WO1998045325A1 - Peptides useful for reducing symptoms of toxic shock syndrome - Google Patents
Peptides useful for reducing symptoms of toxic shock syndrome Download PDFInfo
- Publication number
- WO1998045325A1 WO1998045325A1 PCT/US1998/006663 US9806663W WO9845325A1 WO 1998045325 A1 WO1998045325 A1 WO 1998045325A1 US 9806663 W US9806663 W US 9806663W WO 9845325 A1 WO9845325 A1 WO 9845325A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- group
- amino acid
- peptide
- seq
- antibodies
- Prior art date
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 182
- 102000004196 processed proteins & peptides Human genes 0.000 title abstract description 74
- 231100000650 Toxic shock syndrome Toxicity 0.000 title abstract description 28
- 206010040070 Septic Shock Diseases 0.000 title abstract description 22
- 206010044248 Toxic shock syndrome Diseases 0.000 title abstract description 22
- 208000024891 symptom Diseases 0.000 title description 9
- 108700012359 toxins Proteins 0.000 claims abstract description 85
- 239000003053 toxin Substances 0.000 claims abstract description 84
- 231100000765 toxin Toxicity 0.000 claims abstract description 84
- 238000000034 method Methods 0.000 claims abstract description 45
- 210000002966 serum Anatomy 0.000 claims abstract description 37
- 241000124008 Mammalia Species 0.000 claims abstract description 27
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 25
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 24
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 24
- 239000000203 mixture Substances 0.000 claims abstract description 20
- 231100000331 toxic Toxicity 0.000 claims abstract description 9
- 230000002588 toxic effect Effects 0.000 claims abstract description 9
- 150000001413 amino acids Chemical group 0.000 claims description 116
- 235000001014 amino acid Nutrition 0.000 claims description 99
- 229940024606 amino acid Drugs 0.000 claims description 99
- 239000002095 exotoxin Substances 0.000 claims description 64
- 231100000776 exotoxin Toxicity 0.000 claims description 64
- 229910052740 iodine Inorganic materials 0.000 claims description 35
- 231100000655 enterotoxin Toxicity 0.000 claims description 30
- 229910052720 vanadium Inorganic materials 0.000 claims description 24
- 229910052700 potassium Inorganic materials 0.000 claims description 23
- 210000004027 cell Anatomy 0.000 claims description 21
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 claims description 20
- 229910052757 nitrogen Inorganic materials 0.000 claims description 20
- 241001415395 Spea Species 0.000 claims description 19
- 239000004472 Lysine Substances 0.000 claims description 12
- OTLLEIBWKHEHGU-UHFFFAOYSA-N 2-[5-[[5-(6-aminopurin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy]-3,4-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-3,5-dihydroxy-4-phosphonooxyhexanedioic acid Chemical compound C1=NC=2C(N)=NC=NC=2N1C(C(C1O)O)OC1COC1C(CO)OC(OC(C(O)C(OP(O)(O)=O)C(O)C(O)=O)C(O)=O)C(O)C1O OTLLEIBWKHEHGU-UHFFFAOYSA-N 0.000 claims description 11
- 230000035584 blastogenesis Effects 0.000 claims description 11
- 229910052739 hydrogen Inorganic materials 0.000 claims description 11
- 230000001939 inductive effect Effects 0.000 claims description 11
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 claims description 10
- 230000003053 immunization Effects 0.000 claims description 10
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 claims description 9
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 claims description 9
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical group NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 claims description 8
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 claims description 8
- 239000004474 valine Substances 0.000 claims description 8
- 238000004519 manufacturing process Methods 0.000 claims description 7
- 239000008194 pharmaceutical composition Substances 0.000 claims description 7
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 claims description 6
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 claims description 6
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 claims description 6
- 238000002649 immunization Methods 0.000 claims description 6
- 238000001727 in vivo Methods 0.000 claims description 6
- 229910052717 sulfur Inorganic materials 0.000 claims description 6
- 229910052799 carbon Inorganic materials 0.000 claims description 5
- 235000018417 cysteine Nutrition 0.000 claims description 5
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 claims description 5
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 claims description 4
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 claims description 4
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 claims description 4
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 claims description 4
- 239000004473 Threonine Substances 0.000 claims description 4
- 235000004279 alanine Nutrition 0.000 claims description 4
- 235000013922 glutamic acid Nutrition 0.000 claims description 4
- 239000004220 glutamic acid Substances 0.000 claims description 4
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 claims description 4
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 claims description 4
- 210000005087 mononuclear cell Anatomy 0.000 claims description 4
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 claims description 4
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 claims description 3
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 claims description 3
- 230000037396 body weight Effects 0.000 claims description 3
- 229960000310 isoleucine Drugs 0.000 claims description 3
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 claims description 3
- 229930182817 methionine Natural products 0.000 claims description 3
- 229910052698 phosphorus Inorganic materials 0.000 claims description 3
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 claims description 2
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 claims description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 claims description 2
- 235000009582 asparagine Nutrition 0.000 claims description 2
- 229960001230 asparagine Drugs 0.000 claims description 2
- 235000003704 aspartic acid Nutrition 0.000 claims description 2
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 claims description 2
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 claims description 2
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 claims description 2
- 125000001909 leucine group Chemical group [H]N(*)C(C(*)=O)C([H])([H])C(C([H])([H])[H])C([H])([H])[H] 0.000 claims description 2
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 claims description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 claims description 2
- 125000002987 valine group Chemical group [H]N([H])C([H])(C(*)=O)C([H])(C([H])([H])[H])C([H])([H])[H] 0.000 claims description 2
- 210000000628 antibody-producing cell Anatomy 0.000 claims 2
- 238000003556 assay Methods 0.000 abstract description 19
- 230000004044 response Effects 0.000 abstract description 6
- 230000009851 immunogenic response Effects 0.000 abstract description 3
- 208000035143 Bacterial infection Diseases 0.000 abstract description 2
- 208000022362 bacterial infectious disease Diseases 0.000 abstract description 2
- 230000001698 pyrogenic effect Effects 0.000 description 70
- 241000283973 Oryctolagus cuniculus Species 0.000 description 33
- 108091035707 Consensus sequence Proteins 0.000 description 16
- 125000003275 alpha amino acid group Chemical group 0.000 description 16
- 108010017949 tyrosyl-glycyl-glycine Proteins 0.000 description 16
- 108090000623 proteins and genes Proteins 0.000 description 15
- 101710101607 Toxic shock syndrome toxin-1 Proteins 0.000 description 13
- PJBVXVBTTFZPHJ-GUBZILKMSA-N Glu-Leu-Asp Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](CCC(=O)O)N PJBVXVBTTFZPHJ-GUBZILKMSA-N 0.000 description 12
- 230000002788 anti-peptide Effects 0.000 description 12
- 239000013598 vector Substances 0.000 description 12
- CYHMMWIOEUVHHZ-IHRRRGAJSA-N Cys-Met-Tyr Chemical compound SC[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 CYHMMWIOEUVHHZ-IHRRRGAJSA-N 0.000 description 10
- 201000010099 disease Diseases 0.000 description 10
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 10
- 235000018102 proteins Nutrition 0.000 description 10
- 102000004169 proteins and genes Human genes 0.000 description 10
- OLPPXYMMIARYAL-QMMMGPOBSA-N Gly-Gly-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)CNC(=O)CN OLPPXYMMIARYAL-QMMMGPOBSA-N 0.000 description 9
- 239000003814 drug Substances 0.000 description 9
- 229920000642 polymer Polymers 0.000 description 9
- 239000000427 antigen Substances 0.000 description 8
- 108091007433 antigens Proteins 0.000 description 8
- 102000036639 antigens Human genes 0.000 description 8
- 230000001580 bacterial effect Effects 0.000 description 8
- 238000002347 injection Methods 0.000 description 8
- 239000007924 injection Substances 0.000 description 8
- 239000000178 monomer Substances 0.000 description 8
- 241000894006 Bacteria Species 0.000 description 7
- 239000002671 adjuvant Substances 0.000 description 7
- 230000004071 biological effect Effects 0.000 description 7
- 230000002939 deleterious effect Effects 0.000 description 7
- 230000000694 effects Effects 0.000 description 7
- 239000002158 endotoxin Substances 0.000 description 7
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 7
- UHVIQGKBMXEVGN-WDSKDSINSA-N Glu-Gly-Asn Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(O)=O UHVIQGKBMXEVGN-WDSKDSINSA-N 0.000 description 6
- 108060003951 Immunoglobulin Proteins 0.000 description 6
- RIJCHEVHFWMDKD-SRVKXCTJSA-N Lys-Lys-Asn Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(O)=O RIJCHEVHFWMDKD-SRVKXCTJSA-N 0.000 description 6
- 210000001744 T-lymphocyte Anatomy 0.000 description 6
