
|---|---|
| CA2403359A1 (en) | 2001-09-27 |
| JP2003527440A (en) | 2003-09-16 |
| AU2001256958A1 (en) | 2001-10-03 |
| EP1267930A4 (en) | 2005-01-19 |
| EP1267930A1 (en) | 2003-01-02 |
| US20070122416A1 (en) | 2007-05-31 |
| US7241592B2 (en) | 2007-07-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP1377314B1 (en) | Monoclonal antibodies to the clfa protein and method of use in treating or preventing infections | |
| JP4486748B2 (en) | Extracellular matrix binding protein from Staphylococcus aureus | |
| US7816494B2 (en) | SdrC protein from Staphylococcus aureus and diagnostic kits including same | |
| AU2002256985A1 (en) | Monoclonal antibodies to the ClfA protein and method of use in treating or preventing infections | |
| US7638135B2 (en) | Collagen-binding proteins from enterococcal bacteria | |
| US7241592B2 (en) | Cross-reactive displacing antibodies from collagen-binding proteins and method of identification and use | |
| WO2002074324A1 (en) | Collagen-binding adhesin from staphylococcus epidermidis and method of use | |
| US20100183623A1 (en) | Monoclonal antibodies recognizing a coagulase-negative staphylococcal protein | |
| EP1443957A2 (en) | Surface proteins from gram-positive bacteria having highly conserved motifs and antibodies that recognize them | |
| US20040006209A1 (en) | Monoclonal and polyclonal antibodies recognizing coagulase-negative staphylococcal proteins | |
| EP1177203B1 (en) | Collagen-binding proteins from enterococcal bacteria | |
| US20050202025A1 (en) | Antibodies to the FbsA protein of streptococcus agalactiae and their use in treating or preventing infections | |
| US20030190320A1 (en) | Monoclonal antibodies that are cross-reactive against bacterial collagen binding proteins | |
| WO2008089476A1 (en) | Monoclonal antibodies recognizing the enterococcus faecium acm protein |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A1 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG UZ VN YU ZA ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
| ENP | Entry into the national phase |
Ref country code: JP Ref document number: 2001 568463 Kind code of ref document: A Format of ref document f/p: F |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2403359 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2001930420 Country of ref document: EP |
|
| WWP | Wipo information: published in national office |
Ref document number: 2001930420 Country of ref document: EP |