WO2000071564A2 - Isolated nucleic acids of the p-hyde family, p-hyde proteins, and methods of inducing susceptibility to induction of cell death in cancer - Google Patents
Isolated nucleic acids of the p-hyde family, p-hyde proteins, and methods of inducing susceptibility to induction of cell death in cancer Download PDFInfo
- Publication number
- WO2000071564A2 WO2000071564A2 PCT/US2000/011456 US0011456W WO0071564A2 WO 2000071564 A2 WO2000071564 A2 WO 2000071564A2 US 0011456 W US0011456 W US 0011456W WO 0071564 A2 WO0071564 A2 WO 0071564A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- hyde
- nucleic acid
- cells
- protein
- polypeptide
- Prior art date
Links
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 361
- 150000007523 nucleic acids Chemical class 0.000 title claims abstract description 312
- 102000039446 nucleic acids Human genes 0.000 title claims abstract description 289
- 108020004707 nucleic acids Proteins 0.000 title claims abstract description 289
- 238000000034 method Methods 0.000 title claims abstract description 182
- 102000004169 proteins and genes Human genes 0.000 title claims abstract description 180
- 206010028980 Neoplasm Diseases 0.000 title claims abstract description 179
- 201000011510 cancer Diseases 0.000 title claims abstract description 85
- 230000001939 inductive effect Effects 0.000 title claims abstract description 27
- 230000030833 cell death Effects 0.000 title claims description 18
- 230000006698 induction Effects 0.000 title description 12
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 225
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 184
- 229920001184 polypeptide Polymers 0.000 claims abstract description 157
- 239000012634 fragment Substances 0.000 claims abstract description 89
- 230000035772 mutation Effects 0.000 claims abstract description 45
- 230000006907 apoptotic process Effects 0.000 claims abstract description 44
- 230000000692 anti-sense effect Effects 0.000 claims abstract description 21
- 239000003814 drug Substances 0.000 claims abstract description 21
- 108020001507 fusion proteins Proteins 0.000 claims abstract description 19
- 102000037865 fusion proteins Human genes 0.000 claims abstract description 19
- 230000005855 radiation Effects 0.000 claims abstract description 18
- 229940079593 drug Drugs 0.000 claims abstract description 17
- 238000012216 screening Methods 0.000 claims abstract description 15
- 238000002512 chemotherapy Methods 0.000 claims abstract description 11
- 210000004027 cell Anatomy 0.000 claims description 412
- 108020004414 DNA Proteins 0.000 claims description 127
- 239000013598 vector Substances 0.000 claims description 102
- 239000002299 complementary DNA Substances 0.000 claims description 88
- 230000014509 gene expression Effects 0.000 claims description 86
- 108020004999 messenger RNA Proteins 0.000 claims description 69
- 239000002773 nucleotide Substances 0.000 claims description 61
- 125000003729 nucleotide group Chemical group 0.000 claims description 61
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 59
- 150000001875 compounds Chemical class 0.000 claims description 56
- 241000701161 unidentified adenovirus Species 0.000 claims description 52
- 241000700605 Viruses Species 0.000 claims description 32
- 108091032973 (ribonucleotides)n+m Proteins 0.000 claims description 31
- 108091026890 Coding region Proteins 0.000 claims description 30
- 108091034117 Oligonucleotide Proteins 0.000 claims description 29
- 239000013604 expression vector Substances 0.000 claims description 29
- 230000002401 inhibitory effect Effects 0.000 claims description 28
- 239000002253 acid Substances 0.000 claims description 27
- 230000027455 binding Effects 0.000 claims description 27
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 26
- 230000004075 alteration Effects 0.000 claims description 26
- 238000009739 binding Methods 0.000 claims description 26
- 239000008194 pharmaceutical composition Substances 0.000 claims description 26
- 108700028369 Alleles Proteins 0.000 claims description 25
- 230000012010 growth Effects 0.000 claims description 25
- 239000003085 diluting agent Substances 0.000 claims description 22
- 238000013518 transcription Methods 0.000 claims description 22
- 230000035897 transcription Effects 0.000 claims description 22
- 238000003780 insertion Methods 0.000 claims description 21
- 230000037431 insertion Effects 0.000 claims description 21
- 230000000295 complement effect Effects 0.000 claims description 20
- 238000012217 deletion Methods 0.000 claims description 20
- 230000037430 deletion Effects 0.000 claims description 20
- 230000010076 replication Effects 0.000 claims description 19
- 230000005907 cancer growth Effects 0.000 claims description 17
- 239000003550 marker Substances 0.000 claims description 17
- 239000013612 plasmid Substances 0.000 claims description 17
- 241001135569 Human adenovirus 5 Species 0.000 claims description 14
- 230000002950 deficient Effects 0.000 claims description 14
- 238000004519 manufacturing process Methods 0.000 claims description 14
- 230000009261 transgenic effect Effects 0.000 claims description 14
- 230000000392 somatic effect Effects 0.000 claims description 12
- 241000714474 Rous sarcoma virus Species 0.000 claims description 10
- 230000001580 bacterial effect Effects 0.000 claims description 10
- 241000124008 Mammalia Species 0.000 claims description 9
- 108091008146 restriction endonucleases Proteins 0.000 claims description 9
- 240000004808 Saccharomyces cerevisiae Species 0.000 claims description 8
- 108020005202 Viral DNA Proteins 0.000 claims description 8
- 210000004962 mammalian cell Anatomy 0.000 claims description 8
- 210000000481 breast Anatomy 0.000 claims description 7
- 210000002307 prostate Anatomy 0.000 claims description 7
- 241000238631 Hexapoda Species 0.000 claims description 6
- 210000004556 brain Anatomy 0.000 claims description 6
- 230000029087 digestion Effects 0.000 claims description 6
- 210000003527 eukaryotic cell Anatomy 0.000 claims description 6
- 201000001441 melanoma Diseases 0.000 claims description 6
- 210000005267 prostate cell Anatomy 0.000 claims description 6
- 230000002285 radioactive effect Effects 0.000 claims description 6
- 210000001106 artificial yeast chromosome Anatomy 0.000 claims description 5
- 206010025323 Lymphomas Diseases 0.000 claims description 4
- 206010017758 gastric cancer Diseases 0.000 claims description 4
- 208000010749 gastric carcinoma Diseases 0.000 claims description 4
- 230000009870 specific binding Effects 0.000 claims description 4
- 201000000498 stomach carcinoma Diseases 0.000 claims description 4
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 claims description 3
- 239000010931 gold Substances 0.000 claims description 3
- 229910052737 gold Inorganic materials 0.000 claims description 3
- 210000001236 prokaryotic cell Anatomy 0.000 claims description 3
- 241001515965 unidentified phage Species 0.000 claims description 3
- 241000702421 Dependoparvovirus Species 0.000 claims description 2
- 241000196324 Embryophyta Species 0.000 claims description 2
- 206010039491 Sarcoma Diseases 0.000 claims description 2
- 238000012258 culturing Methods 0.000 claims description 2
- -1 chimerics Proteins 0.000 abstract description 25
- 238000001415 gene therapy Methods 0.000 abstract description 13
- 238000002560 therapeutic procedure Methods 0.000 abstract description 12
- 230000004614 tumor growth Effects 0.000 abstract description 11
- 238000009256 replacement therapy Methods 0.000 abstract description 2
- 238000011275 oncology therapy Methods 0.000 abstract 1
- 235000018102 proteins Nutrition 0.000 description 154
- 239000000523 sample Substances 0.000 description 137
- 235000001014 amino acid Nutrition 0.000 description 75
- 229940024606 amino acid Drugs 0.000 description 72
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 65
- 206010060862 Prostate cancer Diseases 0.000 description 64
- 150000001413 amino acids Chemical class 0.000 description 60
- 230000000694 effects Effects 0.000 description 50
- 239000000047 product Substances 0.000 description 45
- 239000000203 mixture Substances 0.000 description 43
- 238000009396 hybridization Methods 0.000 description 37
- 241000700159 Rattus Species 0.000 description 36
- 241001465754 Metazoa Species 0.000 description 35
- 238000003752 polymerase chain reaction Methods 0.000 description 35
- 238000004458 analytical method Methods 0.000 description 31
- 238000001727 in vivo Methods 0.000 description 28
- 238000011282 treatment Methods 0.000 description 27
- 238000003556 assay Methods 0.000 description 26
- 102000053602 DNA Human genes 0.000 description 25
- 210000001519 tissue Anatomy 0.000 description 25
- 238000013519 translation Methods 0.000 description 25
- 230000006870 function Effects 0.000 description 24
- 230000003612 virological effect Effects 0.000 description 24
- 102000040430 polynucleotide Human genes 0.000 description 23
- 108091033319 polynucleotide Proteins 0.000 description 23
- 239000002157 polynucleotide Substances 0.000 description 23
- 239000013615 primer Substances 0.000 description 23
- 239000000126 substance Substances 0.000 description 23
- 229940088598 enzyme Drugs 0.000 description 22
- 102000004190 Enzymes Human genes 0.000 description 20
- 108090000790 Enzymes Proteins 0.000 description 20
- 238000000338 in vitro Methods 0.000 description 20
- 101710147238 Metalloreductase STEAP3 Proteins 0.000 description 19
- 102100037653 Metalloreductase STEAP3 Human genes 0.000 description 19
- 125000000539 amino acid group Chemical group 0.000 description 19
- 230000001225 therapeutic effect Effects 0.000 description 19
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 18
- 239000003795 chemical substances by application Substances 0.000 description 18
- 239000002853 nucleic acid probe Substances 0.000 description 18
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 17
- 239000002202 Polyethylene glycol Substances 0.000 description 17
- 229920001223 polyethylene glycol Polymers 0.000 description 17
- 229920000642 polymer Polymers 0.000 description 17
- 239000003446 ligand Substances 0.000 description 16
- 101000721661 Homo sapiens Cellular tumor antigen p53 Proteins 0.000 description 15
- 108020004635 Complementary DNA Proteins 0.000 description 14
- 239000012528 membrane Substances 0.000 description 14
- 230000005778 DNA damage Effects 0.000 description 13
- 231100000277 DNA damage Toxicity 0.000 description 13
- 102000036639 antigens Human genes 0.000 description 13
- 238000013270 controlled release Methods 0.000 description 13
- 238000002347 injection Methods 0.000 description 13
- 239000007924 injection Substances 0.000 description 13
- 230000001105 regulatory effect Effects 0.000 description 13
- 238000012163 sequencing technique Methods 0.000 description 13
- 238000000636 Northern blotting Methods 0.000 description 12
- 230000003321 amplification Effects 0.000 description 12
- 239000000427 antigen Substances 0.000 description 12
- 108091007433 antigens Proteins 0.000 description 12
- 230000002068 genetic effect Effects 0.000 description 12
- 238000003199 nucleic acid amplification method Methods 0.000 description 12
- 238000002360 preparation method Methods 0.000 description 12
- 238000006467 substitution reaction Methods 0.000 description 12
- 230000005735 apoptotic response Effects 0.000 description 11
- 230000015572 biosynthetic process Effects 0.000 description 11
- 230000006378 damage Effects 0.000 description 11
- 238000002372 labelling Methods 0.000 description 11
- 239000000243 solution Substances 0.000 description 11
- 238000010361 transduction Methods 0.000 description 11
- 230000026683 transduction Effects 0.000 description 11
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 10
- 108700019146 Transgenes Proteins 0.000 description 10
- 238000013459 approach Methods 0.000 description 10
- 230000022131 cell cycle Effects 0.000 description 10
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 10
- 239000002502 liposome Substances 0.000 description 10
- 230000004048 modification Effects 0.000 description 10
- 238000012986 modification Methods 0.000 description 10
- 230000008439 repair process Effects 0.000 description 10
- 238000003786 synthesis reaction Methods 0.000 description 10
- 238000012360 testing method Methods 0.000 description 10
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 9
- 239000002671 adjuvant Substances 0.000 description 9
- 230000001413 cellular effect Effects 0.000 description 9
- 230000004927 fusion Effects 0.000 description 9
- 239000000463 material Substances 0.000 description 9
- 210000004379 membrane Anatomy 0.000 description 9
- 241000894007 species Species 0.000 description 9
- 108020004705 Codon Proteins 0.000 description 8
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 8
- VSNHCAURESNICA-UHFFFAOYSA-N Hydroxyurea Chemical compound NC(=O)NO VSNHCAURESNICA-UHFFFAOYSA-N 0.000 description 8
- 241001529936 Murinae Species 0.000 description 8
- 241000699666 Mus <mouse, genus> Species 0.000 description 8
- 108700026244 Open Reading Frames Proteins 0.000 description 8
- 238000006243 chemical reaction Methods 0.000 description 8
- 238000003776 cleavage reaction Methods 0.000 description 8
- 238000010367 cloning Methods 0.000 description 8
- 230000000875 corresponding effect Effects 0.000 description 8
- 201000010099 disease Diseases 0.000 description 8
- 239000003623 enhancer Substances 0.000 description 8
- 238000009472 formulation Methods 0.000 description 8
- 239000000499 gel Substances 0.000 description 8
- 229960001330 hydroxycarbamide Drugs 0.000 description 8
- 208000015181 infectious disease Diseases 0.000 description 8
- 238000012546 transfer Methods 0.000 description 8
- 102000011724 DNA Repair Enzymes Human genes 0.000 description 7
- 108010076525 DNA Repair Enzymes Proteins 0.000 description 7
- 239000012623 DNA damaging agent Substances 0.000 description 7
- 238000002965 ELISA Methods 0.000 description 7
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 7
- 108700025716 Tumor Suppressor Genes Proteins 0.000 description 7
- 102000044209 Tumor Suppressor Genes Human genes 0.000 description 7
- 230000000890 antigenic effect Effects 0.000 description 7
- 239000011324 bead Substances 0.000 description 7
- 239000003153 chemical reaction reagent Substances 0.000 description 7
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 7
- 230000034994 death Effects 0.000 description 7
- 231100000517 death Toxicity 0.000 description 7
- 210000002443 helper t lymphocyte Anatomy 0.000 description 7
- 238000001990 intravenous administration Methods 0.000 description 7
- 208000023958 prostate neoplasm Diseases 0.000 description 7
- 108020003175 receptors Proteins 0.000 description 7
- 102000005962 receptors Human genes 0.000 description 7
- 230000007017 scission Effects 0.000 description 7
- 239000007790 solid phase Substances 0.000 description 7
- 230000004083 survival effect Effects 0.000 description 7
- 238000001890 transfection Methods 0.000 description 7
- PBLQSFOIWOTFNY-UHFFFAOYSA-N 3-methylbut-2-enyl 4-methoxy-8-(3-methylbut-2-enoxy)quinoline-2-carboxylate Chemical compound C1=CC=C2C(OC)=CC(C(=O)OCC=C(C)C)=NC2=C1OCC=C(C)C PBLQSFOIWOTFNY-UHFFFAOYSA-N 0.000 description 6
- 201000009030 Carcinoma Diseases 0.000 description 6
- 108090000994 Catalytic RNA Proteins 0.000 description 6
- 102000053642 Catalytic RNA Human genes 0.000 description 6
- 239000003298 DNA probe Substances 0.000 description 6
- 230000004543 DNA replication Effects 0.000 description 6
- 229920002307 Dextran Polymers 0.000 description 6
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 6
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 6
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 6
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 6
- 241000699660 Mus musculus Species 0.000 description 6
- 239000004677 Nylon Substances 0.000 description 6
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 6
- 238000002105 Southern blotting Methods 0.000 description 6
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 6
- 239000004480 active ingredient Substances 0.000 description 6
- 238000007792 addition Methods 0.000 description 6
- 229960004316 cisplatin Drugs 0.000 description 6
- 238000001514 detection method Methods 0.000 description 6
- 229960002949 fluorouracil Drugs 0.000 description 6
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 6
- 238000003018 immunoassay Methods 0.000 description 6
- 238000001802 infusion Methods 0.000 description 6
- 230000005764 inhibitory process Effects 0.000 description 6
- 230000001394 metastastic effect Effects 0.000 description 6
- 206010061289 metastatic neoplasm Diseases 0.000 description 6
- 239000013642 negative control Substances 0.000 description 6
- 238000011580 nude mouse model Methods 0.000 description 6
- 229920001778 nylon Polymers 0.000 description 6
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 6
- 108091092562 ribozyme Proteins 0.000 description 6
- 150000003839 salts Chemical class 0.000 description 6
- 239000011780 sodium chloride Substances 0.000 description 6
- ODHCTXKNWHHXJC-VKHMYHEASA-N 5-oxo-L-proline Chemical compound OC(=O)[C@@H]1CCC(=O)N1 ODHCTXKNWHHXJC-VKHMYHEASA-N 0.000 description 5
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 5
- 241000283973 Oryctolagus cuniculus Species 0.000 description 5
- 238000012408 PCR amplification Methods 0.000 description 5
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 5
- 108091081024 Start codon Proteins 0.000 description 5
- 239000011543 agarose gel Substances 0.000 description 5
- 239000005557 antagonist Substances 0.000 description 5
- 230000001640 apoptogenic effect Effects 0.000 description 5
- 239000007864 aqueous solution Substances 0.000 description 5
- 230000004071 biological effect Effects 0.000 description 5
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 5
- 238000004113 cell culture Methods 0.000 description 5
- 230000010261 cell growth Effects 0.000 description 5
- 230000008859 change Effects 0.000 description 5
- 230000002596 correlated effect Effects 0.000 description 5
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 5
- 235000018417 cysteine Nutrition 0.000 description 5
- 230000003247 decreasing effect Effects 0.000 description 5
- 238000001212 derivatisation Methods 0.000 description 5
- 238000013461 design Methods 0.000 description 5
- 238000011161 development Methods 0.000 description 5
- 230000018109 developmental process Effects 0.000 description 5
- 238000007877 drug screening Methods 0.000 description 5
- 230000002255 enzymatic effect Effects 0.000 description 5
- 210000002919 epithelial cell Anatomy 0.000 description 5
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 5
- 229960005420 etoposide Drugs 0.000 description 5
- 239000000284 extract Substances 0.000 description 5
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 5
- 238000001502 gel electrophoresis Methods 0.000 description 5
- 230000000670 limiting effect Effects 0.000 description 5
- 230000007246 mechanism Effects 0.000 description 5
- 239000002609 medium Substances 0.000 description 5
- 229940043131 pyroglutamate Drugs 0.000 description 5
- 230000004044 response Effects 0.000 description 5
- 230000035945 sensitivity Effects 0.000 description 5
- 229940083575 sodium dodecyl sulfate Drugs 0.000 description 5
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 5
- 238000010561 standard procedure Methods 0.000 description 5
- 239000000758 substrate Substances 0.000 description 5
- 241001430294 unidentified retrovirus Species 0.000 description 5
- 238000001262 western blot Methods 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 4
- 241000894006 Bacteria Species 0.000 description 4
- 102100026189 Beta-galactosidase Human genes 0.000 description 4
- 206010006187 Breast cancer Diseases 0.000 description 4
- 208000026310 Breast neoplasm Diseases 0.000 description 4
- 108020004638 Circular DNA Proteins 0.000 description 4
- 241000588724 Escherichia coli Species 0.000 description 4
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 4
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 4
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 4
- 241000282412 Homo Species 0.000 description 4
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 4
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 4
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 4
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 4
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 4
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 4
- 241000699670 Mus sp. Species 0.000 description 4
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 4
- 229910019142 PO4 Inorganic materials 0.000 description 4
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 4
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 4
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 4
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 4
- 125000003277 amino group Chemical group 0.000 description 4
- 238000000137 annealing Methods 0.000 description 4
- 238000003782 apoptosis assay Methods 0.000 description 4
- 235000003704 aspartic acid Nutrition 0.000 description 4
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 4
- 108010005774 beta-Galactosidase Proteins 0.000 description 4
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 4
- 210000001124 body fluid Anatomy 0.000 description 4
- 239000000872 buffer Substances 0.000 description 4
- 239000001506 calcium phosphate Substances 0.000 description 4
- 229910000389 calcium phosphate Inorganic materials 0.000 description 4
- 235000011010 calcium phosphates Nutrition 0.000 description 4
- 239000012829 chemotherapy agent Substances 0.000 description 4
- 210000000349 chromosome Anatomy 0.000 description 4
- 238000010276 construction Methods 0.000 description 4
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 4
- 230000000254 damaging effect Effects 0.000 description 4
- 239000008121 dextrose Substances 0.000 description 4
- 230000004069 differentiation Effects 0.000 description 4
- ZWAOHEXOSAUJHY-ZIYNGMLESA-N doxifluridine Chemical compound O[C@@H]1[C@H](O)[C@@H](C)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ZWAOHEXOSAUJHY-ZIYNGMLESA-N 0.000 description 4
- 238000004520 electroporation Methods 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 4
- 230000009036 growth inhibition Effects 0.000 description 4
- 230000002209 hydrophobic effect Effects 0.000 description 4
- 230000002163 immunogen Effects 0.000 description 4
- 238000007901 in situ hybridization Methods 0.000 description 4
- 238000011065 in-situ storage Methods 0.000 description 4
- 239000003112 inhibitor Substances 0.000 description 4
- 230000000977 initiatory effect Effects 0.000 description 4
- 238000010253 intravenous injection Methods 0.000 description 4
- 210000003292 kidney cell Anatomy 0.000 description 4
- 239000006166 lysate Substances 0.000 description 4
- 229930182817 methionine Natural products 0.000 description 4
- 238000000520 microinjection Methods 0.000 description 4
- 238000010369 molecular cloning Methods 0.000 description 4
- 230000037361 pathway Effects 0.000 description 4
- 239000010452 phosphate Substances 0.000 description 4
- 230000008488 polyadenylation Effects 0.000 description 4
- 230000000379 polymerizing effect Effects 0.000 description 4
- 239000002243 precursor Substances 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 230000004224 protection Effects 0.000 description 4
- 230000002685 pulmonary effect Effects 0.000 description 4
- 230000006798 recombination Effects 0.000 description 4
- 238000005215 recombination Methods 0.000 description 4
- 238000007894 restriction fragment length polymorphism technique Methods 0.000 description 4
- 239000013605 shuttle vector Substances 0.000 description 4
- 239000007787 solid Substances 0.000 description 4
- 239000002904 solvent Substances 0.000 description 4
- 229940124597 therapeutic agent Drugs 0.000 description 4
- 230000009466 transformation Effects 0.000 description 4
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 4
- 210000004881 tumor cell Anatomy 0.000 description 4
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 4
- 238000011144 upstream manufacturing Methods 0.000 description 4
- 239000004474 valine Substances 0.000 description 4
- 239000003981 vehicle Substances 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- 229920003169 water-soluble polymer Polymers 0.000 description 4
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 3
- 102100021569 Apoptosis regulator Bcl-2 Human genes 0.000 description 3
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 3
- 206010009944 Colon cancer Diseases 0.000 description 3
- 230000033616 DNA repair Effects 0.000 description 3
- 101710088194 Dehydrogenase Proteins 0.000 description 3
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 3
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 101000971171 Homo sapiens Apoptosis regulator Bcl-2 Proteins 0.000 description 3
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 3
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 3
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 3
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 3
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 3
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 3
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 3
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- 206010027476 Metastases Diseases 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 206010061309 Neoplasm progression Diseases 0.000 description 3
- 102000007999 Nuclear Proteins Human genes 0.000 description 3
- 108010089610 Nuclear Proteins Proteins 0.000 description 3
- 108700020796 Oncogene Proteins 0.000 description 3
- 206010061535 Ovarian neoplasm Diseases 0.000 description 3
- 108091005804 Peptidases Proteins 0.000 description 3
- 102000035195 Peptidases Human genes 0.000 description 3
- 239000004372 Polyvinyl alcohol Substances 0.000 description 3
- 102000006382 Ribonucleases Human genes 0.000 description 3
- 108010083644 Ribonucleases Proteins 0.000 description 3
- 230000018199 S phase Effects 0.000 description 3
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 3
- 239000004473 Threonine Substances 0.000 description 3
- 108010019092 Uridine phosphorylase Proteins 0.000 description 3
- 102100020892 Uridine phosphorylase 1 Human genes 0.000 description 3
- DZBUGLKDJFMEHC-UHFFFAOYSA-N acridine Chemical compound C1=CC=CC2=CC3=CC=CC=C3N=C21 DZBUGLKDJFMEHC-UHFFFAOYSA-N 0.000 description 3
- 230000009471 action Effects 0.000 description 3
- 229940009456 adriamycin Drugs 0.000 description 3
- 238000000246 agarose gel electrophoresis Methods 0.000 description 3
- 235000004279 alanine Nutrition 0.000 description 3
- 210000004102 animal cell Anatomy 0.000 description 3
- 239000003242 anti bacterial agent Substances 0.000 description 3
- 229940088710 antibiotic agent Drugs 0.000 description 3
- 235000009582 asparagine Nutrition 0.000 description 3
- 229960001230 asparagine Drugs 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 230000037396 body weight Effects 0.000 description 3
- 230000036952 cancer formation Effects 0.000 description 3
- 239000003183 carcinogenic agent Substances 0.000 description 3
- 230000015556 catabolic process Effects 0.000 description 3
- 230000004663 cell proliferation Effects 0.000 description 3
- 108091092356 cellular DNA Proteins 0.000 description 3
- 230000002860 competitive effect Effects 0.000 description 3
- 229920001577 copolymer Polymers 0.000 description 3
- 238000004132 cross linking Methods 0.000 description 3
- 230000007547 defect Effects 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 238000009510 drug design Methods 0.000 description 3
- 239000000839 emulsion Substances 0.000 description 3
- 239000000194 fatty acid Substances 0.000 description 3
- 238000007667 floating Methods 0.000 description 3
- 230000005714 functional activity Effects 0.000 description 3
- 235000013922 glutamic acid Nutrition 0.000 description 3
- 239000004220 glutamic acid Substances 0.000 description 3
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 3
- 238000002744 homologous recombination Methods 0.000 description 3
- 230000006801 homologous recombination Effects 0.000 description 3
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 230000028993 immune response Effects 0.000 description 3
- 230000006882 induction of apoptosis Effects 0.000 description 3
- 230000010354 integration Effects 0.000 description 3
- 238000007918 intramuscular administration Methods 0.000 description 3
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 3
- 229960000310 isoleucine Drugs 0.000 description 3
- 208000032839 leukemia Diseases 0.000 description 3
- 239000006193 liquid solution Substances 0.000 description 3
- 238000011068 loading method Methods 0.000 description 3
- 230000036210 malignancy Effects 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 230000009401 metastasis Effects 0.000 description 3
- 244000005700 microbiome Species 0.000 description 3
- 230000011278 mitosis Effects 0.000 description 3
- 230000000877 morphologic effect Effects 0.000 description 3
- 238000002703 mutagenesis Methods 0.000 description 3
- 231100000350 mutagenesis Toxicity 0.000 description 3
- 210000005170 neoplastic cell Anatomy 0.000 description 3
- 238000007899 nucleic acid hybridization Methods 0.000 description 3
- 239000003921 oil Substances 0.000 description 3
- 235000019198 oils Nutrition 0.000 description 3
- 210000000287 oocyte Anatomy 0.000 description 3
- 239000008188 pellet Substances 0.000 description 3
- 239000002953 phosphate buffered saline Substances 0.000 description 3
- 229920001983 poloxamer Polymers 0.000 description 3
- 102000054765 polymorphisms of proteins Human genes 0.000 description 3
- 229920002451 polyvinyl alcohol Polymers 0.000 description 3
- 230000006659 positive regulation of apoptotic process Effects 0.000 description 3
- 238000003127 radioimmunoassay Methods 0.000 description 3
- 238000001959 radiotherapy Methods 0.000 description 3
- 230000008707 rearrangement Effects 0.000 description 3
- 238000003259 recombinant expression Methods 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- 238000012552 review Methods 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 238000000527 sonication Methods 0.000 description 3
- 230000002269 spontaneous effect Effects 0.000 description 3
- 125000001424 substituent group Chemical group 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 230000001131 transforming effect Effects 0.000 description 3
- 230000005751 tumor progression Effects 0.000 description 3
- 238000009281 ultraviolet germicidal irradiation Methods 0.000 description 3
- 210000003501 vero cell Anatomy 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 2
- 108010088751 Albumins Proteins 0.000 description 2
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 2
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 2
- 108020005544 Antisense RNA Proteins 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- QCMYYKRYFNMIEC-UHFFFAOYSA-N COP(O)=O Chemical class COP(O)=O QCMYYKRYFNMIEC-UHFFFAOYSA-N 0.000 description 2
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 2
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 2
- 241000282472 Canis lupus familiaris Species 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- 208000005623 Carcinogenesis Diseases 0.000 description 2
- 241000282693 Cercopithecidae Species 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- 208000037051 Chromosomal Instability Diseases 0.000 description 2
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 2
- 208000035473 Communicable disease Diseases 0.000 description 2
- 230000004544 DNA amplification Effects 0.000 description 2
- 238000011346 DNA-damaging therapy Methods 0.000 description 2
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 2
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 2
- 108010054576 Deoxyribonuclease EcoRI Proteins 0.000 description 2
- 108010016626 Dipeptides Proteins 0.000 description 2
- 201000009051 Embryonal Carcinoma Diseases 0.000 description 2
- 101100050026 Enterobacteria phage T4 y01J gene Proteins 0.000 description 2
- 230000010337 G2 phase Effects 0.000 description 2
- 206010064571 Gene mutation Diseases 0.000 description 2
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 2
- NYHBQMYGNKIUIF-UUOKFMHZSA-N Guanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O NYHBQMYGNKIUIF-UUOKFMHZSA-N 0.000 description 2
- 239000012981 Hank's balanced salt solution Substances 0.000 description 2
- 108090000144 Human Proteins Proteins 0.000 description 2
- 102000003839 Human Proteins Human genes 0.000 description 2
- 241000598171 Human adenovirus sp. Species 0.000 description 2
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 2
- 108060003951 Immunoglobulin Proteins 0.000 description 2
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 2
- 150000008575 L-amino acids Chemical group 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- 102000043131 MHC class II family Human genes 0.000 description 2
- 108091054438 MHC class II family Proteins 0.000 description 2
- 101100112138 Mesembryanthemum crystallinum PPCA gene Proteins 0.000 description 2
- 102000010645 MutS Proteins Human genes 0.000 description 2
- 108010038272 MutS Proteins Proteins 0.000 description 2
- 102000048850 Neoplasm Genes Human genes 0.000 description 2
- 108700019961 Neoplasm Genes Proteins 0.000 description 2
- 102000001068 Neural Cell Adhesion Molecules Human genes 0.000 description 2
- 108010069196 Neural Cell Adhesion Molecules Proteins 0.000 description 2
- 239000000020 Nitrocellulose Substances 0.000 description 2
- 102000043276 Oncogene Human genes 0.000 description 2
- 206010033128 Ovarian cancer Diseases 0.000 description 2
- 101150012928 PPC1 gene Proteins 0.000 description 2
- 241001494479 Pecora Species 0.000 description 2
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical group N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 2
- 102000007079 Peptide Fragments Human genes 0.000 description 2
- 108010033276 Peptide Fragments Proteins 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 2
