WO2001038350A2 - 85kDa NEISSERIAL ANTIGEN - Google Patents
85kDa NEISSERIAL ANTIGEN Download PDFInfo
- Publication number
- WO2001038350A2 WO2001038350A2 PCT/IB2000/001851 IB0001851W WO0138350A2 WO 2001038350 A2 WO2001038350 A2 WO 2001038350A2 IB 0001851 W IB0001851 W IB 0001851W WO 0138350 A2 WO0138350 A2 WO 0138350A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- protein
- sequence
- expression
- antigen against
- Prior art date
Links
- 241001212279 Neisseriales Species 0.000 title claims description 10
- 239000000427 antigen Substances 0.000 title abstract description 37
- 108091007433 antigens Proteins 0.000 title abstract description 37
- 102000036639 antigens Human genes 0.000 title abstract description 37
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 266
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 170
- 241000588650 Neisseria meningitidis Species 0.000 claims abstract description 18
- 239000012634 fragment Substances 0.000 claims description 55
- 239000000203 mixture Substances 0.000 claims description 50
- 238000000034 method Methods 0.000 claims description 43
- 150000007523 nucleic acids Chemical class 0.000 claims description 36
- 102000039446 nucleic acids Human genes 0.000 claims description 33
- 108020004707 nucleic acids Proteins 0.000 claims description 33
- 230000002163 immunogen Effects 0.000 claims description 30
- 101710194807 Protective antigen Proteins 0.000 claims description 29
- 229960005486 vaccine Drugs 0.000 claims description 21
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 16
- 239000003814 drug Substances 0.000 claims description 12
- 150000001413 amino acids Chemical class 0.000 claims description 9
- 206010043376 Tetanus Diseases 0.000 claims description 7
- 206010013023 diphtheria Diseases 0.000 claims description 7
- 239000002773 nucleotide Substances 0.000 claims description 7
- 125000003729 nucleotide group Chemical group 0.000 claims description 7
- 241000921898 Neisseria meningitidis serogroup A Species 0.000 claims description 6
- 208000015181 infectious disease Diseases 0.000 claims description 6
- 241000606768 Haemophilus influenzae Species 0.000 claims description 5
- 208000000474 Poliomyelitis Diseases 0.000 claims description 5
- 238000004519 manufacturing process Methods 0.000 claims description 5
- 201000005702 Pertussis Diseases 0.000 claims description 4
- 229940047650 haemophilus influenzae Drugs 0.000 claims description 4
- 241000700721 Hepatitis B virus Species 0.000 claims description 3
- 241000947238 Neisseria meningitidis serogroup C Species 0.000 claims description 3
- 241001573069 Neisseria meningitidis serogroup Y Species 0.000 claims description 3
- 241000590002 Helicobacter pylori Species 0.000 claims description 2
- 229940037467 helicobacter pylori Drugs 0.000 claims description 2
- 241000588652 Neisseria gonorrhoeae Species 0.000 abstract description 11
- 241000588649 Neisseria lactamica Species 0.000 abstract description 2
- 235000018102 proteins Nutrition 0.000 description 152
- 210000004027 cell Anatomy 0.000 description 89
- 230000014509 gene expression Effects 0.000 description 83
- 239000013598 vector Substances 0.000 description 57
- 108020004414 DNA Proteins 0.000 description 45
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 45
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 42
- 241000196324 Embryophyta Species 0.000 description 33
- 241000894006 Bacteria Species 0.000 description 30
- 230000001580 bacterial effect Effects 0.000 description 29
- 108090000765 processed proteins & peptides Proteins 0.000 description 28
- 102000004196 processed proteins & peptides Human genes 0.000 description 27
- 230000035897 transcription Effects 0.000 description 26
- 238000013518 transcription Methods 0.000 description 26
- 239000013612 plasmid Substances 0.000 description 25
- 229920001184 polypeptide Polymers 0.000 description 25
- 241000701447 unidentified baculovirus Species 0.000 description 25
- 108010076504 Protein Sorting Signals Proteins 0.000 description 24
- 239000000872 buffer Substances 0.000 description 24
- 102000040430 polynucleotide Human genes 0.000 description 22
- 108091033319 polynucleotide Proteins 0.000 description 22
- 239000002157 polynucleotide Substances 0.000 description 22
- 230000001105 regulatory effect Effects 0.000 description 22
- 108091028043 Nucleic acid sequence Proteins 0.000 description 21
- 230000027455 binding Effects 0.000 description 21
- 239000003795 chemical substances by application Substances 0.000 description 19
- 150000004676 glycans Chemical class 0.000 description 19
- 238000009396 hybridization Methods 0.000 description 19
- 229920001282 polysaccharide Polymers 0.000 description 19
- 239000005017 polysaccharide Substances 0.000 description 19
- 108090001030 Lipoproteins Proteins 0.000 description 17
- 102000004895 Lipoproteins Human genes 0.000 description 17
- 108091026890 Coding region Proteins 0.000 description 16
- 241000238631 Hexapoda Species 0.000 description 16
- 241000700605 Viruses Species 0.000 description 16
- 230000009466 transformation Effects 0.000 description 16
- 241000588724 Escherichia coli Species 0.000 description 15
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 15
- 150000002632 lipids Chemical class 0.000 description 15
- 239000000523 sample Substances 0.000 description 14
- 230000028327 secretion Effects 0.000 description 14
- 102000037865 fusion proteins Human genes 0.000 description 13
- 108020001507 fusion proteins Proteins 0.000 description 13
- 238000000338 in vitro Methods 0.000 description 13
- 239000002502 liposome Substances 0.000 description 13
- 210000004962 mammalian cell Anatomy 0.000 description 13
- 239000012528 membrane Substances 0.000 description 13
- 230000010076 replication Effects 0.000 description 13
- 238000012546 transfer Methods 0.000 description 13
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 12
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 12
- 238000010367 cloning Methods 0.000 description 12
- 239000013604 expression vector Substances 0.000 description 12
- 108090000790 Enzymes Proteins 0.000 description 11
- 239000002671 adjuvant Substances 0.000 description 11
- 235000001014 amino acid Nutrition 0.000 description 11
- 239000002609 medium Substances 0.000 description 11
- 239000006228 supernatant Substances 0.000 description 11
- 108010083590 Apoproteins Proteins 0.000 description 10
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 10
- 102000004190 Enzymes Human genes 0.000 description 10
- -1 antibody Proteins 0.000 description 10
- 229940088598 enzyme Drugs 0.000 description 10
- 238000011534 incubation Methods 0.000 description 10
- 108020004999 messenger RNA Proteins 0.000 description 10
- 230000005030 transcription termination Effects 0.000 description 10
- 102000006410 Apoproteins Human genes 0.000 description 9
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 9
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 9
- 239000002253 acid Substances 0.000 description 9
- 239000003937 drug carrier Substances 0.000 description 9
- 230000000694 effects Effects 0.000 description 9
- 239000002245 particle Substances 0.000 description 9
- 239000000047 product Substances 0.000 description 9
- 150000003839 salts Chemical class 0.000 description 9
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 8
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 8
- 101000976889 Haemophilus phage HP1 (strain HP1c1) Uncharacterized 19.2 kDa protein in cox-rep intergenic region Proteins 0.000 description 8
- 101000786896 Haemophilus phage HP1 (strain HP1c1) Uncharacterized 19.2 kDa protein in rep-hol intergenic region Proteins 0.000 description 8
- 101000805098 Orgyia pseudotsugata multicapsid polyhedrosis virus Uncharacterized 73.1 kDa protein Proteins 0.000 description 8
- 101710182846 Polyhedrin Proteins 0.000 description 8
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 8
- 239000003623 enhancer Substances 0.000 description 8
- 238000002360 preparation method Methods 0.000 description 8
- 238000012545 processing Methods 0.000 description 8
- 239000000243 solution Substances 0.000 description 8
- 241000894007 species Species 0.000 description 8
- 239000000725 suspension Substances 0.000 description 8
- 238000011144 upstream manufacturing Methods 0.000 description 8
- 108091081024 Start codon Proteins 0.000 description 7
- IXKSXJFAGXLQOQ-XISFHERQSA-N WHWLQLKPGQPMY Chemical compound C([C@@H](C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)NC(=O)[C@@H](N)CC=1C2=CC=CC=C2NC=1)C1=CNC=N1 IXKSXJFAGXLQOQ-XISFHERQSA-N 0.000 description 7
- 238000013459 approach Methods 0.000 description 7
- 239000003153 chemical reaction reagent Substances 0.000 description 7
- 238000010790 dilution Methods 0.000 description 7
- 239000012895 dilution Substances 0.000 description 7
- 230000004927 fusion Effects 0.000 description 7
- 238000002649 immunization Methods 0.000 description 7
- 238000001727 in vivo Methods 0.000 description 7
- 229930182817 methionine Natural products 0.000 description 7
- 239000008188 pellet Substances 0.000 description 7
- 239000008363 phosphate buffer Substances 0.000 description 7
- 210000001938 protoplast Anatomy 0.000 description 7
- 210000002966 serum Anatomy 0.000 description 7
- 210000001519 tissue Anatomy 0.000 description 7
- 230000003612 virological effect Effects 0.000 description 7
- 229920001817 Agar Polymers 0.000 description 6
- 102000053602 DNA Human genes 0.000 description 6
- 241000283973 Oryctolagus cuniculus Species 0.000 description 6
- 101710116435 Outer membrane protein Proteins 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 108090000848 Ubiquitin Proteins 0.000 description 6
- 102000044159 Ubiquitin Human genes 0.000 description 6
- 150000007513 acids Chemical class 0.000 description 6
- 239000008272 agar Substances 0.000 description 6
- 230000003321 amplification Effects 0.000 description 6
- 239000000969 carrier Substances 0.000 description 6
- 238000004113 cell culture Methods 0.000 description 6
- 238000005119 centrifugation Methods 0.000 description 6
- 230000000295 complement effect Effects 0.000 description 6
- 230000002068 genetic effect Effects 0.000 description 6
- 230000000977 initiatory effect Effects 0.000 description 6
- 238000002347 injection Methods 0.000 description 6
- 239000007924 injection Substances 0.000 description 6
- 238000003780 insertion Methods 0.000 description 6
- 230000037431 insertion Effects 0.000 description 6
- 238000003199 nucleic acid amplification method Methods 0.000 description 6
- 230000008569 process Effects 0.000 description 6
- 108091008146 restriction endonucleases Proteins 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- 230000005026 transcription initiation Effects 0.000 description 6
- 102000014150 Interferons Human genes 0.000 description 5
- 108010050904 Interferons Proteins 0.000 description 5
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 5
- 102000007651 Macrophage Colony-Stimulating Factor Human genes 0.000 description 5
- 241001465754 Metazoa Species 0.000 description 5
- 108700009124 Transcription Initiation Site Proteins 0.000 description 5
- 230000000890 antigenic effect Effects 0.000 description 5
- 230000000903 blocking effect Effects 0.000 description 5
- 201000010099 disease Diseases 0.000 description 5
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 239000005556 hormone Substances 0.000 description 5
- 229940088597 hormone Drugs 0.000 description 5
- 230000002209 hydrophobic effect Effects 0.000 description 5
- 230000003053 immunization Effects 0.000 description 5
- 230000010354 integration Effects 0.000 description 5
- 239000007788 liquid Substances 0.000 description 5
- 239000003550 marker Substances 0.000 description 5
- 238000010369 molecular cloning Methods 0.000 description 5
- 239000008194 pharmaceutical composition Substances 0.000 description 5
- 230000008488 polyadenylation Effects 0.000 description 5
- 239000011347 resin Substances 0.000 description 5
- 229920005989 resin Polymers 0.000 description 5
- 239000011780 sodium chloride Substances 0.000 description 5
- 230000001225 therapeutic effect Effects 0.000 description 5
- 238000013519 translation Methods 0.000 description 5
- 241001515965 unidentified phage Species 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 4
- 241000193830 Bacillus <bacterium> Species 0.000 description 4
- 229920002307 Dextran Polymers 0.000 description 4
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 4
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 4
- 201000009906 Meningitis Diseases 0.000 description 4
- 241000588653 Neisseria Species 0.000 description 4
- 239000007977 PBT buffer Substances 0.000 description 4
- 241000235648 Pichia Species 0.000 description 4
- 108700026226 TATA Box Proteins 0.000 description 4
- 229960000723 ampicillin Drugs 0.000 description 4
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 4
- 230000001851 biosynthetic effect Effects 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 239000004202 carbamide Substances 0.000 description 4
- 125000002091 cationic group Chemical group 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 4
- 210000000349 chromosome Anatomy 0.000 description 4
- ATDGTVJJHBUTRL-UHFFFAOYSA-N cyanogen bromide Chemical compound BrC#N ATDGTVJJHBUTRL-UHFFFAOYSA-N 0.000 description 4
- 229960002086 dextran Drugs 0.000 description 4
- PRAKJMSDJKAYCZ-UHFFFAOYSA-N dodecahydrosqualene Natural products CC(C)CCCC(C)CCCC(C)CCCCC(C)CCCC(C)CCCC(C)C PRAKJMSDJKAYCZ-UHFFFAOYSA-N 0.000 description 4
- 238000004520 electroporation Methods 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 238000009472 formulation Methods 0.000 description 4
- 239000000499 gel Substances 0.000 description 4
- 230000012010 growth Effects 0.000 description 4
- 239000001963 growth medium Substances 0.000 description 4
- 230000028993 immune response Effects 0.000 description 4
- 230000001939 inductive effect Effects 0.000 description 4
- 239000003446 ligand Substances 0.000 description 4
- 238000012423 maintenance Methods 0.000 description 4
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 230000006798 recombination Effects 0.000 description 4
- 238000005215 recombination Methods 0.000 description 4
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 4
- 239000007787 solid Substances 0.000 description 4
- 238000003786 synthesis reaction Methods 0.000 description 4
- 230000005945 translocation Effects 0.000 description 4
- 239000003981 vehicle Substances 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- 102000007698 Alcohol dehydrogenase Human genes 0.000 description 3
- 108010021809 Alcohol dehydrogenase Proteins 0.000 description 3
- 108090001008 Avidin Proteins 0.000 description 3
- 241000283707 Capra Species 0.000 description 3
- 108010039939 Cell Wall Skeleton Proteins 0.000 description 3
- 108010004103 Chylomicrons Proteins 0.000 description 3
- 108020004705 Codon Proteins 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- 206010020649 Hyperkeratosis Diseases 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- 241000699670 Mus sp. Species 0.000 description 3
- 241000588677 Neisseria meningitidis serogroup B Species 0.000 description 3
- 102000013009 Pyruvate Kinase Human genes 0.000 description 3
- 108020005115 Pyruvate Kinase Proteins 0.000 description 3
- 229920004890 Triton X-100 Polymers 0.000 description 3
- 108700005077 Viral Genes Proteins 0.000 description 3
- 230000004913 activation Effects 0.000 description 3
- 239000011543 agarose gel Substances 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 239000002585 base Substances 0.000 description 3
- 230000033228 biological regulation Effects 0.000 description 3
- 210000002421 cell wall Anatomy 0.000 description 3
- 210000004520 cell wall skeleton Anatomy 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 239000007330 chocolate agar Substances 0.000 description 3
- 238000007796 conventional method Methods 0.000 description 3
- 229940079593 drug Drugs 0.000 description 3
- 210000002257 embryonic structure Anatomy 0.000 description 3
- 239000000839 emulsion Substances 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 238000000605 extraction Methods 0.000 description 3
- IXORZMNAPKEEDV-OBDJNFEBSA-N gibberellin A3 Chemical compound C([C@@]1(O)C(=C)C[C@@]2(C1)[C@H]1C(O)=O)C[C@H]2[C@]2(C=C[C@@H]3O)[C@H]1[C@]3(C)C(=O)O2 IXORZMNAPKEEDV-OBDJNFEBSA-N 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 238000002744 homologous recombination Methods 0.000 description 3
- 230000006801 homologous recombination Effects 0.000 description 3
- 210000004408 hybridoma Anatomy 0.000 description 3
- 229940079322 interferon Drugs 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 230000037353 metabolic pathway Effects 0.000 description 3
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 3
- 235000015097 nutrients Nutrition 0.000 description 3
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 3
- 229920000053 polysorbate 80 Polymers 0.000 description 3
- 230000008929 regeneration Effects 0.000 description 3
- 238000011069 regeneration method Methods 0.000 description 3
- 238000010561 standard procedure Methods 0.000 description 3
- 229940124597 therapeutic agent Drugs 0.000 description 3
- 230000002103 transcriptional effect Effects 0.000 description 3
- 238000001890 transfection Methods 0.000 description 3
- 238000011282 treatment Methods 0.000 description 3
- 239000011534 wash buffer Substances 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- YYGNTYWPHWGJRM-UHFFFAOYSA-N (6E,10E,14E,18E)-2,6,10,15,19,23-hexamethyltetracosa-2,6,10,14,18,22-hexaene Chemical compound CC(C)=CCCC(C)=CCCC(C)=CCCC=C(C)CCC=C(C)CCC=C(C)C YYGNTYWPHWGJRM-UHFFFAOYSA-N 0.000 description 2
- SNKAWJBJQDLSFF-NVKMUCNASA-N 1,2-dioleoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCC\C=C/CCCCCCCC SNKAWJBJQDLSFF-NVKMUCNASA-N 0.000 description 2
- PXFBZOLANLWPMH-UHFFFAOYSA-N 16-Epiaffinine Natural products C1C(C2=CC=CC=C2N2)=C2C(=O)CC2C(=CC)CN(C)C1C2CO PXFBZOLANLWPMH-UHFFFAOYSA-N 0.000 description 2
- RSMRWWHFJMENJH-LQDDAWAPSA-M 2,3-bis[[(z)-octadec-9-enoyl]oxy]propyl-trimethylazanium;methyl sulfate Chemical compound COS([O-])(=O)=O.CCCCCCCC\C=C/CCCCCCCC(=O)OCC(C[N+](C)(C)C)OC(=O)CCCCCCC\C=C/CCCCCCCC RSMRWWHFJMENJH-LQDDAWAPSA-M 0.000 description 2
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 2
- 241000589158 Agrobacterium Species 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- 235000014469 Bacillus subtilis Nutrition 0.000 description 2
- 108010077805 Bacterial Proteins Proteins 0.000 description 2
- 108020004513 Bacterial RNA Proteins 0.000 description 2
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 2
- 101710132601 Capsid protein Proteins 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- 108010060123 Conjugate Vaccines Proteins 0.000 description 2
- 241000208296 Datura Species 0.000 description 2
- ULGZDMOVFRHVEP-RWJQBGPGSA-N Erythromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)C(=O)[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 ULGZDMOVFRHVEP-RWJQBGPGSA-N 0.000 description 2
- 241000701959 Escherichia virus Lambda Species 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- 108091029865 Exogenous DNA Proteins 0.000 description 2
- 108010058643 Fungal Proteins Proteins 0.000 description 2
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 2
- 239000005980 Gibberellic acid Substances 0.000 description 2
- 108010024636 Glutathione Proteins 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 2
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 2
- 208000032843 Hemorrhage Diseases 0.000 description 2
- 229920000209 Hexadimethrine bromide Polymers 0.000 description 2
- 240000005979 Hordeum vulgare Species 0.000 description 2
- 235000007340 Hordeum vulgare Nutrition 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- 108010063738 Interleukins Proteins 0.000 description 2
- 102000015696 Interleukins Human genes 0.000 description 2
- 108091092195 Intron Proteins 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- 108010007622 LDL Lipoproteins Proteins 0.000 description 2
- 239000006137 Luria-Bertani broth Substances 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- 241000219823 Medicago Species 0.000 description 2
- 108700020354 N-acetylmuramyl-threonyl-isoglutamine Proteins 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 108091093037 Peptide nucleic acid Proteins 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- UTPGJEROJZHISI-UHFFFAOYSA-N Pleniradin-acetat Natural products C1=C(C)C2C(OC(=O)C)CC(C)(O)C2CC2C(=C)C(=O)OC21 UTPGJEROJZHISI-UHFFFAOYSA-N 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 108010076039 Polyproteins Proteins 0.000 description 2
- 229920001213 Polysorbate 20 Polymers 0.000 description 2
- 102000017033 Porins Human genes 0.000 description 2
- 108010013381 Porins Proteins 0.000 description 2
- 241000288906 Primates Species 0.000 description 2
- ATUOYWHBWRKTHZ-UHFFFAOYSA-N Propane Chemical compound CCC ATUOYWHBWRKTHZ-UHFFFAOYSA-N 0.000 description 2
- 102000007327 Protamines Human genes 0.000 description 2
- 108010007568 Protamines Proteins 0.000 description 2
- 230000006819 RNA synthesis Effects 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N Sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 2
- 241000194017 Streptococcus Species 0.000 description 2
- 102000019197 Superoxide Dismutase Human genes 0.000 description 2
- 108010012715 Superoxide dismutase Proteins 0.000 description 2
- 239000004098 Tetracycline Substances 0.000 description 2
- BHEOSNUKNHRBNM-UHFFFAOYSA-N Tetramethylsqualene Natural products CC(=C)C(C)CCC(=C)C(C)CCC(C)=CCCC=C(C)CCC(C)C(=C)CCC(C)C(C)=C BHEOSNUKNHRBNM-UHFFFAOYSA-N 0.000 description 2