- WDFPMSHYMRBLKM-NKIYYHGXSA-N Thr-Glu-His Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N)O WDFPMSHYMRBLKM-NKIYYHGXSA-N 0.000 description 6
- HTONZBWRYUKUKC-RCWTZXSCSA-N Val-Thr-Val Chemical compound CC(C)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O HTONZBWRYUKUKC-RCWTZXSCSA-N 0.000 description 6
- 239000003795 chemical substances by application Substances 0.000 description 6
- 102000018358 immunoglobulin Human genes 0.000 description 6
- 208000015181 infectious disease Diseases 0.000 description 6
- 230000005764 inhibitory process Effects 0.000 description 6
- 231100000617 superantigen Toxicity 0.000 description 6
- 238000002560 therapeutic procedure Methods 0.000 description 6
- 229960005486 vaccine Drugs 0.000 description 6
- 238000001262 western blot Methods 0.000 description 6
- 208000023275 Autoimmune disease Diseases 0.000 description 5
- 241000282412 Homo Species 0.000 description 5
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 5
- 241001465754 Metazoa Species 0.000 description 5
- HIINQLBHPIQYHN-JTQLQIEISA-N Tyr-Gly-Gly Chemical compound OC(=O)CNC(=O)CNC(=O)[C@@H](N)CC1=CC=C(O)C=C1 HIINQLBHPIQYHN-JTQLQIEISA-N 0.000 description 5
- 108010068265 aspartyltyrosine Proteins 0.000 description 5
- 238000010166 immunofluorescence Methods 0.000 description 5
- 230000002163 immunogen Effects 0.000 description 5
- 108010054155 lysyllysine Proteins 0.000 description 5
- QBQVKUNBCAFXSV-ULQDDVLXSA-N Arg-Lys-Tyr Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 QBQVKUNBCAFXSV-ULQDDVLXSA-N 0.000 description 4
- 231100000699 Bacterial toxin Toxicity 0.000 description 4
- 206010012735 Diarrhoea Diseases 0.000 description 4
- 238000002965 ELISA Methods 0.000 description 4
- 101000867232 Escherichia coli Heat-stable enterotoxin II Proteins 0.000 description 4
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 4
- 101000686985 Mouse mammary tumor virus (strain C3H) Protein PR73 Proteins 0.000 description 4
- AUEJLPRZGVVDNU-UHFFFAOYSA-N N-L-tyrosyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CC1=CC=C(O)C=C1 AUEJLPRZGVVDNU-UHFFFAOYSA-N 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- 241000193996 Streptococcus pyogenes Species 0.000 description 4
- CGGVNFJRZJUVAE-BYULHYEWSA-N Val-Asp-Asn Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)N)C(=O)O)N CGGVNFJRZJUVAE-BYULHYEWSA-N 0.000 description 4
- 239000000688 bacterial toxin Substances 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 230000001900 immune effect Effects 0.000 description 4
- 238000011081 inoculation Methods 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 239000000523 sample Substances 0.000 description 4
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- 108010078580 tyrosylleucine Proteins 0.000 description 4
- 239000004471 Glycine Substances 0.000 description 3
- HVAUKHLDSDDROB-KKUMJFAQSA-N Lys-Lys-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O HVAUKHLDSDDROB-KKUMJFAQSA-N 0.000 description 3
- 239000000020 Nitrocellulose Substances 0.000 description 3
- 206010037660 Pyrexia Diseases 0.000 description 3
- CEKSLIVSNNGOKH-KZVJFYERSA-N Val-Thr-Ala Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](C)C(=O)O)NC(=O)[C@H](C(C)C)N)O CEKSLIVSNNGOKH-KZVJFYERSA-N 0.000 description 3
- 230000002612 cardiopulmonary effect Effects 0.000 description 3
- 238000012512 characterization method Methods 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 238000003745 diagnosis Methods 0.000 description 3
- 239000000147 enterotoxin Substances 0.000 description 3
- 108010022946 erythrogenic toxin Proteins 0.000 description 3
- 239000000499 gel Substances 0.000 description 3
- 150000004676 glycans Chemical class 0.000 description 3
- 230000028993 immune response Effects 0.000 description 3
- 230000036039 immunity Effects 0.000 description 3
- 238000003018 immunoassay Methods 0.000 description 3
- 238000003119 immunoblot Methods 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 238000007918 intramuscular administration Methods 0.000 description 3
- 229920001220 nitrocellulos Polymers 0.000 description 3
- 239000002773 nucleotide Substances 0.000 description 3
- 125000003729 nucleotide group Chemical group 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 230000000069 prophylactic effect Effects 0.000 description 3
- 230000000638 stimulation Effects 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- 208000011580 syndromic disease Diseases 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- UQBGYPFHWFZMCD-ZLUOBGJFSA-N Asp-Asn-Asn Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O UQBGYPFHWFZMCD-ZLUOBGJFSA-N 0.000 description 2
- 241000699800 Cricetinae Species 0.000 description 2
- MFBYPDKTAJXHNI-VKHMYHEASA-N Gly-Cys Chemical compound [NH3+]CC(=O)N[C@@H](CS)C([O-])=O MFBYPDKTAJXHNI-VKHMYHEASA-N 0.000 description 2
- NVGBPTNZLWRQSY-UWVGGRQHSA-N Lys-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(O)=O)CCCCN NVGBPTNZLWRQSY-UWVGGRQHSA-N 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- 241000191967 Staphylococcus aureus Species 0.000 description 2
- 108091008874 T cell receptors Proteins 0.000 description 2
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 2
- XIULAFZYEKSGAJ-IXOXFDKPSA-N Thr-Leu-His Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CNC=N1 XIULAFZYEKSGAJ-IXOXFDKPSA-N 0.000 description 2
- 125000000539 amino acid group Chemical group 0.000 description 2
- 230000003466 anti-cipated effect Effects 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 239000012472 biological sample Substances 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 229920002678 cellulose Polymers 0.000 description 2
- 239000001913 cellulose Substances 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- -1 cofactors Substances 0.000 description 2
- 229920006037 cross link polymer Polymers 0.000 description 2
- 230000009260 cross reactivity Effects 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 238000002405 diagnostic procedure Methods 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- 230000009429 distress Effects 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 230000002458 infectious effect Effects 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 230000001665 lethal effect Effects 0.000 description 2
- 231100000225 lethality Toxicity 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 238000011587 new zealand white rabbit Methods 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 210000002381 plasma Anatomy 0.000 description 2
- 229920001282 polysaccharide Polymers 0.000 description 2
- 239000005017 polysaccharide Substances 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 238000010532 solid phase synthesis reaction Methods 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 229940126577 synthetic vaccine Drugs 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- IQFYYKKMVGJFEH-OFKYTIFKSA-N 1-[(2r,4s,5r)-4-hydroxy-5-(tritiooxymethyl)oxolan-2-yl]-5-methylpyrimidine-2,4-dione Chemical compound C1[C@H](O)[C@@H](CO[3H])O[C@H]1N1C(=O)NC(=O)C(C)=C1 IQFYYKKMVGJFEH-OFKYTIFKSA-N 0.000 description 1
- BFSVOASYOCHEOV-UHFFFAOYSA-N 2-diethylaminoethanol Chemical compound CCN(CC)CCO BFSVOASYOCHEOV-UHFFFAOYSA-N 0.000 description 1
- 238000010600 3H thymidine incorporation assay Methods 0.000 description 1
- 101710186708 Agglutinin Proteins 0.000 description 1
- KVWLTGNCJYDJET-LSJOCFKGSA-N Ala-Arg-His Chemical compound C[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N KVWLTGNCJYDJET-LSJOCFKGSA-N 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 241000282709 Aotus trivirgatus Species 0.000 description 1
- BNODVYXZAAXSHW-IUCAKERBSA-N Arg-His Chemical compound NC(=N)NCCC[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CNC=N1 BNODVYXZAAXSHW-IUCAKERBSA-N 0.000 description 1
- JQFZHHSQMKZLRU-IUCAKERBSA-N Arg-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CCCN=C(N)N JQFZHHSQMKZLRU-IUCAKERBSA-N 0.000 description 1
- SSZGOKWBHLOCHK-DCAQKATOSA-N Arg-Lys-Asn Chemical compound NC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCCN=C(N)N SSZGOKWBHLOCHK-DCAQKATOSA-N 0.000 description 1
- CLICCYPMVFGUOF-IHRRRGAJSA-N Arg-Lys-Leu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O CLICCYPMVFGUOF-IHRRRGAJSA-N 0.000 description 1
- RJUHZPRQRQLCFL-IMJSIDKUSA-N Asn-Asn Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CC(N)=O)C(O)=O RJUHZPRQRQLCFL-IMJSIDKUSA-N 0.000 description 1
- DXVMJJNAOVECBA-WHFBIAKZSA-N Asn-Gly-Asn Chemical compound NC(=O)C[C@H](N)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(O)=O DXVMJJNAOVECBA-WHFBIAKZSA-N 0.000 description 1
- QNNBHTFDFFFHGC-KKUMJFAQSA-N Asn-Tyr-Lys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC(=O)N)N)O QNNBHTFDFFFHGC-KKUMJFAQSA-N 0.000 description 1
- GWIJZUVQVDJHDI-AVGNSLFASA-N Asp-Phe-Glu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(O)=O GWIJZUVQVDJHDI-AVGNSLFASA-N 0.000 description 1
- JUWISGAGWSDGDH-KKUMJFAQSA-N Asp-Phe-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(O)=O)CC1=CC=CC=C1 JUWISGAGWSDGDH-KKUMJFAQSA-N 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 206010051625 Conjunctival hyperaemia Diseases 0.000 description 1
- 206010011703 Cyanosis Diseases 0.000 description 1
- DZSICRGTVPDCRN-YUMQZZPRSA-N Cys-Gly-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CS)N DZSICRGTVPDCRN-YUMQZZPRSA-N 0.000 description 1
- JXVFJOMFOLFPMP-KKUMJFAQSA-N Cys-Leu-Tyr Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O JXVFJOMFOLFPMP-KKUMJFAQSA-N 0.000 description 1
- DRXOWZZHCSBUOI-YJRXYDGGSA-N Cys-Thr-Tyr Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)NC(=O)[C@H](CS)N)O DRXOWZZHCSBUOI-YJRXYDGGSA-N 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 238000009007 Diagnostic Kit Methods 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 101710146739 Enterotoxin Proteins 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 241000701533 Escherichia virus T4 Species 0.000 description 1
- 101710178133 Exotoxin type C Proteins 0.000 description 1
- 208000002476 Falciparum Malaria Diseases 0.000 description 1