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- 239000004743 Polypropylene Substances 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 101710148009 Putative uracil phosphoribosyltransferase Proteins 0.000 description 2
- 108020004518 RNA Probes Proteins 0.000 description 2
- 239000003391 RNA probe Substances 0.000 description 2
- 101000880397 Rattus norvegicus Metalloreductase STEAP3 Proteins 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 101100028851 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) PCK1 gene Proteins 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 102000054727 Serum Amyloid A Human genes 0.000 description 2
- 108700028909 Serum Amyloid A Proteins 0.000 description 2
- 108020004682 Single-Stranded DNA Proteins 0.000 description 2
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N Sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 2
- 238000012288 TUNEL assay Methods 0.000 description 2
- 108010022394 Threonine synthase Proteins 0.000 description 2
- 102000005497 Thymidylate Synthase Human genes 0.000 description 2
- 108020004566 Transfer RNA Proteins 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- 102000007410 Uridine kinase Human genes 0.000 description 2
- 208000036142 Viral infection Diseases 0.000 description 2
- 208000027418 Wounds and injury Diseases 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- 208000009956 adenocarcinoma Diseases 0.000 description 2
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 2
- 239000000556 agonist Substances 0.000 description 2
- 229960000723 ampicillin Drugs 0.000 description 2
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 2
- 239000003098 androgen Substances 0.000 description 2
- 230000001093 anti-cancer Effects 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 239000003963 antioxidant agent Substances 0.000 description 2
- 235000006708 antioxidants Nutrition 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- 238000000376 autoradiography Methods 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 2
- DRTQHJPVMGBUCF-PSQAKQOGSA-N beta-L-uridine Natural products O[C@H]1[C@@H](O)[C@H](CO)O[C@@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-PSQAKQOGSA-N 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 239000001110 calcium chloride Substances 0.000 description 2
- 229910001628 calcium chloride Inorganic materials 0.000 description 2
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 2
- 229940127093 camptothecin Drugs 0.000 description 2
- 230000000711 cancerogenic effect Effects 0.000 description 2
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 2
- 231100000357 carcinogen Toxicity 0.000 description 2
- 231100000504 carcinogenesis Toxicity 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 239000013522 chelant Substances 0.000 description 2
- 239000002738 chelating agent Substances 0.000 description 2
- 238000007385 chemical modification Methods 0.000 description 2
- 239000007795 chemical reaction product Substances 0.000 description 2
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 2
- 230000002759 chromosomal effect Effects 0.000 description 2
- 238000000975 co-precipitation Methods 0.000 description 2
- 238000010293 colony formation assay Methods 0.000 description 2
- 230000001332 colony forming effect Effects 0.000 description 2
- 238000012875 competitive assay Methods 0.000 description 2
- 238000002967 competitive immunoassay Methods 0.000 description 2
- 239000003184 complementary RNA Substances 0.000 description 2
- 238000005094 computer simulation Methods 0.000 description 2
- 230000021615 conjugation Effects 0.000 description 2
- 239000000599 controlled substance Substances 0.000 description 2
- 238000011613 copenhagen rat Methods 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 125000004122 cyclic group Chemical group 0.000 description 2
- 230000000120 cytopathologic effect Effects 0.000 description 2
- 230000001086 cytosolic effect Effects 0.000 description 2
- 229940127089 cytotoxic agent Drugs 0.000 description 2
- 231100000135 cytotoxicity Toxicity 0.000 description 2
- 230000003013 cytotoxicity Effects 0.000 description 2
- 230000007812 deficiency Effects 0.000 description 2
- 230000006735 deficit Effects 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 238000003935 denaturing gradient gel electrophoresis Methods 0.000 description 2
- 239000003599 detergent Substances 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- 235000014113 dietary fatty acids Nutrition 0.000 description 2
- 238000002050 diffraction method Methods 0.000 description 2
- 230000003292 diminished effect Effects 0.000 description 2
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 2
- 208000035475 disorder Diseases 0.000 description 2
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 2
- 229940126534 drug product Drugs 0.000 description 2
- 230000009977 dual effect Effects 0.000 description 2
- 238000001962 electrophoresis Methods 0.000 description 2
- 239000003995 emulsifying agent Substances 0.000 description 2
- 230000008995 epigenetic change Effects 0.000 description 2
- 210000000416 exudates and transudate Anatomy 0.000 description 2
- 229930195729 fatty acid Natural products 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- 239000012091 fetal bovine serum Substances 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 238000002509 fluorescent in situ hybridization Methods 0.000 description 2
- 238000002825 functional assay Methods 0.000 description 2
- 230000002538 fungal effect Effects 0.000 description 2
- 108010017007 glucose-regulated proteins Proteins 0.000 description 2
- 230000002414 glycolytic effect Effects 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 2
- 229920001519 homopolymer Polymers 0.000 description 2
- 210000005260 human cell Anatomy 0.000 description 2
- 210000004408 hybridoma Anatomy 0.000 description 2
- 230000003463 hyperproliferative effect Effects 0.000 description 2
- 230000005934 immune activation Effects 0.000 description 2
- 230000036039 immunity Effects 0.000 description 2
- 102000018358 immunoglobulin Human genes 0.000 description 2
- 230000002779 inactivation Effects 0.000 description 2
- 238000010348 incorporation Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 238000013383 initial experiment Methods 0.000 description 2
- 208000014674 injury Diseases 0.000 description 2
- 238000011081 inoculation Methods 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- 210000001161 mammalian embryo Anatomy 0.000 description 2
- 229910021645 metal ion Inorganic materials 0.000 description 2
- 125000000250 methylamino group Chemical group [H]N(*)C([H])([H])[H] 0.000 description 2
- 229960004857 mitomycin Drugs 0.000 description 2
- 230000037230 mobility Effects 0.000 description 2
- 230000009456 molecular mechanism Effects 0.000 description 2
- 230000004660 morphological change Effects 0.000 description 2
- 210000000663 muscle cell Anatomy 0.000 description 2
- 230000000869 mutational effect Effects 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- QGNBDSPDXGLEJP-UHFFFAOYSA-N n-fluoroacetamide Chemical compound CC(=O)NF QGNBDSPDXGLEJP-UHFFFAOYSA-N 0.000 description 2
- 230000001613 neoplastic effect Effects 0.000 description 2
- 230000003472 neutralizing effect Effects 0.000 description 2
- 229920001220 nitrocellulos Polymers 0.000 description 2
- 230000020520 nucleotide-excision repair Effects 0.000 description 2
- 235000015097 nutrients Nutrition 0.000 description 2
- 230000003204 osmotic effect Effects 0.000 description 2
- 230000002611 ovarian Effects 0.000 description 2
- 230000003647 oxidation Effects 0.000 description 2
- 238000007254 oxidation reaction Methods 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 2
- 239000000816 peptidomimetic Substances 0.000 description 2
- 230000002093 peripheral effect Effects 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 239000000825 pharmaceutical preparation Substances 0.000 description 2
- 230000000144 pharmacologic effect Effects 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 150000008300 phosphoramidites Chemical class 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- 210000002381 plasma Anatomy 0.000 description 2
- 229920003023 plastic Polymers 0.000 description 2
- 239000004033 plastic Substances 0.000 description 2
- 229920001987 poloxamine Polymers 0.000 description 2
- 229920002401 polyacrylamide Polymers 0.000 description 2
- 239000008057 potassium phosphate buffer Substances 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 230000005522 programmed cell death Effects 0.000 description 2
- 235000019419 proteases Nutrition 0.000 description 2
- 239000011253 protective coating Substances 0.000 description 2
- ZCCUUQDIBDJBTK-UHFFFAOYSA-N psoralen Chemical compound C1=C2OC(=O)C=CC2=CC2=C1OC=C2 ZCCUUQDIBDJBTK-UHFFFAOYSA-N 0.000 description 2
- 238000003906 pulsed field gel electrophoresis Methods 0.000 description 2
- 239000011541 reaction mixture Substances 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- 210000001995 reticulocyte Anatomy 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- FGDZQCVHDSGLHJ-UHFFFAOYSA-M rubidium chloride Chemical compound [Cl-].[Rb+] FGDZQCVHDSGLHJ-UHFFFAOYSA-M 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 238000011451 sequencing strategy Methods 0.000 description 2
- 239000001509 sodium citrate Substances 0.000 description 2
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 206010041823 squamous cell carcinoma Diseases 0.000 description 2
- 238000001356 surgical procedure Methods 0.000 description 2
- 238000013268 sustained release Methods 0.000 description 2
- 239000012730 sustained-release form Substances 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 229940104230 thymidine Drugs 0.000 description 2
- 231100000331 toxic Toxicity 0.000 description 2
- 230000002588 toxic effect Effects 0.000 description 2
- 230000005026 transcription initiation Effects 0.000 description 2
- 150000005691 triesters Chemical class 0.000 description 2
- GETQZCLCWQTVFV-UHFFFAOYSA-N trimethylamine Chemical compound CN(C)C GETQZCLCWQTVFV-UHFFFAOYSA-N 0.000 description 2
- LWIHDJKSTIGBAC-UHFFFAOYSA-K tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 2
- 241001529453 unidentified herpesvirus Species 0.000 description 2
- DRTQHJPVMGBUCF-UHFFFAOYSA-N uracil arabinoside Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-UHFFFAOYSA-N 0.000 description 2
- 229940045145 uridine Drugs 0.000 description 2
- 210000002700 urine Anatomy 0.000 description 2
- 230000009385 viral infection Effects 0.000 description 2
- 239000001993 wax Substances 0.000 description 2
- 238000002424 x-ray crystallography Methods 0.000 description 2
- 210000005253 yeast cell Anatomy 0.000 description 2
- SBKVPJHMSUXZTA-MEJXFZFPSA-N (2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-5-amino-2-[[2-[[(2S)-1-[(2S)-6-amino-2-[[(2S)-2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-3-(1H-indol-3-yl)propanoyl]amino]-3-(1H-imidazol-4-yl)propanoyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]-4-methylpentanoyl]amino]-5-oxopentanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]acetyl]amino]-5-oxopentanoyl]pyrrolidine-2-carbonyl]amino]-4-methylsulfanylbutanoyl]amino]-3-(4-hydroxyphenyl)propanoic acid Chemical compound C([C@@H](C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)NC(=O)[C@@H](N)CC=1C2=CC=CC=C2NC=1)C1=CNC=N1 SBKVPJHMSUXZTA-MEJXFZFPSA-N 0.000 description 1
- YMBIICKZNSTXJA-VKHMYHEASA-N (2s)-2-(carboxyamino)pentanedioic acid Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(O)=O YMBIICKZNSTXJA-VKHMYHEASA-N 0.000 description 1
- ASWBNKHCZGQVJV-UHFFFAOYSA-N (3-hexadecanoyloxy-2-hydroxypropyl) 2-(trimethylazaniumyl)ethyl phosphate Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(O)COP([O-])(=O)OCC[N+](C)(C)C ASWBNKHCZGQVJV-UHFFFAOYSA-N 0.000 description 1
- WNXJIVFYUVYPPR-UHFFFAOYSA-N 1,3-dioxolane Chemical compound C1COCO1 WNXJIVFYUVYPPR-UHFFFAOYSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-UHFFFAOYSA-N 1-beta-D-Xylofuranosyl-NH-Cytosine Natural products O=C1N=C(N)C=CN1C1C(O)C(O)C(CO)O1 UHDGCWIWMRVCDJ-UHFFFAOYSA-N 0.000 description 1
- VSNHCAURESNICA-NJFSPNSNSA-N 1-oxidanylurea Chemical compound N[14C](=O)NO VSNHCAURESNICA-NJFSPNSNSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- 108020004465 16S ribosomal RNA Proteins 0.000 description 1
- 108020004463 18S ribosomal RNA Proteins 0.000 description 1
- YKBGVTZYEHREMT-KVQBGUIXSA-N 2'-deoxyguanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 YKBGVTZYEHREMT-KVQBGUIXSA-N 0.000 description 1
- UFBJCMHMOXMLKC-UHFFFAOYSA-N 2,4-dinitrophenol Chemical compound OC1=CC=C([N+]([O-])=O)C=C1[N+]([O-])=O UFBJCMHMOXMLKC-UHFFFAOYSA-N 0.000 description 1
- WEEMDRWIKYCTQM-UHFFFAOYSA-N 2,6-dimethoxybenzenecarbothioamide Chemical compound COC1=CC=CC(OC)=C1C(N)=S WEEMDRWIKYCTQM-UHFFFAOYSA-N 0.000 description 1
- SGTNSNPWRIOYBX-UHFFFAOYSA-N 2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile Chemical compound C1=C(OC)C(OC)=CC=C1CCN(C)CCCC(C#N)(C(C)C)C1=CC=C(OC)C(OC)=C1 SGTNSNPWRIOYBX-UHFFFAOYSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- 108020005096 28S Ribosomal RNA Proteins 0.000 description 1
- OSJPPGNTCRNQQC-UWTATZPHSA-N 3-phospho-D-glyceric acid Chemical compound OC(=O)[C@H](O)COP(O)(O)=O OSJPPGNTCRNQQC-UWTATZPHSA-N 0.000 description 1
- VXGRJERITKFWPL-UHFFFAOYSA-N 4',5'-Dihydropsoralen Natural products C1=C2OC(=O)C=CC2=CC2=C1OCC2 VXGRJERITKFWPL-UHFFFAOYSA-N 0.000 description 1
- CKTSBUTUHBMZGZ-ULQXZJNLSA-N 4-amino-1-[(2r,4s,5r)-4-hydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-tritiopyrimidin-2-one Chemical compound O=C1N=C(N)C([3H])=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 CKTSBUTUHBMZGZ-ULQXZJNLSA-N 0.000 description 1
- BTJIUGUIPKRLHP-UHFFFAOYSA-N 4-nitrophenol Chemical compound OC1=CC=C([N+]([O-])=O)C=C1 BTJIUGUIPKRLHP-UHFFFAOYSA-N 0.000 description 1
- 101710169336 5'-deoxyadenosine deaminase Proteins 0.000 description 1
- ZMGMDXCADSRNCX-UHFFFAOYSA-N 5,6-dihydroxy-1,3-diazepan-2-one Chemical compound OC1CNC(=O)NCC1O ZMGMDXCADSRNCX-UHFFFAOYSA-N 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- HRPVXLWXLXDGHG-UHFFFAOYSA-N Acrylamide Chemical compound NC(=O)C=C HRPVXLWXLXDGHG-UHFFFAOYSA-N 0.000 description 1
- 102100036664 Adenosine deaminase Human genes 0.000 description 1
- 206010001258 Adenoviral infections Diseases 0.000 description 1
- 108010000239 Aequorin Proteins 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 102000007698 Alcohol dehydrogenase Human genes 0.000 description 1
- 108010021809 Alcohol dehydrogenase Proteins 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- 201000003076 Angiosarcoma Diseases 0.000 description 1
- 208000019901 Anxiety disease Diseases 0.000 description 1
- 206010003571 Astrocytoma Diseases 0.000 description 1
- 238000012935 Averaging Methods 0.000 description 1
- 241000271566 Aves Species 0.000 description 1
- 241000713842 Avian sarcoma virus Species 0.000 description 1
- 241000304886 Bacilli Species 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 241000701822 Bovine papillomavirus Species 0.000 description 1
- FERIUCNNQQJTOY-UHFFFAOYSA-M Butyrate Chemical compound CCCC([O-])=O FERIUCNNQQJTOY-UHFFFAOYSA-M 0.000 description 1
- FERIUCNNQQJTOY-UHFFFAOYSA-N Butyric acid Natural products CCCC(O)=O FERIUCNNQQJTOY-UHFFFAOYSA-N 0.000 description 1
- 108091028690 C-myc mRNA Proteins 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- 108090000565 Capsid Proteins Proteins 0.000 description 1
- 239000004215 Carbon black (E152) Substances 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 101710150820 Cellular tumor antigen p53 Proteins 0.000 description 1
- 102100023321 Ceruloplasmin Human genes 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 208000005243 Chondrosarcoma Diseases 0.000 description 1
- 201000009047 Chordoma Diseases 0.000 description 1
- 108700010070 Codon Usage Proteins 0.000 description 1
- 102000012422 Collagen Type I Human genes 0.000 description 1
- 108010022452 Collagen Type I Proteins 0.000 description 1
- 102000029816 Collagenase Human genes 0.000 description 1
- 108060005980 Collagenase Proteins 0.000 description 1
- 206010010099 Combined immunodeficiency Diseases 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- 208000009798 Craniopharyngioma Diseases 0.000 description 1
- MIKUYHXYGGJMLM-GIMIYPNGSA-N Crotonoside Natural products C1=NC2=C(N)NC(=O)N=C2N1[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O MIKUYHXYGGJMLM-GIMIYPNGSA-N 0.000 description 1
- 108010069514 Cyclic Peptides Proteins 0.000 description 1
- 102000001189 Cyclic Peptides Human genes 0.000 description 1
- 108050006400 Cyclin Proteins 0.000 description 1
- 102000001493 Cyclophilins Human genes 0.000 description 1
- 108010068682 Cyclophilins Proteins 0.000 description 1
- UHDGCWIWMRVCDJ-PSQAKQOGSA-N Cytidine Natural products O=C1N=C(N)C=CN1[C@@H]1[C@@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-PSQAKQOGSA-N 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-UWTATZPHSA-N D-alanine Chemical compound C[C@@H](N)C(O)=O QNAYBMKLOCPYGJ-UWTATZPHSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-UHFFFAOYSA-N D-alpha-Ala Natural products CC([NH3+])C([O-])=O QNAYBMKLOCPYGJ-UHFFFAOYSA-N 0.000 description 1
- 150000008574 D-amino acids Chemical class 0.000 description 1
- NYHBQMYGNKIUIF-UHFFFAOYSA-N D-guanosine Natural products C1=2NC(N)=NC(=O)C=2N=CN1C1OC(CO)C(O)C1O NYHBQMYGNKIUIF-UHFFFAOYSA-N 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 108020003215 DNA Probes Proteins 0.000 description 1
- 238000007400 DNA extraction Methods 0.000 description 1
- 239000003155 DNA primer Substances 0.000 description 1
- 230000008265 DNA repair mechanism Effects 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 230000006820 DNA synthesis Effects 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010092160 Dactinomycin Proteins 0.000 description 1
- 102000010170 Death domains Human genes 0.000 description 1
- 108050001718 Death domains Proteins 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- SHIBSTMRCDJXLN-UHFFFAOYSA-N Digoxigenin Natural products C1CC(C2C(C3(C)CCC(O)CC3CC2)CC2O)(O)C2(C)C1C1=CC(=O)OC1 SHIBSTMRCDJXLN-UHFFFAOYSA-N 0.000 description 1
- 102100024746 Dihydrofolate reductase Human genes 0.000 description 1
- 108090000204 Dipeptidase 1 Proteins 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 102000001301 EGF receptor Human genes 0.000 description 1
- 108060006698 EGF receptor Proteins 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 108010067770 Endopeptidase K Proteins 0.000 description 1
- 108700041152 Endoplasmic Reticulum Chaperone BiP Proteins 0.000 description 1
- 102100021451 Endoplasmic reticulum chaperone BiP Human genes 0.000 description 1
- 102100039328 Endoplasmin Human genes 0.000 description 1
- 206010014967 Ependymoma Diseases 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- VGGSQFUCUMXWEO-UHFFFAOYSA-N Ethene Chemical compound C=C VGGSQFUCUMXWEO-UHFFFAOYSA-N 0.000 description 1
- 239000005977 Ethylene Substances 0.000 description 1
- IAYPIBMASNFSPL-UHFFFAOYSA-N Ethylene oxide Chemical compound C1CO1 IAYPIBMASNFSPL-UHFFFAOYSA-N 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 208000006168 Ewing Sarcoma Diseases 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 241000282324 Felis Species 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 201000008808 Fibrosarcoma Diseases 0.000 description 1
- 241000724791 Filamentous phage Species 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 108010001498 Galectin 1 Proteins 0.000 description 1
- 102100021736 Galectin-1 Human genes 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 206010071602 Genetic polymorphism Diseases 0.000 description 1
- 208000032612 Glial tumor Diseases 0.000 description 1
- 206010018338 Glioma Diseases 0.000 description 1
- VPZXBVLAVMBEQI-VKHMYHEASA-N Glycyl-alanine Chemical compound OC(=O)[C@H](C)NC(=O)CN VPZXBVLAVMBEQI-VKHMYHEASA-N 0.000 description 1
- 101000636168 Grapevine leafroll-associated virus 3 (isolate United States/NY1) Movement protein p5 Proteins 0.000 description 1
- UYTPUPDQBNUYGX-UHFFFAOYSA-N Guanine Natural products O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 1
- 108010062347 HLA-DQ Antigens Proteins 0.000 description 1
- 108010067802 HLA-DR alpha-Chains Proteins 0.000 description 1
- 101150112743 HSPA5 gene Proteins 0.000 description 1
- 208000001258 Hemangiosarcoma Diseases 0.000 description 1
- 102100021519 Hemoglobin subunit beta Human genes 0.000 description 1
- 108091005904 Hemoglobin subunit beta Proteins 0.000 description 1
- 241000700721 Hepatitis B virus Species 0.000 description 1
- 208000005176 Hepatitis C Diseases 0.000 description 1
- 108010033040 Histones Proteins 0.000 description 1
- 101000573199 Homo sapiens Protein PML Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 241000725303 Human immunodeficiency virus Species 0.000 description 1
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 1
- 244000025221 Humulus lupulus Species 0.000 description 1
- 235000008694 Humulus lupulus Nutrition 0.000 description 1
- 241000282620 Hylobates sp. Species 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 1
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 1
- 102000010789 Interleukin-2 Receptors Human genes 0.000 description 1
- 108010038453 Interleukin-2 Receptors Proteins 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 108010059881 Lactase Proteins 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- 208000018142 Leiomyosarcoma Diseases 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- 108010064171 Lysosome-Associated Membrane Glycoproteins Proteins 0.000 description 1
- 102000014944 Lysosome-Associated Membrane Glycoproteins Human genes 0.000 description 1
- 108010059343 MM Form Creatine Kinase Proteins 0.000 description 1
- 108700036248 MT-RNR1 Proteins 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 108010038049 Mating Factor Proteins 0.000 description 1
- 208000007054 Medullary Carcinoma Diseases 0.000 description 1
- 208000000172 Medulloblastoma Diseases 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 206010027406 Mesothelioma Diseases 0.000 description 1
- 101710201349 Metallothionein B Proteins 0.000 description 1
- 102100031347 Metallothionein-2 Human genes 0.000 description 1
- 101710094505 Metallothionein-2 Proteins 0.000 description 1
- 102100025825 Methylated-DNA-protein-cysteine methyltransferase Human genes 0.000 description 1
- 108060004795 Methyltransferase Proteins 0.000 description 1
- 102000016397 Methyltransferase Human genes 0.000 description 1
- 108020005196 Mitochondrial DNA Proteins 0.000 description 1
- 241000713333 Mouse mammary tumor virus Species 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- 108010079364 N-glycylalanine Proteins 0.000 description 1
- 125000000729 N-terminal amino-acid group Chemical group 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 201000010133 Oligodendroglioma Diseases 0.000 description 1
- 108010067372 Pancreatic elastase Proteins 0.000 description 1
- 102000016387 Pancreatic elastase Human genes 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 241001631646 Papillomaviridae Species 0.000 description 1
- 241000237988 Patellidae Species 0.000 description 1
- 102000012288 Phosphopyruvate Hydratase Human genes 0.000 description 1
- 108010022181 Phosphopyruvate Hydratase Proteins 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 108010053210 Phycocyanin Proteins 0.000 description 1
- 208000007641 Pinealoma Diseases 0.000 description 1
- 102000010780 Platelet-Derived Growth Factor Human genes 0.000 description 1
- 108010038512 Platelet-Derived Growth Factor Proteins 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 108091036407 Polyadenylation Proteins 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 229920000037 Polyproline Polymers 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 108010071690 Prealbumin Proteins 0.000 description 1
- 102000007584 Prealbumin Human genes 0.000 description 1
- 206010036790 Productive cough Diseases 0.000 description 1
- 102100036691 Proliferating cell nuclear antigen Human genes 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 108010071563 Proto-Oncogene Proteins c-fos Proteins 0.000 description 1
- 102000007568 Proto-Oncogene Proteins c-fos Human genes 0.000 description 1
- 108010087705 Proto-Oncogene Proteins c-myc Proteins 0.000 description 1
- 102000009092 Proto-Oncogene Proteins c-myc Human genes 0.000 description 1
- 101100408135 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) phnA gene Proteins 0.000 description 1
- CZPWVGJYEJSRLH-UHFFFAOYSA-N Pyrimidine Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 description 1
- 108091034057 RNA (poly(A)) Proteins 0.000 description 1
- 108010009460 RNA Polymerase II Proteins 0.000 description 1
- 102000009572 RNA Polymerase II Human genes 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 238000010240 RT-PCR analysis Methods 0.000 description 1
- 102000004879 Racemases and epimerases Human genes 0.000 description 1
- 108090001066 Racemases and epimerases Proteins 0.000 description 1
- 101000702488 Rattus norvegicus High affinity cationic amino acid transporter 1 Proteins 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- 108700025701 Retinoblastoma Genes Proteins 0.000 description 1
- 206010038997 Retroviral infections Diseases 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 101100111629 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) KAR2 gene Proteins 0.000 description 1
- 201000010208 Seminoma Diseases 0.000 description 1
- 108091081021 Sense strand Proteins 0.000 description 1
- 239000012506 Sephacryl® Substances 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-N Thiophosphoric acid Chemical class OP(O)(S)=O RYYWUUFWQRZTIU-UHFFFAOYSA-N 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 102000013394 Troponin I Human genes 0.000 description 1
- 108010065729 Troponin I Proteins 0.000 description 1
- GLNADSQYFUSGOU-GPTZEZBUSA-J Trypan blue Chemical compound [Na+].[Na+].[Na+].[Na+].C1=C(S([O-])(=O)=O)C=C2C=C(S([O-])(=O)=O)C(/N=N/C3=CC=C(C=C3C)C=3C=C(C(=CC=3)\N=N\C=3C(=CC4=CC(=CC(N)=C4C=3O)S([O-])(=O)=O)S([O-])(=O)=O)C)=C(O)C2=C1N GLNADSQYFUSGOU-GPTZEZBUSA-J 0.000 description 1
- 230000006750 UV protection Effects 0.000 description 1
- 108091023045 Untranslated Region Proteins 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 208000014070 Vestibular schwannoma Diseases 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 208000004064 acoustic neuroma Diseases 0.000 description 1
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 239000011149 active material Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 230000001476 alcoholic effect Effects 0.000 description 1
- 150000001299 aldehydes Chemical class 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 230000002152 alkylating effect Effects 0.000 description 1
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 1
- 102000015395 alpha 1-Antitrypsin Human genes 0.000 description 1
- 108010050122 alpha 1-Antitrypsin Proteins 0.000 description 1
- 229940024142 alpha 1-antitrypsin Drugs 0.000 description 1
- 102000004139 alpha-Amylases Human genes 0.000 description 1
- 108090000637 alpha-Amylases Proteins 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
- 102000013529 alpha-Fetoproteins Human genes 0.000 description 1
- 108010026331 alpha-Fetoproteins Proteins 0.000 description 1
- 229940024171 alpha-amylase Drugs 0.000 description 1
- VREFGVBLTWBCJP-UHFFFAOYSA-N alprazolam Chemical compound C12=CC(Cl)=CC=C2N2C(C)=NN=C2CN=C1C1=CC=CC=C1 VREFGVBLTWBCJP-UHFFFAOYSA-N 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 239000012491 analyte Substances 0.000 description 1
- 238000012443 analytical study Methods 0.000 description 1
- 229940030486 androgens Drugs 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- 230000005775 apoptotic pathway Effects 0.000 description 1
- 239000008365 aqueous carrier Substances 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- JPIYZTWMUGTEHX-UHFFFAOYSA-N auramine O free base Chemical compound C1=CC(N(C)C)=CC=C1C(=N)C1=CC=C(N(C)C)C=C1 JPIYZTWMUGTEHX-UHFFFAOYSA-N 0.000 description 1
- 230000003305 autocrine Effects 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 108010028263 bacteriophage T3 RNA polymerase Proteins 0.000 description 1
- 102000006635 beta-lactamase Human genes 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- 210000000941 bile Anatomy 0.000 description 1
- 239000003613 bile acid Substances 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 201000001531 bladder carcinoma Diseases 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 208000003362 bronchogenic carcinoma Diseases 0.000 description 1
- AIYUHDOJVYHVIT-UHFFFAOYSA-M caesium chloride Chemical compound [Cl-].[Cs+] AIYUHDOJVYHVIT-UHFFFAOYSA-M 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- BPKIGYQJPYCAOW-FFJTTWKXSA-I calcium;potassium;disodium;(2s)-2-hydroxypropanoate;dichloride;dihydroxide;hydrate Chemical compound O.[OH-].[OH-].[Na+].[Na+].[Cl-].[Cl-].[K+].[Ca+2].C[C@H](O)C([O-])=O BPKIGYQJPYCAOW-FFJTTWKXSA-I 0.000 description 1
- 150000004657 carbamic acid derivatives Chemical class 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 125000003917 carbamoyl group Chemical group [H]N([H])C(*)=O 0.000 description 1
- 125000000837 carbohydrate group Chemical group 0.000 description 1
- 150000004649 carbonic acid derivatives Chemical class 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 229920003064 carboxyethyl cellulose Polymers 0.000 description 1
- 230000021523 carboxylation Effects 0.000 description 1
- 238000006473 carboxylation reaction Methods 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 108091092328 cellular RNA Proteins 0.000 description 1
- 230000030570 cellular localization Effects 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 238000002144 chemical decomposition reaction Methods 0.000 description 1
- 239000005081 chemiluminescent agent Substances 0.000 description 1
- 230000000973 chemotherapeutic effect Effects 0.000 description 1
- 235000013330 chicken meat Nutrition 0.000 description 1
- 229960002424 collagenase Drugs 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 238000004440 column chromatography Methods 0.000 description 1
- 229940046044 combinations of antineoplastic agent Drugs 0.000 description 1
- 230000000536 complexating effect Effects 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- WZHCOOQXZCIUNC-UHFFFAOYSA-N cyclandelate Chemical compound C1C(C)(C)CC(C)CC1OC(=O)C(O)C1=CC=CC=C1 WZHCOOQXZCIUNC-UHFFFAOYSA-N 0.000 description 1
- UPUOLJWYFICKJI-UHFFFAOYSA-N cyclobutane;pyrimidine Chemical compound C1CCC1.C1=CN=CN=C1 UPUOLJWYFICKJI-UHFFFAOYSA-N 0.000 description 1
- 150000001930 cyclobutanes Chemical class 0.000 description 1
- 208000002445 cystadenocarcinoma Diseases 0.000 description 1
- UHDGCWIWMRVCDJ-ZAKLUEHWSA-N cytidine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-ZAKLUEHWSA-N 0.000 description 1
- 229960000640 dactinomycin Drugs 0.000 description 1
- 230000009849 deactivation Effects 0.000 description 1
- 238000000432 density-gradient centrifugation Methods 0.000 description 1
- 239000005549 deoxyribonucleoside Substances 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 230000003831 deregulation Effects 0.000 description 1
- 229960003957 dexamethasone Drugs 0.000 description 1
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- 238000012631 diagnostic technique Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- QONQRTHLHBTMGP-UHFFFAOYSA-N digitoxigenin Natural products CC12CCC(C3(CCC(O)CC3CC3)C)C3C11OC1CC2C1=CC(=O)OC1 QONQRTHLHBTMGP-UHFFFAOYSA-N 0.000 description 1
- SHIBSTMRCDJXLN-KCZCNTNESA-N digoxigenin Chemical compound C1([C@@H]2[C@@]3([C@@](CC2)(O)[C@H]2[C@@H]([C@@]4(C)CC[C@H](O)C[C@H]4CC2)C[C@H]3O)C)=CC(=O)OC1 SHIBSTMRCDJXLN-KCZCNTNESA-N 0.000 description 1
- 108020001096 dihydrofolate reductase Proteins 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 230000003467 diminishing effect Effects 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 230000009429 distress Effects 0.000 description 1
- NAGJZTKCGNOGPW-UHFFFAOYSA-N dithiophosphoric acid Chemical class OP(O)(S)=S NAGJZTKCGNOGPW-UHFFFAOYSA-N 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 238000007878 drug screening assay Methods 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 210000001671 embryonic stem cell Anatomy 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 230000009144 enzymatic modification Effects 0.000 description 1
- 239000002532 enzyme inhibitor Substances 0.000 description 1
- YJGVMLPVUAXIQN-UHFFFAOYSA-N epipodophyllotoxin Natural products COC1=C(OC)C(OC)=CC(C2C3=CC=4OCOC=4C=C3C(O)C3C2C(OC3)=O)=C1 YJGVMLPVUAXIQN-UHFFFAOYSA-N 0.000 description 1
- 208000037828 epithelial carcinoma Diseases 0.000 description 1
- 210000003617 erythrocyte membrane Anatomy 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- HQPMKSGTIOYHJT-UHFFFAOYSA-N ethane-1,2-diol;propane-1,2-diol Chemical compound OCCO.CC(O)CO HQPMKSGTIOYHJT-UHFFFAOYSA-N 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 229940093470 ethylene Drugs 0.000 description 1
- 229940117927 ethylene oxide Drugs 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 235000013861 fat-free Nutrition 0.000 description 1
- 150000002190 fatty acyls Chemical group 0.000 description 1
- 239000012894 fetal calf serum Substances 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 238000000799 fluorescence microscopy Methods 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 125000001153 fluoro group Chemical group F* 0.000 description 1
- 238000013467 fragmentation Methods 0.000 description 1
- 238000006062 fragmentation reaction Methods 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 231100000118 genetic alteration Toxicity 0.000 description 1
- 230000004077 genetic alteration Effects 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 231100000025 genetic toxicology Toxicity 0.000 description 1
- 230000001738 genotoxic effect Effects 0.000 description 1
- 231100000734 genotoxic potential Toxicity 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000011491 glass wool Substances 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- BEBCJVAWIBVWNZ-UHFFFAOYSA-N glycinamide Chemical group NCC(N)=O BEBCJVAWIBVWNZ-UHFFFAOYSA-N 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 239000003630 growth substance Substances 0.000 description 1