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 2
- 108091023040 Transcription factor Proteins 0.000 description 2
- 102100023132 Transcription factor Jun Human genes 0.000 description 2
- 239000007983 Tris buffer Substances 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 2
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 2
- 208000036142 Viral infection Diseases 0.000 description 2
- 108091006088 activator proteins Proteins 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 238000013019 agitation Methods 0.000 description 2
- NWMHDZMRVUOQGL-CZEIJOLGSA-N almurtide Chemical compound OC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)CO[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(C)=O)C=O NWMHDZMRVUOQGL-CZEIJOLGSA-N 0.000 description 2
- 229940037003 alum Drugs 0.000 description 2
- 125000000539 amino acid group Chemical group 0.000 description 2
- 125000000129 anionic group Chemical group 0.000 description 2
- 230000000844 anti-bacterial effect Effects 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 210000003578 bacterial chromosome Anatomy 0.000 description 2
- 239000012472 biological sample Substances 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 230000000740 bleeding effect Effects 0.000 description 2
- 108091006374 cAMP receptor proteins Proteins 0.000 description 2
- 239000001110 calcium chloride Substances 0.000 description 2
- 229910001628 calcium chloride Inorganic materials 0.000 description 2
- 150000001768 cations Chemical class 0.000 description 2
- 235000012000 cholesterol Nutrition 0.000 description 2
- 229940031670 conjugate vaccine Drugs 0.000 description 2
- 229920001577 copolymer Polymers 0.000 description 2
- 230000009089 cytolysis Effects 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 229960000633 dextran sulfate Drugs 0.000 description 2
- 238000000502 dialysis Methods 0.000 description 2
- 239000013024 dilution buffer Substances 0.000 description 2
- 238000005538 encapsulation Methods 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 239000000284 extract Substances 0.000 description 2
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 2
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- IXORZMNAPKEEDV-UHFFFAOYSA-N gibberellic acid GA3 Natural products OC(=O)C1C2(C3)CC(=C)C3(O)CCC2C2(C=CC3O)C1C3(C)C(=O)O2 IXORZMNAPKEEDV-UHFFFAOYSA-N 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- YPZRWBKMTBYPTK-BJDJZHNGSA-N glutathione disulfide Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@H](C(=O)NCC(O)=O)CSSC[C@@H](C(=O)NCC(O)=O)NC(=O)CC[C@H](N)C(O)=O YPZRWBKMTBYPTK-BJDJZHNGSA-N 0.000 description 2
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 2
- 230000002414 glycolytic effect Effects 0.000 description 2
- 230000009931 harmful effect Effects 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 239000001257 hydrogen Substances 0.000 description 2
- 229910052739 hydrogen Inorganic materials 0.000 description 2
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 2
- 230000036039 immunity Effects 0.000 description 2
- 239000003022 immunostimulating agent Substances 0.000 description 2
- 230000002779 inactivation Effects 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 229940047124 interferons Drugs 0.000 description 2
- 229940047122 interleukins Drugs 0.000 description 2
- 239000000543 intermediate Substances 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- PHTQWCKDNZKARW-UHFFFAOYSA-N isoamylol Chemical compound CC(C)CCO PHTQWCKDNZKARW-UHFFFAOYSA-N 0.000 description 2
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 101150095079 menB gene Proteins 0.000 description 2
- JMUHBNWAORSSBD-WKYWBUFDSA-N mifamurtide Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCCCCCCCCCC)COP(O)(=O)OCCNC(=O)[C@H](C)NC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@H]1[C@H](O)[C@@H](CO)OC(O)[C@@H]1NC(C)=O JMUHBNWAORSSBD-WKYWBUFDSA-N 0.000 description 2
- 229960005225 mifamurtide Drugs 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 125000001446 muramyl group Chemical group N[C@@H](C=O)[C@@H](O[C@@H](C(=O)*)C)[C@H](O)[C@H](O)CO 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 238000007899 nucleic acid hybridization Methods 0.000 description 2
- 210000004940 nucleus Anatomy 0.000 description 2
- 239000006179 pH buffering agent Substances 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 229920000747 poly(lactic acid) Polymers 0.000 description 2
- 229920001515 polyalkylene glycol Polymers 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 2
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 2
- 229940031937 polysaccharide vaccine Drugs 0.000 description 2
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 description 2
- 230000001681 protective effect Effects 0.000 description 2
- 238000001742 protein purification Methods 0.000 description 2
- 230000002685 pulmonary effect Effects 0.000 description 2
- 230000002285 radioactive effect Effects 0.000 description 2
- 238000003259 recombinant expression Methods 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 229940016590 sarkosyl Drugs 0.000 description 2
- 238000010845 search algorithm Methods 0.000 description 2
- 239000013605 shuttle vector Substances 0.000 description 2
- 235000020183 skimmed milk Nutrition 0.000 description 2
- 238000000527 sonication Methods 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- ATHGHQPFGPMSJY-UHFFFAOYSA-N spermidine Chemical compound NCCCCNCCCN ATHGHQPFGPMSJY-UHFFFAOYSA-N 0.000 description 2
- PFNFFQXMRSDOHW-UHFFFAOYSA-N spermine Chemical compound NCCCNCCCCNCCCN PFNFFQXMRSDOHW-UHFFFAOYSA-N 0.000 description 2
- 210000004989 spleen cell Anatomy 0.000 description 2
- 229940031439 squalene Drugs 0.000 description 2
- TUHBEKDERLKLEC-UHFFFAOYSA-N squalene Natural products CC(=CCCC(=CCCC(=CCCC=C(/C)CCC=C(/C)CC=C(C)C)C)C)C TUHBEKDERLKLEC-UHFFFAOYSA-N 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 229960002180 tetracycline Drugs 0.000 description 2
- 229930101283 tetracycline Natural products 0.000 description 2
- 235000019364 tetracycline Nutrition 0.000 description 2
- 150000003522 tetracyclines Chemical class 0.000 description 2
- 150000003626 triacylglycerols Chemical class 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- 102000003390 tumor necrosis factor Human genes 0.000 description 2
- 108010016264 ubiquitin-Nalpha-protein hydrolase Proteins 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- 239000002691 unilamellar liposome Substances 0.000 description 2
- 238000002255 vaccination Methods 0.000 description 2
- 230000009385 viral infection Effects 0.000 description 2
- 239000011782 vitamin Substances 0.000 description 2
- 235000013343 vitamin Nutrition 0.000 description 2
- 229940088594 vitamin Drugs 0.000 description 2
- 229930003231 vitamin Natural products 0.000 description 2
- 238000001262 western blot Methods 0.000 description 2
- 238000009736 wetting Methods 0.000 description 2
- 210000005253 yeast cell Anatomy 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- REAWNMHCBIUKLZ-ZYHUDNBSSA-N (3R,4R)-4-(hydroxymethyl)-3-(6-methylheptanoyl)oxolan-2-one Chemical compound CC(C)CCCCC(=O)[C@H]1[C@H](CO)COC1=O REAWNMHCBIUKLZ-ZYHUDNBSSA-N 0.000 description 1
- YHQZWWDVLJPRIF-JLHRHDQISA-N (4R)-4-[[(2S,3R)-2-[acetyl-[(3R,4R,5S,6R)-3-amino-4-[(1R)-1-carboxyethoxy]-5-hydroxy-6-(hydroxymethyl)oxan-2-yl]amino]-3-hydroxybutanoyl]amino]-5-amino-5-oxopentanoic acid Chemical compound C(C)(=O)N([C@@H]([C@H](O)C)C(=O)N[C@H](CCC(=O)O)C(N)=O)C1[C@H](N)[C@@H](O[C@@H](C(=O)O)C)[C@H](O)[C@H](O1)CO YHQZWWDVLJPRIF-JLHRHDQISA-N 0.000 description 1
- AZXKALLRCOCGBV-UHFFFAOYSA-N 1-phenyl-2-(propan-2-ylamino)hexan-1-one Chemical compound CCCCC(NC(C)C)C(=O)C1=CC=CC=C1 AZXKALLRCOCGBV-UHFFFAOYSA-N 0.000 description 1
- GZCWLCBFPRFLKL-UHFFFAOYSA-N 1-prop-2-ynoxypropan-2-ol Chemical compound CC(O)COCC#C GZCWLCBFPRFLKL-UHFFFAOYSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- 108020004465 16S ribosomal RNA Proteins 0.000 description 1
- LDGWQMRUWMSZIU-LQDDAWAPSA-M 2,3-bis[(z)-octadec-9-enoxy]propyl-trimethylazanium;chloride Chemical compound [Cl-].CCCCCCCC\C=C/CCCCCCCCOCC(C[N+](C)(C)C)OCCCCCCCC\C=C/CCCCCCCC LDGWQMRUWMSZIU-LQDDAWAPSA-M 0.000 description 1
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 1
- OSJPPGNTCRNQQC-UWTATZPHSA-N 3-phospho-D-glyceric acid Chemical compound OC(=O)[C@H](O)COP(O)(O)=O OSJPPGNTCRNQQC-UWTATZPHSA-N 0.000 description 1
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 102000013563 Acid Phosphatase Human genes 0.000 description 1
- 108010051457 Acid Phosphatase Proteins 0.000 description 1
- 101100295756 Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / JCM 6841 / CCUG 19606 / CIP 70.34 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) omp38 gene Proteins 0.000 description 1
- 244000179819 Aechmea magdalenae Species 0.000 description 1
- 235000001291 Aechmea magdalenae Nutrition 0.000 description 1
- 241000256118 Aedes aegypti Species 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 102100034044 All-trans-retinol dehydrogenase [NAD(+)] ADH1B Human genes 0.000 description 1
- 101710193111 All-trans-retinol dehydrogenase [NAD(+)] ADH4 Proteins 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 244000144725 Amygdalus communis Species 0.000 description 1
- 241000207875 Antirrhinum Species 0.000 description 1
- 241000219194 Arabidopsis Species 0.000 description 1
- 206010003445 Ascites Diseases 0.000 description 1
- 108010002913 Asialoglycoproteins Proteins 0.000 description 1
- 244000003416 Asparagus officinalis Species 0.000 description 1
- 235000005340 Asparagus officinalis Nutrition 0.000 description 1
- 241001106067 Atropa Species 0.000 description 1
- 241001203868 Autographa californica Species 0.000 description 1
- 229930192334 Auxin Natural products 0.000 description 1
- 102000019260 B-Cell Antigen Receptors Human genes 0.000 description 1
- 108010012919 B-Cell Antigen Receptors Proteins 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- 241000219310 Beta vulgaris subsp. vulgaris Species 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 241000255789 Bombyx mori Species 0.000 description 1
- 241000701822 Bovine papillomavirus Species 0.000 description 1
- 238000009010 Bradford assay Methods 0.000 description 1
- 241000219198 Brassica Species 0.000 description 1
- 235000011331 Brassica Nutrition 0.000 description 1
- 241000209200 Bromus Species 0.000 description 1
- 102100034808 CCAAT/enhancer-binding protein alpha Human genes 0.000 description 1
- 108010071134 CRM197 (non-toxic variant of diphtheria toxin) Proteins 0.000 description 1
- 101100327917 Caenorhabditis elegans chup-1 gene Proteins 0.000 description 1
- 101100408682 Caenorhabditis elegans pmt-2 gene Proteins 0.000 description 1
- 241000589876 Campylobacter Species 0.000 description 1
- 241000222120 Candida <Saccharomycetales> Species 0.000 description 1
- 241000222122 Candida albicans Species 0.000 description 1
- 241000222128 Candida maltosa Species 0.000 description 1
- 235000002566 Capsicum Nutrition 0.000 description 1
- 240000008574 Capsicum frutescens Species 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 241001227713 Chiron Species 0.000 description 1
- 229920001661 Chitosan Polymers 0.000 description 1
- 206010008631 Cholera Diseases 0.000 description 1
- 241000723343 Cichorium Species 0.000 description 1
- 101710117490 Circumsporozoite protein Proteins 0.000 description 1
- 241000207199 Citrus Species 0.000 description 1
- 101710094648 Coat protein Proteins 0.000 description 1
- 238000011537 Coomassie blue staining Methods 0.000 description 1
- 229920000742 Cotton Polymers 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- JPVYNHNXODAKFH-UHFFFAOYSA-N Cu2+ Chemical compound [Cu+2] JPVYNHNXODAKFH-UHFFFAOYSA-N 0.000 description 1
- 244000024469 Cucumis prophetarum Species 0.000 description 1
- 235000010071 Cucumis prophetarum Nutrition 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 108010041986 DNA Vaccines Proteins 0.000 description 1
- 238000011238 DNA vaccination Methods 0.000 description 1
- 241000450599 DNA viruses Species 0.000 description 1
- 102000052510 DNA-Binding Proteins Human genes 0.000 description 1
- 108700020911 DNA-Binding Proteins Proteins 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 241000208175 Daucus Species 0.000 description 1
- 240000001879 Digitalis lutea Species 0.000 description 1
- 241000255601 Drosophila melanogaster Species 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 102100038132 Endogenous retrovirus group K member 6 Pro protein Human genes 0.000 description 1
- 108010067770 Endopeptidase K Proteins 0.000 description 1
- 101710091045 Envelope protein Proteins 0.000 description 1
- 102000003951 Erythropoietin Human genes 0.000 description 1
- 102100031939 Erythropoietin Human genes 0.000 description 1
- 108090000394 Erythropoietin Proteins 0.000 description 1
- 241000588722 Escherichia Species 0.000 description 1
- 101000686777 Escherichia phage T7 T7 RNA polymerase Proteins 0.000 description 1
- 108010074860 Factor Xa Proteins 0.000 description 1
- 108050000784 Ferritin Proteins 0.000 description 1
- 102000008857 Ferritin Human genes 0.000 description 1
- 238000008416 Ferritin Methods 0.000 description 1
- 241000192125 Firmicutes Species 0.000 description 1
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 1
- 241000220223 Fragaria Species 0.000 description 1
- 101150038242 GAL10 gene Proteins 0.000 description 1
- 102100024637 Galectin-10 Human genes 0.000 description 1
- 102100039556 Galectin-4 Human genes 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- 108700007698 Genetic Terminator Regions Proteins 0.000 description 1
- 241000208152 Geranium Species 0.000 description 1
- 229930191978 Gibberellin Natural products 0.000 description 1
- 102000030595 Glucokinase Human genes 0.000 description 1
- 108010021582 Glucokinase Proteins 0.000 description 1
- 108010070600 Glucose-6-phosphate isomerase Proteins 0.000 description 1
- 102100031132 Glucose-6-phosphate isomerase Human genes 0.000 description 1
- 102000004547 Glucosylceramidase Human genes 0.000 description 1
- 108010017544 Glucosylceramidase Proteins 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 1
- JZNWSCPGTDBMEW-UHFFFAOYSA-N Glycerophosphorylethanolamin Natural products NCCOP(O)(=O)OCC(O)CO JZNWSCPGTDBMEW-UHFFFAOYSA-N 0.000 description 1
- 102100021181 Golgi phosphoprotein 3 Human genes 0.000 description 1
- 241000219146 Gossypium Species 0.000 description 1
- 101150029115 HOPX gene Proteins 0.000 description 1
- 241000208818 Helianthus Species 0.000 description 1
- 102000005548 Hexokinase Human genes 0.000 description 1
- 108700040460 Hexokinases Proteins 0.000 description 1
- 108010033040 Histones Proteins 0.000 description 1
- 102000006947 Histones Human genes 0.000 description 1
- 101000945515 Homo sapiens CCAAT/enhancer-binding protein alpha Proteins 0.000 description 1
- 101000608765 Homo sapiens Galectin-4 Proteins 0.000 description 1
- 101001071515 Homo sapiens Gastrin-releasing peptide Proteins 0.000 description 1
- 101001002657 Homo sapiens Interleukin-2 Proteins 0.000 description 1
- 101001050288 Homo sapiens Transcription factor Jun Proteins 0.000 description 1
- 101001033034 Homo sapiens UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 244000025221 Humulus lupulus Species 0.000 description 1
- 235000008694 Humulus lupulus Nutrition 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical class Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 1
- 241000208278 Hyoscyamus Species 0.000 description 1
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 108010060231 Insect Proteins Proteins 0.000 description 1
- 102000006992 Interferon-alpha Human genes 0.000 description 1
- 108010047761 Interferon-alpha Proteins 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 108010002616 Interleukin-5 Proteins 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- 241000235649 Kluyveromyces Species 0.000 description 1
- 244000285963 Kluyveromyces fragilis Species 0.000 description 1
- 235000014663 Kluyveromyces fragilis Nutrition 0.000 description 1
- 241001138401 Kluyveromyces lactis Species 0.000 description 1
- 241000235058 Komagataella pastoris Species 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- 108010054278 Lac Repressors Proteins 0.000 description 1
- 241000186660 Lactobacillus Species 0.000 description 1
- 241000194034 Lactococcus lactis subsp. cremoris Species 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 241000208822 Lactuca Species 0.000 description 1
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 241000208204 Linum Species 0.000 description 1
- 102000011965 Lipoprotein Receptors Human genes 0.000 description 1
- 108010061306 Lipoprotein Receptors Proteins 0.000 description 1
- 241000209082 Lolium Species 0.000 description 1
- 101710125418 Major capsid protein Proteins 0.000 description 1
- 241000121629 Majorana Species 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 240000003183 Manihot esculenta Species 0.000 description 1
- 108091027974 Mature messenger RNA Proteins 0.000 description 1
- 235000017587 Medicago sativa ssp. sativa Nutrition 0.000 description 1
- 206010027202 Meningitis bacterial Diseases 0.000 description 1
- 241000713333 Mouse mammary tumor virus Species 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 101001033276 Mus musculus Interleukin-3 Proteins 0.000 description 1
- 101100476480 Mus musculus S100a8 gene Proteins 0.000 description 1
- OVBPIULPVIDEAO-UHFFFAOYSA-N N-Pteroyl-L-glutaminsaeure Natural products C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-UHFFFAOYSA-N 0.000 description 1
- 125000003047 N-acetyl group Chemical group 0.000 description 1
- SQVRNKJHWKZAKO-PFQGKNLYSA-N N-acetyl-beta-neuraminic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)O[C@H]1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-PFQGKNLYSA-N 0.000 description 1
- 108700015872 N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine Proteins 0.000 description 1
- 101100459189 Neisseria meningitidis serogroup B (strain MC58) mutS gene Proteins 0.000 description 1
- 240000002853 Nelumbo nucifera Species 0.000 description 1
- 235000006508 Nelumbo nucifera Nutrition 0.000 description 1
- 235000006510 Nelumbo pentapetala Nutrition 0.000 description 1
- 241001162910 Nemesia <spider> Species 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 241000208125 Nicotiana Species 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 102000006570 Non-Histone Chromosomal Proteins Human genes 0.000 description 1
- 108010008964 Non-Histone Chromosomal Proteins Proteins 0.000 description 1
- 108091092724 Noncoding DNA Proteins 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 108700020497 Nucleopolyhedrovirus polyhedrin Proteins 0.000 description 1
- 101710141454 Nucleoprotein Proteins 0.000 description 1
- XDMCWZFLLGVIID-SXPRBRBTSA-N O-(3-O-D-galactosyl-N-acetyl-beta-D-galactosaminyl)-L-serine Chemical compound CC(=O)N[C@H]1[C@H](OC[C@H]([NH3+])C([O-])=O)O[C@H](CO)[C@H](O)[C@@H]1OC1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 XDMCWZFLLGVIID-SXPRBRBTSA-N 0.000 description 1
- 241000040340 Oat mosaic virus Species 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 241000219830 Onobrychis Species 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 102100035593 POU domain, class 2, transcription factor 1 Human genes 0.000 description 1
- 101710084414 POU domain, class 2, transcription factor 1 Proteins 0.000 description 1
- 102100035591 POU domain, class 2, transcription factor 2 Human genes 0.000 description 1
- 101710084411 POU domain, class 2, transcription factor 2 Proteins 0.000 description 1
- 241000209117 Panicum Species 0.000 description 1
- 235000006443 Panicum miliaceum subsp. miliaceum Nutrition 0.000 description 1
- 235000009037 Panicum miliaceum subsp. ruderale Nutrition 0.000 description 1
- 241000208181 Pelargonium Species 0.000 description 1
- 241000209046 Pennisetum Species 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108010081690 Pertussis Toxin Proteins 0.000 description 1
- 240000007377 Petunia x hybrida Species 0.000 description 1
- 102000001105 Phosphofructokinases Human genes 0.000 description 1
- 108010069341 Phosphofructokinases Proteins 0.000 description 1
- 102000012288 Phosphopyruvate Hydratase Human genes 0.000 description 1
- 108010022181 Phosphopyruvate Hydratase Proteins 0.000 description 1
- 235000014676 Phragmites communis Nutrition 0.000 description 1
- 108700001094 Plant Genes Proteins 0.000 description 1
- 108010064851 Plant Proteins Proteins 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 241000223960 Plasmodium falciparum Species 0.000 description 1
- 241000209504 Poaceae Species 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 108010039918 Polylysine Proteins 0.000 description 1
- 241001505332 Polyomavirus sp. Species 0.000 description 1
- 101710083689 Probable capsid protein Proteins 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-N Propionic acid Chemical class CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 1
- 101710188315 Protein X Proteins 0.000 description 1
- 102100027584 Protein c-Fos Human genes 0.000 description 1
- 108010071563 Proto-Oncogene Proteins c-fos Proteins 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 101100084022 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) lapA gene Proteins 0.000 description 1
- 101100408135 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) phnA gene Proteins 0.000 description 1
- 238000012181 QIAquick gel extraction kit Methods 0.000 description 1
- 108010009460 RNA Polymerase II Proteins 0.000 description 1
- 102000009572 RNA Polymerase II Human genes 0.000 description 1
- 241000218206 Ranunculus Species 0.000 description 1
- 241000220259 Raphanus Species 0.000 description 1