- 206010017916 Gastroenteritis staphylococcal Diseases 0.000 description 1
- FUESBOMYALLFNI-VKHMYHEASA-N Gly-Asn Chemical compound NCC(=O)N[C@H](C(O)=O)CC(N)=O FUESBOMYALLFNI-VKHMYHEASA-N 0.000 description 1
- AFWYPMDMDYCKMD-KBPBESRZSA-N Gly-Leu-Tyr Chemical compound NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 AFWYPMDMDYCKMD-KBPBESRZSA-N 0.000 description 1
- MHZXESQPPXOING-KBPBESRZSA-N Gly-Lys-Phe Chemical compound [H]NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O MHZXESQPPXOING-KBPBESRZSA-N 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- CIWILNZNBPIHEU-DCAQKATOSA-N His-Arg-Asn Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(O)=O CIWILNZNBPIHEU-DCAQKATOSA-N 0.000 description 1
- AKEDPWJFQULLPE-IUCAKERBSA-N His-Glu-Gly Chemical compound N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O AKEDPWJFQULLPE-IUCAKERBSA-N 0.000 description 1
- RGPWUJOMKFYFSR-QWRGUYRKSA-N His-Gly-Leu Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)NCC(=O)N[C@@H](CC(C)C)C(O)=O RGPWUJOMKFYFSR-QWRGUYRKSA-N 0.000 description 1
- 101710146024 Horcolin Proteins 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- LHSGPCFBGJHPCY-UHFFFAOYSA-N L-leucine-L-tyrosine Natural products CC(C)CC(N)C(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 LHSGPCFBGJHPCY-UHFFFAOYSA-N 0.000 description 1
- 101710189395 Lectin Proteins 0.000 description 1
- 241000880493 Leptailurus serval Species 0.000 description 1
- IZPVWNSAVUQBGP-CIUDSAMLSA-N Leu-Ser-Asp Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O IZPVWNSAVUQBGP-CIUDSAMLSA-N 0.000 description 1
- LRKCBIUDWAXNEG-CSMHCCOUSA-N Leu-Thr Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(O)=O LRKCBIUDWAXNEG-CSMHCCOUSA-N 0.000 description 1
- WFCKERTZVCQXKH-KBPBESRZSA-N Leu-Tyr-Gly Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)NCC(O)=O WFCKERTZVCQXKH-KBPBESRZSA-N 0.000 description 1
- VKVDRTGWLVZJOM-DCAQKATOSA-N Leu-Val-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O VKVDRTGWLVZJOM-DCAQKATOSA-N 0.000 description 1
- ZQCVMVCVPFYXHZ-SRVKXCTJSA-N Lys-Asn-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(O)=O)CCCCN ZQCVMVCVPFYXHZ-SRVKXCTJSA-N 0.000 description 1
- LZWNAOIMTLNMDW-NHCYSSNCSA-N Lys-Asn-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CCCCN)N LZWNAOIMTLNMDW-NHCYSSNCSA-N 0.000 description 1
- CIOWSLJGLSUOME-BQBZGAKWSA-N Lys-Asp Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(O)=O)CC(O)=O CIOWSLJGLSUOME-BQBZGAKWSA-N 0.000 description 1
- VUTWYNQUSJWBHO-BZSNNMDCSA-N Lys-Leu-Tyr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O VUTWYNQUSJWBHO-BZSNNMDCSA-N 0.000 description 1
- UQRZFMQQXXJTTF-AVGNSLFASA-N Lys-Lys-Glu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O UQRZFMQQXXJTTF-AVGNSLFASA-N 0.000 description 1
- WBSCNDJQPKSPII-KKUMJFAQSA-N Lys-Lys-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(O)=O WBSCNDJQPKSPII-KKUMJFAQSA-N 0.000 description 1
- KJIXWRWPOCKYLD-IHRRRGAJSA-N Lys-Lys-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)N KJIXWRWPOCKYLD-IHRRRGAJSA-N 0.000 description 1
- YDDDRTIPNTWGIG-SRVKXCTJSA-N Lys-Lys-Ser Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O YDDDRTIPNTWGIG-SRVKXCTJSA-N 0.000 description 1
- WINFHLHJTRGLCV-BZSNNMDCSA-N Lys-Tyr-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(O)=O)CC1=CC=C(O)C=C1 WINFHLHJTRGLCV-BZSNNMDCSA-N 0.000 description 1
- 102000043131 MHC class II family Human genes 0.000 description 1
- 108091054438 MHC class II family Proteins 0.000 description 1
- 101710179758 Mannose-specific lectin Proteins 0.000 description 1
- 101710150763 Mannose-specific lectin 1 Proteins 0.000 description 1
- 101710150745 Mannose-specific lectin 2 Proteins 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- SITLTJHOQZFJGG-UHFFFAOYSA-N N-L-alpha-glutamyl-L-valine Natural products CC(C)C(C(O)=O)NC(=O)C(N)CCC(O)=O SITLTJHOQZFJGG-UHFFFAOYSA-N 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- QGMRQYFBGABWDR-UHFFFAOYSA-M Pentobarbital sodium Chemical compound [Na+].CCCC(C)C1(CC)C(=O)NC(=O)[N-]C1=O QGMRQYFBGABWDR-UHFFFAOYSA-M 0.000 description 1
- 241000223960 Plasmodium falciparum Species 0.000 description 1
- 201000011336 Plasmodium falciparum malaria Diseases 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 206010039587 Scarlet Fever Diseases 0.000 description 1
- 229920005654 Sephadex Polymers 0.000 description 1
- 238000010266 Sephadex chromatography Methods 0.000 description 1
- 239000012507 Sephadex™ Substances 0.000 description 1
- NADLKBTYNKUJEP-KATARQTJSA-N Ser-Thr-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O NADLKBTYNKUJEP-KATARQTJSA-N 0.000 description 1
- 241000295644 Staphylococcaceae Species 0.000 description 1
- 208000008582 Staphylococcal Food Poisoning Diseases 0.000 description 1
- 206010041925 Staphylococcal infections Diseases 0.000 description 1
- 241000191940 Staphylococcus Species 0.000 description 1
- 101000794214 Staphylococcus aureus Toxic shock syndrome toxin-1 Proteins 0.000 description 1
- 206010061372 Streptococcal infection Diseases 0.000 description 1
- 241001493114 Streptococcus phage T12 Species 0.000 description 1
- 101000702198 Streptococcus pyogenes Exotoxin type A Proteins 0.000 description 1
- 108700037929 Streptococcus pyogenes SpeA Proteins 0.000 description 1
- 241001505901 Streptococcus sp. 'group A' Species 0.000 description 1
- 101710172711 Structural protein Proteins 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 230000006052 T cell proliferation Effects 0.000 description 1
- 210000000662 T-lymphocyte subset Anatomy 0.000 description 1
- PKXHGEXFMIZSER-QTKMDUPCSA-N Thr-Arg-His Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N)O PKXHGEXFMIZSER-QTKMDUPCSA-N 0.000 description 1
- NAXBBCLCEOTAIG-RHYQMDGZSA-N Thr-Arg-Lys Chemical compound NC(N)=NCCC[C@H](NC(=O)[C@@H](N)[C@H](O)C)C(=O)N[C@@H](CCCCN)C(O)=O NAXBBCLCEOTAIG-RHYQMDGZSA-N 0.000 description 1
- IMDMLDSVUSMAEJ-HJGDQZAQSA-N Thr-Leu-Asn Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O IMDMLDSVUSMAEJ-HJGDQZAQSA-N 0.000 description 1
- ZXIHABSKUITPTN-IXOXFDKPSA-N Thr-Lys-His Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N)O ZXIHABSKUITPTN-IXOXFDKPSA-N 0.000 description 1
- WTMPKZWHRCMMMT-KZVJFYERSA-N Thr-Pro-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O WTMPKZWHRCMMMT-KZVJFYERSA-N 0.000 description 1
- JAJOFWABAUKAEJ-QTKMDUPCSA-N Thr-Pro-His Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)N)O JAJOFWABAUKAEJ-QTKMDUPCSA-N 0.000 description 1
- 206010044250 Toxic shock syndrome staphylococcal Diseases 0.000 description 1
- YKCXQOBTISTQJD-BZSNNMDCSA-N Tyr-Leu-His Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](CC2=CC=C(C=C2)O)N YKCXQOBTISTQJD-BZSNNMDCSA-N 0.000 description 1
- CDKZJGMPZHPAJC-ULQDDVLXSA-N Tyr-Leu-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 CDKZJGMPZHPAJC-ULQDDVLXSA-N 0.000 description 1
- AOLHUMAVONBBEZ-STQMWFEESA-N Tyr-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 AOLHUMAVONBBEZ-STQMWFEESA-N 0.000 description 1
- YSGAPESOXHFTQY-IHRRRGAJSA-N Tyr-Met-Asp Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)N YSGAPESOXHFTQY-IHRRRGAJSA-N 0.000 description 1
- GVRKWABULJAONN-VQVTYTSYSA-N Val-Thr Chemical compound CC(C)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(O)=O GVRKWABULJAONN-VQVTYTSYSA-N 0.000 description 1
- PQSNETRGCRUOGP-KKHAAJSZSA-N Val-Thr-Asn Chemical compound CC(C)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CC(N)=O PQSNETRGCRUOGP-KKHAAJSZSA-N 0.000 description 1
- LCHZBEUVGAVMKS-RHYQMDGZSA-N Val-Thr-Leu Chemical compound CC(C)C[C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)[C@@H](C)O)C(O)=O LCHZBEUVGAVMKS-RHYQMDGZSA-N 0.000 description 1
- PDDJTOSAVNRJRH-UNQGMJICSA-N Val-Thr-Phe Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)NC(=O)[C@H](C(C)C)N)O PDDJTOSAVNRJRH-UNQGMJICSA-N 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 239000011149 active material Substances 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 230000004520 agglutination Effects 0.000 description 1
- 239000000910 agglutinin Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000009830 antibody antigen interaction Effects 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 108010062796 arginyllysine Proteins 0.000 description 1
- 108010092854 aspartyllysine Proteins 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 150000001720 carbohydrates Chemical group 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000003593 chromogenic compound Substances 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 238000012875 competitive assay Methods 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 239000000032 diagnostic agent Substances 0.000 description 1
- 229940039227 diagnostic agent Drugs 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 230000006806 disease prevention Effects 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 230000004064 dysfunction Effects 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 108010050475 glycyl-leucyl-tyrosine Proteins 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 208000021760 high fever Diseases 0.000 description 1
- 108010036413 histidylglycine Proteins 0.000 description 1
- 108010028295 histidylhistidine Proteins 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 238000010324 immunological assay Methods 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 239000000644 isotonic solution Substances 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 231100000518 lethal Toxicity 0.000 description 1
- 231100000636 lethal dose Toxicity 0.000 description 1
- 108010012058 leucyltyrosine Proteins 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 108010003700 lysyl aspartic acid Proteins 0.000 description 1
- 108010017391 lysylvaline Proteins 0.000 description 1
- 239000006249 magnetic particle Substances 0.000 description 1
- 229940124735 malaria vaccine Drugs 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000002297 mitogenic effect Effects 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000007479 molecular analysis Methods 0.000 description 1