- 101150028578 grp78 gene Proteins 0.000 description 1
- 229940029575 guanosine Drugs 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 201000002222 hemangioblastoma Diseases 0.000 description 1
- 238000007490 hematoxylin and eosin (H&E) staining Methods 0.000 description 1
- 108060003552 hemocyanin Proteins 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 238000013537 high throughput screening Methods 0.000 description 1
- 239000004030 hiv protease inhibitor Substances 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 230000005745 host immune response Effects 0.000 description 1
- 102000054896 human PML Human genes 0.000 description 1
- 230000028996 humoral immune response Effects 0.000 description 1
- 229930195733 hydrocarbon Natural products 0.000 description 1
- 150000002430 hydrocarbons Chemical class 0.000 description 1
- 235000011167 hydrochloric acid Nutrition 0.000 description 1
- 239000000017 hydrogel Substances 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 150000004679 hydroxides Chemical class 0.000 description 1
- 150000002460 imidazoles Chemical class 0.000 description 1
- 210000001822 immobilized cell Anatomy 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 238000010324 immunological assay Methods 0.000 description 1
- 238000013198 immunometric assay Methods 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 238000012296 in situ hybridization assay Methods 0.000 description 1
- 239000011261 inert gas Substances 0.000 description 1
- 239000012678 infectious agent Substances 0.000 description 1
- 230000001524 infective effect Effects 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 150000007529 inorganic bases Chemical class 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 238000007914 intraventricular administration Methods 0.000 description 1
- 230000009545 invasion Effects 0.000 description 1
- JJWLVOIRVHMVIS-UHFFFAOYSA-N isopropylamine Chemical compound CC(C)N JJWLVOIRVHMVIS-UHFFFAOYSA-N 0.000 description 1
- 238000011005 laboratory method Methods 0.000 description 1
- 229940116108 lactase Drugs 0.000 description 1
- 150000002596 lactones Chemical class 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 206010024627 liposarcoma Diseases 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 231100000053 low toxicity Toxicity 0.000 description 1
- HWYHZTIRURJOHG-UHFFFAOYSA-N luminol Chemical compound O=C1NNC(=O)C2=C1C(N)=CC=C2 HWYHZTIRURJOHG-UHFFFAOYSA-N 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 208000037829 lymphangioendotheliosarcoma Diseases 0.000 description 1
- 208000012804 lymphangiosarcoma Diseases 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 238000010841 mRNA extraction Methods 0.000 description 1
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 230000000873 masking effect Effects 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 208000023356 medullary thyroid gland carcinoma Diseases 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 206010027191 meningioma Diseases 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 108040008770 methylated-DNA-[protein]-cysteine S-methyltransferase activity proteins Proteins 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 239000000693 micelle Substances 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 210000003470 mitochondria Anatomy 0.000 description 1
- 230000002438 mitochondrial effect Effects 0.000 description 1
- 239000002991 molded plastic Substances 0.000 description 1
- 210000005087 mononuclear cell Anatomy 0.000 description 1
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 1
- 210000004877 mucosa Anatomy 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 230000003387 muscular Effects 0.000 description 1
- 108700024542 myc Genes Proteins 0.000 description 1
- 208000001611 myxosarcoma Diseases 0.000 description 1
- 210000001989 nasopharynx Anatomy 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- 231100000957 no side effect Toxicity 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- 239000012457 nonaqueous media Substances 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 238000007826 nucleic acid assay Methods 0.000 description 1
- 238000001216 nucleic acid method Methods 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 150000002894 organic compounds Chemical class 0.000 description 1
- 150000002895 organic esters Chemical class 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 201000008968 osteosarcoma Diseases 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 150000003891 oxalate salts Chemical class 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 238000012856 packing Methods 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 208000004019 papillary adenocarcinoma Diseases 0.000 description 1
- 230000003076 paracrine Effects 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 229940056360 penicillin g Drugs 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 210000003200 peritoneal cavity Anatomy 0.000 description 1
- 102000013415 peroxidase activity proteins Human genes 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 150000004713 phosphodiesters Chemical class 0.000 description 1
- 235000011007 phosphoric acid Nutrition 0.000 description 1
- 150000003016 phosphoric acids Chemical class 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 208000024724 pineal body neoplasm Diseases 0.000 description 1
- 201000004123 pineal gland cancer Diseases 0.000 description 1
- 210000002826 placenta Anatomy 0.000 description 1
- 238000013492 plasmid preparation Methods 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- YJGVMLPVUAXIQN-XVVDYKMHSA-N podophyllotoxin Chemical compound COC1=C(OC)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@H](O)[C@@H]3[C@@H]2C(OC3)=O)=C1 YJGVMLPVUAXIQN-XVVDYKMHSA-N 0.000 description 1
- 229960001237 podophyllotoxin Drugs 0.000 description 1
- YVCVYCSAAZQOJI-UHFFFAOYSA-N podophyllotoxin Natural products COC1=C(O)C(OC)=CC(C2C3=CC=4OCOC=4C=C3C(O)C3C2C(OC3)=O)=C1 YVCVYCSAAZQOJI-UHFFFAOYSA-N 0.000 description 1
- 231100000614 poison Toxicity 0.000 description 1
- 229920001993 poloxamer 188 Polymers 0.000 description 1
- 229920000191 poly(N-vinyl pyrrolidone) Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920001583 poly(oxyethylated polyols) Polymers 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229920000447 polyanionic polymer Polymers 0.000 description 1
- 229920000573 polyethylene Polymers 0.000 description 1
- 229920002704 polyhistidine Polymers 0.000 description 1
- 239000004626 polylactic acid Substances 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 108010026466 polyproline Proteins 0.000 description 1
- 229920001451 polypropylene glycol Polymers 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910000160 potassium phosphate Inorganic materials 0.000 description 1
- 235000011009 potassium phosphates Nutrition 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 239000002987 primer (paints) Substances 0.000 description 1
- 230000001566 pro-viral effect Effects 0.000 description 1
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 1
- 229960004919 procaine Drugs 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- XJMOSONTPMZWPB-UHFFFAOYSA-M propidium iodide Chemical compound [I-].[I-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CCC[N+](C)(CC)CC)=C1C1=CC=CC=C1 XJMOSONTPMZWPB-UHFFFAOYSA-M 0.000 description 1
- 238000012342 propidium iodide staining Methods 0.000 description 1
- 125000006239 protecting group Chemical group 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 238000000751 protein extraction Methods 0.000 description 1
- 230000009145 protein modification Effects 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 239000001397 quillaja saponaria molina bark Substances 0.000 description 1
- 150000003254 radicals Chemical class 0.000 description 1
- 239000000700 radioactive tracer Substances 0.000 description 1
- 230000003439 radiotherapeutic effect Effects 0.000 description 1
- 229920005604 random copolymer Polymers 0.000 description 1
- 238000011552 rat model Methods 0.000 description 1
- 239000011535 reaction buffer Substances 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 230000014493 regulation of gene expression Effects 0.000 description 1
- 230000037425 regulation of transcription Effects 0.000 description 1
- 238000009877 rendering Methods 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 230000001850 reproductive effect Effects 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 208000023504 respiratory system disease Diseases 0.000 description 1
- 230000004043 responsiveness Effects 0.000 description 1
- 229930002330 retinoic acid Natural products 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 239000002342 ribonucleoside Substances 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 238000007363 ring formation reaction Methods 0.000 description 1
- 229940102127 rubidium chloride Drugs 0.000 description 1
- 229930182490 saponin Natural products 0.000 description 1
- 150000007949 saponins Chemical class 0.000 description 1
- 238000007423 screening assay Methods 0.000 description 1
- 201000008407 sebaceous adenocarcinoma Diseases 0.000 description 1
- 238000005204 segregation Methods 0.000 description 1
- 208000002491 severe combined immunodeficiency Diseases 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 238000009097 single-agent therapy Methods 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- HRZFUMHJMZEROT-UHFFFAOYSA-L sodium disulfite Chemical compound [Na+].[Na+].[O-]S(=O)S([O-])(=O)=O HRZFUMHJMZEROT-UHFFFAOYSA-L 0.000 description 1
- 229940001584 sodium metabisulfite Drugs 0.000 description 1
- 235000010262 sodium metabisulphite Nutrition 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 210000004989 spleen cell Anatomy 0.000 description 1
- 238000012453 sprague-dawley rat model Methods 0.000 description 1
- 210000003802 sputum Anatomy 0.000 description 1
- 208000024794 sputum Diseases 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000003153 stable transfection Methods 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 229960002385 streptomycin sulfate Drugs 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 201000010965 sweat gland carcinoma Diseases 0.000 description 1
- 230000001360 synchronised effect Effects 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 206010042863 synovial sarcoma Diseases 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 229940037128 systemic glucocorticoids Drugs 0.000 description 1
- MPLHNVLQVRSVEE-UHFFFAOYSA-N texas red Chemical compound [O-]S(=O)(=O)C1=CC(S(Cl)(=O)=O)=CC=C1C(C1=CC=2CCCN3CCCC(C=23)=C1O1)=C2C1=C(CCC1)C3=[N+]1CCCC3=C2 MPLHNVLQVRSVEE-UHFFFAOYSA-N 0.000 description 1
- 238000011285 therapeutic regimen Methods 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 239000008181 tonicity modifier Substances 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 239000003440 toxic substance Substances 0.000 description 1
- 210000003437 trachea Anatomy 0.000 description 1
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 1
- 229910052723 transition metal Inorganic materials 0.000 description 1
- 150000003624 transition metals Chemical class 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- PYHOFAHZHOBVGV-UHFFFAOYSA-N triazane Chemical compound NNN PYHOFAHZHOBVGV-UHFFFAOYSA-N 0.000 description 1
- 239000001226 triphosphate Substances 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 101150044170 trpE gene Proteins 0.000 description 1
- 230000005760 tumorsuppression Effects 0.000 description 1
- 238000010798 ubiquitination Methods 0.000 description 1
- 230000034512 ubiquitination Effects 0.000 description 1
- 238000005199 ultracentrifugation Methods 0.000 description 1
- 229940035893 uracil Drugs 0.000 description 1
- 208000010570 urinary bladder carcinoma Diseases 0.000 description 1
- 238000002255 vaccination Methods 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 229960001722 verapamil Drugs 0.000 description 1
- 230000006648 viral gene expression Effects 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4747—Apoptosis related proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2799/00—Uses of viruses
- C12N2799/02—Uses of viruses as vector
- C12N2799/021—Uses of viruses as vector for the expression of a heterologous nucleic acid
- C12N2799/022—Uses of viruses as vector for the expression of a heterologous nucleic acid where the vector is derived from an adenovirus
Definitions
- This invention provides isolated nucleic acids of p-Hyde genes, proteins, analogs, fragments, mimetics, mutants, synthetics, and variants thereof of the p-Hyde family. This invention is directed to a method of inducing susceptibility to apoptosis with p-Hyde, a method of suppressing tumor growth with p-Hyde, and a method of treating a subject with cancer with p-Hyde alone or in combination with radiation, chemotherapy, or UV mimetic drugs.
- Prostate cancer is the most common malignancy in men with over 317,000 new cases and the second leading cause of male cancer deaths in the United States (Boring et al., 1993; Steiner et. al, 1 95).
- the molecular mechanisms responsible for the development, progression, and metastasis of prostate cancer remain largely unknown. Up to 20% of prostate cancers occur in men under the age of 65 years of age (Silverberg, 1986) suggesting that prostate carcinogenesis is not only associated with aging, but also to hereditary factors (Silverberg, 1987; McLellan and Norman, 1995; Carter et al., 1992).
- prostate cancer formation is a multistep process involving tumor initiation, promotion, conversion, and progression (Carter et al., 1990f Sandberg, 1992). This process is driven by chromosomal instability, spontaneous mutations, and carcinogen induced genetic and epigenetic changes. Chromosomal instability leads to the total or partial gain or loss of chromosomes, translocations, and other abnormalities. Spontaneous mechanisms are age-related and include activation of oncogenes or inactivation of tumor suppressor genes by genetic mutations.
- mutations result in the misincorporation of nucleotides during DNA replication of the coding region, alteration of the intron-exon junction sequences affecting the splicing mechanism, and aberrations of regulatory sequences changing the control of critical genes.
- mutations escape genetic surveillance by a battery of DNA repair mechanisms and its associated gene products, such as p53 (Effert et al., 1992, Isaacs et al, 1 91 ; Mellon et al , 1992) and p2t (El-Deiry et al., 1994) and PCNA (Te pleton et al., 1996).
- Carcinogen-induced genetic and epigenetic changes initiate tumors as a consequence of the direct damaging effects of carcinogenic agents of the DNA altering gene expression. Tumor initiation is subsequently followed by tumor promotion as affected cells have selective reproductive and clonal expansion capabilities through altered signaling transduction and proliferation responses to growth factors, resistance to cytotoxicity, and deregulation of termmal differentiation (Yuspa and Poi ⁇ er, 1988; einstein, 1987). Finally, tumor promotion is succeeded by other genetic mutational events that lead to loss of hormone sensitivity, increased cell motiJity, invasion, alterations in programmed cell death and metastasis.
- the initiation and progression of cancer is a multistep process whereby genetic alterations or mutations of critical genes ultimately dictate defined cell phenotypes which differ in regard to many important cellular activities including cell proliferation, differentiation, and programmed cell death.
- the exact mutational events responsible for the multistep progression of prostate cancer is unknown.
- a better understanding of the molecular mechanisms responsible for prostate cancer may lead to new therapies to combat, and perhaps, to even prevent prostate cancer
- the present invention provides isolated nucleic acids encoding P-Hyde genes of tire p-Hyde family.
- the p-Hyde gene as shown herein is associated with: (1) the regression of tumor growth in vivo (2) the induction to susceptibility to apoptosis caused by UV or chemotherapy induced DNA damage, and (3) prevention of DNA repair with the upregulation of apoptosis as the result of UV da age and the failure to repair DNA.
- This invention provides a novel class of genes which act as inhibitor of a DNA repair enzyme and induce susceptibility of cancer cells to cell death. Also, this invention provides isolated nucleic acids which encodes a mammalian p-Hyde protein which induce susceptibility of a cancer cell to cell death, including allelic, analogs, fragments, mimetics, mutants, synthetics, or variants tliereof. This invention provides an isolated nucleic acids which encodes a human p-Hyde protein which induces susceptibility of a cancer cell to cell death, including allelic, analogs, fragments, mimetics, mutants, synthetics, or variants thereof.
- nucleic acid which has the nucleotide sequence as shown SEQ ID NO: 1 , SEQ ID NO: 3, SEQ ID NO.5, SEQ ID NO:7 or SEQ ID NO:9.
- nucleic acid molecule which encodes a fragment of a polypeptide having the amino acid sequence of SEQ ID NO: 2, SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8 or SEQ ID NO: 10, the fragment including at least 15 (25, 30, 50, 60, or 63) contiguous amino acids of SEQ ID NO 2, SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8 or SEQ ID NO 10.
- nucleic acid molecule having the nucleotide sequence which is at least about 82%, 84%, 85%, 87%, 90%, 92%, 95%, or 98% identical to the nucleic acid sequence as shown in SEQ ID NO. 1 , SEQ ID NO: 3, SEQ ID NO:5, SEQ ID NO:7 or SEQ ID NO: 9.
- nucleic acid molecule which encodes a naturally occurring allelic variant of a polypeptide comprising the amino acid sequence of SEQ ID NO: 2, SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8, or SEQ ID NO 10 wherein the nucleic acid molecule hybridizes to a nucleic acid molecule comprising SEQ ID NO: 2, SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8 or SEQ ID NO 10 or the complement thereof under stringent conditions.
- isolated p-Hyde proteins having an amino acid sequence that is at least about 82%. 84%, 85%, 87%, 90%, 95%, or 98% identical to the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO:5, SEQ ID NO:7 or SEQ ID NO 9.
- an isolated p-Hyde protein protein which is encoded by a nucleic acid molecule having a nucleotide sequence that is at least about 65%, preferably 75%, 80%, 85%, or 95% identical to SEQ ID NO: _ , SEQ TD NO: 3, SEQ ID NO:5, SEQ ID NO:7 or SEQ ID NO 9; and an isolated p-Hyde protein protein which is encoded by a nucleic acid molecule having a nucleotide sequence which hybridizes under stringent hybridization conditions to a nucleic acid molecule having the nucleotide sequence of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO.5, SEQ ID NO:7 or SEQ ID NO 9, or the complement thereof.
- the p-Hyde protein of the present invention can be operably linked to a non- p-Hyde polypeptide (e.g., heterologous amino acid sequences) to form p-Hydc fusion proteins.
- a non- p-Hyde polypeptide e.g., heterologous amino acid sequences
- This invention provides a vector comprising the isolated nucleic acid encoding P-Hyde gene.
- This invention provides a replication-defective recombinant E1/ ⁇ 3 deleted adenovirus containing a truncated RSV promoter and the P-Hyde cDNA gene (AdRSVpHyde).
- This invention provides an oligonucleotide of at least 15 nucleotides capable of specifically hybridizing with a sequence of nucleotides present within a nucleic acid which encodes the p-Hyde, or a sequence which is complementary to the nucleic acid which encodes the p-Hyde.
- This invention provides an antisense molecule, triplex oligonucleotide, or ribozyme which is capable of specifically hybridizing with the isolated nucleic acid encoding p-Hyde.
- This invention provides a method for producing a polypeptide which comprises growing the host vector system under suitable conditions permitting production of the polypeptide and recovering the polypeptide so produced.
- the method of obtaining a polypeptide in purified form comprises: (a) introducing the vector into a suitable host cell; (b) culturing the resulting cell so as to produce the polypeptide; (c) recovering the polypeptide produced in step (b); and (d) purifying the polypeptide so recovered.
- This invention provides a polypeptide comprising the amino acid sequence of a p-Hyde.
- This invention provides a fusion protein or chimeric comprising the polypeptide.
- This invention provides an antibody which specifically binds to the polypeptide.
- This invention provides a pharmaceutical composition comprising an amount of the polypeptide and a pharmaceutically effective carrier or diluent.
- This invention provides a method for determining whether a subject carries a mutation in the p-Hyde gene which comprises: (a) obtaining an appropriate nucleic acid sample from the subject; and (b) determining whether the nucleic acid sample from step (a) is, or is derived from, a nucleic acid which encodes mutant p-Hyde so as to thereby determine whether a subject carries a mutation in the p-Hyde gene.
- the nucleic acid sample in step (a) comprises mRNA corresponding to the transcript of DNA encoding a mutant p-Hyde
- the determining of step (b) comprises: (i) contacting the mRNA with the oligonucleotide under conditions permitting binding of the mRNA to the oligonucleotide so as to form a complex; (ii) isolating the complex so formed; and (iii) identifying the mRNA in the isolated complex so as to thereby determine whether the mRNA is, or is derived from, a nucleic acid which encodes mutant p-Hyde.
- This invention provides a method for screening a tumor sample from a human subject for a somatic alteration in a p-Hyde gene in said tumor which comprises gene comparing a first sequence selected form the group consisting of a p-Hyde gene from said tumor sample, p-Hyde RNA from said tumor sample and p-Hyde cDNA made from mRNA from said tumor sample with a second sequence selected from the group consisting of p-Hyde gene from a nontumor sample of said subject, p-Hyde RNA from said nontumor sample and p-Hyde cDNA made from mRNA from said nontumor sample, wherein a difference in the sequence of the p-Hyde gene, ⁇ -Hyde RNA or p-Hyde cDNA from said tumor sample from the sequence of the p-Hyde gene, p-Hyde RNA or p-Hyde cDNA from said nontumor sample indicates a somatic alteration in the
- This invention provides a method for screening a tumor sample from a human subject for the presence of a somatic alteration in a p-Hyde gene in said tumor which comprises comparing p-Hyde polypeptide from said tumor sample from said subject to p-Hyde polypeptide from a nontumor sample from said subject to analyze for a difference between the polypeptides, wherein said comparing is perfo ⁇ ned by (i) detecting either a full length polypeptide or a truncated polypeptide in each sample or (ii) contacting an antibody which specifically binds to either an epitope of an altered p-Hyde polypeptide or an epitope of a wild-type p-Hyde polypeptide to the p-Hyde polypeptide from each sample and detecting antibody binding, wherein a difference between the p-Hyde polypeptide from said tumor sample from the p-Hyde polypeptide from said nontumor sample indicates the presence of a somatic alter
- This invention provides a method for identifyirig a chemical compound which is capable inducing susceptibility to cell death which comprises: (a) contacting the p-Hyde with a chemical compound under conditions permitting binding between the p-Hyde and the chemical compound;(b) detecting specific binding of the chemical compound to the p-Hyde; and (c) determining whether the chemical compound inhibits the p-Hyde so as to identify a chemical compound which is capable of capable inducing susceptibility to cell death.
- This invention provides a method of inhibiting the growth of cancer cells, comprising the steps of obtaining the cells and contacting the cells of the subject with a replication-deficient adenovirus type 5 expression vector comprising air adenovirus genome having a deletion m the El and E3 region of the genome and an insertion within the region of a nucleic acid encoding p-Hyde under the control of a Rous Sarcoma virus promoter, thereby inhibiting the growth of tire prostate cancer cells.
- This invention provides a method of inhibiting the growth a prostate cancer cells, comprising: 1) obtaining a sample of prostate cells from a subject; 2) contacting the cells with a replication deficient adenovirus type 5 expression vector which comprises an adenovirus genome having a deletion in the El and E3 regions of the genome and an insertion within the regions of a p-Hyde cDNA under the control of a Rous Sarcoma virus promoter; and 3) introducing the cells into the subject, thereby inhibiting the growth of the cancer cells.
- This invention provides a method of suppressing the growth of cancer cells in a subject. comprising introducing mto the cancer cell an amount of a nucleic acid encoding a p-Hyde protein, a nucleic acid encoding a fragment of p-Hyde protein, or the nucleic acid encoding a mutant p-Hyde protein, thereby suppressing the growth of cancer cells in the subject.
- This invention provides a method of suppressing growth of cancer cells in a subject, comprising administering to the subject a pharmaceutical composition comprising a therapeutically effective amount of a nucleic acid encoding a p-Hyde protein, a nucleic acid encoding a fragment of p-Hyde protein, or the nucleic acid encoding a mutant p-Hyde protein and a pharmaceutical acceptable carrier or diluent, thereby suppressing the growth of cancer cells in the subject.
- This invention provides a method of inducing susceptibility to apoptosis of cancer cells in a subject, comprising introducing into the cancer cell an amount of a nucleic acid encoding a p-Hyde protein, a nucleic acid encoding a fragment of p-Hyde protein, or the nucleic acid encoding a mutant p-Hyde protein, thereby inducing susceptibility to apoptosis .
- This invention provides a method of inducing susceptibility to apoptosis of cancer cells in a subject, comprising admmistering to the subject a pharmaceutical composition comprising a therapeutically effective amount of a nucleic acid encoding a p-Hyde protein, a nucleic acid encoding a fragment of p-Hyde protein, or the nucleic acid encoding a mutant p-Hyde protein and a pharmaceutical acceptable carrier or diluent, thereby inducing susceptibility to apoptosis.
- This invention provides a method of treating a subject with cancer which comprises administering to the subject a pharmaceutical composition comprising a therapeutically effective amount of a nucleic acid encoding a p-Hyde protein, a nucleic acid encoding a fragment of p-Hyde protein, or the nucleic acid encoding a mutant p-Hyde protein and a phainiaceuticai acceptable carrier or diluent, thereby treating the subject with cancer.
- This invention provides a method of treating a subject with cancer, comprising: 1) administering to the subject a pharmaceutical composition comprising a therapeutically effective amount of a nucleic acid encoding a p-Hyde protein, a nucleic acid encoding a fragment of p-Hyde protein, or the nucleic acid encoding a mutant p-Hyde protein in combination with radiation, chemotherapy, or UV mimetic drugs; and 2) a pharmaceutical acceptable carrier or diluent, thereby treating the subject with cancer.
- This invention a method of treating a subject with cancer, comprising administering to the subject a therapeutically effective amount of a pharmaceutical composition
- a pharmaceutical composition comprising: 1 ) an adenovirus type 5 expression vector which comprises an adenovirus genome having a deletion in the El and E3 regions of the genome and an insertion withm the regions of a full length sense p-Hyde cDNA under the control of a Rous Sarcoma virus promoter, and 2) a suitable carrier or diluent, thereby treating the subject with cancer
- tire cancer is selected from a group consisting of. melanoma; lymphoma, leukemia; and prostate, colorectal, pancreatic, breast, brain, or gastric carcinoma.
- the present invention provides the means necessary for production of gene-based therapies directed at cancer cells.
- These therapeutic agents may take the form of polynucleotides comprising all or a portion of the p-Hyde locus placed in appropriate vectors or delivered to target cells in more direct ways such that the function of the p-Hyde protein is reconstituted.
- Therapeutic agents may also take the form of polypeptides based on either a portion of, or the entire proteui sequence of p-Hyde. These may functionally replace the activity of p-Hyde in vivo.
- FIG 1 Schematic presentation of AdRSVpHyde structure.
- the 2664 bp inserted fragment contains a 1467 bp full-length pl yde cDNA gene (SEQ ID NO: 1) and 1 166 bp 3' untranslated downstream region.
- SEQ ID NO: 1 The complete sequence of AdRSVpHyde is set forth in Figure 10, Specifically, the nucleic acid sequence of region A in Figure 1 is set forth in Figure 10 Region A and the nucleic acid sequence of region B in Figure 1 is set forth in Figure 1 0 at Region B.
- FIG. 1 Expression of pHydc by AdRSVpHyde.
- DU145 cells transduced by AdRSVpHyde at MOI-200 were harvested in 48 h post infection for either mRNA or protein extraction.
- A Expression of pHyde at mRNA level in DU145 cells. Sample wells were each loaded with 10 mg of total RNA, electrophoresed in 12.5% agarose gel, transferred to nylon membrane, and hybridized with j2 P-labeled pHyde cDNA. Northern blot was stripped and rehybridized with GAPDH to assess gel loading.
- B Expression of pHyde at protein level in DU145 cells. Protein extracts (50 mg) were loaded on a 12% SDS-PAGE gel. Rabbit anti-rat pHyde antibody was used as the primary antibody.
- tumors were injected subcutaneously into the flanks of nude mice.
- tumors were untreated (control), or intratumorally injected (day 0) either by 5x10 9 pfu control virus AdRSVlacZ (control virus), or 5x10 9 pfu AdRSVpHyde (AdRSVpHyde).
- AdRSVpHyde 5x10 9 pfu AdRSVpHyde
- FIG. 6 Morphological changes of PC-3, TSU, and PPC-1 cells transduced by AdRSVpHyde.
- the morphologic features of untreated control cells and viral -transduced cells were recorded at day 5 post viral transduction. All the photos are at the same magnification (66X).
- A, D, G Untreated control cells
- B, E, H Viral control AdRSVlacZ treated cells
- C, F, I AdRSVpHyde treated cells.
- Figure 7 Expression of p53 and Rb mRNA in various prostate cancer cell lines.
- RNA samples were each loaded with 10 mg of total RNA, electrophoresed in 12.5% agarose gel, transferred to nylon membrane, and hybridized with 32 P-labeled p53 or Rb cDNA probe.
- Northern blot was stripped and rehybndized with GAPDH to normalize the gel loading.
- FIG. 8 AdRSVpHyde induced p53 expression in DU 5 cells. The same Northern blot in Fig. 2A was stripped and rehybridized with 32 P-labeled p53 cDNA.
- FIG 10. Hie sequence of AdRSVpHyde.
- Figure 11. Comparison of the nucleotide sequence of the p-Hyde family genes between human p-Hyde (I) and human p-Hyde 40 (II).
- Figure 12- Comparison of the amino acid sequence of the p-Hyde family genes between human p-Hyde (I) and human p-Hyde 40 (II).
- Figure 13 A) Comparison of the nucleotide sequence of the p-Hyde family genes, between rat p-Hyde and human p-Hyde. B) Comparison of the amino acid sequence of the p-Hyde family genes between rat p-Hyde and human p-Hyde.
- FIG. 14 TUNEL, assay of DU145 cells in vitro.
- FIG. 15 TUNEL, assay of DU145 cells in vivo.
- DU145 xenograft tumors (about 80 fflm') growing on nude mice were either untreated (A) or injected with 5x10 9 pfu AdRSVpHyde (B). Tumors were harvested in 21 days. Tumor sections were fixed and proceeded for TUNEL assay. The sections were counter stained with propidium iodide (red) to show the nucleus of cells. The bright yellowish stained cells indicated the apoptotic cells. Tumor sections from control virus-treated DU145 tumor showed the similar results as in (A). Magnification: A, B: x20.
- FIG 16. Inhibitory effects of pHyde on growth of prostate cancer cell lines DU145 and LNCaP.
- Figure 17 Expression of Rb and pS3 in various prostate cancer cell lines. Various prostate cancer cells were screened for endogenous Rb and p53 expression at mRNA levels. Each well was loaded with 10 ⁇ g of total RNA.
- RNA integrity and gel loading samples were electrophoresed in 12.5%) agarose gel, transferred to nylon membrane, and hybridized with 32 P-labeled Rb (which showed an about 4.4 kb transcript) or p53 CDNA (which showed an about 2.5 kb transcript). The Northern blot was then stripped and rchybridized with GAPDH cDNA (which showed a 1.2 kb transcript) to assess RNA integrity and gel loading.
- FIG. 1 Inhibitory effects of pHyde on growth of prostate cancer cell lines; PC-3 and TSU.
- This invention provides a novel class of genes which act as inhibitor of a DNA repair enzyme and induces susceptibility of cancer cells to cell death
- P-Hyde is and associated with suppression of tumor growth in vivo and increased susceptibility to apoptosis induced by UV irradiation or FUrD treatment.
- the upregulation of apoptosis due to UV damage is correlated with the presence of intact photoproduct in prostate cancer cell lines stably transfected with p-Hyde.
- Use of p-Hyde in human gene therapy as monotherapy or hi combination with radiation or chemotherapy is useful against cancei or hyperproHferative human diseases.
- the class of proteins are DNA repair enzyme inhibitors which downregulate Nucleotide-Excision-Repair (NER) pathway in prostate cancer, MGMT CNA repair pathway in colon cancer cell line, 0 ⁇ methyl guanine methyl transferase enzyme (0 6 MgMT) and 6.4, photoproducts (6,4PP).
- the class of genes is characterized by comprising a leucine zipper binding domain and a death domain which causes the cell to be apoptotic.
- Human p-Hyde (I) and human p-Hyde 40 (II) are examples set forth herein, of a family of molecules (the "p-Hyde family”) having certain homolgous sequences and conserved structural and functional features.