- 108020005091 Replication Origin Proteins 0.000 description 1
- 108010034634 Repressor Proteins Proteins 0.000 description 1
- 241000714474 Rous sarcoma virus Species 0.000 description 1
- 241000235070 Saccharomyces Species 0.000 description 1
- 240000000111 Saccharum officinarum Species 0.000 description 1
- 235000007201 Saccharum officinarum Nutrition 0.000 description 1
- 241001106018 Salpiglossis Species 0.000 description 1
- 241000235346 Schizosaccharomyces Species 0.000 description 1
- 241000235347 Schizosaccharomyces pombe Species 0.000 description 1
- 241000780602 Senecio Species 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 206010040047 Sepsis Diseases 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 241000220261 Sinapis Species 0.000 description 1
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 241000207763 Solanum Species 0.000 description 1
- 235000002634 Solanum Nutrition 0.000 description 1
- PRXRUNOAOLTIEF-ADSICKODSA-N Sorbitan trioleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCC\C=C/CCCCCCCC)[C@H]1OC[C@H](O)[C@H]1OC(=O)CCCCCCC\C=C/CCCCCCCC PRXRUNOAOLTIEF-ADSICKODSA-N 0.000 description 1
- 240000006394 Sorghum bicolor Species 0.000 description 1
- 235000011684 Sorghum saccharatum Nutrition 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 241000256251 Spodoptera frugiperda Species 0.000 description 1
- 241000191940 Staphylococcus Species 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 235000014962 Streptococcus cremoris Nutrition 0.000 description 1
- 244000057717 Streptococcus lactis Species 0.000 description 1
- 235000014897 Streptococcus lactis Nutrition 0.000 description 1
- 101100038645 Streptomyces griseus rppA gene Proteins 0.000 description 1
- 241000187398 Streptomyces lividans Species 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 235000021536 Sugar beet Nutrition 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 1
- 102100040296 TATA-box-binding protein Human genes 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- AUYYCJSJGJYCDS-LBPRGKRZSA-N Thyrolar Chemical class IC1=CC(C[C@H](N)C(O)=O)=CC(I)=C1OC1=CC=C(O)C(I)=C1 AUYYCJSJGJYCDS-LBPRGKRZSA-N 0.000 description 1
- 108010018242 Transcription Factor AP-1 Proteins 0.000 description 1
- 108010083268 Transcription Factor TFIID Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 102100022972 Transcription factor AP-2-alpha Human genes 0.000 description 1
- 101710189834 Transcription factor AP-2-alpha Proteins 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 108090000901 Transferrin Proteins 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- 241000255993 Trichoplusia ni Species 0.000 description 1
- 241000219793 Trifolium Species 0.000 description 1
- 241001312519 Trigonella Species 0.000 description 1
- 239000007984 Tris EDTA buffer Substances 0.000 description 1
- 241000209140 Triticum Species 0.000 description 1
- 235000021307 Triticum Nutrition 0.000 description 1
- YJQCOFNZVFGCAF-UHFFFAOYSA-N Tunicamycin II Natural products O1C(CC(O)C2C(C(O)C(O2)N2C(NC(=O)C=C2)=O)O)C(O)C(O)C(NC(=O)C=CCCCCCCCCC(C)C)C1OC1OC(CO)C(O)C(O)C1NC(C)=O YJQCOFNZVFGCAF-UHFFFAOYSA-N 0.000 description 1
- 102100038413 UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase Human genes 0.000 description 1
- 108010046334 Urease Proteins 0.000 description 1
- 241000219977 Vigna Species 0.000 description 1
- 241000235013 Yarrowia Species 0.000 description 1
- 241000235015 Yarrowia lipolytica Species 0.000 description 1
- 241000209149 Zea Species 0.000 description 1
- 240000008042 Zea mays Species 0.000 description 1
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 1
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 1
- DSNRWDQKZIEDDB-GCMPNPAFSA-N [(2r)-3-[2,3-dihydroxypropoxy(hydroxy)phosphoryl]oxy-2-[(z)-octadec-9-enoyl]oxypropyl] (z)-octadec-9-enoate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@H](COP(O)(=O)OCC(O)CO)OC(=O)CCCCCCC\C=C/CCCCCCCC DSNRWDQKZIEDDB-GCMPNPAFSA-N 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- HMNZFMSWFCAGGW-XPWSMXQVSA-N [3-[hydroxy(2-hydroxyethoxy)phosphoryl]oxy-2-[(e)-octadec-9-enoyl]oxypropyl] (e)-octadec-9-enoate Chemical compound CCCCCCCC\C=C\CCCCCCCC(=O)OCC(COP(O)(=O)OCCO)OC(=O)CCCCCCC\C=C\CCCCCCCC HMNZFMSWFCAGGW-XPWSMXQVSA-N 0.000 description 1
- 150000001242 acetic acid derivatives Chemical class 0.000 description 1
- 108010022164 acetyl-LDL Proteins 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 230000001464 adherent effect Effects 0.000 description 1
- 230000000240 adjuvant effect Effects 0.000 description 1
- 108010050181 aleurone Proteins 0.000 description 1
- 239000003513 alkali Substances 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- 108090000637 alpha-Amylases Proteins 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- AZDRQVAHHNSJOQ-UHFFFAOYSA-N alumane Chemical class [AlH3] AZDRQVAHHNSJOQ-UHFFFAOYSA-N 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- DIZPMCHEQGEION-UHFFFAOYSA-H aluminium sulfate (anhydrous) Chemical compound [Al+3].[Al+3].[O-]S([O-])(=O)=O.[O-]S([O-])(=O)=O.[O-]S([O-])(=O)=O DIZPMCHEQGEION-UHFFFAOYSA-H 0.000 description 1
- 229960003896 aminopterin Drugs 0.000 description 1
- 239000003098 androgen Substances 0.000 description 1
- 229940030486 androgens Drugs 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000001745 anti-biotin effect Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 101150042295 arfA gene Proteins 0.000 description 1
- 239000012131 assay buffer Substances 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 230000003190 augmentative effect Effects 0.000 description 1
- 230000005784 autoimmunity Effects 0.000 description 1
- 238000000376 autoradiography Methods 0.000 description 1
- 239000002363 auxin Substances 0.000 description 1
- 201000009904 bacterial meningitis Diseases 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 150000001558 benzoic acid derivatives Chemical class 0.000 description 1
- 108010051210 beta-Fructofuranosidase Proteins 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000006696 biosynthetic metabolic pathway Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 239000001055 blue pigment Substances 0.000 description 1
- 230000036760 body temperature Effects 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 229940095731 candida albicans Drugs 0.000 description 1
- 239000001390 capsicum minimum Substances 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 235000020971 citrus fruits Nutrition 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000012761 co-transfection Methods 0.000 description 1
- 229940000425 combination drug Drugs 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 229910001431 copper ion Inorganic materials 0.000 description 1
- 235000005822 corn Nutrition 0.000 description 1
- 230000009260 cross reactivity Effects 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- UQHKFADEQIVWID-UHFFFAOYSA-N cytokinin Natural products C1=NC=2C(NCC=C(CO)C)=NC=NC=2N1C1CC(O)C(CO)O1 UQHKFADEQIVWID-UHFFFAOYSA-N 0.000 description 1
- 239000004062 cytokinin Substances 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 238000002716 delivery method Methods 0.000 description 1
- 238000000432 density-gradient centrifugation Methods 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000001784 detoxification Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- UMGXUWVIJIQANV-UHFFFAOYSA-M didecyl(dimethyl)azanium;bromide Chemical compound [Br-].CCCCCCCCCC[N+](C)(C)CCCCCCCCCC UMGXUWVIJIQANV-UHFFFAOYSA-M 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 229960003983 diphtheria toxoid Drugs 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 235000013399 edible fruits Nutrition 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 239000012149 elution buffer Substances 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 230000001804 emulsifying effect Effects 0.000 description 1
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- 229960003276 erythromycin Drugs 0.000 description 1
- 229940105423 erythropoietin Drugs 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 239000000262 estrogen Substances 0.000 description 1
- 229940011871 estrogen Drugs 0.000 description 1
- 229940031098 ethanolamine Drugs 0.000 description 1
- 229960000304 folic acid Drugs 0.000 description 1
- 235000019152 folic acid Nutrition 0.000 description 1
- 239000011724 folic acid Substances 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- 229940044627 gamma-interferon Drugs 0.000 description 1
- 230000035784 germination Effects 0.000 description 1
- 239000003448 gibberellin Substances 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- 102000006602 glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 1
- 210000003714 granulocyte Anatomy 0.000 description 1
- 229960000789 guanidine hydrochloride Drugs 0.000 description 1
- PJJJBBJSCAKJQF-UHFFFAOYSA-N guanidinium chloride Chemical compound [Cl-].NC(N)=[NH2+] PJJJBBJSCAKJQF-UHFFFAOYSA-N 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 239000012510 hollow fiber Substances 0.000 description 1
- 229930186900 holotoxin Natural products 0.000 description 1
- 244000052637 human pathogen Species 0.000 description 1
- 150000003840 hydrochlorides Chemical class 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 210000001822 immobilized cell Anatomy 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 229940042743 immune sera Drugs 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 230000000984 immunochemical effect Effects 0.000 description 1
- 230000004957 immunoregulator effect Effects 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- SEOVTRFCIGRIMH-UHFFFAOYSA-N indole-3-acetic acid Chemical compound C1=CC=C2C(CC(=O)O)=CNC2=C1 SEOVTRFCIGRIMH-UHFFFAOYSA-N 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 101150066555 lacZ gene Proteins 0.000 description 1
- 229940039696 lactobacillus Drugs 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 239000010410 layer Substances 0.000 description 1
- 235000021374 legumes Nutrition 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 238000007169 ligase reaction Methods 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 150000002690 malonic acid derivatives Chemical class 0.000 description 1
- 210000001161 mammalian embryo Anatomy 0.000 description 1
- 235000005739 manihot Nutrition 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 229940124731 meningococcal vaccine Drugs 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- WSFSSNUMVMOOMR-NJFSPNSNSA-N methanone Chemical compound O=[14CH2] WSFSSNUMVMOOMR-NJFSPNSNSA-N 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 229940031348 multivalent vaccine Drugs 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- JXTPJDDICSTXJX-UHFFFAOYSA-N n-Triacontane Natural products CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC JXTPJDDICSTXJX-UHFFFAOYSA-N 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 230000004942 nuclear accumulation Effects 0.000 description 1
- 239000007764 o/w emulsion Substances 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- 101150087557 omcB gene Proteins 0.000 description 1
- 101150115693 ompA gene Proteins 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 230000007030 peptide scission Effects 0.000 description 1
- 210000001322 periplasm Anatomy 0.000 description 1
- 108010021711 pertactin Proteins 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 210000003800 pharynx Anatomy 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 238000000819 phase cycle Methods 0.000 description 1
- 101150009573 phoA gene Proteins 0.000 description 1
- 235000021317 phosphate Nutrition 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 150000008104 phosphatidylethanolamines Chemical class 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 229930195732 phytohormone Natural products 0.000 description 1
- 210000000745 plant chromosome Anatomy 0.000 description 1
- 230000037039 plant physiology Effects 0.000 description 1
- 235000021118 plant-derived protein Nutrition 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920000724 poly(L-arginine) polymer Polymers 0.000 description 1
- 229920001606 poly(lactic acid-co-glycolic acid) Polymers 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 108010011110 polyarginine Proteins 0.000 description 1
- 229920000656 polylysine Polymers 0.000 description 1
- 108010055896 polyornithine Proteins 0.000 description 1
- 229920002714 polyornithine Polymers 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 230000029279 positive regulation of transcription, DNA-dependent Effects 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 230000001124 posttranscriptional effect Effects 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 239000001294 propane Substances 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 229940048914 protamine Drugs 0.000 description 1
- 229940070353 protamines Drugs 0.000 description 1
- 235000019833 protease Nutrition 0.000 description 1
- 238000002731 protein assay Methods 0.000 description 1
- 238000000164 protein isolation Methods 0.000 description 1
- 229940023143 protein vaccine Drugs 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 239000001397 quillaja saponaria molina bark Substances 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 229940064914 retrovir Drugs 0.000 description 1
- 229930182490 saponin Natural products 0.000 description 1
- 150000007949 saponins Chemical class 0.000 description 1
- 108700004121 sarkosyl Proteins 0.000 description 1
- 229920006395 saturated elastomer Polymers 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 239000006152 selective media Substances 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000002356 single layer Substances 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- KSAVQLQVUXSOCR-UHFFFAOYSA-M sodium lauroyl sarcosinate Chemical compound [Na+].CCCCCCCCCCCC(=O)N(C)CC([O-])=O KSAVQLQVUXSOCR-UHFFFAOYSA-M 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 238000000638 solvent extraction Methods 0.000 description 1
- 229940063673 spermidine Drugs 0.000 description 1
- 229940063675 spermine Drugs 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 229940032094 squalane Drugs 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 229940031626 subunit vaccine Drugs 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 150000003467 sulfuric acid derivatives Chemical class 0.000 description 1
- 235000011149 sulphuric acid Nutrition 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 229960000814 tetanus toxoid Drugs 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 239000005495 thyroid hormone Substances 0.000 description 1
- 229940036555 thyroid hormone Drugs 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 231100000167 toxic agent Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 239000012581 transferrin Substances 0.000 description 1
- 238000000844 transformation Methods 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 101150035767 trp gene Proteins 0.000 description 1
- 101150044170 trpE gene Proteins 0.000 description 1
- ZHSGGJXRNHWHRS-VIDYELAYSA-N tunicamycin Chemical compound O([C@H]1[C@@H]([C@H]([C@@H](O)[C@@H](CC(O)[C@@H]2[C@H]([C@@H](O)[C@@H](O2)N2C(NC(=O)C=C2)=O)O)O1)O)NC(=O)/C=C/CC(C)C)[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1NC(C)=O ZHSGGJXRNHWHRS-VIDYELAYSA-N 0.000 description 1
- MEYZYGMYMLNUHJ-UHFFFAOYSA-N tunicamycin Natural products CC(C)CCCCCCCCCC=CC(=O)NC1C(O)C(O)C(CC(O)C2OC(C(O)C2O)N3C=CC(=O)NC3=O)OC1OC4OC(CO)C(O)C(O)C4NC(=O)C MEYZYGMYMLNUHJ-UHFFFAOYSA-N 0.000 description 1
- 238000005199 ultracentrifugation Methods 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- HBOMLICNUCNMMY-XLPZGREQSA-N zidovudine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](N=[N+]=[N-])C1 HBOMLICNUCNMMY-XLPZGREQSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/22—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Neisseriaceae (F)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- This invention relates to an antigen from the related bacteria Neisseria meningitidis and Neisseria gonorrhoeae.
- Neisseria meningitidis is a non-motile, Gram-negative diplococcus human pathogen. It colonises the pharynx, causing meningitis and, occasionally, septicaemia in the absence of meningitis. It is closely related to N. gonorrhoeae, although one feature that clearly differentiates meningococcus from gonococcus is the presence of a polysaccharide capsule that is present in all pathogenic meningococci.
- N. meningitidis causes both endemic and epidemic disease. In the United States the attack rate is 0.6- 1 per 100,000 persons per year, and it can be much greater during outbreaks [Lieber an et al. (1996) JAMA 275(19):1499-1503; Schuchat et al (1997) N Engl J Med 337(14):970-976]. In developing countries, endemic disease rates are much higher and during epidemics incidence rates can reach 500 cases per 100,000 persons per year. Mortality is extremely high, at 10-20% in the United States, and much higher in developing countries. Following the introduction of the conjugate vaccine against Haemophilus influenzae, N. meningitidis is the major cause of bacterial meningitis at all ages in the United States [Schuchat et al (1997) supra].
- the meningococcal vaccine currently in use is a tetravalent polysaccharide vaccine composed of serogroups A, C, Y and W135. Following the success of the vaccination against H.influenzae, however, conjugate vaccines against serogroups A and C have been developed
- Meningococcus B remains a problem, however. This serotype currently is responsible for approximately 50% of total meningitis in the United States, Europe, and South America.
- the polysaccharide approach cannot be used because the menB capsular polysaccharide is a polymer of ⁇ (2-8)-Iinked N-acetyl neuraminic acid that is also present in mammalian tissue. This results in tolerance to the antigen; indeed, if a response were elicited, it would be anti-self, and therefore undesirable.
- the capsular polysaccharide has, for instance, been chemically modified substituting the N-acetyl groups with N-propionyl groups, leaving the specific antigenicity unaltered [Romero & Outschoorn (1994) Clin Microbiol Rev 7(4):559-575].
- OMPs outer membrane proteins
- the invention provides a protein comprising one or more of the following amino acid sequences: SEQ ID 1, SEQ ID 3, SEQ ID 4, SEQ ID 5, SEQ ID 7, SEQ ID 8, SEQ ID 9, SEQ ID 1 1, SEQ ID 12, SEQ ID 13.
- a protein comprising a sequence having sequence identity to SEQ ID 1 , SEQ ID 3, SEQ ID 4, SEQ ID 5, SEQ ID 7, SEQ ID 8, SEQ ID 9, SEQ ID 11, SEQ ID 12, or SEQ ID 13.
- the degree of sequence identity is preferably greater than 50% (e.g. 60%, 70%, 80%, 90%, 95%, 99% or more).
- These homologous sequences include mutants and allelic variants.
- 50% identity or more between two proteins is considered to be an indication of functional equivalence.
- the invention further provides a protein comprising a fragment of SEQ ID 1, SEQ ID 3, SEQ ID 4, SEQ ID 5, SEQ ID 7, SEQ ID 8, SEQ ID 9, SEQ ID 11, SEQ ID 12, or SEQ ID 13.
- the fragment should comprise at least n consecutive amino acids from the sequence and, depending on the particular sequence, n is 7 or more (e.g. 8, 10, 12, 14, 16, 18, 20 or more).
- n is 7 or more (e.g. 8, 10, 12, 14, 16, 18, 20 or more).
- the fragment comprises an epitope from the sequence.
- the proteins of the invention can, of course, be prepared by various means (e.g. recombinant expression, purification from cell culture, chemical synthesis etc.) and in various forms (e.g. native, fusions etc.). They are preferably prepared in substantially pure form (i.e. substantially free from other Neisseria or host cell proteins).
- the invention provides antibodies which bind to these proteins. These may be polyclonal or monoclonal and may be produced by any suitable means.
- the invention provides nucleic acid comprising SEQ ID 2, SEQ ID 6, or SEQ ID 10.
- the invention provides nucleic acid comprising sequences having sequence identity to SEQ ID 2, SEQ ID 6, or SEQ ID 10.
- the degree of sequence identity is preferably greater than 50% (e.g. 60%, 70%, 80%, 90%, 95%, 99% or more).
- nucleic acid which can hybridise to SEQ ID 2, SEQ ID 6, or SEQ ID 10, preferably under "high stringency” conditions (e.g. 65°C in a 0. IxSSC, 0.5% SDS solution).
- Nucleic acid comprising fragments of SEQ ID 2, SEQ ID 6, or SEQ ID 10 are also provided. These should comprise at least n consecutive nucleotides from SEQ ID 2, SEQ ID 6, or SEQ ID 10 and, depending on the particular sequence, n is 10 or more (eg 12, 14, 15, 18, 20, 25, 30, 35, 40 or more).
- the invention provides nucleic acid encoding the proteins and protein fragments of the invention.
- nucleic acid comprising sequences complementary to those described above (e.g. for antisense or probing pu ⁇ oses).
- Nucleic acid according to the invention can, of course, be prepared in many ways (e.g. by chemical synthesis, from genomic or cDNA libraries, from the organism itself etc.) and can take various forms (e.g. single stranded, double stranded, vectors, probes etc.).
- nucleic acid includes DNA and RNA, and also their analogues, such as those containing modified backbones, and also peptide nucleic acids (PNA) etc.
- the invention provides vectors comprising nucleotide sequences of the invention (e.g. expression vectors) and host cells transformed with such vectors.
- vectors comprising nucleotide sequences of the invention (e.g. expression vectors) and host cells transformed with such vectors.
- compositions comprising protein, antibody, and/or nucleic acid according to the invention.
- These compositions may be suitable as vaccines, for instance, or as diagnostic reagents, or as immunogenic compositions.