- 210000000663 muscle cell Anatomy 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 210000000440 neutrophil Anatomy 0.000 description 1
- 230000008816 organ damage Effects 0.000 description 1
- 239000000123 paper Substances 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 229960002275 pentobarbital sodium Drugs 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 229940021222 peritoneal dialysis isotonic solution Drugs 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 150000004804 polysaccharides Polymers 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 210000001995 reticulocyte Anatomy 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 201000003068 rheumatic fever Diseases 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 208000017756 staphylococcal toxic-shock syndrome Diseases 0.000 description 1
- 201000002190 staphyloenterotoxemia Diseases 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 108010051110 tyrosyl-lysine Proteins 0.000 description 1
- 108010073969 valyllysine Proteins 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 229920002554 vinyl polymer Polymers 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/12—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria
- C07K16/1267—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria from Gram-positive bacteria
- C07K16/1275—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria from Gram-positive bacteria from Streptococcus (G)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/305—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Micrococcaceae (F)
- C07K14/31—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Micrococcaceae (F) from Staphylococcus (G)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/315—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/12—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria
- C07K16/1267—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria from Gram-positive bacteria
- C07K16/1271—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria from Gram-positive bacteria from Micrococcaceae (F), e.g. Staphylococcus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
Definitions
- This invention relates to compositions and methods for eliciting an immunogenic response in mammals, including responses which provide protection against, or reduce the severity, of toxic shock syndrome from bacterial infections. More particularly it relates to peptides, which may be polymeric, and carrier-conjugates thereof, derived from homologous sequences of the family of staphylococcal and streptococcal pyrogenic toxins. The peptides of the invention are useful to induce serum antibodies and may also be useful in diagnostic assays.
- the invention also relates to antibodies induced by the peptides and/or carrier-conjugates and their use to prevent, treat, or protect against the toxic effects of bacterial toxins, including most, if not all, of the staphylococcal and streptococcal pyrogenic toxins.
- the invention also relates to compositions and methods to protect against, or ameliorate the effects of, autoimmune diseases which are associated with, or are the result of, the presence of staphylococcal or streptococcal toxins.
- the invention also relates to diagnostic assays and kits to detect the presence of staphylococcal and streptococcal pyrogenic toxins, or antibodies thereto.
- the invention also relates to isolated and purified nucleic acids encoding the peptides of the invention and transformed host cells containing those nucleic acids.
- the ' pyrogenic exotoxins of Group A streptococci and the enterotoxins of Staphylococcus aureus constitute a family of structurally related toxins which share similar biological activities (11, 13) .
- the staphylococcal and streptococcal pyrogenic exotoxins also share significant amino acid homology throughout their sequences (11, 19, 40) .
- This pyrogenic exotoxin family contains nine main toxin types, and several allelic variants (subtypes) have been described.
- Several studies have shown that the toxins share common motifs based on immunologic cross reactivity between the toxins (26, 27) .
- toxins share the ability to bind the major histocompatibility complex (MHC) molecules of infected hosts, as well as the variable beta chain of the T-cell receptor complex (TCR) , causing an aberrant proliferation of specific T-cell subsets (3, 4, 12).
- MHC major histocompatibility complex
- TCR T-cell receptor complex
- This property of the toxins has labeled them as "superantigens” (36) since they do not interact with the MHC and TCR molecules in the manner of conventional antigens (14, 18).
- Staphylococcal enterotoxins have been implicated in staphylococcal food poisoning (26) , as well as toxic shock like syndromes (1) .
- SE staphylococcal enterotoxins
- SE staphylococcal enterotoxins
- SE staphylococcal enterotoxins
- SPE streptococcal pyrogenic exotoxins
- the sequences of three members of this family are known: SPEA, SPEC, and SSA (5, 23, 35) .
- Toxic shock syndrome toxin from S . aureus shares similar biological activity with the enterotoxins and streptococcal pyrogenic exotoxins, however it is not as closely related structurally (2) .
- Toxic shock syndrome can be exacerbated by the synergistic effects of TSST-1 with the enterotoxin/pyrogenic toxin family of toxins (9, 25) .
- Gram negative bacterial endotoxin and the pyrogenic toxins can work synergistically to produce lethal toxic shock (17, 30) .
- Toxic shock like syndrome is the term previously used to describe the syndromes caused by staphyloccal and streptococcal pyrogenic bacterial exotoxins other than toxic shock syndrome toxin (TSST-1) from S. aureus.
- TSST-1 toxic shock syndrome toxin
- toxic shock syndrome is used to describe the syndromes caused by TSST-1 and the other pyrogenic exotoxins, and is the terminology used hereinafter.
- the present invention relates to the identification of consensus sequences derived from two conserved regions of the staphylococcal enterotoxins and streptococcal pyrogenic toxins (hereinafter called “region 1" and “region 2”) and the discovery that compositions comprising amino acid sequences based on these two conserved regions of the staphylococcal enterotoxins and streptococcal pyrogenic exotoxins are capable of inducing antibodies which react with a variety of staphylococcal and streptococcal pyrogenic exotoxins and are also capable of ameliorating or preventing diseases related to the deleterious effects of these toxins.
- the invention also relates to compositions and methods for preventing and treating diseases related to the release of certain pyrogenic exotoxins from bacteria.
- This invention provides amino acid sequences capable of inducing antibodies that reduce, inhibit or eliminate the deleterious effects of bacterial toxins, such as those of staphylococcus and a variety of streptococci. These antibodies may be induced by administration of a pharmaceutical composition and/or vaccine containing a composition comprising a peptide derived from one or both of the two conserved regions described herein, or a structurally and/or immunologically related antigen.
- amino acid sequences provided by this invention are sufficiently common to all members of this family of pyrogenic exotoxins to be useful for eliciting antibodies which are cross-reactive with toxins derived from various bacteria.
- amino acid sequences provided by this invention are also useful for new methods of preventing and treating symptoms associated with the bacterial release of the staphylococcal enterotoxins and the streptococcal pyrogenic exotoxins. Such methods include, for example, administering to an individual at risk of infection or developing a toxic reaction to the exotoxins at least one of the consensus amino acid sequences of this invention in an amount sufficient to elicit the production of antibodies to the exotoxins.
- an individual at risk for developing toxic shock syndrome or an individual with symptoms of toxic shock syndrome may be treated by administering to such individual antibodies which have been generated in a mammal immunized with at least one of the compositions of this invention.
- Vaccines and pharmaceutical compositions comprising at least one of the consensus amino acid sequences and a physiologically acceptable carrier and optionally an adjuvant are also part of this invention.
- Swiss protein SPEA, P08095; SPEC, P13380; SEA, P13163; SEB, P01552; SEC, P01553 ; SED, P20723; SEE, P12993.
- Genbank SEH, U11702; SSA, L29565; TSST1, J02615.
- FIG. 1 ELISA titers of antibodies from rabbits immunized with polymeric peptide #6348.
- the peptide was diluted so that it was delivered to each well to give a final concentration of 2 ⁇ g/100 ⁇ l .
- the serum was then diluted to 1:1,000; 1:10,000; 1:100,000; 1:500,000; and 1:1,000,000 and 100 ⁇ l of each dilution of serum was placed in each well. Experiments were run in triplicate for each dilution of serum. Note the 1 log higher titers of rabbit #443 serum as compared to rabbit #442 serum. Cut off readings were at O.D. 0.6.
- FIG. 3 12% SDS PAGE gels and immunoblot of a variety of staphylococcal and streptococcal toxins developed with the anti-peptide 6348 antibody. Note bands of correct molecular weight (M.W.) of each toxin identified by the anti-peptide antibody.
- Lane 1 SPEA
- lane 2 SEB
- lane 4 SED
- lane 5 SEE
- lane 6 SEC
- lane 7 TssT-1 Note bands at appropriate M.W. in lanes 1-4. Fainter bands are seen in lanes 5 and 7.
- FIG. 4 Bar graphs of blastogenesis assays of human mononuclear cell populations stimulated by various toxins in the presence of normal rabbit serum and anti-peptide 6348 serum. Note the marked inhibition of SEB, SEC, SEE, SPEA and SPEC by the anti-peptide antibody. Less, but definite, inhibition of SEA by the anti-peptide antibody was also seen.