- This inveniion provides an isolated nucleic acid which encodes a mammalian p-Hyde protein which induces susceptibility of a cancer cell to cell death, including allelic, analogs, fragments, mimetics, mutants, synthetics, or variants thereof.
- This invention provides an isolated nucleic acid which encodes a human p-Hyde protein which induces susceptibility of a cancer cell to cell death, including allelic, analogs, fragments, mimetics, mutants, synthetics, or variants thereof.
- p-Hyde activity refers to an activity exerted by a p-Hyde protein, polypeptide or nucleic acid molecule on a p-Hyde responsive cell as determined in vivo, or in vitro, according to standard techniques which causes apoptosis of the cell.
- P-Hyde refers to a family of genes having the p-Hyde activity. Examples of such genes are rat p-hyde, human p-Hyde (I), and human p-Hyde 40 (II).
- these sequences comprise SEQ ID NO: 7 on the nucleotide level and SEQ ID NO: 8 on the ammo acid level.
- examples, of family p-Hyde gene members include isolated nucleic sequences of SEQ ID NOS: 1, 3, 5, or 7 on the nucleotide level and amino acid sequences of SEQ ID NOS: 2, 4, 6 or 8 on the am o acid level.
- the p-Hyde gene has a nucleotide sequence having at least 85% similarity with the nucleic acid coding sequence of SEQ ID NO: 1.
- the nucleic acid has a nucleotide sequence having at least 87% similarity with the nucleic acid coding sequence of SEQ ID NO: 1
- the nucleic acid has a nucleotide sequence having at least 90% similarity with the nucleic acid coding sequence of SEQ ID NO: 1.
- the nucleic acid has a nucleotide sequence having at least 95% similarity with the nucleic acid coding sequence of SEQ ID NO. 1.
- nucleic acid fragment comprises a fragment which begins at the nucleic acid at position 1 of the SEQ ID NO: 1 and ends at position 557 of SEQ ID NO: 1. In another embodiment the nucleic acid comprises a fragment which begins at the nucleic acid at position 1 of SEQ ID NO: 1 and ends at position 158 of SEQ ID NO: 1. In another embodiment the nucleic acid comprises a fragment which begins at the nucleic acid at position 50 of SEQ ID NO: 1 and ends at position 120 of SEQ ID NO: 1.
- the nucleic acid is DNA, cDNA, genomic DNA, or
- the nucleic acid encodes an am o acid sequence having the sequence as set forth in SEQ ID NO 2.
- the a ino acid fragment comprises a fragment which begins at the a ino acid at position 1 of SEQ ID NO 2 and ends at position 101.
- the amino acid fragment comprises a fragment which begins at the amino acid at position 1 of SEQ ID NO 2 and ends at position 80.
- the amino acid fragment comprises a fragment which begins at the amino acid at position 1 of SEQ ID NO 2 and ends at position 60.
- the amino acid has at least 85% similarity with the nucleic acid coding sequence of SEQ ID NO 2
- the amino acid has at least 90% similarity with the nucleic acid coding sequence of SEQ ID NO 2.
- the amino acid has at least 95% similarity with the nucleic acid coding sequence of SEQ ID NO 2.
- the p-Hydc gene has a nucleotide sequence having at least 75% similarity with the nucleic acid coding sequence of SEQ ID NO- 3
- the nucleic acid has a nucleotide sequence having at least 85% similarity with the nucleic acid coding sequence of SEQ TD NO. 3.
- the nucleic acid has a nucleotide sequence having at least 90% similarity with the nucleic acid coding sequence of SEQ ID NO: 3.
- the nucleic acid has a nucleotide sequence having at least 95% similarity with the nucleic acid coding sequence of SEQ ED NO: 3.
- nucleic acid fragment comprises a fragment which begins at the nucleic acid at position 1 of the SEQ ID NO: 3 and ends at position 557 of SEQ ID NO: 3.
- nucleic acid comprises a fragment winch begins at the nucleic acid at position 1 of SEQ ID NO: 3 and ends at position 158 of SEQ ID NO 3.
- nucleic acid comprises a fragment which begins at the nucleic acid at position 50 of SEQ ID NO- 3 and ends at position 120 of SEQ ID NO: 3.
- the nucleic acid is DNA, cDNA, genomic DNA, or RNA
- the nucleic acid encodes an ammo acid sequence having the sequence as set forth in SEQ ID NO 4
- the amino acid fragment comprises a fragment which begins at the amino acid at position 1 of SEQ ID NO 4 and ends at position 101.
- the amino acid fragment comprises a fragment which begins at the amino acid at position 1 of SEQ ID NO 4 and ends at position 80.
- the amino acid fragment comprises a fragment which begins at the amino acid at position 1 of SEQ ID NO 4 and ends at position 60.
- the amino acid has at least 85% similarity with the nucleic acid coding sequence of SEQ ID NO 4.
- the amino acid has at least 90% similarity with the nucleic acid coding sequence of SEQ ID NO 4.
- the amino acid has at least 95% similarity with the nucleic acid coding sequence of SEQ ID NO 4.
- the p-Hyde gene has a nucleotide sequence having at least 75% similarity with the nucleic acid coding sequence of SEQ ID NO: 5. In another embodiment the nucleic acid has a nucleotide sequence having at least 85% similarity with the nucleic acid cod g sequence of SEQ ID NO: 5. In another embodiment the nucleic acid has a nucleotide sequence having at least 90% similarity with the nucleic acid coding sequence of SEQ ID NO: 5. h another embodiment the nucleic acid has a nucleotide sequence havmg at least 95% similarity with the nucleic acid coding sequence of SEQ ID NO: 5.
- nucleic acid fragment comprises a fragment which begins at the nucleic acid at position 1 of the SEQ ID NO: 5 and ends at position 557 of SEQ ID NO: 5.
- nucleic acid comprises a fragment which begins at the nucleic acid at position 1 of SEQ ID NO: 5 and ends at position 1 58 of SEQ ID NO: 5.
- nucleic acid comprises a fragment which begins at the nucleic acid at position 50 of SEQ ID NO: 5 and ends at position 120 of SEQ ID NO: 5.
- the nucleic acid is DNA, cDNA, genomic DNA, or RNA
- the nucleic acid encodes an amino acid sequence having the sequence as set forth in SEQ ID NO 6.
- the amino acid fragment comprises a fragment which begins at the amino acid at position 1 of SEQ ID NO 6 and ends at position 101.
- the amino acid fragment comprises a fragment which begins at the amino acid at position 1 of SEQ ID NO 6 and ends at position 80.
- the amino acid fragment comprises a fragment which begins at the amino acid al position 1 of SEQ ID NO 2 and ends at position 60.
- the amino acid fragment comprises a fragment which begins at the amino acid at position 61 of SEQ ID NO 6 and ends at position 241 .
- the amino acid fragment comprises a fragment which begins at the amino acid at position 81 of SEQ ID NO 6 and ends at position 361. In one embodiment the amino acid fragment comprises a fragment which begins at the amino acid at position 81 of SEQ ID NO 2 and ends at position 421. In another embodiment the amino acid has at least 70% similarity with the nucleic acid coding sequence of SEQ ID NO 6. In anotlier embodniient the ammo acid has at least 75% similarity with the nucleic acid coding sequence of SEQ ID NO 6. In another embodiment the amino acid has at least 80% similarity with the nucleic acid coding sequence of SEQ ID NO 6. In one embodiment the amino acid has at least 85% similarity with the nucleic acid coding sequence of SEQ ID NO 6. In another embodiment the amino acid has at least 90% similarity with the nucleic acid coding sequence of SEQ ID NO 6. In another embodiment the amino acid has at least 95% similarity with the nucleic acid coding sequence of SEQ ID NO 6.
- this invention provides an isolated nucleic acid which encodes an amino acid sequence tccctggccacacgcctggtgggctclggcttc (SEQ ID NO: 7). Further this invention provides an isolated nucleic acid which encodes an amino acid sequence: AAPCVAYVLLSLVYLPGVLAAALQLRRGTKYQRFPDWLDHWLQHRKQIGLLSF F (SEQ ID NO: 8). Further this invention provides an isolated nucleic acid winch encodes an amino acid sequence NFIRDVLQPYIRKDENK.
- the invention further encompasses nucleic acid molecules that differ from the nucleotide sequence of SEQ ID NO 1 , SEQ ID NO.3, SEQ ID NO:5, or SEQ ID NO:7, due to degeneracy of the genetic code and thus encode the same p-Hyde protein as that encoded by the nucleotide sequence shown in SEQ ID NO: 1 , SEQ ID NO:3, SEQ ID NO:5,or SEQ ID NO.7.
- DNA sequence polymorphisms that lead to changes in the amino acid sequences of p-Hyde may exist within a population (e.g., the human population).
- Such genetic polymorphism in the p-Hyde gene may exist among individuals within a population due to natural allelic variation.
- An all el e is one of a group of genes which occur alternatively at a given genetic locus
- Such natural allelic variations can typically result in 1-5% variance in the nucleotide sequence of the p-Hyde gene.
- Alternative alleles can be identified by sequencing the gene of interest hi a number of different individuals. This can be readily carried out by using hybridization probes to identify the same genetic locus in a variety of individuals.
- nucleic acid molecules encoding p-Hyde proteins from other species which have a nucleotide sequence which differs from that of a human p-Hyde, are intended to be within the scope of the invention.
- Nucleic acid molecules corresponding to natural allelic variants and homologues of the p-Hyde cDNA of the invention can be isolated based on their identity to the human p-Hyde nucleic acids disclosed herein using the human cDNAs, or a portion thereof, as a hybridization probe according to standard hybridization techniques under stringent hybridization conditions.
- splice variants of human and mouse p-Hyde cDNA can he isolated based on identity to human and mouse p-Hyde.
- hybridizes under stringent conditions is intended to describe conditions for hybridization and washing under which nucleotide sequences at least 60% (65%o. 70%, preferably 75%) identical to each other typically remain hybridized to each other.
- stringent conditions are known to those skilled in the art and can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6.
- a preferred, non-limiting example of stringent hybridization conditions are hybridization in 6X sodium chloride/sodium citrate (SSC) at about 450C, followed by one or more washes in 0.2 X SSC, 0.1% SDS at 50-650C.
- an isolated nucleic acid molecule of the invention that hybridizes under stringent conditions to the coding or non-coding (or "sense” or “anti-sense") sequence of SEQ ID NO: l , SEQ ID NO:2, SEQ ID NO:5, or SEQ ID NO:7, corresponds to a naturally- occurring nucleic acid molecule.
- a "naturally-occurring" nucleic acid molecule refers to an RNA or DNA molecule having a nucleotide sequence that occurs in nature (e.g., encodes a natural protein).
- allelic variants of the p-Hyde sequence that may exist in the population, the skilled artisan will further appreciate that changes can be introduced by mutation into the nuclectide sequence of SEQ ID NO: l , SEQ ID NO:3, SEQ ID NO:5, or SEQ ID NO.7, thereby leading to changes in the amino acid sequence of the encoded p-Hyde protein, without altering the biological ability of the p-Hyde protein.
- Mutations can be introduced by standard techniques, such as site-directed mutagenesis and PCR-niediated mutagenesis.
- conservative amino acid substitutions are made at one or more predicted non- essential amino acid residues.
- a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta- branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- a predicted nonessential amino acid residue in P-Hyde is preferably replaced with another amino acid residue from the same side chain family.
- mutations can be introduced randomly along all or part of a P-Hyde coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for P-Hyde biological activity to identify mutants that retain activity. Following mutagenesis, the encoded protein can be expressed recombinantly and the activity of the protein can be determined.
- amino acid residues that are conserved among the p-Hyde proteins of various species are not altered (except by conservative substitution). Both murine and human p-Hyde protein have a conserved pattern of six cysteine residues. Such conserved domains and cysteine residues are less likely to be amenable to mutation. Other amino acid residues, however, (e.g., those that are not conserved or only semi- conserved among p-Hyde of various species e.g., between murine and human p-Hyde) may not be essential for activity and thus are likely to be amenable to alteration.
- nucleic acid molecules encoding p-Hyde proteins that contain changes in amino acid residues that are not essential for activity.
- Such p-Hyde proteins differ in amino acid sequence from SEQ ID NO:2 or SEQ ID NO:4 yet retain biological activity.
- the isolated nucleic acid molecule includes a nucleotide sequence encoding a protein that includes an amino acid sequence that is at least about 84% identical, 85%, 90%, 95%, or 98% identical to the amino acid sequence of SEQ ID NO-2, 4, 6, or 8.
- the nucleotide encoding p-Hyde includes RNA, cDNA, genomic DNA, synthetic forms, and mixed polymers, both sense and antisense strands, and may be chemically or biochemically modified or may contain non-natural or derivatized nucleotide bases, as will be readily appreciated by those skilled in the ait.
- modifications include, for example, labels, methylation, substitution of one or more of the naturally occurring nucleotides with an analog, ingruucleotide modifications such as uncharged linkages (e g , methyl phosphonates, phosphotriesters, phosphoamidates, carbamates, etc.), charged linkages (e g .
- phosphorothioates phosphorodithioates, etc.
- pendent moieties e g , polypeptides
- intercalators e.g , acridine, psoralen, etc.
- chelators e.g , alkylators, and modified linkages (e.g., alpha anome ⁇ c nucleic acids, etc ).
- synthetic molecules that mimic nucleotides in their ability to bind to a designated sequence via hydrogen bonding and other chemical interactions.
- Such molecules are known in the art and mclude, for example, those in which peptide linkages substitute for phosphate linkages the backbone of the molecule, substantially homologous to primary structural sequence but which include, e.g , in vivo or in vitro chemical and biochemical modifications or which incorporate unusual amino acids
- the nucleic acid may be modified. Such modifications include, for example, acetylation, carboxylation, phosphorylation, glycosylation, ubiquitination, labeling, e.g., with radionuchdes. and various enzymatic modifications, as will be readily appreciated by those well skilled m the art.
- a variety of methods for labeling polypeptides and of substituents or labels useful for such purposes are well known in the art, and include ladioacuve isotopes such as 32 P, ligands which bind to labeled antiligands (e.g., antibodies), fluorophores, chemiluminescent agents, enzymes, and antiligands which can serve as specific bmding pair members for a labeled ligand.
- labeled antiligands e.g., antibodies
- fluorophores e.g., antibodies
- chemiluminescent agents e.g., enzymes
- antiligands which can serve as specific bmding pair members for a labeled ligand.
- the choice of label depends on the sensitivity required, ease of conjugation with the primer, stability requirements, and available instrumentation. Methods of labeling polypeptides are well known in the art.
- an "isolated" or “substantially pure” nucleic acid is one which is substantially separated from other cellular components which naturally accompany a native human sequence or protein, e.g., ribosomes, polymerases, many other human genome sequences and proteins.
- the term embraces a nucleic acid sequence or protein which has been removed from its naturally occurring environment, and includes recombinant or cloned DNA isolates and chemically synthesized analogs or analogs biologically synthesized by heterologous systems.
- p-Hyde AUele refers to normal alleles of the p-Hyde locus as well as alleles carrying variations that predispose individuals to develop cancer of many sites including, for example, breast, ovarian, colorectal and prostate cancer. Such predisposing alleles are also called “p-Hyde susceptibility alleles”.
- p-Hyde Locus each refer to polynucleotides, all of which are in the p-Hyde region, thai are likely to be expressed in normal tissue, certain alleles of which predispose an individual to develop breast, ovarian, colorectal and prostate cancers which have p-Hyde activity.. Mutations at the p-Hyde locus may be involved in the initiation and/or progression of other types of tumors. The locus is indicated in part by mutations that predispose individuals to develop cancer These mutations fall within the p-Hyde region described infra.
- the p-Hyde locus is intended to include coding sequences, intervening sequences and regulatory elements controlling transcription and/or translation.
- the p-Hyde locus is intended to include all allelic variations of the DNA sequence.
- nucleic acid refers to the phosphate ester polymeric for of ribonucleosides (adenosine, guanosine, uridine or cytidine; "RNA molecules”) or deoxyribonucleosides (deoxyadenosinc, deoxy guanosine. deoxythyniidine, or deoxy cytidine, "DNA molecules”) in either smgle stranded form, or a double-stranded helix. Double stranded DNA-DNA, DNA-RNA and RNA-RNA helices are possible.
- icleic acid molecule refers only to the primary and secondary structure of the molecule, an does not lirn it to any particular tertiary forms.
- this term includes double-stranded DNA found, inter alia, in linear or circular DNA molecules (e.g.. restriction fragments), plasmids, and chromosomes.
- sequences may be described herein according to the normal convention of giving only the sequence in the 5' to 3 ' direction along the nontranscribed strand of DNA (i.e. , the strand having a sequence homologous to the mRNA).
- a "recombinant DNA” is a DNA that has undergone a molecular biological manipulation.
- nucleic acid encoding refers to a nucleic acid molecule which directs the expression of a specific protein or peptide.
- the nucleic acid sequences include both the DNA strand sequence that is transcribed into RNA and the RNA sequence that is translated into protein.
- the nucleic acid molecule include both the full length nucleic acid sequences as well as non-full length sequences derived from the full length protein. It being further understood that the sequence includes the degenerate codons of the native sequence or sequences which may be introduced to provide codon preference in a specific host cell
- Recombinant nucleic acid is a nucleic acid which is not naturally occurring, or which is made by the artificial combination of two otherwise separated segments of sequence. This artificial combination is often accomplished by either chemical synthesis means, or by the artificial manipulation of isolated segments of nucleic acids, e.g., by genetic engineering techniques. Such is usually done to replace a codon with a redundant codon encoding the same or a conservative amino acid, while typically introducing or removing a sequence recognition site. Alternatively, it is performed to join together nucleic acid segments of desired functions to generate a desired combination of functions.
- cancer cell means a tissue that grows by cellular proliferation more rapidly than normal, e.g. , more rapidly than adjoining cells, or other cells in the tissue. Neoplastic cells continue to grow after growth stimuli cease. Generally, tumors represent or form a distinct mass of tissue. The present invention relates to both types of tumors, but is particularly valuable in the treatment of cancers.
- the cancer cells are selected from a group consisting of: melanoma; lymphoma; leukemia; and prostate, colorectal, pancreatic, breast, brain, or gastric carcinoma.
- tumors include but are not limited to: include sarcomas and carcinomas such as, but not limited to: fibrosarcoma, myxosarcoma, liposarcoma.
- chondrosarcoma osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's sarcoma, leiomyosarcoma, rhabdomyo sarcoma, colon carcinoma, pancreatic cancer, breast cancer, ovarian cancer, prostate cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary caicinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duel carcinoma, choriocarcinonia, seminoma, embryonal carcinoma, Wilms 1 tumor, cervical cancer, germ tumor, non-small cell lung carcinoma, small cell lung carcinoma,
- Mutations can be made in a nucleic acid encoding p-Hyde such that a particular codon is changed to a codon which codes for a different ammo acid but the induction of susceptibility to cell death is maintained. Such a mutation is generally made by making the fewest nucleotide changes possible.
- a substitution mutation of this sort can be made to change an ammo acid in the resulting protein in a non-conservative manner (i.e., by changing the codon from an ammo acid belonging to a grouping of amino acids having a particular size or characteristic to an amino acid belonging to another grouping) or in a conservative manner (i.e., by changing the codon from an amino acid belonging to a grouping of amino acids having a particular size or characteristic to an amino acid belonging to the same grouping).
- a conservative change generally leads to less change in the structure and function of the resulting protein.
- a non-conservative change is more likely to alter the structure, activity or function of the resultmg protein.
- the present invention should be considered to include sequences containing conservative changes which do not significantly alter the activity or bmding characteristics of the resulting protein.
- Substitutes for an amino acid within the sequence may be selected from other members of the class to which the amino acid belongs.
- the nonpolar (hydrophobic) amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan and methionine
- Amino acids containing aromatic ring structures are phenylalanine, tryptophan, and tyrosine.
- the polar neutral amino acids include glycine, serine, threonine, cysteine. tyrosine, asparagine, and glutamine.
- the positively charged (basic) amino acids include arginine, lysine and histidine
- the negatively charged (acidic) amino acids include aspartic acid and glutamic acid Such alterations will not be expected to affect apparent molecular weight as determined by polyacrylarnide gel electrophoresis, or isoelectric point. Tins isolated nucleic acid also encodes mutant p-Hyde or the wildtype protein
- the invention further provides a recombinant expression vector comprising a DNA molecule of the invention cloned into the expression vector in an antisense orientation. That is, the DNA molecule is operably linked to a regulatory sequence in a manner which allows for expression (by transcription of the DNA molecule) of an RNA molecule which is antisense to p-Hyde mRNA.
- Regulatory sequences operably linked to a nucleic acid cloned in the antisense orientation can be chosen which direct the continuous expression of the antisense RNA molecule in a variety of cell types, for instance viral promoters and/or enhancers, or regulatory sequences can be chosen which direct constitutive, tissue specific or cell type specific expression of antisense RNA
- the antisense expression vector can be in the form of a recombinant plasmid, phageraid or attenuated virus in which antisense nucleic acids are produced under the control of a high efficiency regulatory region, the activity of which can be determined by the cell type into which the vector is introduced.
- This invention provides for a rephcable vector comprising the isolated nucleic acid molecule of the DNA virus.
- the vector includes, but is not limited to: a plasmid, cosmid, phage or yeast artificial chromosome (YAC) which contains at least a portion of the isolated nucleic acid molecule.
- insert and vector DNA can both be exposed to a restriction enzyme to create complementary ends on both molecules which base pair with each other and are then ligated together with DNA ligase.
- linkers can be ligated to the insert DNA which correspond to a restriction site in the vector DNA, which is then digested with the restriction enzyme which cuts at that site.
- Other means are also available and known to an ordinary skilled practitioner.
- the adenovirus vector is a replication-deficient adenovirus type 5 expression vector.
- the adenovirus vector comprises an adenovirus genome having a deletion in the El and E3 region of the genome and an insertion within the region of a nucleic acid encoding p-Hyde under the control of a promoter.
- the promoter may be a Rous Sarcoma virus promoter.
- adenovirus a 36 kB, linear and double-stranded DNA virus, allows substitution of a large piece of adenoviral DNA with foreign sequences up to 7 kB (Grunhaus and Horwitz, 1992).
- retrovirus the infection of adenoviral DNA into host cells does not result in chromosomal integration because adenoviral DNA can replicate in an episomal manner without potential genotoxicity.
- adeno viruses are structurally stable, and no genome rearrangement has been detected after extensive amplification. Adenovirus can infect virtually all epithelial cells regardless of their cell cycle stage. So far, adenoviral infection appears to be linked only to mild disease such as acute respiratory disease in the human
- Adenovirus is particulaiiy suitable for use as a gene transfer vector because of its mid-sized genome, ease of manipulation, high titer, wide target-cell range, and high infectivity. Both ends of the viral genome contain 100-200 base pair Cop) inverted terminal repeats (ITR), which axe cis elements necessary for viral DNA replication and packaging.
- ITR inverted terminal repeats
- the early (E) and late (L) regions of the genome contain different transcription units that are divided by the onset of viral DNA replication.
- the El region (El A and E1B) encodes proteins responsible for the regulation of transcription of the viral genome and a few cellular genes.
- the expression of the E2 region results in the synthesis of the proteins for viral DNA replication.
- MLP major late promoter
- recombinant adenovirus is generated from homologous recombination between shuttle vector and provhus vectoi Due to the possible recombination between two proviral vectors, wild-type adenovirus may be generated from this process. Therefore, it is critical to isolate a single clone of virus from an individual plaque and examine its genomic structure.
- Use of the YAC system is an alternative approach for the production of recombinant adenovirus.
- adenovirus can package approximately 105%> of the wild-type genome (Ghosh-Choudhury, et al , 1987), providing capacity for about 2 extra kB of DNA. Combined with the approximately 5.5 kB of DNA that is replaceable in the El and E3 regions, the maximum capacity of the current adenovirus vector is under 7.5 kB, or about 15% of the total length of the vector. More than 80% of the adenovirus viral genome remains in the vector backbone and is the source of vector-borne cytotoxicity. Also, the replication deficiency of the El deleted virus is incomplete. For example, leakage of viral gene expression has been observed with the currently available adenovirus vectors at high multiplicities of infection (Mulligan, 1993).
- Helper cell lines may be derived from human cells such as human embryonic kidney cells, muscle cells, hematopoietic cells or other human embryonic mesenchymal or epithelial cells.
- the helper cells may be derived from tlie cells of other mammalian species that are permissive for human adenovirus. Such cells include, e.g., Vero cells or other monkey embryonic mesenchymal or epithelial cells As stated above, the preferred helper cell line is 293.
- the adenovirus may be of any of the 42 different known serotypes or subgroups A-F.
- Adenovirus type 5 of subgroup C is the preferred starting material in order to obtain the conditional replication-defective adenovirus vector for use in the method of the present invention. This is because Adenovirus type 5 is a human adenovirus about which a great deal of biochemical and genetic information is known, and it has historically been used for most constructions employing adenovirus as a vector.
- the typical vector according to the present invention is replication defective and will not have an adenovirus El region.
- the position of insertion of the p-Hyde coding region within the adenovirus sequences is not critical to the present invention.
- the nucleic acid encoding a p-Hyde transcription unit also may be inserted in lieu of the deleted E3 region in E3 replacement vectors as described previously by Karlsson et. al. (1986) or in the E4 region where a helper ceil line or helper virus complements the E4 defect.
- Adenovirus is easy to grow and manipulate and exhibits broad host range in vitro and in vivo. This group of viruses can be obtained in high titers, e.g., 1 0 9 -10 11 plaque-forming unit (PFU)/ml, and they are highly infective
- PFU plaque-forming unit
- the life cycle of adenovirus does not require integration into the host cell genome.
- the foreign genes delivered by adenovirus vectors are episomal, and therefore, have low genotoxicity to host cells. No side effects 00/71564
- Adenovirus vectors have been used in eulkaryotic gene expression (Levrero et al., 1991;
- An appropriate promoter and other necessary vector sequences will be selected so as to be functional in tlie host, and may include, when appropriate, those naturally associated with p-Hyde genes. Examples of workable combinations of cell lines and expression vectors are described in Sambrook et al., 1989 or Ausubel et al., 1992; see also, e.g., Metzger el al , 1988. Many useful vectors are known in the art and may be obtained from such vendors as Stratagene, New England Biolabs, Prornega Biotech, and others. Promoters such as the trp, lac and phage promoters, tRNA promoters and glycolytic enzyme promoters may be used in prokaryotic hosts.
- Useful yeast promoters include promoter regions for metallotliionein, 3-phosphoglycerate kinase or other glycolytic enzymes such as enolase or gly ceraidehyde-3 -phosphate dehydrogenase, enzymes responsible for maltose and galactose utilization, and others. Vectors and promoters suitable for use hi yeast expression are further described in Hitzeman et al., EP 73.675A.
- non-native mammalian promoters might include the early and late promoters from SV40 (Fiers et al., 1 78) or promoters derived from murine Moloney leukemia virus, mouse inor vfrus, avian sarcoma viruses, adenovirus II. bovine papilloma virus or polyoma.
- the construct may be joined to an amplifiable gene (e.g., DHFR) so that multiple copies of the gene may be made.
- amplifiable gene e.g., DHFR
- Expression and cloning vectors will likely contain a selectable marker, a gene encoding a protein necessary for survival or growth of a host cell transformed with the vector. The presence of this gene ensures growth of only those host cells which express the inserts.
- Typical selection genes encode proteins that a) confer resistance to antibiotics or other toxic substances, e.g. ampicillin, neomycin, methotrexaie, etc.; b) complement auxotrophic deficiencies, or c) supply critical nutrients not available from complex media, e.g., the gene encodhig D-alanine racemase for Bacilli. The choice of tlie proper selectable marker will depend on the host cell, and appropriate markers for different hosts are well known in the art.
- the vectors containing tlie nucleic acids of interest can be transcribed in vitro, and the resulting RNA introduced into the host cell by well-known methods, e.g., by injection (see, Kubo et al ., 1 988), or the vectors can be introduced directly into host cells by methods well known in the art, which vary depending on the type of cellular host, including electroporation, transfection employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, or other substances; n icroprojectile bombardment; hpofection; infection (where the vector is an infectious agent, such as a retroviral genome); and other methods.
- a bacterial expression vector includes a promoter such as tlie lac promoter and for transcription initiation the Shine-Dalgarno sequence and the start codon AUG. _ _ -
- a eukaryotic expression vector includes a heterologous or homologous promoter for RNA polymerase II, a downstream polyadenylation signal, the start codon AUG, and a termination codon for detachment of the ribosome.
- RNA polymerase II a heterologous or homologous promoter for RNA polymerase II
- downstream polyadenylation signal a downstream polyadenylation signal
- start codon AUG the start codon AUG
- termination codon for detachment of the ribosome.
- Such vectors may be obtained commercially or assembled from the sequences described by methods well-known in the art, for example tlie methods described above for constructing vectors in general.
- Viral promoters, cellular promoters/enhancers and inducible promoters/enhancers that could be used in combination with the nucleic acid encoding a p-Hyde in an expression construct include but are not limited to tlie following: Immuno globulin Heavy Chain; Tmmunoglobulin Light Chain; T-Cell Receptor; HLA DQ alpha and DQ beta; beta -Interfcron, lnterleukin-2 ; Interleukin-2 Receptor; MHC Class II 5 alpha; MHC Class II HLA-DR alpha; beta -Aclm; Muscle Creatine Kinase; Prealbumin (Transtliy ⁇ etin); Elastase I, Metalloihionein; Collagenase; Albumin Gene; alpha -Fetoprotein; tau -Globin; beta -Globin; c-fos; c-HA-ras; Neural Cell Adhesion Molecul
- Eukaryotic Promoter Data Base EPDB Eukaryotic Promoter Data Base EPDB
- any promoter/enhancer combination could also be used to d ⁇ ve expression of a p-Hyde.
- Use of a T3, T7 or SP6 cytoplasmic expression system is another possible embodiment.
- Eukaryotic cells can support cytoplasmic transcription from certain bacterial promoters if the appropriate bacterial polymerase is provided, either as part of the delivery complex or as an additional genetic expression construct.
- the host cell may contain the isolated DNA molecule artificially introduced into the host cell.
- the host cell may be a eukaryotic or bacterial cell (such as E.coli . yeast cells, fungal cells, insect cells and animal cells Suitable animal cells include, but are not limited to Vero cells, HeLa cells, Cos cells, CV1 cells and various primary mammalian cells.
- host cell and “recombinant host cell” are used interchangeably herein, it is understood that such terms refer not only to the particular subject cell but to the progeny or potential progeny of such a cell Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included withm the scope of the term as used herein.
- a host cell can be any prokaryotic or eukaryotic cell.
- p-Hyde protein can be expressed in bacterial cells such as E.
- vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques.
- transformation and “transfection” are intended to refer to a variety of art-recognized techniques for introducing foreign nucleic acid (e.g., DNA) into a host cell, including calcium phosphate or calcium chloride co- precipitation, DEAE-dextran-mediated transfection, hpofection, or electroporation. Suitable methods for transforming or transfecting host cells can be found in Sambrook, et al.
- a gene that encodes a selectable marker is generally introduced into the host cells along with the gene of interest.
- Preferred selectable markers include those which confer resistance to drugs, such as G418, hygromycm and methotrexate.
- Nucleic acid encoding a selectable marker can be introduced into a host cell on the same vector as that encoding p-Hyde or can be introduced on a separate vector. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die).
- a host cell of the invention such as a prokaryotic or eukaryotic host cell in culture, can be used to produce (i.e., express) p-Hyde protein.
- the invention further provides methods for producing p-Hyde protein using the host cells of the invention.
- the method comprises cultnring tlie host cell of invention (into which a recombinant expression vector encoding p-Hyde has been introduced) in a suitable medium such that p-Hyde protein is produced.
- tlie method further comprises isolating p-Hyde from the medium or the host cell.
- the host cells of the invention can also be used to produce nonhuman transgenic animals.