- compositions of the invention may further comprise immunogenic components selected from one or more of the following:
- compositions further comprise immunogenic components selected from one or more of the following:
- a protein comprising an amino acid sequence selected from the group consisting of SEQ IDs 2, 4, 6, 8,
- a protein comprising an amino acid sequence selected from the group consisting of SEQ IDs 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, & 90, as disclosed in W099/36544 (or a protein comprising an immunogenic fragment of one or more of these SEQ IDs, or a protein comprising a sequence having sequence identity (preferably greater than 50% e.g. 60%, 70%, 80%, 90%, 95%, 99% or more) to one of these SEQ IDs);
- a protein encoded by one of the 21 60 genes N M B 0001 to N M B 2160 disclosed in Tettelin et al [Science (2000) 287: 1809-1815] or a protein com prising an im m unogenic fragm ent of one or m ore of these 2160 genes, or a protein com prising a sequence having sequence identity (preferably greater than 50% e.g. 60% , 70% , 80% , 90% , 95 % , 99% or m ore) to one of these 2 160 genes);
- a protein comprising an amino acid sequence selected from the group consisting of SEQ IDs 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62,
- a protein comprising an amino acid sequence selected from the group consisting of SEQ IDs 1-8 disclosed in WO96/29412 (or a protein comprising an immunogenic fragment of one or more of these SEQ IDs, or a protein comprising a sequence having sequence identity (preferably greater than 50% e.g. 60%, 70%, 80%, 90%, 95%, 99% or more) to one of these SEQ IDs);
- a protein comprising an amino acid sequence selected from the group consisting of SEQ IDs 1-23 disclosed in WO95/03413 (or a protein comprising an immunogenic fragment of one or more of these SEQ IDs, or a protein comprising a sequence having sequence identity (preferably greater than 50% e.g. 60%, 70%, 80%, 90%, 95%, 99% or more) to one of these SEQ IDs);
- a protein comprising an amino acid sequence consisting of SEQ ID 2 disclosed in WO99/31 132 (or a protein comprising an immunogenic fragment of SEQ ID 2, or a protein comprising a sequence having sequence identity (preferably greater than 50% e.g. 60%, 70%, 80%, 90%, 95%, 99% or more) to SEQ ID 2);
- a polysaccharide antigen against Neisseria meningitidis serogroup C such as that described in Costantino et al. (1992) Vaccine 10:691 -698;
- a polysaccharide antigen against pneumococcus • A protective antigen against diphtheria, consisting of a diphtheria toxoid, such as the
- CRM197 mutant [e.g. Del Guidice et al. (1998) Molecular Aspects of Medicine 19: 1 -70].
- a protective antigen against tetanus consisting of a tetanus toxoid [e.g. Wassilak & Orenstein, Chapter 4 of Vaccines (eds. Plotkin & Mortimer), 1988]
- a protective antigen against whooping cough comprising pertussis holotoxin (PT) and filamentous haemagglutinin (FHA); optionally further comprising pertactin and/or agglutinogens 2 and 3 [e.g. Gustafsson et al. (1996) N. Engl. J. Med. 334:349-355; Rappuoli et al (1991) T1BTECH 9:232-238].
- a protective antigen against H. pylori comprising one or more of CagA (e.g. WO93/18150), VacA (e.g. WO93/18150), NAP (e.g. WO99/53310), HopX (e.g. WO98/04702), HopY (e.g. WO98/04702), urease.
- CagA e.g. WO93/18150
- VacA e.g. WO93/18150
- NAP e.g. WO99/53310
- HopX e.g. WO98/04702
- HopY e.g. WO98/04702
- a protective antigen against hepatitis B virus consisting of a HBV surface antigen and/or a HBV core antigen.
- the composition comprises an antigen against diphtheria, it preferably also comprises antigens against tetanus and polio.
- the composition comprises an antigen against tetanus, it preferably also comprises antigens against diphtheria and polio.
- the composition comprises an antigen against polio, it preferably also comprises antigens against diphtheria and tetanus.
- Pertussis toxin is a toxic protein and, when present in the composition, it is preferably detoxified. Detoxification may be by chemical and/or genetic means.
- a preferred detoxified mutant is the 9K/129G double mutant [e.g. Rappuoli (1997) Nature Medicine 3:374-376].
- composition includes a protein that exists in different nascent and mature forms
- the mature form of the protein is preferably used.
- NspA is included, (WO96/29412; see also Martin et al. (1997) J. Exp. Med Xj_5 1 173-1183) the mature form of the protein lacking the signal peptide is preferably used.
- composition includes a polysaccharide antigen
- the polysaccharide is preferably conjugated to a carrier protein.
- the proteins of the invention present in the compositions preferably interact synergistically with at least one of the protective antigens in the composition.
- the invention also provides the compositions of the invention for use as medicaments (preferably as vaccines) or as diagnostic reagents. It also provides the use of a composition according to the invention in the manufacture of: (i) a medicament for treating or preventing infection due to Neisserial bacteria; (ii) a diagnostic reagent for detecting the presence of Neisserial bacteria or of antibodies raised against Neisserial bacteria; and/or (iii) a reagent which can raise antibodies against Neisserial bacteria.
- Said Neisserial bacteria may be any species or strain (such as N. gonorrhoeae) but are preferably N. meningitidis, especially serogroup B.
- the invention also provides a method of treating a patient, comprising administering to the patient a therapeutically effective amount of nucleic acid, protein, and/or antibody according to the invention.
- the method is preferably immunisation.
- Vaccines according to the invention may either be prophylactic (i.e. to prevent infection) or therapeutic (i.e. to treat disease after infection).
- the invention provides various processes.
- a process for producing proteins of the invention comprising the step of culturing a host cell according to the invention under conditions which induce protein expression.
- a process for producing protein or nucleic acid of the invention wherein the protein or nucleic acid is synthesised in part or in whole using chemical means.
- a process for detecting polynucleotides of the invention comprising the steps of: (a) contacting a nucleic probe according to the invention with a biological sample under hybridizing conditions to form duplexes; and (b) detecting said duplexes.
- a process for detecting proteins of the invention comprising the steps of: (a) contacting an antibody according to the invention with a biological sample under conditions suitable for the formation of an antibody-antigen complexes; and (b) detecting said complexes.
- a composition containing X is "substantially free of Y when at least 85% by weight of the total X+Y in the composition is X.
- X comprises at least about 90% by weight of the total of X+Y in the composition, more preferably at least about 95% or even 99% by weight.
- composition comprising X may consist exclusively of X or may include something additional to X, such as X+Y.
- heterologous refers to two biological components that are not found together in nature.
- the components may be host cells, genes, or regulatory regions, such as promoters.
- heterologous components are not found together in nature, they can function together, as when a promoter heterologous to a gene is operably linked to the gene
- a Neisserial sequence is heterologous to a mouse host cell.
- a further examples would be two epitopes from the same or different proteins which have been assembled in a single protein in an arrangement not found in nature.
- An "origin of replication” is a polynucleotide sequence that initiates and regulates replication of polynucleotides, such as an expression vector.
- the origin of replication behaves as an autonomous unit of polynucleotide replication within a cell, capable of replication under its own control.
- An origin of replication may be needed for a vector to replicate in a particular host cell. With certain origins of replication, an expression vector can be reproduced at a high copy number in the presence of the appropriate proteins within the cell. Examples of origins are the autonomously replicating sequences, which are effective in yeast; and the viral T-antigen, effective in COS-7 cells.
- a "mutant" sequence is defined as DNA, RNA or amino acid sequence differing from but having sequence identity with the native or disclosed sequence.
- the degree of sequence identity between the native or disclosed sequence and the mutant sequence is preferably greater than 50% (e g. 60%, 70%, 80%, 90%, 95%, 99% or more, calculated using the Smith-Waterman algorithm as descnbed above)
- an "allelic variant" of a nucleic acid molecule, or region, for which nucleic acid sequence is provided herein is a nucleic acid molecule, or region, that occurs essentially at the same locus in the genome of another or second isolate, and that, due to natural variation caused by, for example, mutation or recombination, has a similar but not identical nucleic acid sequence.
- allelic variant typically encodes a protein having similar activity to that of the protein encoded by the gene to which it is being compared.
- allelic variant can also comprise an alteration in the 5' or 3' untranslated regions of the gene, such as in regulatory control regions (e.g. see US patent 5,753,235).
- Neisse ⁇ al nucleotide sequences can be expressed in a variety of different expression systems; for example those used with mammalian cells, baculov_ruses, plants, bacteria, and yeast. l Mammalian Systems
- a mammalian promoter is any DNA sequence capable of binding mammalian RNA polymerase and initiating the downstream (3') transcription of a coding sequence (e.g. structural gene) into mRNA.
- a promoter will have a transcription initiating region, which is usually placed proximal to the 5' end of the coding sequence, and a TATA box, usually located 25-30 base pairs (bp) upstream of the transcription initiation site. The TATA box is thought to direct RNA polymerase II to begin RNA synthesis at the correct site.
- a mammalian promoter will also contain an upstream promoter element, usually located within 100 to 200 bp upstream of the TATA box.
- An upstream promoter element determines the rate at which transcription is initiated and can act in either orientation [Sambrook et al. (1989) "Expression of Cloned Genes in Mammalian Cells.” In Molecular Cloning: A Laboratory Manual, 2nd ed.].
- Mammalian viral genes are often highly expressed and have a broad host range; therefore sequences encoding mammalian viral genes provide particularly useful promoter sequences. Examples include the SV40 early promoter, mouse mammary tumor virus LTR promoter, adenovirus major late promoter (Ad MLP), and he ⁇ es simplex virus promoter. In addition, sequences derived from non- viral genes, such as the murine metallotheionein gene, also provide useful promoter sequences. Expression may be either constitutive or regulated (inducible), depending on the promoter can be induced with glucocorticoid in hormone-responsive cells.
- Enhancer is a regulatory DNA sequence that can stimulate transcription up to 1000-fold when linked to homologous or heterologous promoters, with synthesis beginning at the normal RNA start site. Enhancers are also active when they are placed upstream or downstream from the transcription initiation site, in either normal or flipped orientation, or at a distance of more than 1000 nucleotides from the promoter [Maniatis et al. (1987) Science 236:1237; Alberts et al. (1989) Molecular Biology of the Cell, 2nd ed.]. Enhancer elements derived from viruses may be particularly useful, because they usually have a broader host range.
- Examples include the SV40 early gene enhancer [Dijkema et al (1985) EMBO J. 4:761] and the enhancer/promoters derived from the long terminal repeat (LTR) of the Rous Sarcoma Virus [Gorman et al. (1982b) Proc. Natl. Acad. Sci. 79:6777] and from human cytomegalovirus [Boshart et al. (1985) Cell 47:521]. Additionally, some enhancers are regulatable and become active only in the presence of an inducer, such as a hormone or metal ion [Sassone-Corsi and Borelli (1986) Trends Genet. 2:2X5; Maniatis et al.
- an inducer such as a hormone or metal ion
- a DNA molecule may be expressed intracellularly in mammalian cells.
- a promoter sequence may be directly linked with the DNA molecule, in which case the first amino acid at the N-terminus of the recombinant protein will always be a methionine, which is encoded by the ATG start codon. If desired, the N-terminus may be cleaved from the protein by in vitro incubation with cyanogen bromide.
- foreign proteins can also be secreted from the cell into the growth media by creating chimeric DNA molecules that encode a fusion protein comprised of a leader sequence fragment that provides for secretion of the foreign protein in mammalian cells.
- the leader sequence fragment usually encodes a signal peptide comprised of hydrophobic amino acids which direct the secretion of the protein from the cell.
- the adenovirus triparite leader is an example of a leader sequence that provides for secretion of a foreign protein in mammalian cells.
- transcription termination and polyadenylation sequences recognized by mammalian cells are regulatory regions located 3' to the translation stop codon and thus, together with the promoter elements, flank the coding sequence.
- the 3' terminus of the mature mRNA is formed by site- specific post-transcriptional cleavage and polyadenylation [Birnstiel et al. (1985) Cell 41:349; Proudfoot and Whitelaw (1988) "Termination and 3' end processing of eukaryotic RNA. In Transcription and splicing (ed. B.D. Hames and D.M. Glover); Proudfoot (1989) Trends Biochem. Sci. 74:105].
- transcription terminater/polyadenylation signals include those derived from SV40 [Sambrook et al (1989) "Expression of cloned genes in cultured mammalian cells.” In Molecular Cloning: A Laboratory Manual].
- the above described components comprising a promoter, polyadenylation signal, and transcription termination sequence are put together into expression constructs.
- Enhancers, introns with functional splice donor and acceptor sites, and leader sequences may also be included in an expression construct, if desired.
- Expression constructs are often maintained in a replicon, such as an extrachromosomal element (e.g. plasmids) capable of stable maintenance in a host, such as mammalian cells or bacteria.
- Mammalian replication systems include those derived from animal viruses, which require trans-acting factors to replicate.
- plasmids containing the replication systems of papova viruses such as SV40 [Gluzman (1981) Cell 23:175] or polyomavirus
- SV40 Gluzman (1981) Cell 23:175
- polyomavirus replicate to extremely high copy number in the presence of the appropriate viral T antigen.
- mammalian replicons include those derived from bovine papillomavirus and Epstein-Barr virus.
- the replicon may have two replicaton systems, thus allowing it to be maintained, for example, in mammalian cells for expression and in a prokaryotic host for cloning and amplification.
- mammalian-bacteria shuttle vectors include pMT2 [Kaufman et al. (1989) Mol. Cell. Biol. 9:946] and pHEBO [Shimizu et al.
- the transformation procedure used depends upon the host to be transformed.
- Methods for introduction of heterologous polynucleotides into mammalian cells include dextran-mediated transfection, calcium phosphate precipitation, polybrene mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, and direct microinjection of the DNA into nuclei.
- Mammalian cell lines available as hosts for expression are known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC), including but not limited to, Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g. Hep G2), and a number of other cell lines.
- ATCC American Type Culture Collection
- CHO Chinese hamster ovary
- HeLa cells HeLa cells
- BHK baby hamster kidney cells
- COS monkey kidney cells
- human hepatocellular carcinoma cells e.g. Hep G2
- the polynucleotide encoding the protein can also be inserted into a suitable insect expression vector, and is operably linked to the control elements within that vector.
- Vector construction employs techniques w hich are known in the art.
- the components of the expression system include a transfer vector, usually a bacterial plasm id, which contains both a fragment of the baculovirus genome, and a convenient restriction site for insertion of the heterologous gene or genes to be expressed; a wild type baculovirus with a sequence hom ologous to the baculovirus-specific fragment in the transfer vector (this allows for the hom ologous recom bination of the heterologous gene in to the baculovirus genom e); and appropriate insect host cells and growth m edia.
- the vector and the wild type viral genome are transfected into an insect host cell where the vector and viral genome are allowed to recombine.
- the packaged recombinant virus is expressed and recombinant plaques are identified and purified.
- Materials and methods for baculovirus/insect cell expression systems are commercially available in kit form from, inter alia, Invitrogen, San Diego CA ("MaxBac” kit). These techniques are generally known to those skilled in the art and fully described in Summers and Smith, Texas Agricultural Experiment Station Bulletin No. 1555 (1987) (hereinafter "Summers and Smith”).
- the above described components comprising a prom oter, leader (if desired), coding sequence of interest, and transcription term ination sequence, are usually assembled into an interm ediate transplacement construct (transfer vector).
- This construct m ay contain a single gene and operably linked regulatory elements; multiple genes, each with its owned set of operably linked regulatory elements; or multiple genes, regulated by the same set of regulatory elements.
- Intermediate transplacem ent constructs are often m aintained in a replicon, such as an extrachromosomal element (e.g.
- plasm ids capable of stable m aintenance in a host, such as a bacterium .
- the replicon w ill have a replication system , thus allowing it to be m aintained in a suitable host for cloning and amplification.
- pAc373 the most commonly used transfer vector for introducing foreign genes into AcNPV.
- Many other vectors known to those of skill in the art, have also been designed. These include, for example, pVL985 (which alters the polyhedrin start codon from ATG to ATT, and which introduces a BamHI cloning site 32 basepairs downstream from the ATT; see Luckow and Summers, Virology (1989) 77:31.
- the plasmid usually also contains the polyhedrin polyadenylation signal (Miller et al. (1988) Ann. Rev. Microbiol, 42:177) and a prokaryotic ampicillin-resistance (amp) gene and origin of replication for selection and propagation in E. coli.
- Baculovirus transfer vectors usually contain a baculovirus promoter.
- a baculovirus promoter is any DNA sequence capable of binding a baculovirus RNA polymerase and initiating the downstream (5' to 3') transcription of a coding sequence (e.g. structural gene) into mRNA.
- a promoter will have a transcription initiation region which is usually placed proximal to the 5' end of the coding sequence.
- This transcription initiation region usually includes an RNA polymerase binding site and a transcription initiation site.
- a baculovirus transfer vector may also have a second domain called an enhancer, which, if present, is usually distal to the structural gene.
- Expression may be either regulated or constitutive. Structural genes, abundantly transcribed at late times in a viral infection cycle, provide particularly useful promoter sequences. Examples include sequences derived from the gene encoding the viral polyhedron protein, Friesen et al., (1986) "The Regulation of Baculovirus Gene Expression," in: The Molecular Biology of Baculoviruses (ed. Walter Doerfler); EPO Publ. Nos.
- DNA encoding suitable signal sequences can be derived from genes for secreted insect or baculovirus proteins, such as the baculovirus polyhedrin gene (Carbonell et al. (1988) Gene, 73:409).
- the signals for mammalian cell posttranslational modifications (such as signal peptide cleavage, proteolytic cleavage, and phosphorylation) appear to be recognized by insect cells, and the signals required for secretion and nuclear accumulation also appear to be conserved between the invertebrate cells and vertebrate cells, leaders of non-insect origin, such as those derived from genes encoding human ⁇ -interferon, Maeda et al., (1985), Nature 315:592; human gastrin-releasing peptide, Lebacq-Verheyden et al., (1988), Molec. Cell. Biol. S:3129; human IL-2, Smith et al., (1985) Proc.
- mammalian cell posttranslational modifications such as signal peptide cleavage, proteolytic cleavage, and phosphorylation
- a recombinant polypeptide or polyprotein may be expressed intracellularly or, if it is expressed with the proper regulatory sequences, it can be secreted.
- Good intracellular expression of nonfused foreign proteins usually requires heterologous genes that ideally have a short leader sequence containing suitable translation initiation signals preceding an ATG start signal. If desired, methionine at the N-terminus may be cleaved from the mature protein by in vitro incubation with cyanogen bromide.
- recombinant polyproteins or proteins which are not naturally secreted can be secreted from the insect cell by creating chimeric DNA molecules that encode a fusion protein comprised of a leader sequence fragment that provides for secretion of the foreign protein in insects.
- the leader sequence fragment usually encodes a signal peptide comprised of hydrophobic amino acids which direct the translocation of the protein into the endoplasmic reticulum.
- an insect cell host is co-transformed with the heterologous DNA of the transfer vector and the genomic DNA of wild type baculovirus — usually by co-transfection.
- the promoter and transcription termination sequence of the construct will usually comprise a 2-5kb section of the baculovirus genome.
- the insertion can be into a gene such as the polyhedrin gene, by homologous double crossover recombination; insertion can also be into a restriction enzyme site engineered into the desired baculovirus gene. Miller et al., (1989), Bioessays 4:91.
- the DNA sequence, when cloned in place of the polyhedrin gene in the expression vector, is flanked both 5' and 3' by polyhedrin-specific sequences and is positioned downstream of the polyhedrin promoter.
- the newly formed baculovirus expression vector is subsequently packaged into an infectious recombinant baculovirus. Homologous recombination occurs at low frequency (between about 1% and about 5%); thus, the majority of the virus produced after cotransfection is still wild-type virus. Therefore, a method is necessary to identify recombinant viruses.
- An advantage of the expression system is a visual screen allowing recombinant viruses to be distinguished.
- the polyhedrin protein which is produced by the native virus, is produced at very high levels in the nuclei of infected cells at late times after viral infection. Accumulated polyhedrin protein forms occlusion bodies that also contain embedded particles.
- occlusion bodies up to 15 ⁇ m in size, are highly retractile, giving them a bright shiny appearance that is readily visualized under the light microscope.
- Cells infected with recombinant viruses lack occlusion bodies.
- the transfection supernatant is plaqued onto a monolayer of insect cells by techniques known to those skilled in the art. Namely, the plaques are screened under the light microscope for the presence (indicative of wild-type virus) or absence (indicative of recombinant virus) of occlusion bodies.
- Recombinant baculovirus expression vectors have been developed for infection into several insect cells.
- recombinant baculoviruses have been developed for, inter alia: Aedes aegypti , Autographa californica, Bombyx mori, Drosophila melanogaster, Spodoptera frugiperda, and Trichoplusia ni (WO 89/046699; Carbonell et al., (1985) J. Virol. 5(5:153; Wright (1986) Nature 327:718; Smith et al., (1983) Mol. Cell. Biol. 3:2156; and see generally, Fraser, et al. (1989) In Vitro Cell. Dev. Biol. 25:225).
- Cells and cell culture media are commercially available for both direct and fusion expression of heterologous polypeptides in a baculovirus/expression system; cell culture technology is generally known to those skilled in the art. See, e.g. Summers and Smith supra.