- the first consensus sequence (“GCG consensus #1”) identified by the Motifs program has the amino acid sequence YGG(LIV) TXXXXN, which is rewritten herein as YGGX 1 TX 2 X 3 X 4 X 5 N (SEQ ID NO:l), wherein X 1 is selected from the group consisting of L, I, or V; and X 2 , X 3 , X 4 and X 5 are each independently selected from the group consisting of any amino acid .
- This pattern is present in the staphylococcal enterotoxins and streptococcal pyrogenic exotoxins , but not in TSST-1.
- the second consensus sequence ( "GCG consensus #2 " ) identified by the Motifs program has the amino acid sequence
- One object of the invention is to provide compositions comprising peptides comprising amino acid sequences based on these two conserved regions of the staphylococcal enterotoxins and streptococcal pyrogenic toxins.
- These peptides may be used for eliciting an immunogenic response in mammals, including responses which provide protection against, or reduce the severity, of toxic shock from staphylococcal or streptococcal infections.
- These peptides may also be useful to protect against, or ameliorate the effects of, autoimmune diseases which are associated with, or are the result of, the presence of staphylococcal or streptococcal pyrogenic exotoxins.
- These peptides are also useful in diagnostic assays and kits to detect the presence of antibodies to staphylococcal and streptococcal pyrogenic exotoxins and to aid in the diagnosis of diseases related to the presence of those toxins.
- the peptides of the invention are those derived from either one or both of the following two consensus sequences:
- YGGX 1 TX 2 X 3 X 4 X 5 N (SEQ ID NO:l), wherein X, is selected from the group consisting of L, I, or V; and X 2 , X 3 , X 4 and X 5 are each independently selected from the group consisting of any amino acid .
- a preferred consensus sequence of the invention from region 1 has the amino acid sequence X 25 X 26 YGGX 1 TX 2 X 3 X 4 X 5 N (SEQ ID NO: 28) , wherein X 1 is selected from the group consisting of L, I, and V; X 2 , X 4 and X 5 are each independently selected from the group consisting of any amino acid; and X 3 , X 25 and X 26 are each independently selected from the group consisting of any amino acid and of no amino acid; but preferably X 1 is selected from the group consisting of I and V; X 2 is selected from the group consisting of L, E, K, P and N; X 3 is selected from the group consisting of H and A and no amino acid; X 4 is selected from the group consisting of D, N, E, Q, and H; X 5 is selected from the group consisting of N, G, S, and R; X 25 is selected from the group consisting of C and Y and no amino acid;
- a preferred consensus sequence of the invention from region 2 has the amino acid sequence: KX 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 DX 14 X 15 X 16 RX 17 X 18 X 27 X 19 X 20 X 21 X 22 X 23 X 24 Y (SEQ ID NO: 29) , wherein X 8 , X 13 and X 24 are each independently selected from the group consisting of L, I and V; X 6 , X 7 , X 9 , X 10 ,
- ⁇ 11' " ⁇ 12' ⁇ 14' ⁇ 15' ⁇ 16' ⁇ 17' ⁇ 18 ⁇ 19' ⁇ 20' " ⁇ 21' ⁇ 22' an ⁇ ⁇ - ⁇ 23 are each independently selected from the group consisting of any amino acid; and X 27 is selected from the group consisting of L and Y; but preferably X 6 is selected from the group consisting of K and D; X 7 is selected from the group consisting of N, K, S, E, M, I and Q; X 8 is selected fro the group consisting of L and V; X 9 is selected from the group consisting of T and A; X 10 is selected from the group consisting of V, A, L, F and I; X n is selected from the group consisting of Q and S; X 12 is selected from the group consisting of E and T; X 13 is selected from group consisting of L and I; X 14 is selected from the group consisting of L, Y, I, A, F and C; X 15 is selected from the group
- Table 1 lists the amino acids that are found at each of the variable positions in the sequences shown in Figure 1, and the number of times they appear at that position:
- X 1 , X 8 , X 13 and X 24 may each independently be selected from the group consisting of L, I and V; X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 9 , X 10 , X 11 ' 12 ' 14 ' 15 ' 16 ' X 17 ' X 18 X 19 ' X 20 ' X 21 ' X 22 ' 23 ' X 25 an ⁇ -*
- X 26 may each independently be any amino acid; X 3 , X 25 and X 26 may also each independently be no amino acid; and X 27 is selected from the group consisting of L and Y.
- the amino acids present at the positions X 1 to X 27 in the toxins shown in Figure 1 (and listed in Table 1) are preferred for those positions, and the amino acids present most often at those positions in the toxins shown in Figure 1 (and listed in Table 1) are more preferred.
- H histidine
- A alanine
- the more preferred amino acid for position X 3 in a peptide of the invention is H (histidine) .
- inosine (I) is used at position X 16 instead of the more frequently found alanine (A) .
- the preferred consensus is larger (consensus #la) , and usually includes a C in the first position (X 25 ) .
- the second residue (X 26 ) is most often a M, but this can vary.
- H is the most highly conserved.
- the eleventh residue (X 5 ) is most often a G.
- the preferred consensus (consensus #2a) is much more highly conserved than suggested by the GCG program, especially if one excludes TSST-1 sequences from consideration, as follows:
- the second position (X 6 ) is more highly conserved than suggested, being almost exclusively a K;
- the fourth residue (X 8 ) is always a V followed exclusively by a T in the fifth position (X 9 ) ;
- the sixth position (X 10 ) is somewhat variable; but the seventh position (X n ) is always a Q, followed by E (X 12 ) •
- the next position is almost always an L (X 13 ) , and the second to last position (X 24 ) is almost always an L.
- X 1 is V or I, preferably V;
- X 2 is L, E, K, P or N, preferably E or L;
- X 4 is D, N, E, Q or H, preferably E.
- Consensus #2b is D, N, E, Q or H, preferably E.
- X 7 is N, K, S, E, M, I or Q, preferably N;
- X 10 is V, A, L, F or I, preferably V;
- X 14 is L, Y, I, A, F or C, preferably Y;
- X 15 is Q, L, K or E, preferably K;
- X 16 is A, T, I or V, preferably I;
- X 17 is R, H, N or K, preferably K;
- X 18 is Y, F, I, L or Q, preferably Y;
- X 19 is Q, V, I, H, S, T or M, preferably V;
- X 20 is E, K, N, D, G, S or Q, preferably D;
- X 21 is K, N, D, R or I, preferably N;
- X 22 is Y, K, L, F or H, preferably K;
- X 23 is N, K, G or Q, preferably K.
- X 27 is L or Y, preferably L.
- Peptides exemplified herein are CMYGGVTEHEGN (SEQ ID NO: 3), CMYGGVTEHEGNGC* (SEQ ID NO: 5), KKNVTVQELDYKIRKYLVDNKKLY (SEQ ID NO: 4), CGKKNVTVQELDYKIRKYLVDNKKLYGC* (SEQ ID NO: 6), CMYGGVTEHEGNKKNVTVQELDYKIRKYLVDNKKLY (SEQ ID NO: 7) and CMYGGVTEHEGNKKNVTVQELDYKIRKYLVDNKKLYGC* (SEQ ID NO: 8) , wherein an asterisk indicates that the peptide is a randomly cross-linked polymer.
- the exemplified polymer peptides are at least 6,000 to 8,000 daltons.
- the average size of the exemplified polymer peptides is about 12,000 to 15,000 daltons.
- Small peptides and/or contaminants may be removed by dialysis or other methods available in the art.
- larger aggregates may be removed using, e.g., a 0.25 micron filter, which can also be used to sterilize the peptides.
- amino acids cysteine and methionine, "CM” are present at the amino terminus of the exemplified region 1 peptides since those amino acids are most often found in that position in nature.
- amino acids cysteine and glycine, "CG” and “GC” are used at the amino and/or carboxy- termini of some of the exemplified region 2 peptides.
- the amino acid cysteine “C” is used to facilitate cross-linking through the formation of disulfide bonds.
- the amino acid glycine, "G” is used as a spacer residue.
- the preferred peptides of the invention are those which exclude full length native toxin molecules.
- the preferred peptides of this invention are not toxic, but toxic peptides maybe useful in this invention, for example, in eliciting antibodies in a non-human system.
- the most preferred peptides of the invention do not contain amino acid sequences in the sequence in which they are found in any particular native toxin molecule.
- the present invention encompasses monomers of the peptides derived from either one or both of the two consensus regions described herein. These monomers may comprise one or more sequences derived from either region 1 or region 2 or both, such as consensus sequences #1 and #2, preferably consensus sequences #ia and/or #2a, more preferably consensus sequences #lb and/or #2b, most preferably one or more of the exemplified consensus sequence peptides. If the monomer contains more than one consensus sequence, these sequences may be immediately adjacent to each other or separated by a linker. In addition, different orientations of the peptides are within the scope of this invention. Furthermore, the order of the consensus peptides within the full peptide may be variable.
- the present invention also encompasses homogeneous or heterogeneous polymers of the peptides disclosed herein (e.g., concatenated, cross-linked and/or fused identical peptide units or concatenated, cross-linked and/or fused diverse peptide units) , and mixtures of the peptides, polymers, and/or conjugates thereof.
- homogeneous or heterogeneous polymers of the peptides disclosed herein e.g., concatenated, cross-linked and/or fused identical peptide units or concatenated, cross-linked and/or fused diverse peptide units
- Linkers useful in the invention may, for example, be simply peptide bonds, or may comprise amino acids, including amino acids capable of forming disulfide bonds, but may also comprise other molecules such as, for example, polysaccharides or fragments thereof.