- a host cell of the invention is a fertilized oocyte or an embryonic stem cell into which p-Hyde-coding sequences have been introduced.
- Such host cells can then he used to create non-human transgenic animals in which exogenous p-Hyde sequences have been introduced into their genome or homologous recombinant animals in which endogenous p-Hyde sequences have been altered.
- Such animals are useful for studying the function and/or activity of p-Hyde and for identifying and/or evaluating modulators of p-Hyde activity.
- transgenic animal is a non-human animal, preferably a mammal, more preferably a rodent such as a rat or mouse, in which one or more of the cells of the animal includes a transgene.
- rodent such as a rat or mouse
- transgenic animals include non-human primates, sheep, dogs, cows, goats, chickens, amphibians, etc.
- a transgenic animal of the invention can be created by introducing p-I yde-encoding nucleic acid into tl e male pronuclei of a fertilized oocyte, e.g., by microinjection, retroviral infection, and allowing the oocyte to develop in a pseudopregnant female foster animal.
- the p-Hyde cDNA sequence e.g., that of (SEQ ID NO:l,3, 5, or 7) can be introduced as a transgene into the genome of a non-human animal.
- a nonhuman homologue of the human p-Hyde gene can be isolated based on hybridization to the human p-Hyde cDNA and used as a transgene.
- Intronic sequences and polyadenylation signals can also be included in the transgene to increase the efficiency of expression of the transgene.
- a tissue-specific regulatory sequence(s) can be operably linked to the p-Hyde transgene to direct expression of p-Hyde protein to particular cells.
- a transgenic founder animal can be identified based upon the presence of tlie p-Hyde transgene in its genome and/or expression of p-Hyde mRNA hi tissues or cells of the animals. A transgenic founder animal can then be used to breed additional animals carrying tlie transgene. Moreover, transgenic animals carrying a transgene encoding p-Hyde can further be bred to other transgenic animals carrying other transgenes.
- a vector is prepared which contains at least a portion of a p-Hyde gene (e.g., a human or a non-human homolog of the p-Hyde gene, e.g., a murine p-Hyde gene) into which a deletion, addition or substitution has been introduced to thereby alter, e.g., functionally disrupt, the p-Hyde gene.
- the vector is designed such that, upon homologous recombination, the endogenous p-Hyde gene is functionally disrupted (i.e., no longer encodes a functional protein; also referred to as a "knock out" vector).
- tlie vector can be designed such that, upon homologous recombination, the endogenous p-Hyde gene is mutated or otherwise altered but still encodes functional protein (e.g., the upstream regulatory region can be altered lo thereby alter the expression of the endogenous p-Hyde protein).
- vector refers to viral expression systems, autonomous self-replicating circular DNA (plasmids), and includes both expression and nonexpression plasmids. Where a recombinant microorganism or cell culture is described as hosting an "expression vector,” this includes both extrachromosomal circular DNA and DNA that has been incorporated into the host chromosome(s). Where a vector is being maintained by a host cell, tlie vector may either be stably replicated by the cells during mitosis as an autonomous structure, or is incorporated within the host's genome. 00/71564
- plasmid refers to an autonomous circular DNA molecule capable of lephcation in a cell, and includes both the expression and nonexpression types. Where a recombinant microorganism or cell culture is described as hosting an "expression plasmid", tins includes latent viral DNA integrated into the host ch ⁇ omosome(s). Where a plasmid is being maintained by a host cell, the plasmid is either bemg stably replicated by the cells during mitosis as an autonomous structure 01 is incorporated within the host's genome.
- ieference sequence is a defined sequence used as a basis for a sequence comparison, a ieference sequence may be a subset of a larger sequence, for example, as a segment of a full-length cDNA or gene sequence given in a sequence listing or may comprise a complete cDNA or gene sequence.
- Optimal alignment of sequences for aligning a comparison window may be conducted by the local homology algorithm of Smith and Waterman (1981) Adv Appl Math 2-482, by the homology alignment algorithm of Needleman and Wunsch (1970) J. Mol Biol 48 443, by the search for similarity method of Pearson and Lipman (1988) Proc Nail Acad S i (USA) 8 - AAA, or by computerized implementations of these algo ⁇ thms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package Release 7.0, Genetics Computer Group, 575 Science Dr., Madison, WI).
- Substantial identity or “substantial sequence identity” mean that two peptide sequences, when optimally aligned, such as by the programs GAP or BESTFIT using default gap which share at least 90 percent sequence identity, preferably at least 95 percent sequence identity, more preferably at least 99 percent sequence identity or more.
- “Peicentage amino acid identity” or “percentage amino acid sequence identity” refers to a comparison of the amino acids of two polypeptides which, when optimally aligned, have approximately tlie designated percentage of the same amino acids. For example, 00/71564
- 95% amino acid identity refers to a comparison of the amino acids of two polypeptides which when optimally aligned have 95% amino acid identity
- residue positions which are not identical differ by conservative amino acid substitutions
- substitution of amino acids havmg similar chemical properties such as charge or polarity are not likely to effect the properties of a protein. Examples include glutamine for asparagine or glutamic acid for aspartic acid.
- the percent identity between the two sequences is a function of the number of identical positions shared by the sequences (i.e., % identity of identical positions/total # of positions (e.g., overlapping) x 100).
- the two sequences are the same length.
- the determination of percent homology between two sequences can be accomplished usmg a mathematical algorithm.
- a preferred, non-limiting example of a mathematical algorithm utilized for tlie comparison of two sequences is the algorithm of Karlin and AJtschul (1990) Proc. Natl. Acad. Sci. USA 87:2264-2268, modified as in Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5877.
- Gapped BLAST can be utilized as described in Altschul et aL, (1997) Nucleic Acids Res.
- This invention provides a nucleic acid having a sequence complementary to the sequence of the isolated nucleic acid of the human p-Hyde gene. Specifically, this invention provides an oligonucleotide of at least 15 nucleotides capable of specifically hybridizing with a sequence of nucleotides present within a nucleic acid which encodes the human p-Hyde
- the nucleic acid is DNA or RNA.
- the oligonucleotide is labeled with a detectable marker.
- the oligonucleotide is a radioactive isotope, a fluorophor or an enzyme.
- Oligonucleotides which are complementary may be obtained as follows: The polymerase chain reaction is then carried out using the two primers. See PCR Protocols A Guide to Methods and Applications [74] Following PCR amplification, the PCR-amplificd regions of a viral DNA can be tested for their ability to hybridize to the three specific nucleic acid probes listed above. Alternatively, hybridization of a viral DNA to the above nucleic acid probes can be performed by a Southern blot procedure without viral DNA amplification and under stringent hybridization conditions as desc ⁇ bed herein
- Oligonucleotides for use as probes or PCR primers arc chemically synthesized according to the solid phase phosphoramidite tnester method first described by Beaucage and Carruthers [19] using an automated synthesizer, as described in Needham-VanDevanter [69]. Purification of oligonucleotides is by either native acrylamide gel electrophoresis or by anion-exchange HPLC as described in Pearson, J.D. and Regnier, F E. [75A]. The sequence of the synthetic oligonucleotide can be verified using the chemical degradation method of Maxa , A.M. and Gilbert, W. [63].
- High st ⁇ ngent hybridization conditions are selected at about 5? C lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH.
- the T is the temperature (under defined ionic strength and pH) at which 50% of tlie target sequence hybridizes to a perfectly matched probe.
- ionic strength and pH the pH at which 50% of tlie target sequence hybridizes to a perfectly matched probe.
- Example high stringency may be attained for example by overnight hybridization at about 68C in a 6x SSC solution, washing at room temperature with 6x SSC solution, followed by washing at about 68C in a 6x SSC in a 0.6x SSX solution.
- Hybridization with moderate stringency may be attained for example by: 1) filter pre-hybridizing and hybridizing with a solution of 3x sodium chloride, sodium citrate (SSC), 50% formamide, 0.1M Tris buffer at Ph 7.5, 5x Denhardt's solution; 2.) pre-hybridization at 37? C for 4 hours; 3) hybridization at 37? C with amount of labelled probe equal to 3,000,000 cpm total for 16 hours; 4) wash in 2x SSC and 0.1% SDS solution; 5) wash 4x for 1 minute each at room temperature at 4x at 60? C for 30 minutes each; and 6) dry and expose to film.
- SSC sodium citrate
- selectively hybridizing to refers to a nucleic acid probe that hybridizes, duplexes or binds only to a particular target DNA or RNA sequence when the target sequences are present in a preparation of total cellular DNA or RNA.
- selectively hybridizing it is meant that a probe binds to a given target in a manner that is detectable in a different manner from non-target sequence under high stringency conditions of hybridization, in a different "Complementary" or “target” nucleic acid sequences refer to those nucleic acid sequences which selectively hybridize to a nucleic acid probe.
- Proper annealing conditions depend, for example, upon a probe's length, base composition, and the number of mismatches and their position on the probe, and must often be determined empirically.
- nucleic acid probe design and annealing conditions see, for example, Sambrook et al., [81 ] or Ausubel, F., et al., [8].
- the primer pairs of the present invention are useful for dete ⁇ nination of the nucleotide sequence of a particular p-Hyde allele using PCR.
- the pairs of single-stranded DNA primers can be annealed to sequences within or surrounding the p-Hyde gene in order to prime amplifying DNA synthesis of the p-Hyde gene itsel f.
- a complete set of these primers allows synthesis of all of tl e nucleotides of the p-Hyde gene coding sequences, i.e., the exons.
- the set of primers preferably allows synthesis of both intron and exon sequences Allele-specific primers can also be used. Such primers anneal only to paiticular p-Hyde mutant alleles, and thus will only amplify a product in the presence of the mutant allele as a template
- DNA probe molecules may be produced by insertion of a DNA molecule having the full-length or a fragment of the isolated nucleic acid molecule of the DNA virus into suitable vectors, such as plasmids or bacteriophages, followed by transforming into suitable bacterial host cells, replication in the transformed bacterial host cells and harvesting of the DNA probes, using methods well known in the art.
- suitable vectors such as plasmids or bacteriophages
- probes may be generated chemically from DNA synthesizers.
- RNA probes may be generated by inserting the full length or a fragment of tlie isolated nucleic acid molecule of the DNA virus downstream of a bacleriophage promoter such as T3, T7 or SP6. Large amounts of RNA probe may be produced by incubating the labeled nucleotides with a linearized isolated nucleic acid molecule of the DNA virus or its fragment where it contains an upstream promoter h the presence of the appropriate RNA polymerase, As defined herein nucleic acid probes may be DNA or RNA fragments.
- DNA fragments can be prepared, for example, by digesting plasmid DNA, or by use of PCR, or synthesized by either the phosphoramidite method described by Beaucage and Carruthers, [19], or by the triester method according to Matteucci, et al., [62], both incorporated herein by refereuce.
- a double stranded fragment may then be obtained, if desired, by annealing tl e chemically synthesized single strands together under appropriate conditions or by synthesizing the complementary strand using DNA polymerase with an appropriate primer sequence. Where a specific sequence for a nucleic acid probe is given, it is understood that the complementary strand is also identified and included.
- the complementary strand will work equally well in situations where the target is a double-stranded nucleic acid. It is also understood that when a specific sequence is identified for use a nucleic probe, a subsequence of the listed sequence which is 25 basepairs or more in length is also encompassed for use as a probe.
- the nucleic acid of the subject invention also include DNA molecules coding for polypeptide analogs, fragments or derivatives of antigenic polypeptides which differ from naturally-occurring forms in terms of the identity ot location of one or more amino acid residues (deletion analogs containing less than all of tl e residues specified for the protein, substitution analogs wherein one or more residues specified are replaced by other residues and addition analogs where in one or more amino acid residues is added to a terminal or medial portion of the polypeptides) and which share some or all properties of naturally-occurring forms.
- These molecules include: the incorporation of codons "preferred" for expression by selected non-mammalian hosts; the provision of sites for cleavage by restriction endonuclease enzymes; and the provision of additional initial, terminal or intermediate DNA sequences that facilitate construction of readily expressed vectors.
- this invention provides an antisense molecule capable of specifically hybridizing with the isolated nucleic acid of the human p-Hyde gene.
- This invention provides an antagonist capable of blocking the expression of the peptide or polypeptide encoded by the isolated DNA molecule.
- the antagonist is capable of hybridizing 00/71564
- the antagonist is a triplex oligonucleotide capable of hybridizing to the DNA molecule.
- the triplex oligonucleotide is capable of binding to at least a portion of tlie isolated DNA molecule with a nucleotide sequence.
- the antisense molecule may be DNA or RNA or valiants thereof (i.e. DNA or RNA with a protein backbone).
- the present invention extends to tlie preparation of antisense nucleotides and ribozymes that may be used to mterfere with the expression of the receptor recognition proteins at the translation of a specific mRNA, either by masking that MRNA with an antisense nucleic acid or cleaving it with a ribozyme.
- Antisense nucleic acids are DNA or RNA molecules that are complementary to at least a portion of a specific MRNA molecule. In the cell, they hybridize to that MRNA, forming a double stranded molecule. The cell does not translate an MRNA in this double-stranded form. Therefore, antisense nucleic acids interfere with the expression of MRNA into protein.
- Antisense nucleotides or polynucleotide sequences are useful in preventing or diminishing the expression of tlie p-Hyde gene, as will be appreciated by those skilled the art.
- polynucleotide vectors containing all or a portion of the p-Hyde gene or other sequences from the p-Hyde region may be placed under the control of a promoter in an antisense orientation and introduced into a cell Expression of such an antisense construct within a cell will interfere with p-Hyde transcription and/or translation and/or replication.
- Oligomers of about fifteen nucleotides and molecules that hybridize to the AUG initiation codon are particularly efficient, since they are easy to synthesize and are likely to pose fewer problems than larger molecules upon introduction to cells.
- This invention provides a transgenic nonhuman mammal which comprises at least a portion of the isolated DNA molecule uitroduced into the mammal at an embryonic stage. Methods of producing a transgenic nonhuman mammal are known to those skilled in the art.
- This invention provides a polypeptide comprising the ammo acid sequence of a human p-Hyde In one embodiment the amino acid sequence is set forth in SEQ ID NOs. 2, 4, 6 or 8
- This invention provides a fusion protein or chimeric comprising the polypeptide.
- This invention provides an antibody which specifically binds to the polypeptide. In one embodiment the antibody is a monoclonal or polycional antibody.
- a p-Hyde “chimeric protein” or “fusion protein” comprises a p-Hyde polypeptide operably linked to a non-p-Hyde polypeptide.
- a "p-Hyde polypeptide” refers to a polypeptide having an amino acid sequence correspondmg to p-Hyde
- a "non-p-Hyde polypeptidell refers to a polypeptide having an amino acid sequence corresponding to a protein which is not substantially identical to the p-Hyde protein, e.g., a protein which is different from the p-Hyde protein and which is derived from the same or a different organism.
- the p-Hyde polypeptide can correspond to all or a portion of a p-Hyde protein, preferably at least one biologically active portion of a p-Hyde pioiein
- tlie fusion protein is an p-Hyde-immunoglobuIin fusion protehi hi which all or part of p-Hyde is fused to sequences derived from a member of the imniu oglobulin protein family.
- Tl e p-Hyde immunoglobulin fusion proteins of the invention can be incorporated into pharmaceutical compositions and administered to a subject
- the present invention furtlier provides methods of preparing a polynucleotide comprising polymerizing nucleotides to yield a sequence comprised of at least eight consecutive nucleotides of the p-Hyde locus; and methods of preparing a polypeptide comprising polymerizing amino acids to yield a sequence comprising at least five amino acids encoded within the p-Hyde locus.
- the present invention provides an isolated polynucleotide comprising all, or a portion of the p-Hyde locus or of a mutated p-Hyde locus. Such polynucleotides may be antisense polynucleotides.
- the present invention also provides a recombinant construct comprising such an isolated polynucleotide, for example, a recombinant construct suitable for expression in a transformed host cell.
- Also provided by the present invention are methods of detecting a polynucleotide comprising a portion of the p-Hyde locus or its expression product in an analyte. Such methods may further comprise the step of amplifying tl e portion of the p-Hyde locus, and may further include a step of providing a set of polynucleotides which are primers for amplification of said portion of the p-Hyde locus. The method is useful for either diagnosis of the predisposition to cancer or the diagnosis or prognosis of cancer.
- This invention also provides a method of producing a polypeptide encoded by isolated DNA molecule, which comprises growing the above host vector system under suitable conditions permitting production of the polypeptide and recovering the polypeptide so produced.
- Furtlier, tlie isolated polypeptide encoded by the isolated DNA molecule may be linlced 5 to a second polypeptide encoded by a nucleic acid molecule to form a fusion protein by expression in a suitable host cell
- the second nucleic acid molecule encodes beta-galactosidase
- Other nucleic acid molecules which are used to form a fusion protein are known to those skilled in the art.
- This invention provides an antibody which specifically binds to the polypeptide encoded by the isolated DNA molecule.
- the antibody is a monoclonal antibody.
- tlie antibody is a polycional antibody.
- the antibody or DNA molecule may be labelled with a detectable marker including, but not limited to: a radioactive label, or a colorimetric, a luminescent, or a fluorescent marker, or gold.
- Radioactive labels include, but are not limited to: 3 H, l4 C, 32 P, 33 P, 35 S, 36 C1, 5 l Cr, 57 Co, 5y Co, 5 Fe, ⁇ Y, 125 I, 131 L and ] 86 Re.
- Fluorescent markers include but are not . limited to: fluorescein, rhoda ⁇ une and auramine.
- Colorimetric markers include, but are not limited to: biotin, and digoxigenin. Methods of producing the polycional or monoclonal antibody are known to those of ordinary skill in tlie art. 0
- the antibody or nucleic acid molecule complex may be detected by a second antibody which may be linked to an enzyme, such as alkaline phosphatase or horseradish peroxidase.
- an enzyme such as alkaline phosphatase or horseradish peroxidase.
- Other enzymes which may be employed are well known to one of ordinary skill in the ait.
- Specifically binds to an antibody or “specifically immunoreactive with”, when referring to a protein or peptide, refers to a binding reaction which is determinative of the presence of the p-Hyde of tlie invention in the presence of a heterogeneous population of proteins and other biologies including viruses other than the p-Hyde. 0
- the specified antibodies bind to tlie p-Hydc antigens and do not bind in a significant amount to other antigens present in the sample. Specific binding to an antibody under such conditions may require an antibody 00/71564
- thai is selected for its specificity for a particular protein.
- antibodies raised to the human p-Hyde immunogen descnbed herein can be selected to obtain antibodies specifically mimunoreactive with the p-Hyde proteins and not with other proteins. These antibodies recognize proteins homologous to the human p-Hyde protein.
- a variety of lm unoassay formats may be used to select antibodies specifically immunorcactive with a particular protein
- solid-phase ELISA l munoassays are routinely used to select monoclonal antibodies specifically immuiioreactive with a protein. See Harlow and Lane [32] for a description of hnmunoassay formats and conditions that can be used to dete ⁇ nine specific lmniunoreactivity.
- This invention provides a method to select specific regions on the polypeptide encoded by the isolated DNA molecule of the DNA vims to generate antibodies.
- the protein sequence may be detenni ⁇ ed from tl e cDNA sequence.
- Amino acid sequences may be analyzed by methods well known to those skilled in tlie art to determine whether they produce hydrophobic or hydrophilic regions in the proteins which they build.
- hydrophobic regions are well known to form the part of the protein that is inserted into the lipid bilay ⁇ r of tlie cell membrane, while hydrophilic legions are located on the cell surface, in an aqueous envnonment.
- the hydrophilic regions will be more immunogenic than the hydrophobic regions.
- tlie hydrophilic amino acid sequences may be selected and used to generate antibodies specific to polypeptide encoded by the isolated nucleic acid molecule encoding the DNA virus.
- the selected peptides may be prepared using commercially available machines.
- DNA, such as a cDNA or a fragment thereof, may be cloned and expressed and the resulting polypeptide recovered and used as an immunogen.
- Polycional antibodies against these peptides may be produced by immunizing animals using tlie selected peptides.
- Monoclonal antibodies aie prepared using hybridoma technology by fusing antibody producing B cells from immunized animals with myeloma cells and selecting the resulting hybridoma cell line producing the desired antibody.
- monoclonal antibodies may be produced by in vitro techniques known to a person of ordinary skill in the art. These antibodies are useful to detect the expression of polypeptide encoded by tlie isolated DNA molecule of the DNA virus in living animals, in humans, or in biological tissues or fluids isolated from animals or humans.
- the antibodies may be detectably labelled, utilizing conventional labelling techniques well-known to the art.
- the antibodies may be radiolabelled using, for example, radioactive isotopes such as 3 H, ]2s I, 131 I, and 3:> S.
- the antibodies may also be labelled using fluorescent labels, enzyme labels, free radical labels, or bacteriophage labels, using techniques known in the art. Typical fluorescent labels include fluorescein isothiocyanate, rhodamine, phycoerytlirin, phycocyanin, alophycocyanin, and Texas Red.
- enzymes may be coupled to other molecules by covalent links, the possibility also exists that they might be used as labels for the production of tracer materials.
- Suitable enzymes include alkaline phosphatase, beta-galactosidase, glucose-6-pl ⁇ osphate dehydrogenase, maleate dehydrogenase, and peroxidase.
- Two principal types of enzyme immunoassay are the enzyme-linked immunosorbent assay (ELISA), and the homogeneous enzyme immunoassay, also known as enzyme-multiplied immunoassay (EMIT, Syva Corporation, Palo Alto, CA).
- ELISA enzyme-linked immunosorbent assay
- EMIT enzyme-multiplied immunoassay
- separation may be achieved, for example, by the use of antibodies coupled to a solid phase.
- the EMIT system depends on deactivation of the enzyme in the bracer-antibody complex; the activity can thus be measured without the need for a separation step.
- chemiluminescent compounds may be used as labels.
- Typical chemiluminescent compounds include luminol, isoluinin ⁇ l, aromatic acridinium esters, imidazoles, acridinium salts, and oxalate esters.
- bioluminescent compounds may be utilized for labelling, tlie bioluminescent compounds including luciferin, luciferase, and aequorin.
- the antibody may be employed to identify and quantify inimunologic counterparts (antibody or antigenic polypeptide) utilizing techniques well-known to the art.
- RIA radioimmunoassay
- antibodies to tlie human p-Hyde can be used to detect the agent in the sample.
- the sequence being targeted is expressed in transfected cells, preferably bacterial cells, and purified.
- the product is injected into a mammal capable of producing antibodies.
- Either monoclonal or polycional antibodies (as well as any recombinant antibodies) specific for the gene product can be used in various immunoassays.
- assays include competitive immunoassays, radioimmunoassays, Western blots, ELISA, indirect im unofluorescent assays and the like. For competitive immunoassays, see Harlow and Lane [32] at pages 567-573 and 584-589.
- kits suitable for use by a medical specialist may be prepared to dele ⁇ nine the presence or absence of predetermined binding activity or predetermined binding activity capability to suspected target cells.
- one class of such kits will contain at least the labeled polypeptide or its binding partner, for instance an antibody specific thereto, and directions, of course, depending upon the method selected, e.g., "competitive,” “sandwich,” “DASP” and tlie like
- the kits may also contain peripheral reagents such as buffers, stabilizers, etc.
- Monoclonal antibodies or recombinant antibodies may be obtained by various techniques familiar to those skilled in the art.
- spleen cells or other lymphocytes from an animal immunized with a desired antigen are immortalized, commonly by fusion with a myeloma cell (see, Kohler and Milstein [50], incorporated herein by reference).
- Alternative methods of immortalization include transformation with Epstein Barr Virus, oncogenes, or retroviruses, or other methods well known in tlie art. Colonies arising from single immortalized cells are screened for production of antibodies of the desired specificity and affinity for tlie antigen, and yield of the monoclonal antibodies produced by such cells may be enhanced by various techniques, including injection into tlie peritoneal cavity of a vertebrate host.
- New techniques using recombinant phage antibody expression systems can also be used to generate monoclonal antibodies. See for example: McCafferty, J et al. [64]; Hoogenboom, H.R. et al. [39]; and Marks, J.D. et al. [60].
- Such peptides may be produced by expressing the specific sequence in a recombinantly engineered cell such as bacteria, yeast, filamentous fungal, insect (especially employing baculoviral vectors), and mammalian cells.
- a recombinantly engineered cell such as bacteria, yeast, filamentous fungal, insect (especially employing baculoviral vectors), and mammalian cells.
- the expression of natural or synthetic nucleic acids encoding viral protein will typically be achieved by operably linking the desired sequence or portion thereof to a promoter (which is either constitutive or inducible), and incorporated into an expression vector.
- the vectors are suitable for replication or integration in either prokaryotes or eukaryoies.
- Typical cloning vectors contain antibiotic resistance markers, genes for selection of transformants, inducible or regulatable promoter regions, and translation terminators that are useful for the expression of viral genes.
- Suitable eukaryote hosts may include plant cells, insect cells, mammalian cells, yeast, and filamentous fungi
- the peptides derived form the nucleic acids, peptide fragments are produced by recombinant technology may be purified by standard techniques well known to those of skill in the art Recombinantly produced sequences can be directly expressed or expressed as a fusion protein The protein is then purified by a combination of cell lysis (e.g , sonication) and affinity chromatography. For fusion products, subsequent digestion of the fusion protein with an appropriate proteolytic enzyme releases tlie desired peptide.
- the proteins may be purified to substantial purity by standard techniques well known in the art, including selective precipitation with such substances as ammonium sulfate, column chromatography, immunopurification methods, and others. See, for instance, Scopes, R [84], incorporated herein by reference.
- This invention is directed to analogs of the isolated nucleic acid and polypeptide which comprise the amino acid sequence as set forth above
- the analog may have an N-iermmal methionine or an N-terminal polyhistidine optionally attached to tlie N or COOH terminus of tlie polypeptide which comprise the ammo acid sequence
- this invention contemplates peptide fragments of the polypeptide which result from proteolytic digestion products of the polypeptide.
- the de ⁇ vative of the polypeptide has one or more chemical moieties attached thereto, hi another embodiment the chemical moiety is a water soluble polymer In anotlier embodiment the chemical moiety is polyethylene glycol In another embodiment the chemical moiety is mon-, di-, t ⁇ - or tetrapegylated. In another embodiment the chemical moiety is N-terminal monopegylated.
- a polypeptide "fragment,” “portion” or “segment” is a stretch of amino acid residues of at least about five lo seven contiguous amino acids, often at least about seven to nine contiguous amino acids, typically at least about nine to 13 contiguous amino acids and, most preferably, at least about 20 to 30 or more contiguous amino acids.
- Tlie polypeptides of tl e present invention may be coupled to a solid-phase support, e.g., nitrocellulose, nylon, column packing materials (e.g., Sepharose beads), magnetic beads, glass wool, plastic, metal, polymer gels, cells, or other substrates.
- a solid-phase support e.g., nitrocellulose, nylon, column packing materials (e.g., Sepharose beads), magnetic beads, glass wool, plastic, metal, polymer gels, cells, or other substrates.
- Such supports may take the form, for example, of beads, wells, dipsticks, or membranes.
- Target region refers to a region of the nucleic acid which is amplified and/or detected.
- target sequence refers to a sequence with which a probe or primer will form a stable hybrid under desired conditions.
- PEG polyethylene glycol
- Attachment of polyethylene glycol (PEG) to compounds is particularly useful because PEG has very low toxicity in mammals (Carpenter et al., 1971).
- PEG adduct of adenosine deaminase was approved in the United States for use in humans for the treatment of severe combined immunodeficiency syndrome.
- a second advantage afforded by the conjugation of PEG is that of effectively reducing the immunogenicty and antigenicity of heterologous compounds.
- a PEG adduct of a human protein might be useful for the treatment of disease in other mammalian species without the risk of triggering a severe immune response.
- the compound of the present invention may be delivered in a microencapsulation device so as to reduce or prevent an host immune response against the compound or against cells which may produce the compound.
- the compound of the present mvention may also be delivered microencapsulated in a membrane, such as a liposome.
- PEG reagents for reaction with protein amino groups include active esters of carboxylic acid or carbonate derivatives, particulaiiy those in which the leaving groups are N-hydroxysuccinimide, p-nitrophenol, imidazole or l -hydroxy-2-nitiObenzene-4-sulfonate.
- PEG derivatives containing maleimido or haloaceiyl groups are useful reagents for the modification of protein free sulfhydryl groups.
- PEG reagents containing amino hydrazine or hydrazide groups are useful for reaction with aldehydes generated by pe ⁇ odate oxidation of carbohydrate groups in proteins.
- the amino acid residues of tlie polypeptide described herein are preferred to be hi the "L" isomeric form.
- the residues in the "D" lsomcric form can be substituted for any L-amino acid residue, as long as the desired functional pioperty of lectin activity is retained by the polypeptide.
- NH 2 refers to the free amino group present at the am o terminus of a polypeptide.
- COOH refers to the free carboxy group present at the carboxy teimmus of a polypeptide.
- Abbreviations used herein are in keeping with standard polypeptide nomenclature, J Biol Chem , 243 3552-59 (1969).
- ammo-acid residue sequences are represented herein by formulae whose left and right orientation is in the conventional direction of a ino-te ⁇ ninus to carboxy-ter inus Furthermore, it should be noted that a dash at the beginning or end of an amino acid residue sequence indicates a peptide bond to a further sequence of one or more amino-acid residues
- Synthetic polypeptide prepared using the well known techniques of solid phase, liquid phase, or peptide condensation techniques, or any combination thereof, can include natural and unnatural a o acids.
- Amino acids used for peptide synthesis may be standard Boc (N-amino protected N-t-butyloxycarbo ⁇ yl) amino acid resin with the standard deproiecting, neutralization, coupling and wash protocols of the original solid phase procedure of Mcrrifield (1963, J Am Chem. Soc. 85:2149-2154), or the base-labile N-amino protected 9-fiuorenylmethoxycarbonyl (Fmoc) amino acids first described by Carpmo and Han (1972. j. Org Chem 37.3403-3409).
- polypeptide of the invention may comprise D-amino acids, a combination of D- and L-amino acids, and various "designer" amino acids (e.g. , methyl amino acids, C-methyl amino acids, and N-methyl amino acids, etc.) to convey special properties
- Synthetic amino acids include omithmc for lysine, fluorophenylalatiine for phenylalanine, and noiieucine for leucine or isoJeucine. Additionally, by assigning specific amino acids at specific 00/71564
- the peptides may compnse a special amino acid at the C-terminus which incorporates either a C0 2 H or CONH 2 side chain to simulate a free glycine or a glycine-amide group Another way to consider this special residue would be as a D or L amino acid analog with a side chain consisting of the linker or bond to the bead.
- the pseudo-free C-terminal lesidue may be of tlie D or the L optical configuration, in another embodiment, a racenuc mixture of D and L-isomers may be used.
- pyroglutamate may be included as tlie N-terminal residue of the peptide.
- pyroglutamate is not amenable to sequence by Edman degradation, by limiting substitution to only 50% of the peptides on a given bead with N-te ⁇ ninal pyroglutamate, there will remain enough non-pyroglutamate peptide on the bead for sequencing.
- this technique could be used for sequencing of any peptide that incorporates a residue resistant to Edman degradation at the N-tenmnus. Other methods to characterize individual peptides that demonstrate desired activity are described in detail infra.
- tlie present invention envisions preparing peptides that have more well defined structural properties, and the use of peptidomimetics, and peptidomimetic bonds, such as ester bonds, to prepare peptides with novel properties.
- a peptide may be generated that incorporates a reduced peptide bond, i.e., R ⁇ -CH 2 -NH-R 2 , where Ri and R 2 are ammo acid residues or sequences.
- a reduced peptide bond may be introduced as a dipeptide subunit.
- Such a molecule would be resistant to peptide bond hydrolysis, e.g. , protease activity.
- Such peptides would provide ligands with unique function and activity, such as extended half-lives in vivo due to resistance to metabolic breakdown, or protease activity. Furthermore, it is well known that in certain systems constrained peptides show enhanced functional activity (Hruby, 1982, Life Sciences 31 : 189-199; Hruby et al., 1990, Biochem J. 268:249-262); the present invention provides a method to produce a constrained peptide that incorporates random sequences at al) other positions.