- the modified insect cells may then be grown in an appropriate nutrient medium, which allows for stable maintenance of the plasmid(s) present in the modified insect host. Where the expression product gene is under inducible control, the host may be grown to high density, and expression induced. Alternatively, where expression is constitutive, the product will be continuously expressed into the medium and the nutrient medium must be continuously circulated, while removing the product of interest and augmenting depleted nutrients.
- the product may be purified by such techniques as chromatography, e.g.
- the product may be further purified, as required, so as to remove substantially any insect proteins which are also secreted in the medium or result from lysis of insect cells, so as to provide a product which is at least substantially free of host debris, e.g. proteins, lipids and polysaccharides.
- recombinant host cells derived from the transformants are incubated under conditions which allow expression of the recombinant protein encoding sequence. These conditions will vary, dependent upon the host cell selected. However, the conditions are readily ascertainable to those of ordinary skill in the art, based upon what is known in the art. iii. Plant Systems
- a desired polynucleotide sequence is inserted into an expression cassette comprising genetic regulatory elements designed for operation in plants.
- the expression cassette is inserted into a desired expression vector with companion sequences upstream and downstream from the expression cassette suitable for expression in a plant host.
- the companion sequences will be of plasmid or viral origin and provide necessary characteristics to the vector to permit the vectors to move DNA from an original cloning host, such as bacteria, to the desired plant host.
- the basic bacterial/plant vector construct will preferably provide a broad host range prokaryote replication origin; a prokaryote selectable marker; and, for Agrobacterium transformations, T DNA sequences for Agrobacterium-mediated transfer to plant chromosomes.
- the construct will preferably also have a selectable marker gene suitable for determining if a plant cell has been transformed.
- a selectable marker gene suitable for determining if a plant cell has been transformed is found in Wilmink and Dons, 1993, Plant Mol. Biol. Reptr, 11 (2): 165-185.
- Sequences suitable for permitting integration of the heterologous sequence into the plant genome are also recommended. These might include transposon sequences and the like for homologous recombination as well as Ti sequences which permit random insertion of a heterologous expression cassette into a plant genome. Suitable prokaryote selectable markers include resistance toward antibiotics such as ampicillin or tetracycline. Other DNA sequences encoding additional functions may also be present in the vector, as is known in the art.
- the nucleic acid molecules of the subject invention may be included into an expression cassette for expression of the protein(s) of interest.
- the recombinant expression cassette will contain in addition to the heterologous protein encoding sequence the following elements, a promoter region, plant 5' untranslated sequences, initiation codon depending upon whether or not the structural gene comes equipped with one, and a transcription and translation termination sequence.
- Unique restriction enzyme sites at the 5' and 3' ends of the cassette allow for easy insertion into a pre-existing vector.
- a heterologous coding sequence may be for any protein relating to the present invention.
- the sequence encoding the protein of interest will encode a signal peptide which allows processing and translocation of the protein, as appropriate, and will usually lack any sequence which might result in the binding of the desired protein of the invention to a membrane. Since, for the most part, the transcriptional initiation region will be for a gene which is expressed and translocated during germination, by employing the signal peptide which provides for translocation, one may also provide for translocation of the protein of interest. In this way, the protein(s) of interest will be translocated from the cells in which they are expressed and may be efficiently harvested.
- the ultimate expression of the desired gene product will be in a eucaryotic cell it is desirable to determine whether any portion of the cloned gene contains sequences which will be processed out as introns by the host's splicosome machinery. If so, site-directed mutagenesis of the "intron" region may be conducted to prevent losing a portion of the genetic message as a false intron code, Reed and Maniatis, Cell 41 :95-105, 1985.
- the vector can be microinjected directly into plant cells by use of micropipettes to mechanically transfer the recombinant DNA. Crossway, Mol. Gen. Genet, 202:179-185, 1985.
- the genetic material may also be transferred into the plant cell by using polyethylene glycol, Krens, et al., Nature, 296, 72-74, 1982.
- Another method of introduction of nucleic acid segments is high velocity ballistic penetration by small particles with the nucleic acid either within the matrix of small beads or particles, or on the surface, Klein, et al., Nature, 327, 70-73, 1987 and Knudsen and Muller, 1991, Planta, 185:330-336 teaching particle bombardment of barley endosperm to create transgenic barley.
- Yet another method of introduction would be fusion of protoplasts with other entities, either minicells, cells, lysosomes or other fusible lipid-surfaced bodies, Fraley, et al., Proc. Natl. Acad. Sci. USA, 79, 1859-1863, 1982.
- the vector may also be introduced into the plant cells by electroporation. (Fromm et al., Proc. Natl Acad. Sci. USA 82:5824, 1985).
- plant protoplasts are electroporated in the presence of plasmids containing the gene construct. Electrical impulses of high field strength reversibly permeabilize biomembranes allowing the introduction of the plasmids. Electroporated plant protoplasts reform the cell wall, divide, and form plant callus.
- All plants from which protoplasts can be isolated and cultured to give whole regenerated plants can be transformed by the present invention so that whole plants are recovered which contain the transferred gene. It is known that practically all plants can be regenerated from cultured cells or tissues, including but not limited to all major species of sugarcane, sugar beet, cotton, fruit and other trees, legumes and vegetables.
- Some suitable plants include, for example, species from the genera Fragaria, Lotus, Medicago, Onobrychis, Trifolium, Trigonella, Vigna, Citrus, Linum, Geranium, Manihot, Daucus, Arabidopsis, Brassica, Raphanus, Sinapis, Atropa, Capsicum, Datura, Hyoscyamus, Lycopersion, Nicotiana, Solanum, Petunia, Digitalis, Majorana, Cichorium, Helianthus, Lactuca, Bromus, Asparagus, Antirrhinum, Hererocallis, Nemesia, Pelargonium, Panicum, Pennisetum, Ranunculus, Senecio, Salpiglossis, Cucumis, Browaalia, Glycine, Lolium, Zea, Triticum, Sorghum, and Datura.
- Means for regeneration vary from species to species of plants, but generally a suspension of transformed protoplasts containing copies of the heterologous gene is first provided. Callus tissue is formed and shoots may be induced from callus and subsequently rooted. Alternatively, embryo formation can be induced from the protoplast suspension. These embryos germinate as natural embryos to form plants.
- the culture media will generally contain various amino acids and hormones, such as auxin and cytokinins. It is also advantageous to add glutamic acid and proline to the medium, especially for such species as corn and alfalfa. Shoots and roots normally develop simultaneously. Efficient regeneration will depend on the medium, on the genotype, and on the history of the culture. If these three variables are controlled, then regeneration is fully reproducible and repeatable.
- the desired protein of the invention may be excreted or alternatively, the protein may be extracted from the whole plant. W ere the desired protein of the invention is secreted into the medium, it may be collected. Alternatively, the embryos and embryoless-half seeds or other plant tissue may be mechanically disrupted to release any secreted protein between cells and tissues. The mixture may be suspended in a buffer solution to retrieve soluble proteins. Conventional protein isolation and purification methods will be then used to purify the recombinant protein. Parameters of time, temperature pH, oxygen, and volumes will be adjusted through routine methods to optimize expression and recovery of heterologous protein. iv. Bacterial Systems
- a bacterial promoter is any DNA sequence capable of binding bacterial RNA polymerase and initiating the downstream (3') transcription of a coding sequence (e.g. structural gene) into mRNA.
- a promoter will have a transcription initiation region which is usually placed proximal to the 5' end of the coding sequence. This transcription initiation region usually includes an RNA polymerase binding site and a transcription initiation site.
- a bacterial promoter may also have a second domain called an operator, that may overlap an adjacent RNA polymerase binding site at which RNA synthesis begins. The operator permits negative regulated (inducible) transcription, as a gene repressor protein may bind the operator and thereby inhibit transcription of a specific gene.
- Constitutive expression may occur in the absence of negative regulatory elements, such as the operator.
- positive regulation may be achieved by a gene activator protein binding sequence, which, if present is usually proximal (5') to the RNA polymerase binding sequence.
- An example of a gene activator protein is the catabolite activator protein (CAP), which helps initiate transcription of the lac operon in Escherichia coli (E. coli) [Raibaud et al. (1984) Annu. Rev. Genet. 75:173].
- Regulated expression may therefore be either positive or negative, thereby either enhancing or reducing transcription.
- Sequences encoding metabolic pathway enzymes provide particularly useful promoter sequences. Examples include promoter sequences derived from sugar metabolizing enzymes, such as galactose, lactose (lac) [Chang et al. (1977) Nature 798:1056], and maltose. Additional examples include promoter sequences derived from biosynthetic enzymes such as tryptophan (trp) [Goeddel et al. (1980) Nuc. Acids Res. 8:4057; Yelverton et al. (1981) Nucl. Acids Res. 9:731 ; US patent 4,738,921; EP-A-0036776 and EP-A-0121775].
- the tac promoter is a hybrid trp-lac promoter comprised of both trp promoter and lac operon sequences that is regulated by the lac repressor [Amann et al. (1983) Gene 25:167; de Boer et al. (1983) Proc. Natl. Acad. Sci. 80:21].
- a bacterial promoter can include naturally occurring promoters of non-bacterial origin that have the ability to bind bacterial RNA polymerase and initiate transcription.
- a naturally occurring promoter of non-bacterial origin can also be coupled with a compatible RNA polymerase to produce high levels of expression of some genes in prokaryotes.
- bacteriophage T7 RNA polymerase/promoter system is an example of a coupled promoter system [Studier et al. (1986) J. Mol. Biol. 789:1 13; Tabor et al. (1985) Proc Natl. Acad. Sci. 82: 1074].
- a hybrid promoter can also be comprised of a bacteriophage promoter and an E. coli operator region (EPO- A-0 267 851).
- an efficient ribosome binding site is also useful for the expression of foreign genes in prokaryotes.
- the ribosome binding site is called the Shine-Dalgarno (SD) sequence and includes an initiation codon (ATG) and a sequence 3-9 nucleotides in length located 3-1 1 nucleotides upstream of the initiation codon [Shine et al. (1975) Nature 254:34].
- SD sequence is thought to promote binding of mRNA to the ribosome by the pairing of bases between the SD sequence and the 3' and of E. coli 16S rRNA [Steitz et al.
- a DNA molecule may be expressed intracellularly.
- a promoter sequence may be directly linked with the DNA molecule, in which case the first amino acid at the N-terminus will always be a methionine, which is encoded by the ATG start codon. If desired, methionine at the N-terminus may be cleaved from the protein by in vitro incubation with cyanogen bromide or by either in vivo on in vitro incubation with a bacterial methionine N-terminal peptidase (EPO-A-0219 237).
- Fusion proteins provide an alternative to direct expression. Usually, a DNA sequence encoding the
- N-terminal portion of an endogenous bacterial protein, or other stable protein is fused to the 5' end of heterologous coding sequences.
- this construct will provide a fusion of the two amino acid sequences.
- the bacteriophage lambda cell gene can be linked at the 5' terminus of a foreign gene and expressed in bacteria.
- the resulting fusion protein preferably retains a site for a processing enzyme (factor Xa) to cleave the bacteriophage protein from the foreign gene
- Fusion proteins can also be made with sequences from the lacZ [Jia et al (1987) Gene 60:197], trpE [Allen et al. (1987) J. Biotechnol. 5:93; Makoff et al.
- the DNA sequence at the junction of the two amino acid sequences may or may not encode a cleavable site.
- a ubiquitin fusion protein is made with the ubiquitin region that preferably retains a site for a processing enzyme (e.g. ubiquitin specific processing-protease) to cleave the ubiquitin from the foreign protein.
- a processing enzyme e.g. ubiquitin specific processing-protease
- foreign proteins can also be secreted from the cell by creating chimeric DNA molecules that encode a fusion protein comprised of a signal peptide sequence fragment that provides for secretion of the foreign protein in bacteria [US patent 4,336,336].
- the signal sequence fragment usually encodes a signal peptide comprised of hydrophobic am ino acids w hich direct the secretion of the protein from the cell.
- the protein is either secreted into the growth media (gram-positive bacteria) or into the periplasmic space, located between the inner and outer membrane of the cell (gram-negative bacteria).
- w hich can be cleaved either in vivo or in vitro encoded between the signal peptide fragment and the foreign gene.
- DNA encoding suitable signal sequences can be derived from genes for secreted bacterial proteins, such as the E. coli outer membrane protein gene (ompA) [Masui et al (1983), in: Experimental Manipulation of Gene Expression; Ghrayeb et al. (1984) EMBO J. 3:2437] and the E. coli alkaline phosphatase signal sequence (phoA) [Oka et al. (1985) Proc. Natl. Acad. Sci. 82:72X2].
- the signal sequence of the alpha-amylase gene from various Bacillus strains can be used to secrete heterologous proteins from B. subtilis [Palva et al. (1982) Proc. Natl Acad. Sci. USA 79:5582; EP-A-0 244 042].
- transcription termination sequences recognized by bacteria are regulatory regions located 3' to the translation stop codon, and thus together with the promoter flank the coding sequence. These sequences direct the transcription of an mRNA which can be translated into the polypeptide encoded by the DNA. Transcription termination sequences frequently include DNA sequences of about 50 nucleotides capable of forming stem loop structures that aid in terminating transcription. Examples include transcription termination sequences derived from genes with strong promoters, such as the trp gene in E. coli as well as other biosynthetic genes. Usually, the above described components, comprising a promoter, signal sequence (if desired), coding sequence of interest, and transcription termination sequence, are put together into expression constructs.
- Expression constructs are often maintained in a replicon, such as an extrachromosomal element (e.g. plasmids) capable of stable maintenance in a host, such as bacteria.
- the replicon will have a replication system, thus allowing it to be maintained in a prokaryotic host either for expression or for cloning and amplification.
- a replicon may be either a high or low copy number plasmid.
- a high copy number plasmid will generally have a copy number ranging from about 5 to about 200, and usually about 10 to about 150.
- a host containing a high copy number plasmid will preferably contain at least about 10, and more preferably at least about 20 plasmids. Either a high or low copy number vector may be selected, depending upon the effect of the vector and the foreign protein on the host.
- the expression constructs can be integrated into the bacterial genome with an integrating vector.
- Integrating vectors usually contain at least one sequence homologous to the bacterial chromosome that allows the vector to integrate. Integrations appear to result from recombinations between homologous DNA in the vector and the bacterial chromosome.
- integrating vectors constructed with DNA from various Bacillus strains integrate into the Bacillus chromosome (EP-A- 0 127 328). Integrating vectors may also be comprised of bacteriophage or transposon sequences.
- extrachromosomal and integrating expression constructs may contain selectable markers to allow for the selection of bacterial strains that have been transformed.
- Selectable markers can be expressed in the bacterial host and may include genes which render bacteria resistant to drugs such as ampicillin, chloramphenicol, erythromycin, kanamycin (neomycin), and tetracycline [Davies et al. (1978) Annu. Rev. Microbiol. 32:469].
- Selectable markers may also include biosynthetic genes, such as those in the histidine, tryptophan, and leucine biosynthetic pathways.
- Transformation vectors are usually comprised of a selectable market that is either maintained in a replicon or developed into an integrating vector, as described above.
- Expression and transformation vectors have been developed for transformation into many bacteria.
- expression vectors have been developed for, inter alia, the following bacteria: Bacillus subtilis [Palva et al (1982) Proc. Natl. Acad. Sci. USA 79:5582; EP-A-0 036 259 and EP-A-0 063 953; WO 84/04541], Escherichia coli [Shimatake et al. (1981) Nature 292:128; A ann et al. (1985) Gene 40:183; Studier et al. (1986) J. Mol. Biol.
- Methods of introducing exogenous DNA into bacterial hosts are well-known in the art, and usually include either the transformation of bacteria treated with CaCl 2 or other agents, such as divalent cations and DMSO. DNA can also be introduced into bacterial cells by electroporation.
- Transformation procedures usually vary with the bacterial species to be transformed. See e.g.
- a yeast promoter is any DNA sequence capable of binding yeast RNA polymerase and initiating the downstream (3') transcription of a coding sequence (e.g. structural gene) into mRNA.
- a promoter will have a transcription initiation region which is usually placed proximal to the 5' end of the coding sequence. This transcription initiation region usually includes an RNA polymerase binding site (the "TATA Box") and a transcription initiation site.
- a yeast promoter may also have a second domain called an upstream activator sequence (UAS), which, if present, is usually distal to the structural gene.
- the UAS permits regulated (inducible) expression. Constitutive expression occurs in the absence of a UAS. Regulated expression may be either positive or negative, thereby either enhancing or reducing transcription.
- Yeast is a fermenting organism with an active metabolic pathway, therefore sequences encoding enzymes in the metabolic pathway provide particularly useful promoter sequences. Examples include alcohol dehydrogenase (ADH) (EP-A-0 284 044), enolase, glucokinase, glucose-6- phosphate isomerase, glyceraldehyde-3-phosphate-dehydrogenase (GAP or GAPDH), hexokinase, phosphofructokinase, 3-phosphoglycerate mutase, and pyruvate kinase (PyK) (EPO-A-0 329 203).
- the yeast PH05 gene encoding acid phosphatase, also provides useful promoter sequences [Myanohara et al. ( 1983) Proc. Natl. Acad. Sci. USA 80: 1 ] .
- synthetic promoters which do not occur in nature also function as yeast promoters.
- UAS sequences of one yeast promoter may be joined with the transcription activation region of another yeast promoter, creating a synthetic hybrid promoter.
- hybrid promoters include the ADH regulatory sequence linked to the GAP transcription activation region (US Patent Nos. 4,876,197 and 4,880,734).
- Other examples of hybrid promoters include promoters which consist of the regulatory sequences of either the ADH2, GAL4, GAL10, OR PH05 genes, combined with the transcriptional activation region of a glycolytic enzyme gene such as GAP or PyK (EP-A-0 164 556).
- a yeast promoter can include naturally occurring promoters of non-yeast origin that have the ability to bind yeast RNA polymerase and initiate transcription. Examples of such promoters include, ter alia, [Cohen et al. (1980) Proc. Natl. Acad. Sci. USA 77: 1078; Henikoff et al. (1981) Nature 283:835; Hollenberg et al. (1981) Curr. Topics Microbiol. Immunol. 96:1 19; Hollenberg et al. (1979) "The Expression of Bacterial Antibiotic Resistance Genes in the Yeast Saccharomyces cerevisiae," in: Plasmids of Medical, Environmental and Commercial Importance (eds. K.N. Timmis and A. Puhler); Mercerau-Puigalon et al. (1980) Gene 77:163; Panthier et al. (1980) Curr. Genet. 2: 109;].
- a DNA molecule may be expressed intracellularly in yeast.
- a promoter sequence may be directly linked with the DNA molecule, in which case the first amino acid at the N-terminus of the recombinant protein will always be a methionine, which is encoded by the ATG start codon. If desired, methionine at the N-terminus may be cleaved from the protein by in vitro incubation with cyanogen bromide.
- Fusion proteins provide an alternative for yeast expression systems, as well as in mammalian, baculovirus, and bacterial expression systems.
- a DNA sequence encoding the N-terminal portion of an endogenous yeast protein, or other stable protein is fused to the 5' end of heterologous coding sequences.
- this construct will provide a fusion of the two amino acid sequences.
- the yeast or human superoxide dismutase (SOD) gene can be linked at the 5' terminus of a foreign gene and expressed in yeast.
- the DNA sequence at the junction of the two amino acid sequences may or may not encode a cleavable site. See e.g. EP-A-0 196 056.
- a ubiquitin fusion protein is made with the ubiquitin region that preferably retains a site for a processing enzyme (e.g. ubiquitin-specific processing protease) to cleave the ubiquitin from the foreign protein.
- a processing enzyme e.g. ubiquitin-specific processing protease
- native foreign protein can be isolated (e.g. WO88/024066).
- foreign proteins can also be secreted from the cell into the growth media by creating chimeric DNA molecules that encode a fusion protein comprised of a leader sequence fragment that provide for secretion in yeast of the foreign protein.
- a leader sequence fragment that provide for secretion in yeast of the foreign protein.
- the leader sequence fragment usually encodes a signal peptide comprised of hydrophobic amino acids which direct the secretion of the protein from the cell.
- DNA encoding suitable signal sequences can be derived from genes for secreted yeast proteins, such as the yeast invertase gene (EP-A-0 012 873; JPO. 62,096,086) and the A-factor gene (US patent 4,588,684).
- leaders of non-yeast origin such as an interferon leader, exist that also provide for secretion in yeast (EP-A-0060057).
- a preferred class of secretion leaders are those that employ a fragment of the yeast alpha-factor gene, which contains both a "pre" signal sequence, and a "pro” region.
- the types of alpha-factor fragments that can be employed include the full-length pre-pro alpha factor leader (about 83 amino acid residues) as well as truncated alpha-factor leaders (usually about 25 to about 50 amino acid residues) (US Patents 4,546,083 and 4,870,008; EP-A-0 324 274).
- Additional leaders employing an alpha-factor leader fragment that provides for secretion include hybrid alpha-factor leaders made with a presequence of a first yeast, but a pro-region from a second yeast alphafactor. (e.g. see WO 89/02463.)