- sequences derived from consensus region 1 and consensus region 2 may be immediately adjacent to each other, linked by peptide bonds, (see, e.g. , SEQ ID NO: 7) and/or connected via amino acid linkers capable of forming di-sulfide bonds via cysteine residues (see, e.g. , SEQ ID NO: 8) .
- sequences of region 1 and region 2 are separated by 27 amino acids.
- linkers are additional amino acids, they are most preferably 1 to 27 amino acids in length, although longer linkers may also be used in accordance with this invention.
- linkers for use with this invention may be chosen so as to contribute their own immunogenic effect which may be either the same, or different, than that elicited by the consensus sequences of the invention.
- linkers may be bacterial antigens which also elicit the production of antibodies to infectious bacteria.
- the linker may be a protein or protein fragment of an infectious bacteria, or a bacterial polysaccharide or polysaccharide fragment.
- a peptide of the invention includes any substituted analog or chemical derivative of a peptide derived from one or both of the two consensus regions described herein, most preferably of the exemplified peptides described herein, so long as the peptide is capable of either eliciting the production of antibodies capable of binding to most of the staphylococcal and streptococcal pyrogenic exotoxins, or reacting with (i.e., specifically binding to) antibodies that react with most of the staphylococcal and streptococcal pyrogenic exotoxins. Therefore, a peptide can be subject to various changes that provide for certain advantages in its use.
- the peptides of the invention are useful for providing active immunization for the prevention of disease related to the deleterious effects of staphylococcal and streptococcal pyrogenic exotoxins and for preparation of antibodies as a passive immunization therapy.
- the peptides are designed to induce antibodies which react with a variety of staphylococcal and streptococcal pyrogenic exotoxins (preferably with at least two, more preferably with at least four, and most preferably with at least seven of the pyrogenic exotoxins) for use in therapy to increase resistance to, prevent and/or treat toxic shock syndrome.
- the peptides may also be useful to protect against, or ameliorate the effects of, autoimmune diseases which are associated with, or are the result of, the presence of staphylococcal or streptococcal exotoxins.
- the peptides of the invention will also be useful in diagnostic tests for detecting antibodies to staphylococcal and streptococcal pyrogenic exotoxins.
- the peptide may be mixed with an adjuvant.
- the peptide also may be bound to a non-toxic non-host protein carrier to form a conjugate or it may be bound to a saccharide carrier and/or a non-toxic non-host protein carrier to form a conjugate.
- the molecular weight of the peptide monomers having one consensus sequence of the invention range from about 1000 to 5000 daltons. Such lower molecular weight species of the invention may be useful as immunogens themselves or, more preferably, may be used as haptens conjugated to a larger carrier molecule, such as, for example, a protein. As with other peptides, the molecular weight of the peptide alone, when conjugated to a carrier or in the presence of an adjuvant, is related to its immunogenicity . Thus, the peptide may vary in molecular weight in order to enhance its antigenicity or immunogenicity.
- the molecular weight of the peptide, in polymeric form is greater than about 6000 to 8000 daltons, with an average weight of 12,000 to 15,000 daltons.
- the total size of the peptide is only limited to its ability to be physiologically tolerated.
- the invention also relates to isolated and purified nucleic acid molecules which code for the peptides of the invention.
- the encoded peptides may be monomers, polymers or linked to other peptide sequences (i.e., they may be fusion proteins) .
- Other features of the invention include vectors which comprise the nucleic acid molecules of the invention operably linked to promoters, as well as cell lines, such as prokaryotic (e.g., E_;_ coli) and eukaryotic (e.g., CHO and COS) cells transfected with the nucleic acid molecules of the invention.
- Vectors and compositions for enabling production of the peptides jln vivo, i.e., in the individual to be treated or immunized, are also within the scope of this invention.
- nucleic acids encoding the peptides of the invention can be introduced into a vector such as a plasmid, cosmid, phage, virus or mini-chromosome and inserted into a host cell or organism by methods well known in the art.
- the vectors containing these nucleic acids can be utilized in any cell, either eukaryotic or prokaryotic, including mammalian cells (e.g., human (e.g., HeLa) , monkey (e.g., Cos), rabbit (e.g., rabbit reticulocytes) , rat, hamster (e.g., CHO and baby hamster kidney cells) or mouse cells (e.g., L cells), plant cells, yeast cells, insect cells or bacterial cells (e.g., ___ coli) .
- mammalian cells e.g., human (e.g., HeLa) , monkey (e.g., Cos), rabbit (e.g., rabbit reticulocytes) , rat, hamster (e.g., CHO and baby hamster kidney cells) or mouse cells (e.g., L cells), plant cells, yeast cells, insect cells or bacterial cells (e.g., ___ coli) .
- the vectors which can be utilized to clone and/or express these nucleic acids are the vectors which are capable of replicating and/or expressing the nucleic acids in the host cell in which the nucleic acids are desired to be replicated and/or expressed. See, e.g., F. Ausubel et al . , Current Protocols in Molecular Biology, Greene Publishing Associates and Wiley-Interscience (1992) and Sambrook et al. (1989) for examples of appropriate vectors for various types of host cells. Strong promoters compatible with the host into which the gene is inserted may be used. These promoters may be inducible. The host cells containing these nucleic acids can be used to express large amounts of the protein useful in pharmaceuticals, diagnostic reagents, vaccines and therapeutics.
- the nucleic acids could be used, for example, in the production of peptides for diagnostic reagents, vaccines and therapies for pyrogenic exotoxin related diseases.
- vectors expressing high levels of peptide can be used in immunotherapy and immunoprophylaxis, after expression in humans.
- Such vectors include retroviral vectors and also include direct injection of DNA into muscle cells or other receptive cells, resulting in the efficient expression of the peptide, using the technology described, for example, in Wolff et al., Science 247:1465- 1468 (1990), Wolff et al . , Human Molecular Genetics l(6):363-369 (1992) and Ulmer et al . , Science 259:1745- 1749 (1993) .
- antibodies which react with peptides of the invention, as well as a variety of staphylococcal and streptococcal pyrogenic exotoxins (preferably with at least two, more preferably with at least four, and most preferably with at least seven of the pyrogenic exotoxins) .
- These antibodies will be useful for passive immunization therapy to increase resistance to or prevent toxic shock syndrome or other diseases related to the presence of bacterial pyrogenic exotoxin.
- the antibodies may also be useful to protect against, or ameliorate the effects of, autoimmune diseases which are associated with, or are the result of, the presence of staphylococcal or streptococcal pyrogenic exotoxins.
- the antibodies of the invention will also be useful in diagnostic tests and kits for detecting the presence of staphylococcal and streptococcal pyrogenic exotoxins. These uses are discussed in more detail below.
- the peptides of the invention may be prepared by synthetic methods or by recombinant DNA methods, as known in the art and as described herein.
- compositions of this invention contain an effective, immunogenic amount of peptide of this invention.
- the effective amount of peptide per unit dose sufficient to induce an immune response depends, among other things, on the species of mammal inoculated, the body weight of the mammal and the chosen inoculation regimen, as well as the presence or absence of an adjuvant, as is well known in the art.
- Inocula typically contain peptide concentrations of about 1 microgram to about 1000 micrograms per inoculation (dose) , preferably about 3 micrograms to about 100 micrograms per dose, most preferably about 5 micrograms to 50 micrograms.
- unit dose refers to physically discrete units suitable as unitary dosages for mammals, each unit containing a predetermined quantity of active material (peptide) calculated to produce the desired immunogenic effect in association with the required diluent.
- Inocula are typically prepared as a solution in a physiologically acceptable carrier such as saline, phosphate-buffered saline and the like to form an aqueous pharmaceutical composition.
- a physiologically acceptable carrier such as saline, phosphate-buffered saline and the like to form an aqueous pharmaceutical composition.
- the route of inoculation of the peptides of the invention is typically parenteral and is preferably intramuscular, sub-cutaneous and the like, which results in eliciting antibodies protective against the deleterious effects of staphylococcal and streptococcal pyrogenic exotoxins.
- the dose is administered at least once.
- at least one booster dose may be administered after the initial injection, preferably at about 4 to 6 weeks after the first dose. Subsequent doses may be administered as indicated.
- antibody titers may be determined. In most instances it will be sufficient to assess the antibody titer in serum or plasma obtained from such an individual. Decisions as to whether to administer booster inoculations or to change the amount of the composition administered to the individual may be at least partially based on the titer.
- the titer may be based on either an immunobinding assay which measures the concentration of antibodies in the serum which bind to a specific antigen, i.e. peptide or toxin; or bactericidal assays which measure the ability of the antibodies to participate with complement in killing bacteria.
- an immunobinding assay which measures the concentration of antibodies in the serum which bind to a specific antigen, i.e. peptide or toxin
- bactericidal assays which measure the ability of the antibodies to participate with complement in killing bacteria.
- the ability to neutralize jLn vitro and in vivo biological effects of the pyrogenic exotoxins may also be assessed to determine the effectiveness of the treatment. See Example 1.
- Antibodies which measures the concentration of antibodies in the serum which bind to a specific antigen, i.e. peptide or toxin
- bactericidal assays which measure the ability of the antibodies to participate with complement in killing bacteria.
- antibody molecules is used herein to refer to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules.
- Exemplary antibody molecules are intact immunoglobulin molecules, substantially intact immunoglobulin molecules and portions of an immunoglobulin molecule, including those portions known in the art as Fab, Fab', F(ab') 2 and F(v) as well as chimeric antibody molecules.
- An antibody of the present invention is typically produced by immunizing a mammal with an immunogen or vaccine containing one or more peptides of the invention, or a structurally and/or antigenically related molecule, to induce, in the mammal, antibody molecules having immunospecificity for the immunizing peptide or peptides.