- a constrained, cyclic or rigidized peptide may be prepared synthetically, provided that in at least two positions in the sequence of the peptide an amino acid or amino acid analog is inserted that provides a chemical functional group capable of cross-linking to constrain, cyclise or rigidize the peptide after treatenenl to form the cross-link. Cyclization will be favored when a turn-inducing amino acid is incorporated.
- Examples of a ino acids capable of cross-linking a peptide are cysteine to form disulfide, aspartic acid to form a lactone or a lactase, and a chelator such as carboxyl-glutarnic acid (Gla) (Bachem) to chelate a transition metal and form a cross-link.
- a chelator such as carboxyl-glutarnic acid (Gla) (Bachem) to chelate a transition metal and form a cross-link.
- Protected carboxyl glutamic acid may be prepared by modifying the synthesis described by Zee-Cheng and Olson (1980, Biophys. Biochem. Res. Commun. 94: 1 128-11 32).
- a peptide in which the peptide sequence comprises at least two amino acids capable of cross-linking may be treated, e.g.
- the present invention provides sttategies to systematically prepare cross-links. For example, if four cysteine residues are incorporated in the peptide sequence, different protecting groups may be used (Hiskey, 1981, in The Peptides: Analysis, Synthesis, Biology. Vol. 3, Gross and Meienliofer, eds., Academic Press: New York, pp. 137-167; Ponsanti et aL, 1990, Tetrahedron 46:8255-8266). The first pah of cysteine may be deprotected and oxidized, then the second set may be deprotected and oxidized. In this way a defined set of disulfide cross-links may be fo ⁇ ned.
- a pah of cysteine and a pair of collating amino acid analogs may be incorporated so that the cross-links are of a different chemical nature.
- the following non-classical amino acids may be incorporated in the peptide in order to introduce particular conformational motifs: l,2,3.4-tetrahydroisoquinohne-3-carboxylate (Kazmierski et al., 1991 , J Am. Chem Soc.
- ammo acid analogs and peplidominielics may be incorporated into a peptide to induce or favor specific secondary structures: LL-Acp
- the present invention further provides for modification or derivatization of the polypeptide or peptide of the invention.
- Modifications of peptides are well known to one of ordinary skill, and include phosphorylation, carboxymethylation, and acylation. Modifications may be effected by chemical or enzymatic means. In another aspect, glycosylaled or fatty acylated peptide derivatives may be prepared. Preparation of O 00/71564
- glycosylated or fatty acylated peptides is well Icnown in the art.
- Fatty acyl peptide derivatives may also be prepared.
- a free amino group (N-terminal or lysyl) may be acylated, e.g. , myristoylated.
- an amino acid comprising an aliphatic side chain of the structure -(CH 2 ) n CH3 may be incorporated in tlie peptide.
- Chemical Moieties for Derivatization may be selected from among water soluble polymers.
- the polymer selected should be water soluble so that the component to which it is attached does not precipitate in an aqueous environment, such as a physiological environment.
- the polymer will be pharmaceutically acceptable.
- One skilled in the ait will be able to select the desired polymer based on such considerations as whether the polymer/component conjugate will be used therapeutically, and if so, the desired dosage, circulation time, resistance to proteolysis, and other considerations. For the present component or components, these may be ascertained using the assays provided herein. O 00/71564
- the water soluble polymer may be selected from tlie group consisting of, for example, polyethylene glycol, copolymers of etliylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1 , 3-dioxolane, poly-1 , 3, -trioxane, ethylene/maleic anliydride copolyroer, polyamino cids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)poly ⁇ thyiene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethyl ene oxide co- polymers, polyoxyethylated polyols and polyvinyl alcohol.
- Polyethylene glycol propionaldenhyde may have advantages in manufacturing due to its stability in water.
- the number of polymer molecules so attached may vary, and one skilled in the art will be able to ascertain the effect on function.
- One may mono-derivatize, or may provide for a di-, tri-, tetra- or some combination of derivatization, with the same or different chemical moieties (e g. , polymers, such as different weights of polyethylene giycols).
- the proportion of polymer molecules to component or components molecules will vary, as will their concentrations in the reaction mixture.
- the optimum ratio in tenns of efficiency of reaction in that there is no excess unreacted component or components and polymer
- the desired degree of derivatization e.g., mono, di-, tri-, etc.
- the molecular weight of the polymer selected whether the polymer is branched or unbranched, and the reaction conditions.
- This mvention provides a method for determining whether a subject carries a mutation in the p-Hyde gene which comprises- a) obtaining an appropriate nucleic acid sample from the subject; and(b) dete ⁇ nining whether the nucleic acid sample from step (a) is, or is derived from, a nucleic acid which encodes mutant p-Hyde so as to thereby determine whether a subject carries a mutation in the p-Hyde gene.
- the nucleic acid sample in step (a) comprises mRNA co ⁇ esponding to the transcript of DNA encoding a mutant p-Hyde
- the determining of step (b) comprises: (i) contacting the mRNA with the oligonucleotide under conditions permitting binding of tlie mRNA to the oligonucleotide so as to fonn a complex; (ii) isolathig the complex so formed; and (iii) identifying the mRNA in the isolated complex so as to thereby determine whether the mRNA is, or is derived from, a nucleic acid which encodes O 00/71564
- the determining of step (b) comprises: i) contacting the nucleic acid sample of step (a), and the isolated nucleic acid with restriction enzymes under conditions permitting the digestion of tl e nucleic acid sample, and the isolated nucleic acid mto distinct, distinguishable pieces of nucleic acid; (ii) isolating the pieces of nucleic acid; and (iii) comparing the pieces of nucleic acid de ⁇ ved from the nucleic acid sample with the pieces of nucleic acid derived from the isolated nucleic acid so as to thereby determine whether the nucleic acid sample is, or is de ⁇ ved from, a nucleic acid which encodes mutant p-FIyde.
- the present invention further provides methods of preparing a polynucleotide comprising polymerizing nucleotides to yield a sequence comprised of at least eight consecutive nucleotides of the p-Hyde gene, and methods of preparing a polypeptide comprising polymerizing amino acids to yield a sequence comprising at least five amino acids encoded within the p-Hyde gene.
- This invention provides a method for determining whether a subject carries a mutation m the p-Hyde gene which comprises, (a) obtaining an appropriate nucleic acid sample from the subject; and (b) determining whether the nucleic acid sample from step (a) is, or is derived from, a nucleic acid which encodes mutant p-Hyde so as to thereby determine whether a subject carries a mutation in the p-Hyde gene, h one embodiment the nucleic acid sample in step (a) comprises mRNA corresponding to the transcript of DNA encoding a mutant p-Hyde, and wherem the determining of step (b) comprises: (i) contacting the mRNA with the oligonucleotide under conditions permitting binding of the mRNA to the oligonucleotide so as to form a complex, (ii) isolating the complex so formed; and (iii) identifying the mRNA in the isolated complex so as to thereby determine whether the mRNA is,
- nucleic acid sample and the isolated nucleic acid into distinct, distinguishable pieces of nucleic acid; (ii) isolating tlie pieces of nucleic acid; and (iii) comparing the pieces of nucleic acid derived from the nucleic acid sample with the pieces of nucleic acid derived from the isolated nucleic acid so as to thereby determine whether the nucleic acid sample is, or is derived from, a nucleic acid which encodes mutant p-Hyde.
- Detection of point mutations or variations may be accomplished by molecular cloning of tlie p-Hyde allele(s) and sequencing tlie allele(s) using techniques well known in the art.
- the gene sequences can be amplified directly from a genomic DNA preparation from the tumor tissue, using known techniques. The DNA sequence of the amplified sequences can then be determined.
- coli mutS protein (Modrich, 1991 ); and 6) ailele-specific PCR (Rano & Kidd, 198.9).
- primers are used which hybridize at their 3' ends to a particular p-Hyde mutation. If the particular p-Hyde mutation is not present, an amplification product is not observed.
- Amplification Refractory Mutation System (ARMS) can also be used, is disclosed in European Patent Application Publication No. 0332435 and in Newton et al., 1989. Insertions and deletions of genes can also be detected by cloning, sequencing and amplification.
- restriction fragment length polymorphism (RFLP) probes for the gene or surrounding marker genes can be used to score alteration of an allele or an insertion in a polymorphic fragment.
- RFLP restriction fragment length polymorphism
- Such a method is particularly useful for screening relatives of an affected individual for the presence of the p-Hyde mutation found in that individual.
- Other techniques for detecting insertions and deletions as Icnown in the art can be used.
- DNA probes can be used to detect mismatches, through enzymatic or chemical cleavage. See, e.g., Cotton et al., 1988; Shenk et al., 1975; Novack et al., O 00/71564
- mismatches can be detected by shifts in the electrophoretic mobility of mismatched duplexes relative to matched duplexes. See, e.g., Caxiello, 1988.
- riboprobes or DNA probes tlie cellular mRNA or DNA which might contain a mutation can be amplified using PCR (see below) before hybridization. Changes in DNA of the p-Hyde gene can also be detected using Southern hybridization, especially if the changes are gross rearrangements, such as deletions and insertions.
- non-PCR based screening assays hybridizes a nucleic acid probe (or an analog such as a methyl phosphonate backbone replacing the normal phosphodiester), to the low level DNA target.
- This probe may have an enzyme covalently linked to tlie probe, such that the covalent linkage does not interfere with tlie specificity of the hybridization.
- This enzyme-probe-conjugate-target nucleic acid complex can then be isolated away from the free probe enzyme conjugate and a substrate is added for enzyme detection. Enzymatic activity is observed as a change in color development or luminescent output resulting in a 10 sup 3 -10 sup 6 increase in sensitivity.
- Two-step label amplification methodologies are known in the art. These assays work on the principle that a small ligand (such as digoxigcnin, biotin, or the like) is attached to a nucleic acid probe capable of specifically binding p-Hyde. Allele specific probes are also contemplated within the scope of this example.
- the small ligand attached to the nucleic acid probe is specifically recognized by an antibody-enzyme conjugate.
- digoxigerun is attached to the nucleic acid probe. Hybridization is detected by an antibody-alkaline phosphatase conjugate which turns over a chemiluminescent substrate.
- an antibody-alkaline phosphatase conjugate which turns over a chemiluminescent substrate.
- the small ligand is recognized by a second Iigand-enzyme conjugate that is capable of specifically complexing to the first ligand.
- a well known embodiment of this example is the biotin-avidin type of interactions.
- the nucleic acid probe assays of this invention will employ a cocktail of nucJeic acid probes capable of detecting p-Hyde.
- a cocktail of nucJeic acid probes capable of detecting p-Hyde.
- the number of different probes is alternatively 2, 3, or 5 different nucleic acid probe sequences.
- the cocktail includes probes capable of patients with alternate-specific mutations identified in populations of patients with alterations in p-Hyde.
- any number of probes can be used, and will preferably include probes corresponding to the major gene mutations identified as predisposing an individual to breast cancer.
- This invention provides a method for screening a tumor sample from a human subject for a somatic alteration in a p-Hyde gene in said tumor which comprises gene comparing a first sequence selected form the group consisting of a p-Hyde gene from said tumor sample, p-Hyde RNA from said tumor sample and p-Hyde cDNA made from mRNA from said tumor sample with a second sequence selected from the group consisting of p-Hyde gene from a nontumor sample of said subject, p-Hyde RNA from said nontumor sample and p-Hyde cDNA made from mRNA from said nontumor sample, wherein a difference in the sequence of the p-Hyde gene,p-Hyde RNA or p-Hyde cDNA from said tumor sample from the sequence of the p-Hyde gene, p-Hyde RNA or p-Hyde cDNA from said nontumor sample indicates a somatic alteration in the
- This invention provides a method for screening a tumor sample from a human subject for the presence of a somatic alteration in a p-Hyde gene in said tumor which comprises comparing p-Hyde polypeptide from said rumor sample from said subject to p-Hyde polypeptide from a nontumor sample from said subject to analyze for a difference between the polypeptides, wherein said comparing is performed by (i) detecting either a full length polypeptide or a truncated polypeptide in each sample or (ii) contacting an antibody which specifically binds to either an epitope of an altered p-Hyde polypeptide or an epitope of a wild-type p-Hyde polypeptide to the p-Hyde polypeptide from each sample and detecting antibody binding, wherein a difference between the p-Hyde polypeptide from said tumor sample from the p-Hyde polypeptide from said nontumor sample indicates the presence of a somatic alteration in the
- This invention is particularly useful for screening compounds by using the p-Hyde polypeptide or binding fragment thereof in any of a variety of drug screening techniques.
- the p-Hyde polypeptide or fragment employed in such a test may either be free in solution, affixed to a solid support, or borne on a cell surface.
- One method of drug screening utilizes eucaryotic or procaryotic host cells which are stably transformed with recombinant polynucleotides expressing tlie polypeptide or fragment, preferably in competitive binding assays. Such cells, either in viable or fixed form, can be used for standard binding assays.
- the present invention provides methods of screening for drugs comprising contacting such an agent with a p-Hyde polypeptide or fragment thereof and assaying (i) for the presence of a complex between the agent and the p-Hyde polypeptide or fragment, or (ii) for the presence of a complex between the p-Hyde polypeptide or fragment and a ligand, by methods well Icnown in the art.
- the p-Hyde polypeptide or fragment is typically labeled.
- Free p-Hyde polypeptide or fragment is separated from that present in a proteimprotein complex, and the amount of free (i.e., uncomplexed) label is a measure of the binding of the agent being tested to p-Hyde or its interference with p-Hyde :ligand binding, respectively.
- Anotlier technique for drug screening provides high throughput screening for compounds having suitable binding affinity to the p-Hyde polypeptides and is described in detail in Geysen, PCT published application WO 84/03564, published on Sep. 13, 1984. Briefly stated, large numbers of different small peptide test compounds are synthesized on a solid substrate, such as plastic pins or some other surface. The peptide test compounds are reacted with p-Hyde polypeptide and washed. Bound p-Hyde polypeptide is then detected by methods well known in the art.
- Purified p-Hyde can be coated directly onto plates for use in the aforementioned drug screening techniques.
- non-neutralizing antibodies to the polypeptide can be used to capture antibodies to immobilize the p-Hyde polypeptide on the solid phase.
- This invention also contemplates the use of competitive drug screening assays in which neutralizing antibodies capable of specifically binding the p-Hyde polypeptide compete with a test compound for binding to the p-Hyde polypeptide or fragments thereof. In this manner, the antibodies can be used to detect the presence of any peptide which shares one or more antigenic determinants of the p-Hyde polypeptide.
- a further technique for drug screening involves the use of host eukaryotic cell lines or cells (such as described above) which have a nonfunctional p-Hyde gene. These host cell lines or cells are defective at the p-Hyde polypeptide level. The host cell lines or cells are grown in the presence of drug compound. The rate of growth of the host cells is measured to determine if the compound is capable of regulating the growth of p-Hyde defective cells.
- the goal of rational drug design is to produce structural analogs of biologically active polypeptides of interest or of small molecules with which they interact (e.g., agonists, antagonists, inhibitors) in order to fashion drags which are, for example, more active or stable forms of the polypeptide, or which, e.g., enhance or interfere with the function of a polypeptide in vivo. See, e.g., Hodgson, 1991.
- one first determines tlie three-dimensional structure of a protein of interest (e.g., p-Hyde polypeptide) or, for example, of the p-Hyde-receptor or ligand complex, by x-ray 00/71564
- drugs which have, e.g., improved p-Hyde polypeptide activity or stability or which act as inhibitors, agonists, antagonists, etc. of p-Hyde polypeptide activity.
- p-Hyde polypeptide activity e.g., improved p-Hyde polypeptide activity or stability or which act as inhibitors, agonists, antagonists, etc. of p-Hyde polypeptide activity.
- sufficient amounts of the p-Hyde polypeptide may be made available to perform such analytical studies as x-ray crystallography.
- the knowledge of the p-Hyde protein sequence provided herein will guide those employing computer modeling techniques in place of, or in addition to x-ray crystallography.
- This invention provides a method for identifying a chemical compound which is capable inducing susceptibility to cell death which comprises: (a) contacting the p-Hyde with a chemical compound under conditions permitting binding between the p-Hyde and the chemical compound;(b) detecting specific binding of the chemical compound to the p-Hyde; and (c) determining whether the chemical compound inhibits the p-Hyde so as to identify a chemical compound which is capable of capable inducing susceptibility to cell death.
- Useful diagnostic techniques include, but are not limited to fluorescent in situ hybridization (FISH), direct DNA sequencing, PFGE analysis, Southern blot analysis, single stranded conformation analysis (SSCA), Rnase protection assay, ailele-specific oligonucleotide (ASO), dot blot analysis and PCR-SSCP, as discussed in detail further below.
- FISH fluorescent in situ hybridization
- PFGE analysis direct DNA sequencing
- SSCA single stranded conformation analysis
- ASO ailele-specific oligonucleotide
- dot blot analysis PCR-SSCP
- a rapid preliminary analysis to detect polymorphisms in DNA sequences can be performed by looking at a series of Southern blots of DNA cut with one or more restriction enzymes, preferably with a large number of restriction enzymes. Each blot contains a series of normal individuals and a series of tumors. Southern blots displaying hybridizing fragments (differing in length from control DNA when probed with sequences near or including the p-Hyde gene) indicate a possible mutation. If restriction enzymes which produce very large restriction fragments are used, then pulsed field gel electrophoresis (PFGE) is employed.
- PFGE pulsed field gel electrophoresis
- Detection of point mutations may be accomplished by molecular cloning of the p-Hyde allele(s) and sequencing the allele(s) using techniques well known tn the art.
- the gene sequences can be amplified directly from a genomic DNA preparation from the tumor tissue, using known techniques. The DNA sequence of the amplified sequences can then be dete ⁇ nined.
- SSCA single stranded conformation analysis
- DGGE denaturing gradient gel electrophoresis
- RNase protection assays Finkelstein et al., 1990; Kinszleret al., 1991
- ASOs ailele-specific oligonucleotides
- coli mutS protein (Modrich, 1991); and 6) ailele-specific PCR (Ratio & Kidd, 1989).
- primers are used which hybridize at their 3' ends to a particular p-Hyde mutation. If the particular p-Hyde mutation is not present, an amplification product is not observed.
- Amplification Refractory Mutation System (ARMS) can also be used, as disclosed in European Patent Application Publication No. 0332435 and in Newton et al., 1989. Insertions and deletions of genes can also be detected by cloning, sequencing and amplification.
- restriction fragment length polymorphism (RFLP) probes for the gene or surrounding marker genes can be used to score alteration of an allele or an insertion in a polymorphic fragment.
- RFLP restriction fragment length polymorphism
- Such a method is particularly useful for screening relatives of an affected individual for the presence of the p-Hyde mutation found in that individual.
- Other techniques for detecting insertions and deletions as known in the art can be used.
- DNA probes can be used to detect mismatches, through enzymatic or chemical cleavage. See, e.g., Cotton et al., 1988; Shenk et aL, 1975; Novack et al., 1986.
- mismatches can be detected by shifts in the electrophoretic mobility of mismatched duplexes relative to matched duplexes. See, e.g., Cariello, 1988.
- the cellular mRNA or DNA which might contain a mutation can be amplified using PCR (see below) before hybridization. Changes in DNA of the p-Hyde gene can also be detected using Southern hybridization, especially if the changes are gross rearrangements, such as deletions and insertions.
- DNA sequences of the p-Hyde gene which have been amplified by use of PCR may also be screened using ailele-specific probes.
- These probes are nucleic acid oligomers, each of which contains a region of the p-Hyde gene sequence harboring a known mutation.
- one oligomer may be about 30 nucleotides in length, corresponding to a portion of the p-Hyde gene sequence.
- Hybridization of ailele-specific probes with amplified p-Hyde sequences can be performed, for example, on a nylon filter. Hybridization to a particular probe under stringent hybridization conditions indicates the presence of the same mutation in the tumor tissue as in the ailele-specific probe.
- Alteration of p-Hyde mRNA expression can be detected by any techniques known in the art. These include Northern blot analysis, PCR amplification and RNase protection. Diminished mRNA expression indicates an alteration of the wild-type p-Hyde gene. 00/7156
- Alteration of wild-type p-Hyde genes can also be detected by screening for alteration of wild-type p-Hyde protein.
- monoclonal antibodies immunoreactive with p-Hyde can be used to screen a tissue. Lack of cognate antigen would indicate a p-Hyde mutation.
- Antibodies specific for products of mutant alleles could also be used to detect mutant p-Hyde gene product.
- immunological assays can be done in any convenient formats Icnown in the art. These include Western blots, immiinohistochemical assays and ELISA assays. Any means for detecting an altered p-Hyde protein can be used to detect alteration of wild-type p-Hyde genes.
- assays such as protein binding determinations, can be used.
- assays can be used which detect p-Hyde biochemical function. Finding a mutant p-Hyde gene product indicates alteration of a wild-type p-Hyde gene. Mutant p-Hyde genes or gene products can also be detected in other human body samples, such as serum, stool, urine and sputum.
- the present invention also provides for fusion polypeptides, comprising p-Hyde polypeptides and fragments.
- Homologous polypeptides may be fusions between two or more p-Hyde polypeptide sequences or between the sequences of p-Hyde and a related protein.
- heterologous fusions may be constructed which would exhibit a combination of properties or activities of tlie derivative proteins. For example, ligand-binding or other domains may be "swapped" between different new fusion polypeptides or fragments.
- Such homologous or heterologous fusion polypeptides may display, for example, altered strength or specificity of binding.
- Fusion partners include immunoglobulins, bacterial beta -galactosidase, trpE, protein A, beta -lactamase, alpha amylase, alcohol dehydrogenase and yeast alpha mating factor. See, e.g., Godowski et al. , 1988. Fusion proteins will typically be made by either recombinant nucleic acid methods, as described below, or may be chemically synthesized. Techniques for the synthesis of polypeptides are described, for example, in Merrifield, 1963.
- Probes for p-Hyde alleles may be derived from tlie sequences of the p-Hyde region or its cDNAs.
- the probes may be of any suitable length, which span all or a portion of the p-Hyde region, and which allow specific hybridization to the p-Hyde region. If the target sequence contains a sequence identical to that of the probe, the probes may be short, e.g., in the range of about 8-30 base pairs, since tl e hybrid will be relatively stable under even stringent conditions. If some degree of mismatch is expected with the probe, i.e., if it is suspected that the probe will hybridize to a variant region, a longer probe may be employed which hybridizes to tlie target sequence with the requisite specificity.
- the probes will include an isolated polynucleotide attached to a label or reporter molecule and may be used to isolate other polynucleotide sequences, having sequence similarity by standard methods. For techniques for preparing and labeling probes see, e.g., Sambrook et al. , 1989 or Ausubel et al., 1992.
- Probes comprising synthetic oligonucleotides or other polynucleotides of the present invention may be derived from naturally occurring or recombinant single- or double-stranded polynucleotides, or be chemically synthesized. Probes may also be labeled by nick translation, Klenow fill-in reaction, or other methods known in the art.
- Tlie probes may also be used to determine whether mRNA encoding p-Hyde is present in a cell or tissue.
- This invention provides a method of inhibiting the growth of cancer cells, comprising the steps of obtaining the cells and contacting the cells of tlie subject with a replication-deficient adenovirus type 5 expression vector comprising an adenovirus genome having a deletion in the El and E3 region of the genome and an insertion within the region of a nucleic acid encoding p-Hyde under the control of a Rous Sarcoma virus promoter, thereby inhibiting the growth of the prostate cancer cells.
- This invention provides a method of inhibiting the growth a prostate cancer cells, comprising: 1) obtaining a sample of prostate cells from a subject; 2) contacting the cells with a replication deficient adenovirus type 5 expression vector which comprises an adenovirus genome having a deletion in the El and E3 regions of the genome and an insertion within the regions of a p-Hyde cDNA under the control of a Rous Sarcoma virus promoter; and 3) introducing the cells into the subject, thereby inhibiting the growth of the cancer cells.
- This invention provides a method of suppressing the growth of cancer cells in a subject, comprising introducing into tlie cancer cell an amount of a nucleic acid encoding a p-Hyde protein, a nucleic acid encoding a fragment of p-Hyde protein, or the nucleic acid encoding a mutant p-Hyde protein, thereby suppressing the growth of cancer cells in the subject.
- This invention provides a method of suppressing growth of cancer cells in a subject, comprising administering to the subject a pharmaceutical composition comprising a therapeutically effective amount of a nucleic acid encoding a p-Hyde protein, a nucleic acid encoding a fragment of p-Hyde protein, or the nucleic acid encoding a mutant p-Hyde protein and a pharmaceutical acceptable carrier or diluent, thereby suppressing the growth of cancer cells in the subject.
- apoptotic response was assessed using DNA laddering assay. DNAs were extracted after the respective treatment (24 hours with 1 mM Hydroxyurea followed by 24 hours with 0.1 mM 5'-dFUrd) and analyzed on 1.6% agarose gel electrophoresis. In agreement with cell cycle analyses, apoptotic response of the stable transfectants ATI -HI and AT3-H1 (pcHYDE transfected AT-1 and AT-3) are consistently and significantly higher relative to both parental (AT-1 and AT-3) and pcDNA-transfected parental cell lines (ATI -pel and AT3-pcl).
- the enhanced apoptotic response in AT1-H1 and AT3-H1 transfectant after hydroxyurea treatment is the result of "thymineless death" (Kyprianou, 1994, Kyprianou et al., 1994) leading to depletion of intracellular thymidJne-5-triphos ⁇ hate (TTP) pools through indirect inhibition of thymidylate synthetase by fluorodeoxyuridine.
- TTP thymidJne-5-triphos ⁇ hate
- the exact mechanism of the apoptosis itself in association with TTP depletion is not Icnown. Taken together, these data suggest that the apoptotic response in the pcHYDE stable trausfectants is likely due to the downstream effect of pcHYDE gene product.
- This invention provides a method of inducing susceptibility to apoptosis of cancer cells, comprising introducing into the cancer cell an amount of a nucleic acid encoding a p-Hyde protein, a nucleic acid encoding a fragment of p-Hyde protein, or the nucleic acid encoding a mutant p-Hyde protein, thereby inducing susceptibility to apoptosis.
- This invention provides a method of inducing susceptibility to apoptosis of cancer cells in a subject, comprising administering to the subject a pharmaceutical composition comprising a therapeutically effective amount of a nucleic acid encoding a p-Hyde protein, a nucleic acid encoding a fragment of p-Hyde protein, or the nucleic acid encoding a mutant p-Hyde protein and a pharmaceutical acceptable carrier or diluent, thereby inducing susceptibility to apoptosis.
- AT3 cell line was transfected with pcHYDE, a construct of p-Hyde in mammalian expression vector of ⁇ cDNA3.1(-) under G418 selection.
- pcHYDE a construct of p-Hyde in mammalian expression vector of ⁇ cDNA3.1(-) under G418 selection.
- AT-3 cell line was also transfected with the vector only and the stable transfectants obtained was designated as AT3-pc.
- the tumor growth of the parental cell line of AT-3 and in stable transfecta ⁇ t AT3-H1 and AT3-H2 have been evaluated in vivo.
- p-Hyde l as the dual ability to act like a tumor suppressor gene and induce susceptibility to apoptosis by what may be p53 independent pathways.
- the growth of prostate tumors in rats was greatly inhibited by p-Hyde.
- prostate cancer cells expressing p-Hyde were more sensitive to UV DNA damage driving these cells into cell programmed death.
- Analysis of DNA repair enzyme activity suggests a defect resulting in the presence of intact (6-4) PP and decreased cell survival by colony forming assay.
- the capacity of p-Hyde to induce susceptibility to apoptosis is not limited to UV DNA damage.
- Chemotherapy agent Fluorodeoxyuridine, a pyrimidine antimetabolite which is related to fluorouraciJ (5-FU) and has been used for treatment of a wide variety of human epithelial malignancies, also more readily induces apoptosis in prostate cancer cell expressing p-Hyde.
- cancer cells expressing p-Hyde are also more susceptible to gamma radiation.
- the mechanisms of cellular DNA injury are different for UV, gamma radiation, and Fluorodeoxyuridine suggesting that the ability to make cells more susceptible to apoptosis is more global in action.
- This unique function of p-Hyde may represent a new class genes that induce susceptibility to apoptosis.
- This invention provides a method of suppressing cancer cells, comprising hitroducing into the cancer cell an amount of a nucleic acid encoding a p-Hyde protein, a nucleic acid encoding a fragment of p-Hyde protein, or the nucleic acid encoding a mutant p-Hyde protein, thereby inducing susceptibility to apoptosis.
- This invention provides a method of suppressing cancer cells a subject, comprising administering to the subject a pharmaceutical composition comprising a therapeutically effective amount of a nucleic acid encoding a p-Hyde protein, a nucleic acid encoding a fragment of p-Hyde protein, or the nucleic acid encoding a mutant p-Hyde protein and a pharmaceutical acceptable carrier or diluent, thereby suppressing cancer cells.
- This invention provides a method of treating a subject with cancer which comprises administering to the subject a pharmaceutical composition comprising a therapeutically effective amount of a nucleic acid encoding a p-Hyde protehi, a nucleic acid encoding a fragment of p-Hyde protein, or tl e nucleic acid encoding a mutant p-Hyde protein and a pharmaceutical acceptable carrier or diluent, thereby treating tlie subject with cancer.
- This invention provides a method of treating a subject with cancer, comprising: 1) administering to the subject a pharmaceutical composition comprising a therapeutically effective amount of a nucleic acid encoding a p-Hyde protein, a nucleic acid encoding a fragment of p-Hyde protein, or the nucleic acid encoding a mutant p-Hyde protein in combination with radiation, chemotherapy, or UV mimetic drugs; and 2) a pharmaceutical acceptable carrier or diluent, thereby treating the subject with cancer.
- the unique functional features of the p-Hyde gene may be exploited for the treatment of hyperproliferative disorders and cancer.
- One effective therapeutic strategy for example, may be tlie treatment of carcinoma cells expressing p-Hyde with chemotherapy agents or UV mimetic drugs (such as acetylaminofluorine).
- chemotherapy agents such as acetylaminofluorine
- UV mimetic drugs such as acetylaminofluorine
- Tumors transduced with vectors containing p-Hyde may not only be directly suppressed by p-Hyde as demonstrated in this study, but also when treated in combination with DNA damaging therapy such as chemotherapy, UV mimetic drugs, or radiation, have even a greater anti -cancer effect. Since gene therapy will target cancer cells, then enhancement of apoptosis will occur more selectively in cancer cells following DNA damage (UV, radiation, or chemotherapy).
- This invention a method of treating a subject with cancer, comprising administering to the subject a therapeutically effective amount of a pharmaceutical composition
- a pharmaceutical composition comprising 1 ) an adenovirus type 5 expression vector which comprises an adenovirus genome having a deletion h the El and E3 regions of the genome and an insertion within the regions of a full length sense p-Hyde cDNA under the control of a Rous Sarcoma virus promoter, and 2) a suitable carrier or diluent, thereby treating the subject with cancer
- the cancer is selected from a group consisting of: melanoma; lymphoma; leulcemia; and prostate, colorectal, pancreatic, breast, brain, or gastric carcinoma.
- the present invention provides the means necessary for production of gene-based therapies diiected at cancer cells
- therapeutic agents may take the form of polynucleotides comprising all or a portion of the p-Hyde locus placed in appropriate vectors or delivered to target cells in more direct ways such that the function of the p-Hyde protein is reconstituted.
- Therapeutic agents may also take the form of polypeptides based on either a portion of, or the entire protehi sequence of p-Hyde. These may functionally replace the activity of p-Hyde in vivo.
- a suitable bodily fluid includes, but is not limited to- serum, plasma, cerebrospinal fluid, lymphocytes, urine, transudates, or exudates.
- the suitable bodily fluid sample is serum or plasma.