- transcription termination sequences recognized by yeast are regulatory regions located 3' to the translation stop codon, and thus together with the promoter flank the coding sequence. These sequences direct the transcription of an mRNA which can be translated into the polypeptide encoded by the DNA. Examples of transcription terminator sequence and other yeast-recognized termination sequences, such as those coding for glycolytic enzymes.
- Expression constructs are often maintained in a replicon, such as an extrachromosomal element (e.g. plasmids) capable of stable maintenance in a host, such as yeast or bacteria.
- the replicon may have two replication systems, thus allowing it to be maintained, for example, in yeast for expression and in a prokaryotic host for cloning and amplification.
- yeast- bacteria shuttle vectors include YEp24 [Botstein et al. (1979) Gene 8:17-24], pCl/1 [Brake et al. (1984) Proc. Natl Acad.
- a replicon may be either a high or low copy number plasmid.
- a high copy number plasmid will generally have a copy number ranging from about 5 to about 200, and usually about 10 to about 150.
- a host containing a high copy number plasmid will preferably have at least about 10, and more preferably at least about 20. Enter a high or low copy number vector may be selected, depending upon the effect of the vector and the foreign protein on the host. See e.g. Brake et al, supra.
- the expression constructs can be integrated into the yeast genome with an integrating vector.
- Integrating vectors usually contain at least one sequence homologous to a yeast chromosome that allows the vector to integrate, and preferably contain two homologous sequences flanking the expression construct. Integrations appear to result from recombinations between homologous DNA in the vector and the yeast chromosome [Orr- Weaver et al. (1983) Methods in Enzymol. 707:228- 245].
- An integrating vector may be directed to a specific locus in yeast by selecting the appropriate homologous sequence for inclusion in the vector. See Orr- Weaver et al, supra.
- One or more expression construct may integrate, possibly affecting levels of recombinant protein produced [Rine et al.
- the chromosomal sequences included in the vector can occur either as a single segment in the vector, which results in the integration of the entire vector, or two segments homologous to adjacent segments in the chromosome and flanking the expression construct in the vector, which can result in the stable integration of only the expression construct.
- extrachromosomal and integrating expression constructs may contain selectable markers to allow for the selection of yeast strains that have been transformed.
- Selectable markers may include biosynthetic genes that can be expressed in the yeast host, such as ADE2, H1S4, LEU2, TRP1, and ALG7, and the G418 resistance gene, which confer resistance in yeast cells to tunicamycin and G418, respectively.
- a suitable selectable marker may also provide yeast with the ability to grow in the presence of toxic compounds, such as metal.
- the presence of CUP1 allows yeast to grow in the presence of copper ions [Butt et al. (1987) Microbiol, Rev. 57:351].
- Transformation vectors are usually comprised of a selectable marker that is either maintained in a replicon or developed into an integrating vector, as described above.
- Expression and transformation vectors have been developed for transformation into many yeasts.
- expression vectors have been developed for, ter alia, the following yeasts:Candida albicans [Kurtz, et al. (1986) Mol Cell. Biol. 6: 142], Candida maltosa [Kunze, et al. (1985) J. Basic Microbiol. 25:141]. Hansenula polymo ⁇ ha [Gleeson, et al. (1986) J. Gen. Microbiol. 732:3459; Roggenkamp et al (1986) Mol. Gen. Genet. 202:302], Kluyveromyces fragilis [Das, et al.
- Methods of introducing exogenous DNA into yeast hosts are well-known in the art, and usually include either the transformation of spheroplasts or of intact yeast cells treated with alkali cations. Transformation procedures usually vary with the yeast species to be transformed. See e.g. [Kurtz et al. (1986) Mol. Cell. Biol. 6:142; Kunze et al. (1985) J. Basic Microbiol 25:141; Candida]; [Gleeson et al. (1986) J. Gen. Microbiol. 732:3459; Roggenkamp et al. (1986) Mol. Gen. Genet. 202:302; Hansenula]; [Das et al. (1984) J. Bacteriol.
- antibody refers to a polypeptide or group of polypeptides composed of at least one antibody combining site.
- An “antibody combining site” is the three-dimensional binding space with an internal surface shape and charge distribution complementary to the features of an epitope of an antigen, which allows a binding of the antibody with the antigen.
- Antibody includes, for example, vertebrate antibodies, hybrid antibodies, chimeric antibodies, humanised antibodies, altered antibodies, univalent antibodies, Fab proteins, and single domain antibodies. Antibodies against the proteins of the invention are useful for affinity chromatography, immunoassays, and distinguishing/identifying Neisserial proteins.
- Antibodies to the proteins of the invention may be prepared by conventional methods.
- the protein is first used to immunize a suitable animal, preferably a mouse, rat, rabbit or goat. Rabbits and goats are preferred for the preparation of polyclonal sera due to the volume of serum obtainable, and the availability of labeled anti-rabbit and anti-goat antibodies.
- Immunization is generally performed by mixing or emulsifying the protein in saline, preferably in an adjuvant such as Freund's complete adjuvant, and injecting the mixture or emulsion parenterally (generally subcutaneously or intramuscularly). A dose of 50-200 ⁇ g injection is typically sufficient.
- Immunization is generally boosted 2-6 weeks later with one or more injections of the protein in saline, preferably using Freund's incomplete adjuvant.
- Polyclonal antisera is obtained by bleeding the immunized animal into a glass or plastic container, incubating the blood at 25°C for one hour, followed by incubating at 4°C for 2-18 hours. The serum is recovered by centrifugation (e.g. 1 ,000g for 10 minutes). About 20-50 ml per bleed may be obtained from rabbits.
- Monoclonal antibodies are prepared using the standard method of Kohler & Milstein [Nature (1975) 256:495-96], or a modification thereof.
- a mouse or rat is immunized as described above.
- the spleen (and optionally several large lymph nodes) is removed and dissociated into single cells.
- the spleen cells may be screened (after removal of nonspecifically adherent cells) by applying a cell suspension to a plate or well coated with the protein antigen.
- B-cells expressing membrane-bound immunoglobulin specific for the antigen bind to the plate, and are not rinsed away with the rest of the suspension.
- Resulting B-cells, or all dissociated spleen cells are then induced to fuse with myeloma cells to form hybridomas, and are cultured in a selective medium (e.g. hypoxanthine, aminopterin, thymidine medium, "HAT").
- a selective medium e.g. hypoxanthine, aminopterin, thymidine medium, "HAT”
- the resulting hybridomas are plated by limiting dilution, and are assayed for the production of antibodies which bind specifically to the immunizing antigen (and which do not bind to unrelated antigens).
- the selected MAb-secreting hybridomas are then cultured either in vitro (e.g. in tissue culture bottles or hollow fiber reactors), or in vivo (as ascites in mice).
- Suitable labels include fluorophores, chro ophores, radioactive atom s (particularly 32 P and 125 I), electron-dense reagents, enzym es, and ligands having specific binding partners.
- Enzym es are typically detected by their activity. For example, horseradish peroxidase is usually detected by its ability to convert 3 ,3 ',5 ,5 '-tetram ethylbenzidine (TM B ) to a blue pigm ent, quantifiable w ith a spectrophotom eter.
- S pecific binding partner refers to a protein capable of binding a ligand m olecule w ith high specificity, as for ex am ple in the case of an antigen and a m onoclonal antibody specific therefor.
- Other specific binding partners include biotin and avidin or streptavidin, IgG and protein A , and the num erous receptor-ligand couples know n in the art. It should be understood that the above description is not m eant to categorize the various labels into distinct classes, as the sam e label m ay serve in several different m odes. For example, l 25 I m ay serve as a radioactive label or as an electron-den se reagent.
- H RP m ay serve as enzym e or as antigen for a M A b. Further, one m ay com bine various labels for desired effect.
- M A bs and avidin also require labels in the practice of this invention: thus, one m ight label a M A b w ith biotin, and detect its presence w ith avidin labeled w ith l 25 I, or w ith an anti-biotin M A b labeled w ith H RP. O ther perm utations and possibilities w ill be readily apparent to those of ordinary skill in the art, and are considered as equivalents w ithin the scope of the instant invention.
- compositions can comprise either polypeptides, antibodies, or nucleic acid of the invention.
- the pharmaceutical compositions will comprise a therapeutically effective amount of either polypeptides, antibodies, or polynucleotides of the claimed invention.
- therapeutically effective amount refers to an amount of a therapeutic agent to treat, ameliorate, or prevent a desired disease or condition, or to exhibit a detectable therapeutic or preventative effect.
- the effect can be detected by, for example, chemical markers or antigen levels.
- Therapeutic effects also include reduction in physical symptoms, such as decreased body temperature.
- the precise effective amount for a subject will depend upon the subject's size and health, the nature and extent of the condition, and the therapeutics or combination of therapeutics selected for administration. Thus, it is not useful to specify an exact effective amount in advance. However, the effective amount for a given situation can be determined by routine experimentation and is within the judgement of the clinician.
- an effective dose w ill be from about 0.01 m g/ kg to 50 m g/kg or 0.05 m g/kg to about 1 0 m g/kg of the D N A constructs in the individual to w hich it is adm inistered.
- a pharm aceutical composition can also contain a pharm aceutically acceptable carrier.
- the term "pharm aceutically acceptable carrier" refers to a carrier for adm inistration of a therapeutic agent, such as antibodies or a polypeptide, genes, and other therapeutic agents.
- Suitable carriers m ay be large, slow ly m etabolized m acrom olecules such as proteins, polysaccharides, poly lactic acids, poly glycolic acids, polym eric am ino acids, am ino acid copolym ers, and inactive virus particles.
- Such carriers are w ell know n to those of ordinary skill in the art.
- Pharmaceutically acceptable salts can be used therein, for example, mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like.
- mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like
- organic acids such as acetates, propionates, malonates, benzoates, and the like.
- Pharm aceutically acceptable carriers in therapeutic compositions m ay contain liquids such as w ater, saline, glycerol and ethanol.
- aux iliary substances such as wetting or em ulsifying agents, pH buffering substances, and the like, m ay be present in such vehicles.
- the therapeutic com positions are prepared as injectables, either as liqu id solutions or suspensions; solid form s suitable for solution in, or suspension in, liquid vehicles prior to injection m ay also be prepared.
- Liposomes are included w ithin the definition of a pharm aceutically acceptable carrier. Delivery Methods
- compositions of the invention can be administered directly to the subject.
- the subjects to be treated can be animals; in particular, human subjects can be treated.
- Direct delivery of the compositions will generally be accomplished by injection, either subcutaneously, intraperitoneally, intravenously or intramuscularly or delivered to the interstitial space of a tissue.
- the compositions can also be administered into a lesion.
- Other modes of administration include oral and pulmonary administration, suppositories, and transdermal or transcutaneous applications (e.g. see WO98/20734), needles, and gene guns or hyposprays.
- Dosage treatment may be a single dose schedule or a multiple dose schedule.
- Vaccines V accines com prise im m u nising antigen(s), im m unogen(s), polypeptide(s), protein(s) or nucleic acid, usually in com bination w ith “pharm aceutically acceptable carriers," w hich include any carrier that does not itself induce the production of antibodies harm ful to the individual receiving the composition .
- Suitable carriers are typically large, slow ly m etabolized m acrom olecu les such as proteins, polysaccharides, poly lactic acids, polyglycoiic acids, polym eric am ino acids, am ino acid copolym ers, lipid aggregates (such as oil droplets or liposom es), and inactive virus particles.
- Such carriers are w ell know n to those of ordinary skill in the art. A dditionally, these carriers m ay function as im m unostimu lating agents ("adju vants").
- the antigen or im m unogen m ay be conjugated to a bacterial toxoid, such as a toxoid from diphtheria, tetanus, cholera, H. pylori, etc. pathogens.
- a bacterial toxoid such as a toxoid from diphtheria, tetanus, cholera, H. pylori, etc. pathogens.
- Preferred adjuvants to enhance effectiveness of the composition include, but are not limited to: (1) aluminum salts (alum), such as aluminum hydroxide, aluminum phosphate, aluminum sulfate, etc; (2) oil-in-water emulsion formulations (with or without other specific immunostimulating agents such as muramyl peptides (see below) or bacterial cell wall components), such as for example (a) MF59TM (WO 90/14837; Chapter 10 in Vaccine design: the subunit and adjuvant approach, eds.
- aluminum salts alum
- oil-in-water emulsion formulations with or without other specific immunostimulating agents such as muramyl peptides (see below) or bacterial cell wall components
- MF59TM WO 90/14837
- Span 85 containing various amounts of MTP-PE (see below), although not required) formulated into submicron particles using a microfluidizer such as Model HOY microfluidizer (Microfluidics, Newton, MA), (b) SAF, containing 10% Squalane, 0.4% Tween 80, 5% pluronic- blocked polymer L121, and thr-MDP (see below) either microfluidized into a submicron emulsion or vortexed to generate a larger particle size emulsion, and (c) RibiTM adjuvant system (RAS), (Ribi Immunochem, Hamilton, MT) containing 2% Squalene, 0.2% Tween 80, and one or more bacterial cell wall components from the group consisting of monophosphorylipid A (MPL), trehalose di ycolate (TDM), and cell wall skeleton (MPL), trehalose di ycolate (TDM), and cell wall skeleton (MPL), trehalose di
- interferons e.g. gamma interferon
- M-CSF macrophage colony stimulating factor
- TNF tumor necrosis factor
- other substances that act as immunostimulating agents to enhance the effectiveness of the composition.
- Alum and MF59TM are preferred.
- muramyl peptides include, but are not limited to, N-acetyl -muramyl -L- threonyl-D-isoglutamine (thr-MDP), N-acetyl-normuramyl-L-alanyl-D-isoglutamine (nor-MDP), N- acetylmuramyI- -alanyl-D-isoglutaminyl-L-aIanine-2-(r-2'-dipalmitoyl-.sn-glycero-3- hydroxyphosphoryloxy)-ethylamine (MTP-PE), etc.
- thr-MDP N-acetyl -muramyl -L- threonyl-D-isoglutamine
- nor-MDP N-acetyl-normuramyl-L-alanyl-D-isoglutamine
- MTP-PE N-acetylmuramyI
- the immunogenic compositions typically will contain diluents, such as water, saline, glycerol, ethanol, etc. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present in such vehicles.
- diluents such as water, saline, glycerol, ethanol, etc.
- auxiliary substances such as wetting or emulsifying agents, pH buffering substances, and the like, may be present in such vehicles.
- the im m unogenic com positions are prepared as injectables, either as liquid solutions or suspensions; solid form s suitable for solution in, or suspension in, liquid vehicles prior to injection m ay also be prepared.
- the preparation also m ay be em ulsified or encapsulated in liposom es for enhanced adjuvant effect, as discussed above under pharm aceutically acceptable carriers.
- Immunogenic compositions used as vaccines comprise an immunologically effective amount of the antigenic or immunogenic polypeptides, as well as any other of the above-mentioned components, as needed.
- immunologically effective amount it is meant that the administration of that amount to an individual, either in a single dose or as part of a series, is effective for treatment or prevention. This amount varies depending upon the health and physical condition of the individual to be treated, the taxonomic group of individual to be treated (e.g. nonhuman primate, primate, etc.), the capacity of the individual's immune system to synthesize antibodies, the degree of protection desired, the formulation of the vaccine, the treating doctor's assessment of the medical situation, and other relevant factors. It is expected that the amount will fall in a relatively broad range that can be determined through routine trials.
- the immunogenic compositions are conventionally administered parenterally, e.g. by injection, either subcutaneously, intramuscularly, or transdermally/transcutaneously (e.g. WO98/20734). Additional formulations suitable for other modes of administration include oral and pulmonary formulations, suppositories, and transdermal applications. Dosage treatment may be a single dose schedule or a multiple dose schedule. The vaccine may be administered in conjunction with other immunoregulatory agents.
- DNA vaccination may be employed [e.g. Robinson & Torres (1997) Seminars in Immunology 9:271-283; Donnelly et al. (1997) Annu Rev Immunol 15:617-648; see later herein].
- Polynucleotide and polypeptide pharmaceutical compositions may be employed [e.g. Robinson & Torres (1997) Seminars in Immunology 9:271-283; Donnelly et al. (1997) Annu Rev Immunol 15:617-648; see later herein].
- polypeptides which include, without limitation: asioloorosomucoid (ASOR); transferrin; asialoglycoproteins; antibodies; antibody fragments; ferritin; interleukins; interferons, granulocyte, macrophage colony stimulating factor (GM-CSF), granulocyte colony stimulating factor (G-CSF), macrophage colony stimulating factor (M-CSF), stem cell factor and erythropoietin.
- Viral antigens such as envelope proteins, can also be used.
- proteins from other invasive organisms such as the 17 amino acid peptide from the circumsporozoite protein of plasmodium falciparum known as RII.
- hormones for example: hormones, steroids, androgens, estrogens, thyroid hormone, or vitamins, folic acid.
- polyalkylene glycol can be included with the desired polynucleotides/polypeptides.
- the polyalkylene glycol is polyethlylene glycol.
- mono-, di-, or polysaccharides can be included.
- the polysaccharide is dextran or DEAE-dextran.
- the desired polynucleotide/polypeptide can also be encapsulated in lipids or packaged in liposomes prior to delivery to the subject or to cells derived therefrom.
- Lipid encapsulation is generally accomplished using liposomes which are able to stably bind or entrap and retain nucleic acid.
- the ratio of condensed polynucleotide to lipid preparation can vary but will generally be around 1 : 1 (mg DNA:micromoles lipid), or more of lipid.
- Liposomal preparations for use in the present invention include cationic (positively charged), anionic (negatively charged) and neutral preparations.
- Cationic liposomes have been shown to mediate intracellular delivery of plasmid DNA (Feigner (1987) Proc. Natl. Acad. Sci. USA 84:7413-7416); mRNA (Malone (1989) Proc. Natl. Acad. Sci. USA 86:6077-6081); and purified transcription factors (Debs (1990) J. Biol. Chem. 265: 10189-10192), in functional form.
- Cationic liposomes are readily available.
- N[l-2,3-dioleyloxy)propyl]-N,N,N- triethylammonium (DOTMA) liposomes are available under the trademark Lipofectin, from GIBCO BRL, Grand Island, NY. (See, also, Feigner supra).
- Other commercially available liposomes include transfectace (DDAB/DOPE) and DOTAP/DOPE (Boerhinger).
- Other cationic liposomes can be prepared from readily available materials using techniques well known in the art. See, e.g. Szoka (1978) Proc. Natl. Acad. Sci. USA 75:4194-4198; WO90/1 1092 for a description of the synthesis of DOTAP (l ,2-bis(oleoyloxy)-3-(trimethylammonio)propane) liposomes.
- anionic and neutral liposom es are readily available, such as from Avanti Polar Lipids (B irm ingham , AL), or can be easily prepared using readily available m aterials.
- Such m aterials include phosphatidyl choline, cholesterol, phosphatidyl ethanolam ine, dioleoylphosphatidyl choline (D0PC), dioleoylphosphatidyl glycerol (D 0 PG ), dioleoylphoshatidyl ethanolam ine (DOPE), am ong others.
- m aterials can also be m ixed w ith the DOTM A and D OTA P starting m aterials in appropriate ratios.
- M ethods for m aking liposom es using these m aterials are well known in the art.
- the liposomes can comprise multilammelar vesicles (MLVs), small unilamellar vesicles (SUNs), or large unilamellar vesicles (LUVs).
- MLVs multilammelar vesicles
- SUNs small unilamellar vesicles
- LUVs large unilamellar vesicles
- the various liposome-nucleic acid complexes are prepared using methods known in the art. See e.g. Straubinger (1983) Meth. Immunol 101:512-527; Szoka (1978)
- lipoproteins can be included w ith the polynucleotide/polypeptide to be delivered.
- lipoproteins to be utilized include: chylom icrons, HDL, ID L, LDL, and VLDL. M utants, fragm ents, or fusions of these proteins can also be used. A lso, m odifications of naturally occurring lipoproteins can be used, such as acetylated LDL.
- These lipoproteins can target the delivery of polynucleotides to cells expressing lipoprotein receptors.
- lipoproteins are including w ith the polynucleotide to be delivered, no other targeting ligand is included in the composition.
- Naturally occurring lipoproteins comprise a lipid and a protein portion.
- the protein portion are known as apoproteins.
- apoproteins A, B, C, D, and E have been isolated and identified. At least two of these contain several proteins, designated by Roman numerals, Al, All, AIV; Cl, CII, Cffl.
- a lipoprotein can comprise more than one apoprotein.
- naturally occurring chylomicrons comprises of A, B, C, and E, over time these lipoproteins lose A and acquire C and E apoproteins.
- VLDL comprises A, B, C, and E apoproteins
- LDL comprises apoprotein B; and HDL comprises apoproteins A, C, and E.
- Lipoproteins contain a variety of lipids including, triglycerides, cholesterol (free and esters), and phospholipids. The composition of the lipids varies in naturally occurring lipoproteins. For example, chylomicrons comprise mainly triglycerides.
- the composition of the lipids are chosen to aid in conformation of the apoprotein for receptor binding activity.
- the composition of lipids can also be chosen to facilitate hydrophobic interaction and association with the polynucleotide binding molecule.