- the peptide (s) or related molecule (s) may be monomeric, polymeric, conjugated to a carrier, and/or administered in the presence of an adjuvant.
- the antibody molecules may then be collected from the mammal if they are to be used in immunoassays or for providing passive immunity.
- the antibody molecules of the present invention may be polyclonal or monoclonal. Monoclonal antibodies may be produced by methods known in the art. Portions of immunoglobulin molecules may also be produced by methods known in the art.
- the antibody of the present invention may be contained in various carriers or media, including blood, plasma, serum (e.g. , fractionated or unfractionated serum) , hybridoma supernatants and the like. Alternatively, the antibody of the present invention is isolated to the extent desired by well known techniques such as, for example, by using DEAE Sephadex, or affinity chromatography.
- the antibodies may be purified so as to obtain specific classes or subclasses of antibody such as IgM, IgG, IgA, IgG,,, IgG 2 , IgG 3 , IgG 4 and the like.
- Antibody of the IgG class are preferred for purposes of passive protection.
- the presence of the antibodies of the present invention can be determined by various assays.
- Assay techniques include, but are not limited to, immunobinding, immunofluorescence (IF) , indirect immunofluorescence, immunoprecipitation, ELISA, agglutination and Western blot techniques.
- the antibodies of the present invention have a number of diagnostic and therapeutic uses.
- the antibodies can be used as an in vitro diagnostic agent to test for the presence of various staphylococcal and streptococcal pyrogenic exotoxins in biological samples in standard immunoassay protocols and to aid in the diagnosis of various diseases related to the presence of bacterial pyrogenic exotoxins.
- the assays which use the antibodies to detect the presence of bacterial pyrogenic exotoxins in a sample involve contacting the sample with at least one of the antibodies under conditions which will allow the formation of an immunological complex between the antibody and the toxin that may be present in the sample. The formation of an immunological complex if any, indicating the presence of the toxin in the sample, is then detected and measured by suitable means.
- Such assays include, but are not limited to, radioimmunoassays, (RIA) , ELISA, indirect immunofluorescence assay, Western blot and the like.
- the antibodies may be labeled or unlabeled depending on the type of assay used.
- Labels which may be coupled to the antibodies include those known in the art and include, but are not limited to, enzymes, radionucleotides, fluorogenic and chromogenic substrates, cofactors, biotin/avidin, colloidal gold and magnetic particles.
- Modification of the antibodies allows for coupling by any known means to carrier proteins or peptides or to known supports, for example, polystyrene or polyvinyl microliter plates, glass tubes or glass beads and chromatographic supports, such as paper, cellulose and cellulose derivatives, and silica.
- Such assays may be, for example, of direct format (where the labelled first antibody reacts with the antigen) , an indirect format (where a labelled second antibody reacts with the first antibody) , a competitive format (such as the addition of a labelled antigen) , or a sandwich format (where both labelled and unlabelled antibody are utilized) , as well as other formats described in the art.
- the biological sample is contacted to antibodies of the present invention and a labelled second antibody is used to detect the presence of staphylococcal and streptococcal pyrogenic exotoxins, to which the antibodies are bound.
- the antibodies of the present invention are also useful as therapeutic agents in the prevention and treatment of diseases caused by the deleterious effects of staphylococcal and streptococcal pyrogenic exotoxins.
- the antibodies are generally administered with a physiologically acceptable carrier or vehicle therefor.
- a physiologically acceptable carrier is one that does not cause an adverse physical reaction upon administration and one in which the antibodies are sufficiently soluble and retain their activity to deliver a therapeutically effective amount of the compound.
- the therapeutically effective amount and method of administration of the antibodies may vary based on the individual patient, the indication being treated and other criteria evident to one of ordinary skill in the art.
- a therapeutically effective amount of the antibodies is one sufficient to attenuate the dysfunction without causing significant side effects such as non-specific T cell lysis or organ damage.
- the route (s) of administration useful in a particular application are apparent to one or ordinary skill in the art.
- Routes of administration of the antibodies include, but are not limited to, parenteral, and direct injection into an affected site.
- Parenteral routes of administration include but are not limited to intravenous, intramuscular, intraperitoneal and subcutaneous.
- compositions of the antibodies described above suitable for parenteral administration including, but not limited to, pharmaceutically acceptable sterile isotonic solutions.
- pharmaceutically acceptable sterile isotonic solutions include, but are not limited to, saline and phosphate buffered saline for intravenous, intramuscular, intraperitoneal, subcutaneous or direct injection into a joint or other area.
- Antibodies for use to elicit passive immunity in humans are preferably obtained from other humans previously inoculated with compositions comprising one or more of the consensus amino acid sequences of the invention. Alternatively, antibodies derived from other species may also be used. Such antibodies used in therapeutics suffer from several drawbacks such as a limited half-life and propensity to elicit an immune response. Several methods have been proposed to overcome these drawbacks. Antibodies made by these methods are encompassed by the present invention and are included herein. One such method is the "humanizing" of non-human antibodies by cloning the gene segment encoding the antigen binding region of the antibody to the human gene segments encoding the remainder of the antibody.
- the dosage of administered antibodies will vary depending upon such factors as the mammal's age, weight, height, sex, general medical condition, previous medical history and the like.
- the recipient In general, it is desirable to provide the recipient with a dosage of antibodies which is in the range of from about 5 mg/kg to about 20 mg/kg body weight of the mammal, although a lower or higher dose may be administered. In general, the antibodies will be administered intravenously (IV) or intramuscularly (IM) .
- the antibodies of the present invention are intended to be provided to the recipient subject in an amount sufficient to prevent, or attenuate the severity, extent or duration of the deleterious effects of staphylococcal and streptococcal pyrogenic exotoxins.
- the administration of the agents including peptide and antibody compositions of the invention may be for either "prophylactic” or "therapeutic” purpose.
- the agents are provided in advance of any symptom.
- the prophylactic administration of the agent serves to prevent or ameliorate any subsequent deleterious effects of staphylococcal and streptococcal pyrogenic exotoxins.
- the agent is provided at (or shortly after) the onset of a symptom of infection with bacteria expressing staphylococcal or streptococcal pyrogenic exotoxins.
- the agent of the present invention may, thus, be provided either prior to the anticipated exposure to bacteria expressing staphylococcal or streptococcal pyrogenic exotoxin (so as to attenuate the anticipated severity, duration or extent of disease symptoms) or after the initiation of the infection.
- therapies based upon vectors, such as viral vectors containing nucleic acid sequences coding for the peptides described herein. These molecules, developed so that they do not provoke a pathological effect, will stimulate the immune system to respond to the peptides.
- the peptide of the invention alone or linked to a carrier, as well as antibodies and other necessary reagents and appropriate devices and accessories may be provided in kit form so as to be readily available and easily used.
- kits may contain a solid support, such as a membrane (e.g., nitrocellulose) , a bead, sphere, test tube, rod, and so forth, to which a receptor such as an antibody specific for the target molecule will bind.
- a solid support such as a membrane (e.g., nitrocellulose)
- a bead e.g., nitrocellulose
- Such kits can also include a second receptor, such as a labelled antibody.
- kits can be used for sandwich assays to detect toxins. Kits for competitive assays are also envisioned.
- sequences were based on alignments of the streptococcal pyrogenic exotoxins with the staphylococcal enterotoxins, and the amino acids used in positions with possible degeneracy were the amino acids most frequently found in these positions.
- Three of the peptides were then catenated and polymerized to produce peptides of greater than 8000 daltons (i.e., peptides 6343, 6345 and 6348, described below) .
- peptide 6348 was used to immunize rabbits, which produced high titer antibodies to this peptide. These antibodies were tested for the ability to recognize the streptococcal and staphylococcal pyrogenic exotoxins.
- Immunological assays revealed that these antibodies recognized regions common to all the pyrogenic exotoxins. These antibodies were also tested for the ability to neutralize in vitro and in vivo biological activity of the pyrogenic exotoxins. These antibodies protected against the biological T-cell proliferation of these toxins in an in vitro blastogenesis assay using human mononuclear cell populations. The lethal effects of staphylococcal toxin SEB and streptococcal pyrogenic toxin SPEA iri vivo were also completely blocked by mixing the antibodies with the toxin prior to injection.
- Peptides were constructed by solid phase synthesis (20) using the modifications described by Houghton (10) .
- GCG Consensus #2 KX 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 DX 14 X 15 X 16 RX 17 X 18 L 19 20 21 22 23 24 (SEQ ID NO:2) peptide #2 KKNVTVQELDYKIRKYLVDNKKLY (SEQ ID NO: 4)
- synthetic peptides #1 and #2 are not native peptides, i.e., their sequences differ from those found in native toxins. Variations of these peptides have also been constructed in order to generate concatenated polymers of the peptides.
- polymers were constructed by the addition of glycine and of additional cysteine residues to the amino- and/or carboxyl- termini of the initial 2 peptides, thus facilitating concatenation via disulfide bond formation (37, 38, 39).
- the polymerized molecules were then dialyzed to remove molecules with molecular weights less than 6000-8000 daltons.
- One polymeric construct is composed of the monomer: CMYGGVTEHEGNGC (SEQ ID N0:5).
- An additional polymer is composed of the peptide: CGKKNVTVQELDYKIRKYLVDNKKLYGC (SEQ ID NO: 6).
- consensus region #1 precedes consensus region #2 by 27 amino acid residues (e.g. [consensus region 1] x27 [consensus region 2]).
- CMYGGVTEHEGNKKNVTVQELDYKIRKYLVDNKKLY SEQ ID NO : 7 .
- this peptide is representative of the two consensus regions joined together in the proper order (region 1 in the N terminal half, and region 2 in the C-terminal half of the molecule) , however they are not separated by an additional 27 residues as they are in the native toxins.