- the bodily fluid sample may be cells from bone marrow, or a supernatant from a cell culture Methods of obtaining a suitable bodily fluid sample from a subject are known to those skilled in the art. Methods of determining tl e level of antibody or antigen include, but are not limited to: ELISA, IF A, and Western blotting.
- the diagnostic assays of the invention can be nucleic acid assays such as nucleic acid hybridization assays and assays which detect amplification of specific nucleic acid to detect for a nucleic acid sequence of the human p-Hyde described herein.
- Target specific probes may be used in the nucleic acid hybridization diagnostic.
- the probes are specific for or complementary to tlie target of interest. For precise allelic differentiations, the probes should be about 14 nucleotides long and preferably about 20-30 nucleotides.
- nucleic acid probes are about 50 to about 1000 nucleotides, most preferably about 200 to about 400 nucleotides.
- the specific nucleic acid probe can be RNA or DNA polynucleotide or oligonucleotide, or their analogs.
- the probes may be single or double stranded nucleotides.
- the probes of the invention may be synthesized enzymatically, usmg methods well known in the art (e g., nick translation, primer extension, reverse transcription, the polymerase chain reaction, and others) or chemically (e.g., by methods such as the phosphora idite method described by Beaucage and Carruthers [19], or by the triester method according to Matteucci, et al. [62], both incorporated herein by reference).
- An alternative means for determining tlie presence of the human p-Hyde is in situ hybridization, or more recently, in situ polymerase chain reaction.
- In situ PCR is described in Neuvo et al. [71], Intracellular localization of polymerase chain reaction (PCR)-amplif ⁇ ed Hepatitis C cDNA; Bagasra et al. [10], Detection of Human Immunodeficiency virus type 1 provirus in mononuclear cells by in situ polymerase chain reaction; and Heniford et al. [35], Variation in cellular EGF receptor mRNA expression demonstrated by in situ reverse transcriptase polymerase chain reaction.
- PCR polymerase chain reaction
- In situ hybridization assays are well Icnown and are generally described in Methods Enzymol. [67] incorporated by reference herein, hi an in situ hybridization, cells are fixed to a solid support, typically a glass slide. The cells are then contacted with a hybridization solution at a moderate temperature to permit annealing of target-specific probes that are labelled.
- the probes are preferably labelled w th radioisotopes or fluorescent reporters.
- the above described probes are also useful for in-situ hybridization or in order to locate tissues which express this gene, or for other hybridization assays for the presence of this gene or its MRNA in various biological tissues. In-situ hybridization is a sensitive localization method which is not dependent on expression of antigens or native vs. 5 denatured conditions.
- inhibitory nucleic acid therapy approaches can be classified into those that target DNA sequences, those that target RNA sequences (including pre-mRNA and mRNA), those that target proteins (sense strand approaches), and those that cause l o cleavage or chemical modification of the target nucleic acids.
- Nucleic acids can be designed to bind to the major groove of the duplex DNA to fonn a triple helical or "triplex" structure.
- inhibitory nucleic acids are designed to bind to regions of 1 single stranded DNA resulting from the opening of the duplex DNA during replication •or transcription.
- inhibitory nucleic acids are designed to bind to mRNA or mRNA precursors. Inhibitory nucleic acids are used to prevent maturation of pre-mRNA. 20 Inhibitory nucleic acids may be designed to interfere with RNA processing, splicing or translation.
- the inhibitory nucleic acids can be targeted to mRNA.
- tlie inhibitory nucleic acids are designed to specifically block translation of the encoded protein.
- the inhibitory nucleic acid can be used to selectively suppress certain cellular functions by inhibition of translation of mRNA encoding critical proteins.
- an inhibitory nucleic acid complementary to regions of c-myc mRNA inhibits c-myc protein expression in a human promyelocytic leukemia cell line, HL60, which overexpresses the c-myc proto-oncogene. See Wiclcstrom EX., et al. [93] and
- inhibitory nucleic acids targeting mRNA have been shown to work by several different mechanisms to inhibit translation of the encoded protein(s).
- the inhibitory nucleic acids can be used to induce chemical inactivation or cleavage of the target genes or mRNA. Chemical inactivation can occur by the induction of crosslinks between the inhibitory nucleic acid and tl e target nucleic acid withm the cell. Other chemical modifications of the target nucleic acids induced by appropriately derivatized inhibitory nucleic acids may also be used.
- Cleavage, and therefore inactivation, of the target nucleic acids may be effected by attaching a substituent to the inhibitory nucleic acid which can be activated to induce cleavage reactions.
- the substituent can be one that affects either chemical, or enzymatic cleavage.
- cleavage can be induced by the use of ribozymes or catalytic RNA.
- the inhibitory nucleic acids would comprise either naturally occurring RNA (ribozymes) or synthetic nucleic acids with catalytic activity,
- compositions could mean therapeutically effective amounts of polypeptide products of the invention together with suitable diluents, preservatives, solubilizers, emulsifiers, adjuvant and or earners useful in SCF (stem cell factor) therapy.
- a “therapeutically effective amount” as used herein refers to that amount which provides a therapeutic effect for a given condition and administration regimen.
- Such compositions are liquids or lyophilized or otherwise dried foniiulations and include diluents of various buffer content (e.g., Tris-HCL, acetate, phosphate), pH and ionic strength, additives such as albumin or gelatin to prevent absorption to surfaces, detergents (e.g..
- solubilizing agents e.g., glycerol, polyethylene glycerol
- anti-oxidants e.g., ascorbic acid, sodium metabisulfite
- preservatives e.g., Thimerosal, benzyl alcohol, parabens
- bulking substances or tonicity modifiers e.g., lactose, mannitol
- covalent attachment of polymers such as polyethylene glycol to the protein, coraplexation with metal ions, or incorporation of tlie material into or onto particulate preparations of polymeric compounds such as polylactic acid, polglycolic acid, hydrogels, etc, or onto liposomes, microemulsions, micelles, unilamellar or multilamellar vesicles, erythrocyte ghosts, or spheroplasts.
- compositions will influence tl e physical state, solubility, stability, rate of in vivo release, and rate of in vivo clearance of SCF.
- the choice of compositions will depend on the physical and chemical properties of the protein having SCF activity. For example, a product derived from a membrane-bound form of SCF may require a formulation containing detergent.
- Controlled or sustained release compositions include formulation in lipophilic depots (e.g., fatty acids, waxes, oils).
- paniculate compositions coated with polymers e.g., poloxamers or poloxamines
- SCF coupled to antibodies directed agamst tissue-specific receptors, ligands or antigens or coupled to ligands of tissue-specific receptors.
- compositions of tlie invention incorporate particulate forms protective coatings, protease inhibitors or permeation enhancers for various routes of administration, including parenteral, pulmonary, nasal and oral.
- pharmaceutical composition is administered parenterally, paracancerally, transmucosally, transde ⁇ nally, intramuscularly, intravenously, intradermaly, subcutaneously, intraperitonealy, intraventricularly, intracranialy.
- pharmaceutically acceptable carrier include, but are not limited to, 0.01-0. IM and preferably 0.05M phosphate buffer or 0.8% saline.
- pharmaceutically acceptable carriers may be aqueous or non-aqueous solutions, suspensions, and emulsions.
- non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and mjectable organic esters such as ethyl oieate.
- Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
- Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's or fixed oils.
- Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers such as those based on Ringer's dextrose, and the like. Preseivatives and other additives may also be present, such as, for example, antimicrobials, antioxidants, collating agents, inert gases and the like.
- adjuvant refers to a compound or mixture that enhances the immune response to an antigen.
- An adjuvant can serve as a tissue depot that slowly releases the antigen and also as a lymphoid system activator that non-specifically enhances the immune response (Hood et al., Immunology, Second Ed , 1984, Benjamin/Cummings: Menlo Park, California, p. 384).
- a primary challenge with an antigen alone, in the absence of an adjuvant will fail to elicit a humoral or cellular immune response.
- Adjuvant include, but are not limited to, complete Freund's adjuvant, incomplete Freund's adjuvant, saponin, mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil or hydrocarbon emulsions, keyhole limpet hemocyanins, dinitrophenol, and potentially useful human adjuvant such as BCG (hacille Calmette-G ⁇ enn) and Corynebacterium parvum.
- the adjuvant is pharmaceutically acceptable.
- Conn-oiled or sustained release compositions include fo ⁇ nulation in hpophilic depots (e.g. fatty acids, waxes, oils).
- hpophilic depots e.g. fatty acids, waxes, oils.
- particulate compositions coated with polymers e.g. poloxamers or poloxamines
- the compound coupled lo antibodies directed against tissue-specific receptors, ligands or antigens or coupled to ligands of tissue-specific receptors.
- Other embodiments of the compositions of the invention incorporate particulate forms protective coatings, protease inhibitors or permeation enhancers for various routes of administration, including parenteral, pulmonary, nasal and oral.
- Such modifications may also increase the compound's solubility in aqueous solution, eliminate aggregation, enhance the physical and chemical stability of the compound, and greatly reduce the immunogenicity and reactivity of the compound.
- the desired in vivo biological activity may be achieved by the administration of such polymer-compound abducts less frequently or in lower doses than with the unmodified compound. Dosages.
- the sufficient amount may include but is not limited to from about 1 ⁇ g/kg to about 1000 mg/kg.
- the amount may be 10 mg/ g.
- the pharmaceutically acceptable form of tl e composition includes a pharmaceutically acceptable carrier.
- compositions which contain an active component
- an active component is well understood in the art.
- such compositions are prepared as an aerosol of the polypeptide delivered to tlie nasopharynx or as injectables, either as liquid solutions or suspensions, however, solid forms suitable for solution hi, or suspension in, liquid prior to injection can also be prepared.
- the preparation can also be emulsified.
- the active therapeutic ingredient is often mixed with excipients which are pharmaceutically acceptable and compatible with the active ingredient. Suitable excipients are, for example, water, salme, dextrose, glycerol, ethanol, or the like and combinations thereof.
- the composition can contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents which enhance the effectiveness of the active ingredient.
- An active component can be formulated into the therapeutic composition as neutralized pharmaceutically acceptable salt forms.
- Pharmaceutically acceptable salts include the acid addition salts (fanned with the free amino groups of the polypeptide or antibody molecule) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed from the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, 2-ethylaroino ethanol, histidine, procaine, and the like.
- a composition comprising "A” (where "A” is a single protein, DNA molecule, vector, etc.) is substantially free of “B” (where “B” comprises one or more contaminating proteins, DNA molecules, vectors, etc.) when at least about 75%> by weight of the proteins, DNA, vectors (depending on the category of species to which A and B belong) in the composition is "A”
- "A” comprises at least about 90% by weight of the A+B species in the composition, most preferably at least about 99% by weight.
- terapéuticaally effective amount is used herein to mean an amount sufficient to reduce by at least about 15 percent, preferably by at least 50 percent, more preferably by al least 90 percent, and most preferably prevent, a clinically significant deficit in the activity, function and response of the host.
- the component or components of a therapeutic composition of tlie invention may be introduced parenterally, tra ⁇ smucosally, e.g , orally, nasally, pulmoiiarailly, or rectally, or transde ⁇ nally.
- administration is parenteral, e.g., via intravenous injection, and also including, but is not limited to, intra-arteriole, intramuscular, intradermal, subcutaneous, lnttaperitoneal, intraventricular, and mtracranial administration.
- unit dose when used in reference to a therapeutic composition of the present invention refers to physically discrete units suitable as unitary dosage for humans, each unit containing a predetermined quantity of active material calculated to produce tlie desired therapeutic effect in association with tlie required diluent; i.e., carrier, or vehicle.
- a method is also provided of supplying wild-type p-Hyde function to a cell which carries mutant p-Hyde alleles. Supplying such a function should suppress neoplastic growth of tl e recipient cells.
- the wild-type p-Hyde gene or a part of tl e gene may be introduced into the cell in a vector such that tlie gene remains extrachromosomal. In such a situation, the gene will be expressed by the cell from the extrachromosomal location.
- a " gene fragment is introduced and expressed in a cell carrying a mutant p-Hyde allele
- the gene fragment should encode a part of the p-Hyde protein wliich is required for non-neoplastic growth of the cell. More preferred is the situation where the wild-type p-Hyde gene or a part thereof is introduced into the mutant cell in such a way that it rcco bines with the endogenous mutant p-Hyde gene present in the cell. Such recombination requires a double recombination event which results in the co ⁇ ection of the p-Hyde gene mutation.
- Vectors for introduction of genes both for recombination and for extrachromosomal maintenance are known in the art, and any suitable vector may be used.
- the p-Hyde gene or fragment may be employed in gene therapy methods in order to increase the amount of the expression products of such genes in cancer cells.
- gene therapy is particulaiiy appropriate for use in both cancerous and pre-cancerous cells, in which the level of p-Hyde polypeptide is absent or diminished compared to normal cells. It may also be useful to increase the level of expression of a given p-Hyde gene even in those rumor cells in which the mutant gene is expressed at a "normal" level, but the gene product is not fully functional
- Gene therapy would be carried out according to generally accepted methods, for example, as described by Friedman, 1991.
- Cells from a patient's tumor would be first analyzed by the diagnostic methods described above, to ascertain the production of p-Hyde polypeptide in the rumor cells.
- a virus or plasmid vector (see further details below), containing a copy of the p-Hyde gene linked to expression control elements and capable of replicating inside the rumor cells, is prepared.
- Suitable vectors are known, such as disclosed in U.S. Pat. No. 5,252,479 and PCT published application WO 93/07282.
- the vector is then inj ected into the patient, either locally at the site of tlie rumor or systemically (in order to reach any rumor cells That may have metastasized to other sites). If the transfected gene is not permanently incorporated into the genome of each of the targeted minor cells, the treatment may have to be repeated periodically.
- Gene transfer systems known in the art may be useful in tlie practice of the gene therapy methods of the present invention. These include viral and nonviral transfer methods.
- viruses have been used as gene transfer vectors, including papovaviruses, e.g., SV40 (Madzak et al., 1992), adenovirus (Berlcner, 1992; Berlcner et al., 1988; Gorziglia and Kapikian, 1992; Quanthi et aL, 1992; Rosenfeld et al., 1992; Wilkinson et al., 1992; Stratford-Pen ⁇ caudet et al., 1990), vaccinia virus (Moss, 1 92), adeno-associated virus (Muzyczka, 1992; Ohi et al., 1990), herpesviruses including HSV and EBV (Margolskee, 1992; Johnson et al., 1992; Fink et al., 1992; Breakfield and Geller, 1987; Freese et aL, 1990), and retroviruses of avian (Brandyo adhy y and Temin
- Peptides which have p-Hyde activity can be supplied to cells which carry mutant or missing p-Hyde alleles.
- Tl e sequence of the p-Hyde protein is disclosed (SEQ ID NO:2).
- Protein can be produced by expression of the cDNA sequence in bacteria, for example, using Icnown expression vectors.
- p-Hyde polypeptide can be extracted from p-Hyde-producing mammalian cells.
- the techniques of synthetic chemistry can be employed to synthesize p-Hyde protein. Any of such techniques can provide the preparation of the present invention which comprises the p-Hyde protein. The preparation is substantially free of other human proteins. This is most readily accomplished by synthesis in a microorganism or m vitro.
- P-Hyde molecules can be introduced into cells by microinjection or by use of liposomes, for example. Alternatively, some active molecules may be taken up by cells, actively or by diffusion. Extracellular application of the p-Hyde gene product may be sufficient to affect rumor growth. Supply of molecules with p-Hyde activity should lead to partial reversal of the neoplastic state. Other molecules with p-Hyde activity (for example, peptides, drugs or organic compounds) may also be used to effect such a reversal. Modified polypeptides having substantially similar function are also used for peptide therapy.
- the active compound can be delivered in a vesicle, in particular a liposome (see Langer, Science 249:1527-1533 (1990); Treat et aL, in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez-Berestein and Fidler (eds.), Liss, New York, pp. 353-365 (1989); Lopez-Berestein, ibid., pp. 317-327; see generally ibid).
- a liposome see Langer, Science 249:1527-1533 (1990); Treat et aL, in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez-Berestein and Fidler (eds.), Liss, New York, pp. 353-365 (1989); Lopez-Berestein, ibid., pp. 317-327; see generally ibid).
- the therapeutic compound can be delivered in a controlled release system.
- the polypeptide may be administered using intravenous infusion, an implantable osmotic pump, a transdermal patch, liposomes, or other modes of administration.
- a pump may be used (see Langer, supra; Sefton, CRC Crit. Ref. Biomed. Eng. 14:201 (1987); Buchwald et al., Surgery 88:507 (1980); Saudek et al., N. Engl. J. Med.
- polymeric materials can be used (see Medical Applications of Controlled Release, Langer and Wise (eds.), CRC Pres., Boca Raton, Florida (1974); Controlled Drug Bioavailability, Drug Product Design and Performance, Smolen and Ball (eds.), Wiley, New York (1984); Ranger and Peppas, J. Macromol. Sci. Rev. Macromol. Chem. 23:61 (1983); see also Levy et al., Science 228:190 (1985); During et al., Ann. Neurol. 25:351 (1989); Howard et al., J. Neurosurg. 71 :105 (1989)).
- a controlled release system can be placed in proximity of the therapeutic target, i.e., the brain, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, in Medical Applications of Controlled Release, supra, vol. 2, pp. 115-138 (1984)).
- a controlled release device is introduced into a subject in proximity of the site of inappropriate immune activation or a tumor.
- Other controlled release systems are discussed in the review by Langer (Science 249:1527-1533 (1990)).
- a subject in whom administration of an active component as set ' forth above is an effective therapeutic regimen for a bacterial infection is preferably a human, but can be any animal.
- tlie methods and pharmaceutical compositions of the present invention are particularly suited to administration to any animal, particularly a mammal, and including, but by no means limited to, domestic animals, such as feline or canine subjects, farm animals, such as but not limited to bovine, equine, caprine, ovine, and porcine subjects, wild animals (whether in the wild or in a zoological garden), research animals, such as mice, rats, rabbits, goats, sheep, pigs, dogs, cats, etc., i.e. , for veterinary medical use.
- a therapeutically effective dosage of the active component is provided.
- a therapeutically effective dosage can be dete ⁇ nined by the ordinary skilled medical worker based on patient characteristics (age, weight, sex, condition, complications, other diseases, etc.), as is well Icnown in the art. Furthermore, as further routine studies are conducted, more specific information will emerge regarding appropriate dosage levels for treatment of various conditions in various patients, and tlie ordinary skilled worker, considering tlie therapeutic context, age and general health of the recipient, is able to ascertain proper dosing. Generally, for intravenous injection or infusion, dosage may be lower than for intraperitoneal, intramuscular, or other route of administration.
- the dosing schedule may vary, depending on tlie circulation half-life, and the fo ⁇ uulation used.
- the compositions are administered in a manner compatible with the dosage formulation ui the therapeutically effective amount. Precise amounts of active ingredient required to be administered depend on the judgment of the practitioner and are peculiar to each individual. However, suitable dosages may range from about 0.1 to 20, preferably about 0.5 to about 10, and more preferably one to several, milligrams of active ingredient per kilogram body weight of individual per day and depend on tl e route of administration. Suitable regimes for initial administration and booster shots are also variable, but are typified by an initial administration followed by repeated doses at one or more hour intervals by a subsequent injection or other administration. Alternatively, continuous intravenous infusion sufficient to maintain concentrations of ten nanomolar to ten micromolar in the blood are contemplated
- p-Hyde replacement therapy could be used similarly in conjunction with chemo- or radiotherapeutic intervention.
- a "target" cell with the expression vector and at least one DNA damaging agent.
- the cell is contacted with a single composition or pharmacological formulation that includes both agents, or by contacting the cell with two distinct compositions or formulations, at the same time, wherein one composition includes the vectoi and the other includes the DNA damaging agent.
- treatment with the vector may precede or follow the DNA damaging agent treatment by intervals ranging from minutes to weeks. Protocols and methods are Icnown to those skilled in tlie art.
- DNA damaging agents or factors are known to those skilled in the art and means any chemical compound or treatment method that induces DNA damage when applied to a cell. Such agents and factors mclude radiation and waves that induce DNA damage such as, gamma -irradiation, X-rays, UV-irradiation, microwaves, electronic emissions, and the like. A variety of chemical compounds, also described as "chemotherapeutic agents", function to induce DNA damage, all of which are intended to be of use in the combined treatment methods disclosed herein. Chemotherapeutic agents contemplated to be of use.
- the invention also encompasses the use of a combmation of one or more DNA damaging agents, whether radiation-based or actual compounds, -such as tlie use of X-rays with cisplatui or the use of cisplatin with etoposide.
- the tumor cells may be contacted with the DNA damaging agent by administering to the subject a therapeutically effective amount of a pharmaceutical composition comprising a DNA damaging compound such as, ad ⁇ amycin, 5-fluorourac ⁇ I, etoposide, camptothecin, aclinomycin-D, mitomycin C, or more preferably, cisplatin.
- the DNA damaging agent may be prepared and used as a combined therapeutic composition, or kit, by combining it with a p-Hydc expression construct, as descnbed above.
- Agents that directly cross-link nucleic acids, specifically DNA, are envisaged and are shown herein, to eventuate DNA damage leading to a synergistic antineoplastic combination.
- Agents such as cisplatin, and other DNA alkylating may be used.
- Cisplatin has been widely used to treat cancer, with efficacious doses used in clinical applications of 20 mg/m ⁇ 2 > for 5 days every three weeks for a total of three courses. Cisplatin is not absorbed orally and must therefore be delivered via injection intravenously, subcutaneously, intratumorally or intraperitoneally.
- Agents that damage DNA also include compounds that interfere with DNA replication, mitosis and chromosomal segregation.
- chemotherapeutic compounds include adriamycin, also known as doxorubicin, etoposide, verapamil, podophyllotoxin, and tlie like. Widely used in a clinical setting for the treatment of neoplasms, these compounds are administered through bolus injections intravenously at doses ranging from 25-75 mg/m ⁇ 2 > at 21 day intervals for adriamycin, to 35-50 mg/m ⁇ 2 > for etoposide intravenously or double the intravenous dose orally.
- nucleic acid precursors and subunits also lead to DNA damage.
- nucleic acid precursors have been developed.
- agents that have undergone extensive testing and are readily available are particularly useful.
- agents such as 5-fluorouracil (5-FU) are preferentially used by neoplastic tissue, making this agent particularly useful for targeting to neoplastic cells.
- 5-FU is applicable in a wide range of carriers, including topical, however intravenous administration with doses ranging from 3 to 15 mg/kg/day being commonly used.
- DNA damaging factors include what are commonly known as gamma -rays, X-rays, and/or the directed delivery of radioisotopes to tumor cells.
- Other forms of DNA damaging factors are also contemplated such as microwaves and UV-irradiation. It is most likely that all of these factors effect a broad range of damage DNA, on the precursors of DNA, the replication and repair of DNA, and the assembly and maintenance of chromosomes.
- Dosage ranges for X-rays range from daily doses of 50 to 200 roentgens for prolonged periods of time (3 to 4 weeks), to single doses of 2000 to 6000 roentgens.
- Radioisotopes vary widely, and depend on the half-life of the isotope, the strength and type of radiation emitted, and the uptake by the neoplastic cells.
- Several non-viral methods for the transfer of expression constructs into cultured mammalian cells also are contemplated by the present invention.
- helper cell lines may be derived from human cells such as human embryonic kidney cells, muscle cells, hematopoietic cells or other human embryonic mesenchymal or epithelial cells.
- the helper cells may be derived from the cells of other mammalian species that are permissive for hunian adenovirus. Such cells include, e.g , Vero cells or other monkey embryonic mesenchymal or epithelial cells.
- the preferred helper cell line is 293.
- the active compound can be delivered in a vesicle, in particular a liposome (see Langer, Science 249:1527-1533 (1990); Treat et al., in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez-Berestein and Fidler (eds.), Liss, New York, pp. 353-365 (1989); Lopez-Berestein, ibid., pp. 317-327; see generally ibid).
- a liposome see Langer, Science 249:1527-1533 (1990); Treat et al., in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez-Berestein and Fidler (eds.), Liss, New York, pp. 353-365 (1989); Lopez-Berestein, ibid., pp. 317-327; see generally ibid).
- tlie therapeutic compound can be delivered in a controlled release system.
- the polypeptide may be administered using intravenous infusion, an implantable osmotic pump, a transdermal patch, liposomes, or other modes of administration.
- a pump may be used (see Langer, supra; Sefton, CRC Crit. Ref. Bionied. Eng. 14:201 (1987); Buchwald et aL, Surgery 88:507 (1980); Saudek et al., N. Engl. J. Med. 321 :574 (1989)).
- polymeric materials can be used (see Medical Applications of Controlled Release, Langer and Wise (eds.), CRC Pres., Boca Raton, Florida (1974); Controlled Drug Bioavailability, Drug Product Design and Performance, Smolen and Ball (eds.), Wiley, New York (1984); Ranger and Peppas, J. Macromol. Sci. Rev. Macromol. Chem. 23:61 (1983); see also Levy et al., Science 228: 190 (1985); During et al., Ann. Neural. 25:351 (1989); Howard et al., J. Neui-osurg. 71 : 105 (1989)).
- a controlled release system can be placed in proximity of the therapeutic target, i.e., the brain, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, in Medical Applications of Controlled Release, supra, vol. 2, pp. 115-138 (1984)).
- a controlled release device is introduced into a subject in proximity of the site of inappropriate immune activation or a tumor.
- Other controlled release systems are discussed in the review by Langer (Science 249: 1527-1533 (1990)).
- compositions of the present invention are particularly suited to administration to a mammal, preferable a human subject.
- a therapeutically effective dosage of the active component is provided.
- a therapeutically effective dosage can be determined by the ordinary skilled medical worker based on patient characteristics (age, weight, sex, condition, complications, other diseases, etc.), as is well known in the art. Furthermore, as further routine studies are conducted, more specific information will emerge regarding appropriate dosage levels for treat ⁇ ient of various conditions in variotis patients, and the ordinary skilled worker, considering the therapeutic context, age and general health of the recipient, is able to ascertain proper dosing. Generally, for intravenous injection or infusion, dosage may be lower than for intraperitoneal, intramuscular, or other route of administration. The dosing schedule may vary, depending on the circulation half-life, and the formulation used.
- compositions are administered in a manner compatible with the dosage formulation in the therapeutically effective amount.
- Precise amounts of active ingredient required to be administered depend on the judgment of the practitioner and are peculiar to each individual.
- suitable dosages may range from about 0.1 to 20, preferably about 0.5 to about 10, and more preferably one to several, milligrams of active ingredient per kilogram body weight of individual per day and depend on the route of administration.
- Suitable regimes for initial administration and booster shots are also variable, but are typified by an initial administration followed by repeated doses at one or more hour intervals by a subsequent injection or other administration.
- continuous intravenous infusion sufficient to maintain concentrations of ten nanomolar to ten micromolar in the blood are contemplated.
- the present invention provides a kit comprising the all tlie essential materials and reagents required for inhibiting prostate tumor cell proliferation, transforming prostate cells or detecting prostate cancer cells, may be assembled together hi a kit.
- This generally will comprise selected expression constructs.
- Also included may be various media for replication of the expression constructs and host cells for such replication.
- Such kits will comprise distinct containers for each individual reagent.
- the liquid solution preferably is an aqueous solution, with a sterile aqueous solution being particularly preferred.
- the expression construct may be formulated into a pharmaceutically acceptable syringeable composition.
- the container means may itself be an inhalent, syringe, pipette, eye dropper, or other such like apparatus, from which tlie formulation may be applied to an infected area of the body, such as the lungs, injected into an animal, or even applied to and mixed with the other components of the kit.
- the components of the kit may also be provided in dried or lyophilized forms. When reagents or components are provided as a dried form, reconstitution generally is by the addition of a suitable solvent. It is envisioned that the solvent also may be provided ui another container means.
- kits of the present invention also will typically include a means for containing the vials in close confinement for commercial sale such as, e.g., injection or blow-molded plastic containers into which the deshed vials are retained.
- the kits of the mvention also may comprise, or be packaged with, an instrument for assisting with the injection/administration or placement of the ultimate complex composition within the body of an animal.
- an instrument may be an inhalent, syringe, pipette, forceps, measured spoon, eye dropper or any such medically approved delivery vehicle.
- EXAMPLE p-Hyde induces susceptibility to induction of cell progra ⁇ imed cell death in prostate cancer
- rat prostatic cancer cell lines Two rat prostatic cancer cell lines (anaplastic tumor, low metastatic AT-1 and highly metastatic MAT-LyLu) were used for tlie cDNA competition hybridization strategy (Rhialdy and Steiner, 1997). Other Dumiing rat prostate cancer cell lines used for Northern analyses were AT-3, MAT-LyLu, MAT-Lu and G. These cell lines were derived from established in-vivo Dtmning R3327 rat prostatic tumor sublines and further developed as m-vilro cell lines by Isaacs et al at Johns Hopkins Oncology Center, Baltimore, Maryland (Isaacs et al., 1986).
- Human prostate cancer cell lines PPC-1, LNCaP, TSU and DU145 used for Northern analyses were obtained from American Tissue Culture Collection, Roclcville, Maryland. All cells were grown in RPMI 1640 medium (Mediatech, Herndon, Virginia) in the presence of 10% fetal calf serum, 50 units of penicillin G and 50 ⁇ g streptomycin sulfate per l and 250 ⁇ M dexamethasone as previously described (Isaacs et al, 1986).
- Northern blot analyses Total R As were isolated from cell lines during exponential growth (70% confluence) by using RNAZol B as suggested by the supplier (Tel-Test, Inc., Friendswood, Texas) and subjected to Northern blot analyses.
- Reverse and forward PCR primer were designed and used to amplify 1.35 kb of the p-Hyde sequence representing the 1467 bases of its open reading frame.
- the PCR product was radiolabeled by random oligo labeling technique (Multiprime DNA Labeling System, Amersha ) and used as a probe for Northern analyses.
- Relative expression of p-Hyde gene was compared to an internal control (cyclophylin) by scanning of the autoradio ram with a PDI Discovery Series Scanner equipped with Quantity One software.
- In vitro transcription and translation The open reading frame of the cDNA was confirmed using in-vitro transcription (capped mRNA) as described followed by in-vitro translation using rabbit reticulocyte lysate (Stratagene, La Jolla, California) in the presence of 75 Ci of L-[ 3S S] Methionine (Amersham, Arlington Heights, Illinois). The in vitro translation product was further identified on 10% SDS polyacrylamide gel electrophoresis by autoradiography.
- the new construct of p-Hyde was then used to transfect AT3 rat prostatic cancer subline by using lipofectamine (Gibco/BRL) followed by G418 selection (Rhialdy et al., 1988). Eight clones were obtained and two of them, AT3-H1 and AT3-H2, were used to assess the function of p-Hyde in its association with apoptosis.
- AT3 cell line was also transfected with pcDNA3.1(-) vector only and its stable transfected eel 1 line, designated as AT3-pc was used as negative control relative to stable transfectant of AT3-H1 and AT3-H2 for the functional assessment of the p-Hyde.
- Apoptosis assay Apoptosis intensity in AT3 parental cell line was assessed in comparison with AT3-H1 , AT3-H2 and AT3-pc as negative control. Two apoptotic agents were employed for this assessment: (1) UV damage of tlie DNA using UV dosage of 200 J/m2; apoptosis intensity was assayed at 36 h post-UV i ⁇ adiation and (2) 100 ⁇ M Fluorodeoxy ⁇ ridiiie (FUrD) treatment for 36 hours followed by the apoptosis assay. After these apoptotic induction, cells were collected in two fractions: floating and attached cells. Both cell fractions were counted using Neubaue chamber and trypan blue exclusion. DNA were extracted separately from both fractions and analyzed on 1.6 % agarose gel electrophoresis to visualize the DNA laddering.
- UV-da agc repair assay Ultraviolet induced damage in the DNA was assayed using mouse monoclonal antibody specifically cross reacts with cyclobutane pyrimidine dhner (TDM-2) and photoproduct (64M-2). The presence of cyclobutane dimer and 64 photoproducts in DNAs were assessed in microtiter plates (1 0 and 200 ng/well) using both antibodies separately in a standard ELISA technique. In addition, the UV resistance was also assessed by using UV gradient assay as published (Rinaldy et al, 1988).