- Naturally occurring lipoproteins can be isolated from serum by ultracentrifugation, for instance. Such methods are described in Meth. Enzymol. (supra); Pitas (1980) J. Biochem. 255:5454-5460 and Mahey (1979) J Clin. Invest 64:743-750. Lipoproteins can also be produced by in vitro or recombinant methods by expression of the apoprotein genes in a desired host cell. See, for example, Atkinson (1986) Annu Rev Biophys Chem 15:403 and Radding (1958) Biochim Biophys Acta 30: 443. Lipoproteins can also be purchased from commercial suppliers, such as Biomedical Techniologies, Inc., Stoughton, Massachusetts, USA. Further description of lipoproteins can be found in Zuckermann et al. PCT/US97/ 14465. F.Polvcationic Agents
- Polycationic agents can be included, with or without lipoprotein, in a composition with the desired polynucleotide/polypeptide to be delivered.
- Polycationic agents typically, exhibit a net positive charge at physiological relevant pH and are capable of neutralizing the electrical charge of nucleic acids to facilitate delivery to a desired location. These agents have both in vitro, ex vivo, and in vivo applications. Polycationic agents can be used to deliver nucleic acids to a living subject either intram uscularly, subcutaneously, etc.
- useful polypeptides as polycationic agents: polylysine, polyarginine, polyornithine, and protamine.
- transcriptional factors also contain domains that bind DNA and therefore may be useful as nucleic aid condensing agents. Briefly, transcriptional factors such as C/CEBP, c-jun, c-fos, AP-1, AP-2, AP-3, CPF, Prot-1, Sp-1, Oct-1, Oct-2, CREP, and TFIID contain basic domains that bind DNA sequences.
- Organic polycationic agents include: spermine, spermidine, and purtrescine.
- polycationic agent The dimensions and of the physical properties of a polycationic agent can be extrapolated from the list above, to construct other polypeptide polycationic agents or to produce synthetic polycationic agents.
- Synthetic polycationic agents which are useful include, for example, DEAE-dextran, polybrene.
- LipofectinTM, and lipofect AMINETM are monomers that form polycationic complexes when combined with polynucleotides/polypeptides. Nucleic Acid Hybridisation
- Hybridization refers to the association of two nucleic acid sequences to one another by hydrogen bonding. Typically, one sequence w ill be fixed to a solid support and the other will be free in solution. Then, the two sequences will be placed in contact with one another under conditions that favor hydrogen bonding. Factors that affect this bonding include: the type and volume of solvent; reaction tem perature; time of hybridization; agitation; agents to block the non-specific attachment of the liquid phase sequence to the solid support (Denhardt's reagent or B LOTTO); concentration of the sequences; use of compounds to increase the rate of association of sequences (dextran sulfate or polyethylene glycol); and the stringency of the washing conditions following hybridization.
- “Stringency” refers to conditions in a hybridization reaction that favor association of very similar sequences over sequences that differ.
- the combination of temperature and salt concentration should be chosen that is approximately 120 to 200°C below the calculated Tm of the hybrid under study.
- the temperature and salt conditions can often be determined empirically in preliminary experiments in which samples of genomic DNA immobilized on filters are hybridized to the sequence of interest and then washed under conditions of different stringencies. See Sambrook et al. at page 9.50.
- Variables to consider when performing, for example, a Southern blot are (1) the complexity of the DNA being blotted and (2) the homology between the probe and the sequences being detected.
- the total amount of the fragment(s) to be studied can vary a magnitude of 10, from 0.1 to l ⁇ g for a plasmid or phage digest to 10 '9 to 10 "8 g for a single copy gene in a highly complex eukaryotic genome.
- substantially shorter blotting, hybridization, and exposure times a smaller amount of starting polynucleotides, and lower specific activity of probes can be used.
- a single-copy yeast gene can be detected with an exposure time of only 1 hour starting with 1 ⁇ g of yeast DNA, blotting for two hours, and hybridizing for 4-8 hours with a probe of 10 8 cpm/ ⁇ g.
- a conservative approach would start with 10 ⁇ g of DNA, blot overnight, and hybridize overnight in the presence of 10% dextran sulfate using a probe of greater than 10 8 cpm/ ⁇ g, resulting in an exposure time of -24 hours.
- Tm melting temperature
- Tm 81 + 16.6(log 10 Ci) + 0.4[%(G + C)]-0.6(%formamide) - 600// ⁇ -1.5(%mismatch).
- Ci is the salt concentration (monovalent ions)
- n is the length of the hybrid in base pairs (slightly modified from Meinkoth & Wahl (1984) Anal. Biochem. 138: 267-284).
- the temperature of the hybridization and washes and the salt concentration during the washes are the simplest to adjust. As the temperature of the hybridization increases (i.e.
- formamide content should be lowered and temperature adjusted accordingly, using the equation above. If the homology between the probe and the target fragment are not known, the simplest approach is to start with both hybridization and wash conditions which are nonstringent. If non-specific bands or high background are observed after autoradiography, the filter can be washed at high stringency and reexposed. If the time required for exposure makes this approach impractical, several hybridization and/or washing stringencies should be tested in parallel.
- N. meningitidis serogroup B contained a component of approximately 80-85kDa. This protein was purified from SDS-PAGE gels and N-terminal sequenced (SEQ ID 1).
- Antibodies raised against the SDS-PAGE purified protein cross-reacted with equivalent proteins in more than 50 N. meningitidis strains of diverse serogroups and serotypes. Cross-reactivity with N. gonorrhoeae, N.polysaccharia and N. lactamica was also observed. Post-immune sera from vaccinated patients also reacted with the protein.
- the complete gene was cloned from serogroup B N meningitidis (SEQ ID 2) and the encoded protein was inferred (SEQ ID 3).
- SEQ ID 4 The complete gene was cloned from serogroup B N meningitidis (SEQ ID 2) and the encoded protein was inferred (SEQ ID 3).
- SEQ ID 4 The complete gene was cloned from serogroup B N meningitidis (SEQ ID 2) and the encoded protein was inferred (SEQ ID 3).
- SEQ ID 4 signal peptide
- SEQ ED 5 a mature sequence
- SEQ ID 6 The complete gene from serogroup A N.meningitidis is shown in SEQ ID 6, with the encoded protein in SEQ ID 7.
- the signal peptide and mature sequence are SEQ IDs 8 and 9.
- the complete gene from N.gonorrhoeae is shown in SEQ ID 10, with the encoded protein in SEQ ID 11.
- the signal peptide and mature sequence are SEQ IDs 12 and 13.
- the protein sequences were compared and are highly homologous.
- the N.meningitidis serogroup B sequence and the N.gonorrhoeae sequence show 95.4% identity in 797 aa overlap:
- pep LPGSK QYYSATHNQTWFFP SKTFTLM GGEVGIAGGYGRTKEIPFFENFYGGGLGSVR orf21ng .pep LPGSK QYYSATHNQTWFFP ⁇ KTFT M GGEVGIAGGYGRTKEIPFFE FYGGGLGSVR
- N.meningitidis serogroup A and B sequences show 99.9% identity in 797 aa overlap:
- pep KPEDEIQRFQFQLGTTF orf 2 la pep KPEDEIQRFQFQ GTTFX
- N.meningitidis strains 2996 and MC58 were grown to exponential phase in 100ml of GC medium, harvested by centrifugation, and resuspended in 5ml buffer (20% w/v sucrose, 50mM Tris-HCl, 50mM EDTA, pH8). After 10 minutes incubation on ice, the bacteria were lysed by adding 10ml of lysis solution (50mM NaCl, 1% Na-Sarkosyl, 50 ⁇ g/ml Proteinase K), and the suspension incubated at 37°C for 2 hours. Two phenol extractions (equilibrated to pH 8) and one CHCl 3 /isoamylalcohol (24: 1) extraction were performed.
- DNA was precipitated by addition of 0.3M sodium acetate and 2 volumes of ethanol, and collected by centrifugation. The pellet was washed once with 70%(v/v) ethanol and redissolved in 4.0ml TE buffer (lOmM Tris- HCl, ImM EDTA, pH 8.0). The DNA concentration was measured by reading OD 26 o-
- ORF21 without the sequence encoding the leader peptide, was amplified by PCR using the following oligonucleotides: orf21 for ⁇ SEQ ID 105> (BamHI-Ndel) orf21 rev ⁇ SEQ ID 106> (Xhol)
- the 5' primer included two restriction sites (BamHI-Ndel), the 3' primer included a Xhol restriction site, in order to direct the cloning of the amplification product (corresponding to ORF21) into the two expression vectors pGEX-KG (using BamHI-XhoT) to have a N-terminal GST-fusion, and pET21b+ (using Ndel-Xhol), to have a C-terminal His-fusion.
- the standard PCR protocol was as follows: 200ng of genomic DNA from 2996 or MC58 strains or lOng of plasmid DNA preparation of recombinant clones were used as template in the presence of 40 ⁇ M of each oligonucletide primer, 400-800 ⁇ M dNTPs solution, lx PCR buffer (including 1.5mM MgCl 2 ), 2.5 units Taql DNA polymerase (using Perkin-Elmer AmpliTaQ, Boerhingher Mannheim ExpandTM Long Template).
- each sample underwent a two-step amplification: the first 5 cycles were performed using the hybridisation temperature that excluded the restriction enzyme tail of the primer (T m ⁇ ). This was followed by 30 cycles according to the hybridisation temperature calculated for the whole length oligos (T m2 ). Elongation times, performed at 68°C or 72°C, varied according to the length of the Orf to be amplified. In the case of Orf 1 the elongation time, starting from 3 minutes, was increased by 15 seconds each cycle. The cycles were completed with a 10 minute extension step at 72°C.
- the amplified DNA was either loaded directly on a 1% agarose gel.
- the DNA fragment corresponding to the band of correct size was purified from the gel using the Qiagen Gel Extraction Kit, following the manufacturer's protocol.
- the purified DNA corresponding to the amplified fragment was digested with the appropriate restriction enzymes for cloning into pET-21b+ or pET22b+.
- Digested fragments were purified using the QIAquick PCR purification kit (following the manufacturer's instructions) and eluted with either H O or lOmM Tris, pH 8.5.
- Plasmid vectors were digested with the appropriate restriction enzymes, loaded onto a 1.0% agarose gel and the band corresponding to the digested vector purified using the Qiagen QIAquick Gel Extraction Kit.
- Recombinant plasmid was transformed into competent E.coli DH5 or HB101 by incubating the ligase reaction solution and bacteria for 40 minutes on ice, then at 37°C for 3 minutes. This was followed by the addition of 800 ⁇ l LB broth and incubation at 37°C for 20 minutes. The cells were centrifuged at maximum speed in an Eppendorf microfuge, resuspended in approximately 200 ⁇ l of the supernatant and plated onto LB ampicillin (lOOmg/ml ) agar.
- Screening for recombinant clones was performed by growing randomly selected colonies overnight at 37°C in 4.0ml of LB broth + lOO ⁇ g/ml ampicillin. Cells were pelleted and plasmid DNA extracted using the Qiagen QIAprep Spin Miniprep Kit, following the manufacturer's instructions. Approximately l ⁇ g of each individual miniprep was digested with the appropriate restriction enzymes and the digest loaded onto a 1-1.5% agarose gel (depending on the expected insert size), in parallel with the molecular weight marker (lkb DNA Ladder, GIBCO). Positive clones were selected on the basis of the size of insert.
- recombinant plasmids were transformed into E.coli strains suitable for expression of the recombinant protein, l ⁇ l of each construct was used to transform E.coli BL21-DE3 as described above.
- Single recombinant colonies were inoculated into 2ml LB+Amp (lOO ⁇ g/ml), incubated at 37°C overnight, then diluted 1:30 in 20ml of LB+Amp (lOO ⁇ g/ml) in 100ml flasks, to give an OD 600 between 0.1 and 0.2.
- OD 6 oo indicated exponential growth suitable for induction of expression (0.4-0.8 OD).
- Protein expression was induced by addition of LOmM IPTG. After 3 hours incubation at 30°C or 37°C the OD 6 oo was measured and expression examined. 1.0ml of each sample was centrifuged in a microfuge, the pellet resuspended in PBS and analysed by SDS-PAGE and Coomassie Blue staining.
- the GST fusion protein was expressed, but it was found to be insoluble (i.e. unpurifiable).
- the His-fusion was expressed as insoluble protein.
- a single colony was streaked and grown overnight at 37°C on a LB/Amp (100 ⁇ g/ml) agar plate.
- An isolated colony from this plate was inoculated into 20ml of LB/Amp (100 ⁇ g/ml) liquid medium and grown overnight at 37°C with shaking.
- the overnight culture was diluted 1:30 into 1.0 L LB/Amp (100 ⁇ g/ml) liquid medium and allowed to grow at the optimal temperature (30 or 37°C) until the OD5 5 0 reached 0.6-0.8.
- Expression of recombinant protein was induced by addition of IPTG (final concentration LOmM) and the culture incubated for a further 3 hours.
- Bacteria were harvested by centrifugation at 8000g for 15 min at 4°C. The bacterial pellet was resuspended in 7.5 ml of buffer B (8M urea, lOmM Tris-HCl, 100 mM phosphate buffer, pH 8.8). Cells were disrupted by sonication on ice four times for 30 sec at 40W using a Branson sonifier 450 and centrifuged at 13 OOOxg for 30 min at 4°C. Pellets were resuspended in 2.0 ml buffer C (6 M guanidine hydrochloride, 100 mM phosphate buffer, 10 mM Tris- HC1, pH 7.5 and treated with 10 passes of a Dounce homogenizer.
- buffer B 8M urea, lOmM Tris-HCl, 100 mM phosphate buffer, pH 8.8
- Cells were disrupted by sonication on ice four times for 30 sec at 40W using a Branson sonifier 450 and centrif
- the homogenate was centrifuged at 13000g for 30 min and the supernatant retained. Supernatants were mixed with 150 ⁇ l Ni + -resin (previously equilibrated with buffer B) and incubated at room temperature with gentle agitation for 30 min.
- the resin was Chelating Sepharose Fast Flow (Pharmacia), prepared according to the manufacturer's protocol. The batch-wise preparation was centrifuged at 700 x g for 5 min at 4°C and the supernatant discarded. The resin was washed twice (batch-wise) with 10ml buffer B for 10 min, resuspended in 1.0 ml buffer B and loaded onto a disposable column.
- the resin continued to be washed with buffer B at room temperature, until the OD 280 of the flow-through reached 0.02- 0.01.
- the resin was further washed with buffer D (8M urea, lOmM Tris-HCl, lOOmM phosphate buffer, pH 6.3) until OD 280 of the flow-through reached 0.02-0.01.
- the His-fusion protein was eluted by addition of 700 ⁇ l of elution buffer B (8 M urea, 10 mM Tris-HCl, 100 mM phosphate buffer, pH 4.5) and fractions collected until the OD 8 o indicated all the recombinant protein was obtained. 20 ⁇ l aliquots of each elution fraction were analysed by SDS-PAGE. Protein concentrations were estimated using the Bradford assay.
- glycerol was added to the denatured fractions obtained above to give a final concentration of 10% v/v.
- the proteins were diluted to 200 ⁇ g/ml using dialysis buffer I (10% v/v glycerol, 0.5M arginine, 50 mM phosphate buffer, 5.0 mM reduced glutathione, 0.5 mM oxidised glutathione, 2.0 M urea, pH 8.8) and dialysed against the same buffer for 12-14 hours at 4°C.
- mice were immunized with antigens on days 0, 21 and 35 and sera analyzed at day 49.
- 0RF21 gave a positive results on the following ELISA assay: acapsulated M enB M 7 and the capsulated strains were plated on chocolate agar plates and incubated overnight at 37°C with 5% C0 2 .
- B acterial colonies were collected from the agar plates using a sterile dracon swab and inoculated into M ueller-Hinton Broth (Difco) containing 0.25% glucose. B acterial growth was m onitored every 30 m inutes by following OU 2 o. The bacteria were let to grow until the 0D reached the value of 0.4-0.5. The culture was centrifuged for 10 minutes at 4000rpm .
- the membrane was washed twice with washing buffer (3% skimmed milk, 0.1% Triton X100 in PBS) and incubated for 2 hours at 37°C with mice sera diluted 1:200 in washing buffer. The membrane was washed twice and incubated for 90 minutes with a 1:2000 dilution of horseradish peroxidase labelled anti-mouse Ig. The membrane was washed twice with 0.1% Triton X100 in PBS and developed with the Opti-4CN Substrate Kit (Bio-Rad). The reaction was stopped by adding water.
- the OMVs were prepared as follows: N. meningitidis strain 2996 was grown overnight at 37 degrees with 5% CO 2 on 5 GC plates, harvested with a loop and resuspended in 10 ml of 20mM
- Tris-HCl pH 7.5, 2 mM EDTA Tris-HCl pH 7.5, 2 mM EDTA. Heat inactivation was performed at 56°C for 45 minutes and the bacteria disrupted by sonication for 5 minutes on ice (50% duty cycle, 50% output , Branson sonifier 3 mm microtip). Unbroken cells were removed by centrifugation at 5000g for 10 minutes, the supernatant containing the total cell envelope fraction recovered and further centrifuged overnight at 50000g at the temperature of 4°C . The pellet containing the membranes was resuspended in 2% sarkosyl, 20mM Tris-HCl pH 7.5, 2 mM EDTA and incubated at room temperature for 20 minutes to solubilyze the inner membranes.
- the suspension was centrifuged at lOOOOg for 10 minutes to remove aggregates, the supernatant was further centrifuged at 50000g for 3 hours.
- the pellet, containing the outer membranes was washed in PBS and resuspended in the same buffer.
- the protein concentration was measured by the D.C. Bio-Rad Protein assay (Modified Lowry method), using BSA as a standard.
- Total cell extracts were prepared as follows: N. meningitidis strain 2996 was grown overnight on a GC plate, harvested with a loop and resuspended in 1ml of 20mM Tris-HCl. Heat inactivation was performed at 56°C for 30 minutes. ELISA, FACS and Western analysis all show that ORF21 is surface-exposed.
- B acteria were diluted in 50m M Phosphate buffer pH 7.2 containing l Om M M gC l 2 , l Om M CaCl 2 and 0.5 % (w/v) B SA (assay buffer) at the w orking dilution of 10 5 CFU/m l.
- Controls included bacteria incubated with complement serum , im m une sera incubated with bacteria and with complem ent inactivated by heating at 56°C for 30'.
- l O ⁇ l of the controls were plated on M ueller-Hinton agar plates using the tilt method (tim e 0).
- the 96-wells plate was incubated for 1 hour at 37°C with rotation.
- 7 ⁇ l of each sample were plated on M ueller-Hinton agar plates as spots, whereas l O ⁇ l of the controls were plated using the tilt method (time 1 ).
- a gar plates were incubated for 18 hours at 37 degrees and the colonies corresponding to time 0 and time 1 were counted.
- Computer analysis Figure 1 shows the sequence of ORF21, together with computer analysis data.
- ORF21 has the following AMPHI regions [Gao et al. (1989) J. Immunol. 143:3007; Roberts et al (1996) AIDS Res Hum Retrovir 12:593; Quakyi et al (1992) Scand J Immunol suppl.l 1:9]: SEQ IDs 14 to 32.
- the antigenic index algorithm identified the following regions: SEQ IDs 33 to 70.
- Hopp & Woods analysis reveals the following hydrophilic regions: SEQ IDs 71 to 104.
- SEQ IDs 14-104 may be used as these oligopeptides, or as part of longer polypeptides.
- the three proteins identified above are expressed and used for immunisation. Good immune responses are observed against the proteins.
- the proteins are each combined with antigens against other pathogenic organisms (e.g. the Chiron polysaccharide vaccine against serogroup C meningitis), and used for immunisation. Good immune responses are observed.