- Uridine Phosphorylase Assay Cell extract will be prepared from the cell pellet Before and after tlie induction with 1 mM 5-dFUrd for 24 hours, the corresponding cell extract will be prepared in 50 mM Potassium Phosphate buffer pH 7.4 through sonication followed by dialysis against the reaction buffer (50 mM potassium phosphate, pH 7.4). The amount of protein will be determined by using standard Lowry or Biorad assay. The same amount of protein from all cell lines will be assayed for UP activity in 50 mM potassium phosphate buffer (pH 7.4) containing 10 mM uridine or thymidine as substrate.
- reaction product Uracil or Thymidine can be measured with UV detector at 265 nm compared to tlie standard. As negative controL the similar reaction mixture will be boiled before the incubation.
- cDNA libraries derived from AT-1 and MAT-LyLu cell lines were generated using Uni ZAP XR vector based on the protocol of Sttatagene. The independent clones obtained were 1.9 and 3.4 million clones for MAT-LyLu and AT-1, respectively. These unamplified libraries were subjected to PCR amplification of the cDNA insert population. Reverse primers (RP) and forward primers (FP), downstream and upstream of Xhol and Eco RI cloning site, were used to amplify the cDNA insert population. Tlie distance between both primers in ? Uni ZAP or pBluescript was 228 bases.
- Radiolabeled MAT-LyLu cDNA population probe was amplified: radiolabeled MAT-LyLu cDNA population probe and the non-radiolabeled AT-1 cDNA population probe (the cold competitor).
- the radiolabeled MAT-LyLu PCR product was enriched using S400 Sephacryl spin column. The majority of tlie unincorporated 32 P-dCTP, prhner dimer, and 228 bp of PCR product resulting from tl e amplification of ? DNA without insert, was separated from the cDNAs.
- the purified radiolabeled cDNAs were mixed with 30 fold excess of non-radiolabeled cold competitor AT-1 PCR products and used as a competition-probe to screen the MAT-LyLu cDNA library.
- Two kinds of unexpected radiolabeled PCR products that may potentially interfere with the hybridization between the radiolabeled cDNA of the competition probe and the screened cDNA of the library were: 1) the non-exponential amplification of the cDNAs, and 2) 228 bp PCR product derived from the ? DNA without cDNA insert.
- excess amounts of I-ImdI ⁇ -digested_DNA, PvuII-digested-pBluescript DNA, and the 228 bp PCR product of the pBluescript based on both primers were mixed with the competition probe.
- helper phage ExAssist (Stratagene) to excise the cDNA with the pBluescript sequence h circular form as a filamentous phage and secreted from the cell (Fig. 2).
- Recombinant pBluescript plasmids were recovered by infecting an F' strain of E. coli (SOLR strain, Stratagene), ampicilliii resistant colonies were selected, and the plasmid DNA was extracted.
- the obtained plasmids were digested with Eco RI and Xhol to identify the cDNA inserts by agarose geJ electrophoresis. The results indicated that only four plasmids carried cDNA inserts.
- MAT-LyLu exhibits twice the number of both nucleoli and mitochondria (Isaacs et al, 1986). This also suggests that the MAT-LyLu cell line is metabolically more active due to higher gene-dosage or gene-amplification of nucleolar and mitochondrial rRNA and its associated genes.
- the complete sequence of the putative gene, p-Hyde The fourth cDNA (lane 1), designated as p-Hyde, had an initial sequence which did not match any known full length sequences in the BLASTN nucleic acid database of the NCBI. Accordingly, p-Hyde cDNA was completely sequenced by using a walk-through sequencing strategy in both directions for three redundancies. Nine contigs from each sequencing direction were obtained and compounded as a full length composite of 2694 bases. Tiie poly(A) tail on the 3 '-end and polyadenylation signal sequence of GAGAAA (a slight modification of the conserved AATAAA sequence) located at the position 27 upstream from the poly(A) was also identified.
- GAGAAA a slight modification of the conserved AATAAA sequence
- Fig.6 shows the sequencing strategy and the restriction map illustrating the open reading frame of p-Hyde.
- SEQ ID No. 3 sets forth the resulting nucleic acid sequence of the rat p-Hyde and the resulting amino acid sequence of the rat p-Hyde.
- Figure 8 shows the PCR amplification of the cDNA insert using three sets of sequencing primers.
- PCR product based on primer 11 and 5 represents the open reading frame of 0a& p-Hyde cDNA . It was further radiolabeled by Random-Oligo-Labeling technique and used as a representative probe for the cDNA insert in Northern analysis.
- Northern blot analysis of p-H de Some of the rat prostate- cancer sublines (AT-1, MAT-LyLu, MAT-Lu, AT-3 and G) and human prostate cancer cell line (PPC, LNCaP, DU145 and TSU) were assessed by Northern blot analysis using PCR radiolabeled probe. The result indicated that the transcript of the human counterpart was slightly smaller relative to the rat p-Hyde mRNA. Tlie same blot was further hybridized with cyclophylin cDNA as internal conttol. In this antoradiogram, 28S and 18S ribosomal RNA were used as marker.
- MAT-Lu showed the highest level of transcription, whereas AT-3 had the lowest.
- AT-3 had the lowest.
- the level of transcription in MAT-LyLu was relatively higher than that of AT-1, suggesting that the novel cDNA was the result of cDNA competition between MAT-LyLu and AT-1 cDNAs.
- the human homologue of p-Hyde does exist as demonstrated in the human prostate cancer cell lines The highest level of p-Hyde transcription occurred in PPC-1, whereas tlie lowest was in LNCaP cell line (Table 1).
- Two peptide regions (residues 113 through 131 and residues 223 through 249) exhibited the highest points of hydrophilicity and the antigenic index. Both peptide sequences can be used as immunogenic peptide to generate antibody. Its application to detect the translation product of p-Hyde hi Western analysis was in agreement with the highest score of its surface probability.
- This capped mRNA was then used as a template for in-vitro translation using rabbit reticulocyte lysates (Stratagene) in tl e presence of 35 S-Methionine.
- the translation products were identified under denaturing conditions using polyacrylamide gel electrophoresis containing 8 M urea.
- the autoradiograph shown in Fig.13 revealed that two translation products (55 and 55.5 kDa protein) were observed.
- Moleculai- weights of these two protems are in agreement with the calculated molecular weight of the deduced amino acid sequence of the reading frame.
- two start codons were also identified in this reading frame correlating with the two translation products obtained through in vitro translation of the riboprobe.
- the difference in molecular weight between both translation products is hi agreement with the difference in 4 amino acid residues (MSGE) on the C terminal between both start codons.
- MSGE 4 amino acid residues
- Tl e function of pcHYDE in stable transfectants were assessed in vitro hi association with the cell cycle and apoptosis.
- the objective for the apoptosis assessment is based on the hypothesis that p-Hyde is a rat homologue of the murine putative TSAP-6 gene which is associated with the upregulation of apoptosis response under the induction of tumor suppressor p53 (Amson et al., 1996).
- the cell cycle analysis is referred to the fact that MAT-LyLu cell line is highly metastatic and the level of p-Hyde expression in this cell line is relatively higher than AT-1 cell line.
- Cell cycle analysis The strategy of the cell cycle analysis is based on the arrest of cell population in GI and S boundary after 24 hours treatment with 1 mM Hydroxyurea (Iwasaki et al., 1995). As a result, the G2 phase should be zero. Cells were harvested after hydroxyurea release at 0, 10 and 24 hours and subjected to flowcytometer analysis using standard propidium iodide staining. Tl e result is shown in TABLE III and showed that both AT1-H1 and AT3-H1, at 10 hours after tl e release of Hydroxyurea, were relatively slow in entering the S-phase, whereas the parental cell line (ATI and AT3) were faster At 24 hours after the release, the G2 cells were all elevated indicating that cell cycle was hi progress.
- Induction of susceptibility to apoptosis Apoptotic response was assessed using DNA laddering assay. DNAs were extracted after the respective tteatment (24 hours with 1 mM Hydroxyurea followed by 24 hours with 0.1 mM 5'-dFUrd) and analyzed on 1.6% agarose gel electrophoresis. In agreement with cell cycle analyses, apoptotic response of the stable transfectants ATl-Hl and AT3-H1 (pcHYDE transfected AT-1 and AT-3) are consistently and significantly higher relative to both parental (AT-1 and AT-3) and pcDNA-transfected parental cell lines (ATI -pel and AT3-pcl). In particular, the highest apoptotic response occurred in synclironized culture under the induction with 0.1 mM 5'-dFUrd.
- the enhanced apoptotic response in ATl-Hl and AT3-H1 transfectant after hydroxyurea treatment is the result of "thymineless death" (Kyprianou, 1994, Kyprianou et al., 1994) leading to depletion of intracellular thymidine-5-triphosphate (TTP) pools through indirect inhibition of thymidylate synthetase by fluorodeoxyuridine.
- UV-damaged DNA cannot be repaired in prostate cells transfected with ?-ETj - e:Three DNA enzyme repair systems were evaluated in parental compared to p-Hyde transfected cells: uridine phosphorylase, uridine kinase, and UV damage repair.
- UV damage repair was unpaired in e p-Hyde transfected cells. Decreased DNA repair activity results in higher levels of intact photoproducts (64PP). Consistent with these data, pHyde transfected cells also had a significant reduction in survival following UV exposure compared to parental AT3 cells as determined by colony formation assay.
- DNA repair enzyme impai ⁇ nent correlated with shorter survival and induction of apoptosis in prostate cancer cells transfected wif . p-Hyde.
- Northern RNA analysis of p-Hyde confirms overexpression of p-Hyde: To confirm the con-elation between apoptotic response and p-Hyde on the transcription level, Northern analysis of the total RNA derived from AT3-H1, AT3-H2 relative to AT3 parental cell line was performed. The result clearly demonstrated that the transcription level of pcHYDE in stable transfectant of AT3-H1 and AT3-H2 were significantly higher relative to AT3 parental cell line. This Northern analysis was carried out only in AT3, AT3-H1 and AT3-H2 using Hyde PCR product and internal control cyclophilin as a probe.
- AT3 cell line was transfected with pcHYDE, a construct of p-Hyde in mammalian expression vector of pcDNA3.1(-) under G418 selection.
- pcHYDE a construct of p-Hyde in mammalian expression vector of pcDNA3.1(-) under G418 selection.
- As negative control AT-3 cell line was also transfected with the vector only and the stable transfectants obtained was designated as AT3-pc.
- the tumor growth of the parental cell line of AT-3 and in stable transfectant AT3-H1 and AT3-H2 have been evaluated in vivo.
- One million cells of each cell lines in 0.3 ml of Hanks solution were inoculated subcutaneously in each flank of inbred male Copenhagen rat.
- three groups of each five rats were injected with each cell line.
- the size of tumors were scored after a time schedule.
- Tumor progression represents an accumulation of genetic changes that affect oncogene and tumor suppressor gene expression, thereby altering the responsiveness of tlie cell to autocrine and paracrine positive and negative growth regulators.
- the Dunning tumor rat model of prostate cancer tumor progression consists of a spectrum of prostate cancer phenotypes ranging from well differentiated to poorly differentiated with differing responses to androgens.
- the sublines originated and evolved from the same original spontaneous rat prostate tumor, thus making this present study of tumor progression unique. The development of these cell lines as the results of progression of tumor within a single and multiple serial passage .
- the frill length of this cDNA indicated as its restriction map, consists of 2713 nucleic acid residues; it contains two reading frames consisting of 1467 and 1452 residues, respectively. Forty six percent of the sequence is the untranslated region and majority of this is in the 3' end of the gene.
- the nucleic acid sequence of the rat p-Hyde is set forth in SEQ ID NO 3 and the nucleic acid sequence of tlie human p-Hyde is set forth in SEQ ID NO 1.
- the level of expression of p-Hyde was determined by Northern blot analyses in both rat and human prostate cancer cell lines and compared to the cyclophylin expression as internal control.
- the Dunning rat prostatic cancer cell line AT-1, MAT-LyLu, MAT-Lu, AT-3 and G and human prostate cancer cell lines PPC1, LNCaP, TSU and DU145 are all positive with different level of expression (Table I).
- Tl e transcript size of the human counterpart is slightly smaller relative to the rat p-Hyde mRNA.
- the data also indicated that there is a differential expression of p-Hyde gene in both rat and human prostatic cancer cell lines suggesting that there may be a functional correlation between p-Hyde expression and prostate cancer progression.
- MAT-Lu showed the highest level of transcription, whereas AT-3 had the lowest.
- the striking difference between these two cell lines is important in its association with the growth characteristic of MAT-Lu cell lme which is highly metastatic.
- These data also indicated that the level of transcription in MAT-LyLu was relatively (10%) higher than that of AT-1 , demonstrating that the novel cDNA was tlie result of cDNA competition between MAT-LyLu and AT-1 cDNAs (Riualdy and Steiner, 1997).
- the human homologue of p-Hyde does exist the human prostate cancer cell lines.
- p-Hyde does not appear to be specific to mammalian prostate tissue, but has been found in other tissues including placenta and breast and in other species such as mouse and human suggesting that its role is important in fundamental cellular biology.
- p-Hyde has the dual ability to act like a tumor suppressor gene and induce susceptibility to apoptosis by what may be p53 independent pathways. Tlie growth of prostate tumors in rats was greatly inhibited by p-Hyde. Moreover, prostate cancer cells expressing p-Hyde were more sensitive to UV DNA damage driving these cells into cell programmed death. Analysis of DNA repair enzyme activity suggests a defect resulting in the presence of intact (6-4) PP and decreased cell survival by colony forming assay, However, the capacity of p-Hyde to induce susceptibility to apoptosis is not limited to UV DNA damage.
- Chemotherapy agent Fluorodeoxyuridine, a py ⁇ midine antimetabolile which is related to fluorouracil (5-FU) and has been used for treatment of a wide variety of human epithelial malignancies, also more readily induces apoptosis in prostate cancer cell expressing p-Hyde .
- cancer cells expressing p-Hyde are also more susceptible to gamma radiation.
- the mechanisms of cellular DNA injury are different for UV, gamma radiation, and Fluoro deoxyuridhie suggesting that the ability to make cells more susceptible to apoptosis is more global in action.
- This unique function of p-Hyde represents a new class genes that induce susceptibility to apoptosis.
- p-Hyde gene Use in therapy of human disease: These unique functional features of the p-Hyde gene may be exploited for the treatment of hyperproliferative disorders and cancer.
- One effective therapeutic strategy for example, may be the treatment of carcinoma cells expressing p-Hyde with chemotherapy agents or UV mimetic drugs (such as acetylaminofluorine).
- chemotherapy agents such as acetylaminofluorine
- UV mimetic drugs such as acetylaminofluorine
- cancer cells are not likely to produce significant levels o f the growth inhibition p-Hyde. Consequently, the p-Hyde gene my be introduced into cancer cells by gene therapy.
- Tumors transduced with vectors containing p-Hyde may not only be directly suppressed by p-Hyde as demonstrated hi this study, but also when ueated in combination with DNA damaging therapy such as chemotherapy, UV mimetic drugs, or radiation, have even a greater anti-cancer effect. Since gene therapy will target cancer cells, then enhancement of apoptosis will occur more selectively in cancer cells following DNA damage (UV, radiation, or chemotherapy).
- EXAMPLE 2 Prostate Cancer Gene Therapy Using Adenovirus Expressing A Novel Tumor Suppressor Gene pl-Iyde
- AdRSVpHyde A rat pHyde cDNA gene was isolated as described in U.S Serial No: 09/302,457. After digestion with EcoR I, a 2.6 kb fragment which contains the 1467 bp full-length coding sequence of pHyde cDNA was subcloned under the control of a truncated RSV promoter (395 bp) into an E1 E3 deleted adenoviral shuttle vector. The resultant adenoviral shuttle vector was cotransfected into 293 cells with pJM17, an adenoviral type 5 genome plasmid, by calcium phosphate method.
- the cDNA probes (pHyde or p53) were labeled by a- 32 P-dCTP using random primer method (Prime-It II Kit, Stratagene, La Jolla, CA). The membrane was hybridized with the probe in Rapid-hyb buffer (Amersham Life Science) according to the Manufacturer's protocol. The membrane was exposed to a Kodak X-ray film under one intensifying screens at -80°C for autoradiography.
- GAPDH cDNA probe was labeled as described above and used as an internal control for norm lization.
- the membrane was treated with blocking solution (15% nonfat milk, 0.02% sodium azide in phosphate-buffered saline) overnight at 4°C.
- the membrane was incubated for 1 hr at room temperature with rabbit anti-rat pHyde polycional antibody (specifically generated by Research Genetics, Inc. based on the computer-created antigenic peptide derived from pHyde coding sequences).
- the membrane was then incubated for 1 hr at room temperature with 125 I-labeled second antibody (Amersham Life Science, Arlington Heights, IL)
- the membrane was exposed to a Kodak X-ray film between two intensifying screens at -80°C for autoradio raphy.
- AdRSVpHyde in vitro studies Human prostate cancer cells were infected with AdRSVpHyde in vitro with a multiplicity of infection (MOI) of 100 or 200. After viral infection, cells were incubated'at 37°C and cell numbers were determined at day 5 after viral infection.
- MOI multiplicity of infection
- DU145 cells (1.4xl0 7 cells in 0.2 ml of PBS) were injected subcutaneously into the flank of male nude mice (Harlan Sprague Dawley) When the tumors reached an average volume of 80 mm 3 , 5x10 9 pfu adenoviral vectors (AdRSVpHyde or control adenovirus AdRSVlacZ) or PBS alone for untreated controls were injected directly into tlie tumor. Tumor volume was measured every three to four days until the animals were euthanized. All the animals were sacrificed at day 52 after viral uijection when several of them showed distress or had a tumor burden greater than 15% of total body weight. Tumor samples were collected and processed for H&E staining.
- the cells were lysed in 10 mM Tr-s-HCl (pH 8.0), 10 mM EDTA, and 0 5% Triton X-100 on ice for 15 min Tl e lysate was centnfuged at 12,000xg for 1 5 min to separate soluble (fragmented) DNA from pellet (intact genomic) DNA Soluble DNA was treated with Rnase A (50 ug/ml) at 37C for 1 h, followed by ueatment with proteinase K (100 ug/ml) 0 5% SDS, at 50C for 2 h. The residual material was extracted with phenol/chloroform, precipitated in ethanol, electrophoresed on a 2% agarose gel
- AdRSVpHyde Growth inhibition by AdRSVpHyde correlated to pS3 expression in prostate cancer cells:
- a phenotype of DU145 and LNCaP cells ttansduced by AdRSVpHyde were also altered.
- AdRSVpl-Iyde-transduced cells had a marked morphology of round, detaching and floated dying cells, a characteristic of cells undergoing apoptosis, and cell number decreased quickly over time (Fig. 5).
- AdRSVpHyde showed a strong inhibition on the growth of these two cell lines (Fig. 3).
- AdRSVpHyde did not inhibit the cellular growth of PC-3 and TSU-Pr cells, and had only a minor growth inhibition on PPC-1 cells (data not shown). Consistently, there was no evident morphological differences between untreated control, control virus-treated and AdRSVpHyde-treated cells in these lines (Fig. 6). To detertnine whether the differential expression of various genes, especially those involved in apoptosis pathway, accounted for the differential inhibitory effect by AdRSVpHyde on different prostate cancer cell lines, several genes including p53 and Rb were screened at mRNA level by Northern hybridization.
- p53 was found to only express in DU145 and LNCaP cells but not in PC-3, TSU-Pr, and PPC-1 cells; in contrast, Rb gene were all expressed at the mRNA level in these cells (Fig, 7). Therefore, it appeared that there was a correlation between p53 expression and AdRSVpHyde-mediated inhibition.
- pHyde regulated p53 expression the same Northern blot in Fig. 2A was stripped and rehybridized with p53 probe Indeed an induction of p53 mRNA was observed in AdRSVpHyde transduced DU145 cells (Fig. 8).
- pHyde has the dual ability to act like a tumor suppressor gene and induce susceptibility to apoptosis.
- the growth of prostate tumors in rats was greatly inhibited by p-Hyde.
- prostate cancer cells expressing pHyde were more sensitive to UV DNA damage driving these cells into cell programmed death.
- AdRSVpHyde was shown to have an effective inhibition on cell growth both in vitro and in vivo for the prostate cancer cells expressing p53, but not for the prostate cancer cells missing p53 expression
- pHyde can induces apoptosis by p53 dependent pathway (such as in DU145 and LNCaP cells) and p53 independent pathway which requires an outside cell death trigger such as UV or chemical (such as methylnitrosourea) to act as a co-inducer for apoptosis.
- p53 dependent pathway such as in DU145 and LNCaP cells
- p53 independent pathway which requires an outside cell death trigger such as UV or chemical (such as methylnitrosourea) to act as a co-inducer for apoptosis.
- UV or chemical such as methylnitrosourea
- AdRSVpHyde induced p53 expression in DU145 cells One interesting and important finding of this study was that AdRSVpHyde induced p53 expression in DU145 cells. Not only this may explain that pl-Iyde acts in a more global manner to induce susceptibility to apoptosis, but also partially explains why pHyde has a partial sequence homologue with TSAP-6, a human protein claimed to be involved in p53 -associated pathway: because pHyde could be a rat homologue of TSAP-6 gene, or a member of tl e TSAP-6 like family which is involved hi p53-associated pathway.
- pHyde is a novel a tumor suppressor gene and AdRSVpHyde effectively inhibites prostate cancer both in vitro and in vivo.
- the monotherapy of AdRSVpHyde alone or combined therapy of AdRSVpHyde with radio- or chemo-therapy should have an effective therapeutic potential for treatment of locally advanced prostate cancer.
- TUNEL assay The other classical method for detecting apoptosis, TUNEL assay, was also used to demonstrate that AdRSVpHyde indeed caused DU145 cells to apoptosis. Seventy two hrs after viral transduction, DU145 cells growing on culture dish were subjected to TUNEL assay. There were more fluorescence-stained cells in AdRSVpHyde transduced cells (Fig. 15C and 15F) compared to untreated control (Fig. 15A and 15D) or control virus transduced cells, (Fig.
- apoptosis may accounts for only part of the pHyde-mediated growth inhibition, in other words, pHyde-mediated growth inhibition may be composed of apoptosis and some other unknown mechanisms.
- AdRSVpHyde was able to inhibit cell growth of anotlier human prostate cancer cell line TSU, however, no apoptosis was observed in AdRSVpHyde transduced TSU cells.
- AdRSVpHyde had a strong growth inhibition on DU1 5 and LNCaP cells (76.9%) and 83, 1 % inhibition compared to the untreated control, respectively, Fig. 17), tlie two cell lines that expressed p53.
- AdRSVpHyde had no inhibitory effect on the growth of PC-3 cells, but had a minor inhibition (24.5% inhibition compared to untreated control) on the growth of TSU cells (Fig. 19).
- Isolation of 10 differentially expressed cDNAs in p53- ⁇ nduced apoptosis Activation of the vertebrate homologue of the Drosophila seven in absentia gene, Proc.Natl Acad.Sci.USA, 93, 3953 - 3957.
- Wild-type p53 induces apoptosis of myeloid leukemic cells that is inhibited by interlekin-6, Nature (London), 352, 345 - 347.
Abstract
Description
Claims
Priority Applications (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
JP2000619819A JP2003529321A (en) | 1999-04-29 | 2000-05-01 | Isolated nucleic acids of the P-HYDE family, P-HYDE proteins, and methods of inducing susceptibility to inducing cell death in cancer |
EP00953630A EP1328151A4 (en) | 1999-04-29 | 2000-05-01 | Isolated nucleic acids of the p-hyde family, p-hyde proteins, and methods of inducing susceptibility to induction of cell death in cancer |
AU66046/00A AU769889B2 (en) | 1999-04-29 | 2000-05-01 | Isolated nucleic acids of the p-Hyde family, P-Hyde proteins, and methods of inducing susceptibility to induction of cell death in cancer |
MXPA01010890A MXPA01010890A (en) | 1999-04-29 | 2000-05-01 | Isolated nucleic acids of the p-hyde family, p-hyde proteins, and methods of inducing susceptibility to induction of cell death in cancer. |
CA002371828A CA2371828A1 (en) | 1999-04-29 | 2000-05-01 | Isolated nucleic acids of the p-hyde family, p-hyde proteins, and methods of inducing susceptibility to induction of cell death in cancer |
Applications Claiming Priority (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US30245799A | 1999-04-29 | 1999-04-29 | |
US13160799P | 1999-04-29 | 1999-04-29 | |
US09/302,457 | 1999-04-29 | ||
US60/131,607 | 1999-04-29 | ||
US09/499,817 | 2000-02-08 | ||
US09/499,817 US7043009B1 (en) | 2000-02-08 | 2000-02-08 | Providing customer data to an automatic call distribution system agent |
Publications (3)
Publication Number | Publication Date |
---|---|
WO2000071564A2 true WO2000071564A2 (en) | 2000-11-30 |
WO2000071564A8 WO2000071564A8 (en) | 2001-10-04 |
WO2000071564A3 WO2000071564A3 (en) | 2003-05-01 |
Family
ID=27384176
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2000/011456 WO2000071564A2 (en) | 1999-04-29 | 2000-05-01 | Isolated nucleic acids of the p-hyde family, p-hyde proteins, and methods of inducing susceptibility to induction of cell death in cancer |
Country Status (5)
Country | Link |
---|---|
EP (1) | EP1328151A4 (en) |
JP (1) | JP2003529321A (en) |
AU (1) | AU769889B2 (en) |
CA (1) | CA2371828A1 (en) |
WO (1) | WO2000071564A2 (en) |
Cited By (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6835812B1 (en) | 1999-04-29 | 2004-12-28 | University Of Tennessee Research Corporation | Human p-Hyde proteins |
CN113106082A (en) * | 2021-05-27 | 2021-07-13 | 云南师范大学 | Alanine racemase from animal manure metagenome as well as preparation and application thereof |
CN113507933A (en) * | 2019-03-05 | 2021-10-15 | 陶氏环球技术有限责任公司 | Induction of caspase Activity |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1997022695A2 (en) * | 1995-12-20 | 1997-06-26 | Fondation Jean Dausset-Ceph | Nucleotide sequences, proteins, drugs and diagnostic agents for treating cancer |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP1074617A3 (en) * | 1999-07-29 | 2004-04-21 | Research Association for Biotechnology | Primers for synthesising full-length cDNA and their use |
AU2001235000A1 (en) * | 2000-02-11 | 2001-08-20 | Incyte Genomics, Inc. | Drug metabolizing enzymes |
AU2001249411B2 (en) * | 2000-03-24 | 2007-02-15 | Fahri Saatcioglu | Novel prostate-specific or testis-specific nucleic acid molecules, polypeptides,and diagnostic and therapeutic methods |
-
2000
- 2000-05-01 AU AU66046/00A patent/AU769889B2/en not_active Ceased
- 2000-05-01 EP EP00953630A patent/EP1328151A4/en not_active Withdrawn
- 2000-05-01 CA CA002371828A patent/CA2371828A1/en not_active Abandoned
- 2000-05-01 WO PCT/US2000/011456 patent/WO2000071564A2/en active IP Right Grant
- 2000-05-01 JP JP2000619819A patent/JP2003529321A/en active Pending
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1997022695A2 (en) * | 1995-12-20 | 1997-06-26 | Fondation Jean Dausset-Ceph | Nucleotide sequences, proteins, drugs and diagnostic agents for treating cancer |
Non-Patent Citations (1)
Title |
---|
See also references of EP1328151A2 * |
Cited By (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6835812B1 (en) | 1999-04-29 | 2004-12-28 | University Of Tennessee Research Corporation | Human p-Hyde proteins |
CN113507933A (en) * | 2019-03-05 | 2021-10-15 | 陶氏环球技术有限责任公司 | Induction of caspase Activity |
CN113106082A (en) * | 2021-05-27 | 2021-07-13 | 云南师范大学 | Alanine racemase from animal manure metagenome as well as preparation and application thereof |
CN113106082B (en) * | 2021-05-27 | 2022-11-04 | 云南师范大学 | Animal waste metagenome-derived alanine racemase and preparation and application thereof |
Also Published As
Publication number | Publication date |
---|---|
JP2003529321A (en) | 2003-10-07 |
CA2371828A1 (en) | 2000-11-30 |
WO2000071564A3 (en) | 2003-05-01 |
AU769889B2 (en) | 2004-02-05 |
WO2000071564A8 (en) | 2001-10-04 |
EP1328151A2 (en) | 2003-07-23 |
AU6604600A (en) | 2000-12-12 |
EP1328151A4 (en) | 2004-06-16 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP0785216B1 (en) | Chomosome 13-linked breast cancer susceptibility gene BRCA2 | |
EP1260520B1 (en) | Chromosome 13-linked breast cancer susceptibility gene | |
EP0705903B1 (en) | Mutations in the 17q-linked breast and ovarian cancer susceptibility gene | |
US5709999A (en) | Linked breast and ovarian cancer susceptibility gene | |
US7655778B2 (en) | SISP-1, a novel p53 target gene and use thereof | |
US5710001A (en) | 17q-linked breast and ovarian cancer susceptibility gene | |
US5693473A (en) | Linked breast and ovarian cancer susceptibility gene | |
US5891857A (en) | Characterized BRCA1 and BRCA2 proteins and screening and therapeutic methods based on characterized BRCA1 and BRCA2 proteins | |
EP0705902A1 (en) | 17q-Linked breast and ovarian cancer susceptibility gene | |
US5753441A (en) | 170-linked breast and ovarian cancer susceptibility gene | |
JP4771576B2 (en) | GASC1 gene | |
AU769889B2 (en) | Isolated nucleic acids of the p-Hyde family, P-Hyde proteins, and methods of inducing susceptibility to induction of cell death in cancer | |
US6835812B1 (en) | Human p-Hyde proteins | |
US20080145347A1 (en) | p-Hyde sequences in the Rat | |
JP4336926B2 (en) | Human p51 gene and its gene product | |
HUT74413A (en) | A novel tumor suppressor gene | |
US6503502B1 (en) | Nucleotide sequences, proteins, drugs and diagnostic agents of use in treating cancer | |
US20040235769A1 (en) | Anti-tumor effects of prostage Carcinoma Tumor Antigen-1 | |
JP4280878B2 (en) | MASL1 gene | |
JP2000325087A (en) | Tsa2306 gene | |
AU773601B2 (en) | Chromosome 13-linked breast cancer susceptibility gene | |
JPH10509320A (en) | Human MutT2 | |
HUT76558A (en) | Prostate tumor suppressor gene located on human chromosome |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CR CU CZ DE DK DM EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GH GM KE LS MW SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
AK | Designated states |
Kind code of ref document: C1 Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CR CU CZ DE DK DM EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: C1 Designated state(s): GH GM KE LS MW SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
CFP | Corrected version of a pamphlet front page | ||
CR1 | Correction of entry in section i |
Free format text: PAT. BUL. 48/2000 UNDER (30) REPLACE "26.11.99" BY "08.02.2000" |
|
WWE | Wipo information: entry into national phase |
Ref document number: 66046/00 Country of ref document: AU |
|
ENP | Entry into the national phase in: |
Ref document number: 2371828 Country of ref document: CA Ref country code: CA Ref document number: 2371828 Kind code of ref document: A Format of ref document f/p: F |
|
WWE | Wipo information: entry into national phase |
Ref document number: PA/a/2001/010890 Country of ref document: MX |
|
ENP | Entry into the national phase in: |
Ref country code: JP Ref document number: 2000 619819 Kind code of ref document: A Format of ref document f/p: F |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2000953630 Country of ref document: EP |
|
REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
WWP | Wipo information: published in national office |
Ref document number: 2000953630 Country of ref document: EP |
|
WWG | Wipo information: grant in national office |
Ref document number: 66046/00 Country of ref document: AU |