- pathogenic organisms e.g. the Chiron polysaccharide vaccine against serogroup C meningitis
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Description
Claims
Priority Applications (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CA2390344A CA2390344C (en) | 1999-11-29 | 2000-11-28 | 85kda neisserial antigen |
JP2001540113A JP4840956B2 (en) | 1999-11-29 | 2000-11-28 | 85kDa Neisseria antigen |
BR0015961-1A BR0015961A (en) | 1999-11-29 | 2000-11-28 | 85kda neisserial antigen |
EP00981520A EP1234039A2 (en) | 1999-11-29 | 2000-11-28 | 85kDa NEISSERIAL ANTIGEN |
AU18753/01A AU1875301A (en) | 1999-11-29 | 2000-11-28 | 85kda neisserial antigen |
US11/264,676 US7700119B2 (en) | 1999-11-29 | 2005-11-01 | 85kDa neisserial antigen |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
GBGB9928197.4A GB9928197D0 (en) | 1999-11-29 | 1999-11-29 | 85kDA antigen |
GB9928197.4 | 1999-11-29 | ||
GB0005698.6 | 2000-03-09 | ||
GB0005698A GB0005698D0 (en) | 2000-03-09 | 2000-03-09 | 85kDa Antigen |
Related Child Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10148534 A-371-Of-International | 2000-11-28 | ||
US11/264,676 Division US7700119B2 (en) | 1999-11-29 | 2005-11-01 | 85kDa neisserial antigen |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2001038350A2 true WO2001038350A2 (en) | 2001-05-31 |
WO2001038350A3 WO2001038350A3 (en) | 2001-11-15 |
Family
ID=26243826
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/IB2000/001851 WO2001038350A2 (en) | 1999-11-29 | 2000-11-28 | 85kDa NEISSERIAL ANTIGEN |
Country Status (13)
Country | Link |
---|---|
US (1) | US7700119B2 (en) |
EP (2) | EP1234039A2 (en) |
JP (2) | JP4840956B2 (en) |
CN (1) | CN1433471A (en) |
AT (1) | ATE460484T1 (en) |
AU (1) | AU1875301A (en) |
BR (1) | BR0015961A (en) |
CA (1) | CA2390344C (en) |
CY (1) | CY1110540T1 (en) |
DE (1) | DE60044005D1 (en) |
DK (1) | DK1741784T3 (en) |
RU (1) | RU2002117308A (en) |
WO (1) | WO2001038350A2 (en) |
Cited By (30)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2010070453A2 (en) | 2008-12-17 | 2010-06-24 | Novartis Ag | Meningococcal vaccines including hemoglobin receptor |
US7763589B2 (en) | 1996-09-17 | 2010-07-27 | Novartis Vaccines And Diagnostics, Inc. | Compositions and methods for treating intracellular diseases |
WO2010109323A1 (en) | 2009-03-24 | 2010-09-30 | Novartis Ag | Adjuvanting meningococcal factor h binding protein |
EP2248822A2 (en) | 2001-07-27 | 2010-11-10 | Novartis Vaccines and Diagnostics S.r.l. | Meningococcus adhesins |
EP2255826A2 (en) | 2002-08-02 | 2010-12-01 | GlaxoSmithKline Biologicals S.A. | Neisserial vaccine compositions comprising a combination of antigens |
EP2279746A2 (en) | 2002-11-15 | 2011-02-02 | Novartis Vaccines and Diagnostics S.r.l. | Surface proteins in neisseria meningitidis |
WO2011024072A2 (en) | 2009-08-27 | 2011-03-03 | Novartis Ag | Hybrid polypeptides including meningococcal fhbp sequences |
WO2011024071A1 (en) | 2009-08-27 | 2011-03-03 | Novartis Ag | Adjuvant comprising aluminium, oligonucleotide and polycation |
WO2011039631A2 (en) | 2009-09-30 | 2011-04-07 | Novartis Ag | Expression of meningococcal fhbp polypeptides |
WO2011051893A1 (en) | 2009-10-27 | 2011-05-05 | Novartis Ag | Modified meningococcal fhbp polypeptides |
WO2011161653A1 (en) | 2010-06-25 | 2011-12-29 | Novartis Ag | Combinations of meningococcal factor h binding proteins |
WO2012020326A1 (en) | 2010-03-18 | 2012-02-16 | Novartis Ag | Adjuvanted vaccines for serogroup b meningococcus |
WO2012032498A2 (en) | 2010-09-10 | 2012-03-15 | Novartis Ag | Developments in meningococcal outer membrane vesicles |
WO2012153302A1 (en) | 2011-05-12 | 2012-11-15 | Novartis Ag | Antipyretics to enhance tolerability of vesicle-based vaccines |
WO2013098589A1 (en) | 2011-12-29 | 2013-07-04 | Novartis Ag | Adjuvanted combinations of meningococcal factor h binding proteins |
WO2013113917A1 (en) | 2012-02-02 | 2013-08-08 | Novartis Ag | Promoters for increased protein expression in meningococcus |
WO2013132040A2 (en) | 2012-03-08 | 2013-09-12 | Novartis Ag | In vitro potency assay for protein-based meningococcal vaccines |
US8563007B1 (en) | 2001-10-11 | 2013-10-22 | Wyeth Holdings Corporation | Immunogenic compositions for the prevention and treatment of meningococcal disease |
WO2014037472A1 (en) | 2012-09-06 | 2014-03-13 | Novartis Ag | Combination vaccines with serogroup b meningococcus and d/t/p |
US8986710B2 (en) | 2012-03-09 | 2015-03-24 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
EP3017826A1 (en) | 2009-03-24 | 2016-05-11 | Novartis AG | Combinations of meningococcal factor h binding protein and pneumococcal saccharide conjugates |
US9556240B2 (en) | 2010-08-23 | 2017-01-31 | Wyeth Llc | Stable formulations of Neisseria meningitidis rLP2086 antigens |
US9757443B2 (en) | 2010-09-10 | 2017-09-12 | Wyeth Llc | Non-lipidated variants of Neisseria meningitidis ORF2086 antigens |
US9802987B2 (en) | 2013-03-08 | 2017-10-31 | Pfizer Inc. | Immunogenic fusion polypeptides |
US9822150B2 (en) | 2013-09-08 | 2017-11-21 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
US10183070B2 (en) | 2017-01-31 | 2019-01-22 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
US10196429B2 (en) | 2012-03-09 | 2019-02-05 | Pfizer Inc. | Neisseria meningitidis composition and methods thereof |
US10888611B2 (en) | 2015-02-19 | 2021-01-12 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
EP3782643A1 (en) | 2014-02-28 | 2021-02-24 | GlaxoSmithKline Biologicals SA | Modified meningococcal fhbp polypeptides |
WO2023067031A2 (en) | 2021-10-21 | 2023-04-27 | Glaxosmithkline Biologicals Sa | Assay |
Families Citing this family (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
PT2270030E (en) * | 2000-02-28 | 2012-07-24 | Novartis Vaccines & Diagnostic | Heterologous expression of neisserial proteins |
AU2003274511B2 (en) * | 2002-10-11 | 2009-06-04 | Glaxosmithkline Biologicals S.A. | Polypeptide-vaccines for broad protection against hypervirulent meningococcal lineages |
GB0408977D0 (en) * | 2004-04-22 | 2004-05-26 | Chiron Srl | Immunising against meningococcal serogroup Y using proteins |
US9148335B2 (en) * | 2008-09-30 | 2015-09-29 | Qualcomm Incorporated | Third party validation of internet protocol addresses |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1990006696A2 (en) * | 1988-12-19 | 1990-06-28 | Praxis Biologics, Inc. | Meningococcal class 1 outer-membrane protein vaccine |
WO1997028273A1 (en) * | 1996-02-01 | 1997-08-07 | North American Vaccine, Inc. | Expression of group b neisseria meningitidis outer membrane (mb3) protein from yeast and vaccines |
Family Cites Families (11)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB9313045D0 (en) | 1993-06-24 | 1993-08-11 | Source Vision Technology The L | Printing and laminating |
US5439808A (en) | 1993-07-23 | 1995-08-08 | North American Vaccine, Inc. | Method for the high level expression, purification and refolding of the outer membrane group B porin proteins from Neisseria meningitidis |
IL117483A (en) | 1995-03-17 | 2008-03-20 | Bernard Brodeur | Proteinase k resistant surface protein of neisseria meningitidis |
EP1900818A3 (en) | 1997-11-06 | 2008-06-11 | Novartis Vaccines and Diagnostics S.r.l. | Neisserial antigens |
GB9726398D0 (en) | 1997-12-12 | 1998-02-11 | Isis Innovation | Polypeptide and coding sequences |
CA2317815A1 (en) | 1998-01-14 | 1999-07-22 | Chiron S.P.A. | Neisseria meningitidis antigens |
EP2261343A3 (en) | 1998-05-01 | 2012-01-18 | Novartis Vaccines and Diagnostics, Inc. | Neisseria meningitidis antigens and compositions |
JP2004511201A (en) * | 1998-10-09 | 2004-04-15 | カイロン コーポレイション | Neisseria genome sequences and methods of using them |
US6610306B2 (en) * | 1998-10-22 | 2003-08-26 | The University Of Montana | OMP85 protein of neisseria meningitidis, compositions containing the same and methods of use thereof |
EP1123403A1 (en) * | 1998-10-22 | 2001-08-16 | The University Of Montana | OMP85 PROTEINS OF $i(NEISSERIA GONORRHOEAE) AND $i(NEISSERIA MENINGITIDIS), COMPOSITIONS CONTAINING SAME AND METHODS OF USE THEREOF |
DE60015084T2 (en) * | 1999-02-26 | 2006-02-16 | Chiron S.R.L. | IMPROVEMENT OF BACTERIC ACIDITY OF NEISSERIA ANTIGENES CG-CONTAINING OLIGONUCLEOTIDES |
-
2000
- 2000-11-28 EP EP00981520A patent/EP1234039A2/en not_active Withdrawn
- 2000-11-28 WO PCT/IB2000/001851 patent/WO2001038350A2/en not_active Application Discontinuation
- 2000-11-28 BR BR0015961-1A patent/BR0015961A/en not_active Application Discontinuation
- 2000-11-28 RU RU2002117308/13A patent/RU2002117308A/en unknown
- 2000-11-28 JP JP2001540113A patent/JP4840956B2/en not_active Expired - Fee Related
- 2000-11-28 DE DE60044005T patent/DE60044005D1/en not_active Expired - Lifetime
- 2000-11-28 CN CN00818571A patent/CN1433471A/en active Pending
- 2000-11-28 DK DK06076814.0T patent/DK1741784T3/en active
- 2000-11-28 EP EP06076814A patent/EP1741784B1/en not_active Expired - Lifetime
- 2000-11-28 AU AU18753/01A patent/AU1875301A/en not_active Abandoned
- 2000-11-28 AT AT06076814T patent/ATE460484T1/en not_active IP Right Cessation
- 2000-11-28 CA CA2390344A patent/CA2390344C/en not_active Expired - Fee Related
-
2005
- 2005-11-01 US US11/264,676 patent/US7700119B2/en not_active Expired - Fee Related
-
2010
- 2010-05-21 CY CY20101100452T patent/CY1110540T1/en unknown
- 2010-11-01 JP JP2010245716A patent/JP2011055838A/en not_active Withdrawn
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1990006696A2 (en) * | 1988-12-19 | 1990-06-28 | Praxis Biologics, Inc. | Meningococcal class 1 outer-membrane protein vaccine |
WO1997028273A1 (en) * | 1996-02-01 | 1997-08-07 | North American Vaccine, Inc. | Expression of group b neisseria meningitidis outer membrane (mb3) protein from yeast and vaccines |
Non-Patent Citations (1)
Title |
---|
MANNING D S ET AL: "OMP85 PROTEINS OF NEISSERIA GONORRHOEAE AND NEISSERIA MENINGITIDIS ARE SIMILAR TO HAEMOPHILUS INFLUENZAE D-15-AG AND PASTEURELLA MULTOCIDA OMA87" MICROBIAL PATHOGENESIS,US,ACADEMIC PRESS LIMITED, NEW YORK, NY, vol. 25, no. 1, 1998, pages 11-21, XP000857391 ISSN: 0882-4010 * |
Cited By (56)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7763589B2 (en) | 1996-09-17 | 2010-07-27 | Novartis Vaccines And Diagnostics, Inc. | Compositions and methods for treating intracellular diseases |
EP2248822A2 (en) | 2001-07-27 | 2010-11-10 | Novartis Vaccines and Diagnostics S.r.l. | Meningococcus adhesins |
US9168293B2 (en) | 2001-10-11 | 2015-10-27 | Wyeth Holdings Llc | Immunogenic compositions for the prevention and treatment of meningococcal disease |
US9757444B2 (en) | 2001-10-11 | 2017-09-12 | Wyeth Holdings Llc | Immunogenic compositions for the prevention and treatment of meningococcal disease |
US9623101B2 (en) | 2001-10-11 | 2017-04-18 | Wyeth Holdings Llc | Immunogenic compositions for the prevention and treatment of meningococcal disease |
US9132182B2 (en) | 2001-10-11 | 2015-09-15 | Wyeth Holdings Llc | Immunogenic compositions for the prevention and treatment of meningococcal disease |
US9107873B2 (en) | 2001-10-11 | 2015-08-18 | Wyeth Holdings Llc | Immunogenic compositions for the prevention and treatment of meningococcal disease |
US10300122B2 (en) | 2001-10-11 | 2019-05-28 | Wyeth Holdings Llc | Immunogenic compositions for the prevention and treatment of meningococcal disease |
US8563006B2 (en) | 2001-10-11 | 2013-10-22 | Wyeth Holdings Corporation | Immunogenic compositions for the prevention and treatment of meningococcal disease |
US8563007B1 (en) | 2001-10-11 | 2013-10-22 | Wyeth Holdings Corporation | Immunogenic compositions for the prevention and treatment of meningococcal disease |
US11116829B2 (en) | 2001-10-11 | 2021-09-14 | Wyeth Holdings Llc | Immunogenic compositions for the prevention and treatment of meningococcal disease |
EP2255826A2 (en) | 2002-08-02 | 2010-12-01 | GlaxoSmithKline Biologicals S.A. | Neisserial vaccine compositions comprising a combination of antigens |
EP2279746A2 (en) | 2002-11-15 | 2011-02-02 | Novartis Vaccines and Diagnostics S.r.l. | Surface proteins in neisseria meningitidis |
WO2010070453A2 (en) | 2008-12-17 | 2010-06-24 | Novartis Ag | Meningococcal vaccines including hemoglobin receptor |
WO2010109323A1 (en) | 2009-03-24 | 2010-09-30 | Novartis Ag | Adjuvanting meningococcal factor h binding protein |
EP3017826A1 (en) | 2009-03-24 | 2016-05-11 | Novartis AG | Combinations of meningococcal factor h binding protein and pneumococcal saccharide conjugates |
EP3017828A1 (en) | 2009-08-27 | 2016-05-11 | GlaxoSmithKline Biologicals SA | Hybrid polypeptides including meningococcal fhbp sequences |
WO2011024072A2 (en) | 2009-08-27 | 2011-03-03 | Novartis Ag | Hybrid polypeptides including meningococcal fhbp sequences |
WO2011024071A1 (en) | 2009-08-27 | 2011-03-03 | Novartis Ag | Adjuvant comprising aluminium, oligonucleotide and polycation |
WO2011039631A2 (en) | 2009-09-30 | 2011-04-07 | Novartis Ag | Expression of meningococcal fhbp polypeptides |
WO2011051893A1 (en) | 2009-10-27 | 2011-05-05 | Novartis Ag | Modified meningococcal fhbp polypeptides |
WO2012020326A1 (en) | 2010-03-18 | 2012-02-16 | Novartis Ag | Adjuvanted vaccines for serogroup b meningococcus |
WO2011161653A1 (en) | 2010-06-25 | 2011-12-29 | Novartis Ag | Combinations of meningococcal factor h binding proteins |
US9556240B2 (en) | 2010-08-23 | 2017-01-31 | Wyeth Llc | Stable formulations of Neisseria meningitidis rLP2086 antigens |
US10512681B2 (en) | 2010-09-10 | 2019-12-24 | Wyeth Llc | Non-lipidated variants of Neisseria meningitidis ORF2086 antigens |
US11077180B2 (en) | 2010-09-10 | 2021-08-03 | Wyeth Llc | Non-lipidated variants of Neisseria meningitidis ORF2086 antigens |
WO2012032498A2 (en) | 2010-09-10 | 2012-03-15 | Novartis Ag | Developments in meningococcal outer membrane vesicles |
US9757443B2 (en) | 2010-09-10 | 2017-09-12 | Wyeth Llc | Non-lipidated variants of Neisseria meningitidis ORF2086 antigens |
WO2012153302A1 (en) | 2011-05-12 | 2012-11-15 | Novartis Ag | Antipyretics to enhance tolerability of vesicle-based vaccines |
WO2013098589A1 (en) | 2011-12-29 | 2013-07-04 | Novartis Ag | Adjuvanted combinations of meningococcal factor h binding proteins |
US10596246B2 (en) | 2011-12-29 | 2020-03-24 | Glaxosmithkline Biological Sa | Adjuvanted combinations of meningococcal factor H binding proteins |
US9657297B2 (en) | 2012-02-02 | 2017-05-23 | Glaxosmithkline Biologicals Sa | Promoters for increased protein expression in meningococcus |
WO2013113917A1 (en) | 2012-02-02 | 2013-08-08 | Novartis Ag | Promoters for increased protein expression in meningococcus |
WO2013132040A2 (en) | 2012-03-08 | 2013-09-12 | Novartis Ag | In vitro potency assay for protein-based meningococcal vaccines |
US11209436B2 (en) | 2012-03-08 | 2021-12-28 | Glaxosmithkline Biologicals Sa | Vitro potency assay for protein-based meningococcal vaccines |
US10598666B2 (en) | 2012-03-08 | 2020-03-24 | Glaxosmithkline Biologicals Sa | In vitro potency assay for protein-based meningococcal vaccines |
US8986710B2 (en) | 2012-03-09 | 2015-03-24 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
US10196429B2 (en) | 2012-03-09 | 2019-02-05 | Pfizer Inc. | Neisseria meningitidis composition and methods thereof |
US11472850B2 (en) | 2012-03-09 | 2022-10-18 | Pfizer Inc. | Neisseria meningitidis composition and methods thereof |
US10550159B2 (en) | 2012-03-09 | 2020-02-04 | Pfizer Inc. | Neisseria meningitidis composition and methods thereof |
US10829521B2 (en) | 2012-03-09 | 2020-11-10 | Pfizer Inc. | Neisseria meningitidis composition and methods thereof |
US9561269B2 (en) | 2012-03-09 | 2017-02-07 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
US9724402B2 (en) | 2012-03-09 | 2017-08-08 | Pfizer Inc. | Neisseria meningitidis composition and methods thereof |
WO2014037472A1 (en) | 2012-09-06 | 2014-03-13 | Novartis Ag | Combination vaccines with serogroup b meningococcus and d/t/p |
US9526776B2 (en) | 2012-09-06 | 2016-12-27 | Glaxosmithkline Biologicals Sa | Combination vaccines with serogroup B meningococcus and D/T/P |
US9802987B2 (en) | 2013-03-08 | 2017-10-31 | Pfizer Inc. | Immunogenic fusion polypeptides |
US11680087B2 (en) | 2013-09-08 | 2023-06-20 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
US9822150B2 (en) | 2013-09-08 | 2017-11-21 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
US10899802B2 (en) | 2013-09-08 | 2021-01-26 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
EP3782643A1 (en) | 2014-02-28 | 2021-02-24 | GlaxoSmithKline Biologicals SA | Modified meningococcal fhbp polypeptides |
US10888611B2 (en) | 2015-02-19 | 2021-01-12 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
US10813989B2 (en) | 2017-01-31 | 2020-10-27 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
US10543267B2 (en) | 2017-01-31 | 2020-01-28 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
US10183070B2 (en) | 2017-01-31 | 2019-01-22 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
US11730800B2 (en) | 2017-01-31 | 2023-08-22 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
WO2023067031A2 (en) | 2021-10-21 | 2023-04-27 | Glaxosmithkline Biologicals Sa | Assay |
Also Published As
Publication number | Publication date |
---|---|
BR0015961A (en) | 2003-06-10 |
JP2011055838A (en) | 2011-03-24 |
JP4840956B2 (en) | 2011-12-21 |
US20060233827A1 (en) | 2006-10-19 |
DK1741784T3 (en) | 2010-05-25 |
CN1433471A (en) | 2003-07-30 |
CA2390344A1 (en) | 2001-05-31 |
RU2002117308A (en) | 2004-03-10 |
EP1741784B1 (en) | 2010-03-10 |
US7700119B2 (en) | 2010-04-20 |
DE60044005D1 (en) | 2010-04-22 |
CY1110540T1 (en) | 2015-04-29 |
JP2003514575A (en) | 2003-04-22 |
EP1234039A2 (en) | 2002-08-28 |
ATE460484T1 (en) | 2010-03-15 |
WO2001038350A3 (en) | 2001-11-15 |
EP1741784A1 (en) | 2007-01-10 |
CA2390344C (en) | 2014-08-26 |
AU1875301A (en) | 2001-06-04 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US7700119B2 (en) | 85kDa neisserial antigen | |
EP2275554B1 (en) | Neisserial antigenic peptides | |
CA2871789C (en) | Outer membrane vesicle (omv) vaccine comprising n. meningitidis serogroup b outer membrane proteins | |
EP1196587B1 (en) | Antigenic meningococcal peptides | |
AU2006200732B2 (en) | Outer membrane vesicle (OMV) vaccine comprising N. meningitidis serogroup B outer membrane proteins |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
AK | Designated states |
Kind code of ref document: A3 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A3 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2390344 Country of ref document: CA |
|
ENP | Entry into the national phase |
Ref document number: 2001 540113 Country of ref document: JP Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: PA/A/2002/005325 Country of ref document: MX |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2000981520 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 18753/01 Country of ref document: AU |
|
WWE | Wipo information: entry into national phase |
Ref document number: 519716 Country of ref document: NZ |
|
ENP | Entry into the national phase |
Ref document number: 2002 2002117308 Country of ref document: RU Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: 008185719 Country of ref document: CN |
|
WWP | Wipo information: published in national office |
Ref document number: 2000981520 Country of ref document: EP |
|
REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
WWW | Wipo information: withdrawn in national office |
Ref document number: 2000981520 Country of ref document: EP |