- New Zealand White rabbits were immunized by subcutaneous injection with 500 ⁇ g of peptide in complete Freund's adjuvant. Additional booster injections of 500 ⁇ g in incomplete adjuvant was administered 4 weeks after the primary injections. Ten days after booster injections, the rabbits were bled, and the anti peptide titers were determined by ELISA.
- Staphylococcal enterotoxins TSST-1, and streptococcal pyrogenic exotoxins were purchased from Toxin Technology Inc. (Sarasota, FL) . Immunoblots
- Each of the staphylococcal and streptococcal pyrogenic exotoxins were electrophoresed through 10% SDS PAGE gels (16) and transferred to nitrocellulose for western blots (33) .
- the western blots were developed using the rabbit anti-peptide 6348 serum (anti-pep 6348 or AP6348) diluted 1:5000, followed by goat anti-rabbit (IgG) alkaline phosphate conjugate (Sigma) . Inhibition of blastogenesis
- PBMC peripheral blood mononuclear cell
- mice Female New Zealand White rabbits >lyr old were obtained from Hazelton Dutchland Labs, Inc. (Denver, PA) . Rabbits were challenged with staphylococcal or streptococcal toxins at doses ranging from 50 to 100 ⁇ g/kg, as previously described (24) . Briefly, pyrogenic toxins were incubated with normal rabbit serum or anti-pep #6348 serum for one hour prior to challenge. Toxin-serum mixtures were administered intravenously through the marginal ear veins. Normal control rabbits were treated in an identical manner, with isotonic saline substituted for the pyrogenic toxin.
- rabbits were given a sub-lethal dose (5 ⁇ g/kg) of endotoxin (E ⁇ _ coli LPS, List Biological Laboratories, Inc., Campbell, CA) . Rabbits were monitored 72 h for clinical signs of toxic shock. These included elevated temperature, diarrhea, cardiopulmonary distress, and conjunctival injection. Rabbits with severe toxic shock exhibiting cyanosis and temperatures less than 97 °F were declared moribund. Moribund rabbits were euthanized by administration of 5 ml pentobarbital sodium. All animal protocols were reviewed by the Laboratory Animal Research Center at the Rockefeller University.
- rabbits raised significant antibody titers to peptide 6348. Similarly, rabbits receiving immunizations with peptides 6344 and 6346 also developed high titers.
- 6348 serum recognizes the conserved regions of the bacterial toxin molecules; SEA, SEB, SEC, SEE, SPEA, SPEC, and TSST-1 ( Figure 3) . SED did not show a significant reaction with anti-peptide 6348. Blastogenesis inhibition
- AP6348 Since recognition of the toxins by AP6348 was successful, we tested this serum for the ability to inhibit the biological effects of these pyrogenic toxins. AP6348 was capable of inhibiting n vitro blastogenesis of human PBMCs by many of the pyrogenic toxins (e.g., SEA, SEB, SEC, SEE, SPEA, and SPEC) .
- SEA SEA
- SEB SEB
- SEC SEE
- SPEA SPEA
- SPEC SPEC
- AP6348 was also able to provide passive . in vivo protection of animals challenged with lethal doses of SEB and SPEA. These animals developed fever, however the fever returned to normal within 30 hours and remained normal. Rabbits appeared to be fully recovered within days of challenge.
- Streptococcal pyrogenic exotoxin type A (scarlet fever toxin) is related to staphylococcus aureus enterotoxin B. Molecular and General Genetics. 203:354-356.
- V beta-specific superantigen staphylococcal enterotoxin B stimulation of mature T cells and clonal deletion in neonatal mice. Cell. 56:27-35.
- SEB 140 CMYGGVTEHNGN 151 SEQ ID NO: 10
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Gastroenterology & Hepatology (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
Claims
Priority Applications (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CA002286346A CA2286346A1 (en) | 1997-04-07 | 1998-04-01 | Peptides useful for reducing symptoms of toxic shock syndrome |
JP54294198A JP2001523088A (en) | 1997-04-07 | 1998-04-01 | Peptides useful for reducing the signs of toxic shock syndrome |
EP98915277A EP0973803A1 (en) | 1997-04-07 | 1998-04-01 | Peptides useful for reducing symptoms of toxic shock syndrome |
AU69501/98A AU744477B2 (en) | 1997-04-07 | 1998-04-01 | Peptides useful for reducing symptoms of toxic shock syndrome |
US11/542,774 US20080305109A1 (en) | 1997-04-07 | 2006-10-03 | Method of passive immunization |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US08/838,413 US6075119A (en) | 1997-04-07 | 1997-04-07 | Peptides useful for reducing symptoms of toxic shock syndrome |
US08/838,413 | 1997-04-07 |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US08/838,413 Continuation-In-Part US6075119A (en) | 1997-04-07 | 1997-04-07 | Peptides useful for reducing symptoms of toxic shock syndrome |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16830398A Continuation-In-Part | 1997-04-07 | 1998-10-07 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO1998045325A1 true WO1998045325A1 (en) | 1998-10-15 |
Family
ID=25277036
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US1998/006663 WO1998045325A1 (en) | 1997-04-07 | 1998-04-01 | Peptides useful for reducing symptoms of toxic shock syndrome |
Country Status (6)
Country | Link |
---|---|
US (3) | US6075119A (en) |
EP (1) | EP0973803A1 (en) |
JP (1) | JP2001523088A (en) |
AU (1) | AU744477B2 (en) |
CA (1) | CA2286346A1 (en) |
WO (1) | WO1998045325A1 (en) |
Cited By (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1999004820A2 (en) * | 1997-07-21 | 1999-02-04 | Pharmacia & Upjohn Ab | Cytolysis of target cells by superantigen conjugates inducing t-cell activation |
WO2000020598A1 (en) * | 1998-10-07 | 2000-04-13 | The Rockefeller University | Peptides useful for reducing symptoms of toxic shock syndrome and septic shock |
WO2000078790A2 (en) * | 1999-06-18 | 2000-12-28 | The Rockefeller University | Methods for inhibiting hiv replication |
WO2004087742A2 (en) * | 2003-03-28 | 2004-10-14 | The Rockefeller University | Peptides for reducing symptoms of toxic shock syndrome and septic shck |
US7115268B1 (en) | 1997-04-07 | 2006-10-03 | The Rockefeller University | Peptides useful for reducing symptoms of toxic shock syndrome and septic shock |
US7659255B2 (en) * | 2001-10-26 | 2010-02-09 | Paivi Liesi | Methods of inhibiting glutamate receptors by administering the tripeptide KDI |
Families Citing this family (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6872394B1 (en) * | 1997-12-02 | 2005-03-29 | Idaho Research Foundation, Inc. | Non-toxic immune stimulating enterotoxin compositions |
EP1097212B1 (en) * | 1998-07-10 | 2008-12-24 | U.S. Medical Research Institute of Infectious Diseases | Anthrax vaccine |
DE10116042A1 (en) * | 2001-03-30 | 2002-10-24 | Fresenius Hemocare Gmbh | Exotoxin ligand |
US20040236082A1 (en) * | 2001-04-13 | 2004-11-25 | Marshall Matthew J. | Modified staphylococcal enterotoxins and expression systems therefore |
WO2003065010A2 (en) * | 2002-02-01 | 2003-08-07 | University Of Maryland | Identification of epitopes on staphylococcal enterotoxins that inhibit transcytosis |
US20070178113A1 (en) * | 2005-11-22 | 2007-08-02 | Backstrom B T | Superantigen conjugate |
EP3806896A4 (en) * | 2018-05-16 | 2022-06-29 | Griffith University | Streptococcal toxic shock syndrome |
Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1991010680A1 (en) * | 1990-01-17 | 1991-07-25 | Terman David S | Tumor killing effects of enterotoxins and related compounds |
WO1993024136A1 (en) * | 1991-01-17 | 1993-12-09 | Terman David S | Tumor killing effects of enterotoxins, superantigens, and related compounds |
WO1994020124A1 (en) * | 1992-06-01 | 1994-09-15 | Terman David S | Method of cancer treatment |
WO1994025483A1 (en) * | 1993-05-03 | 1994-11-10 | The University Of British Columbia | Immunotherapeutic peptides derived from toxic shock syndrome toxin-1, antibodies thereto, their uses in pharmaceutical compositions and diagnosis |
WO1996036366A1 (en) * | 1995-05-18 | 1996-11-21 | National Jewish Center For Immunology And Respiratory Medicine | Gene therapy for effector cell regulation |
WO1996040930A1 (en) * | 1995-06-07 | 1996-12-19 | Regents Of The University Of Minnesota | Mutants of streptococcal toxin a and methods of use |
Family Cites Families (14)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5728388A (en) * | 1989-10-03 | 1998-03-17 | Terman; David S. | Method of cancer treatment |
US5529934A (en) * | 1991-07-29 | 1996-06-25 | Biomide Investment Limited Partnership | Method for measuring blood procoagulant activity of human leukocyte antigens |
US5378607A (en) * | 1991-07-29 | 1995-01-03 | Biomide Investment Limited Partnership | Method for testing for the presence of metastatic tumor cells |
JPH0549477A (en) * | 1991-08-05 | 1993-03-02 | Wakunaga Pharmaceut Co Ltd | Detection of bacteria of the genus staphylococcus |
US5545716A (en) * | 1992-09-08 | 1996-08-13 | University Of Florida | Superantigen agonist and antagonist peptides |
US5585465A (en) * | 1993-04-05 | 1996-12-17 | National Jewish Center For Immunology And Respiratory Medicine | Isolated toxin associated with Kawasaki syndrome |
US5470716A (en) * | 1993-04-05 | 1995-11-28 | National Jewish Center For Immunology And Respiratory Medicine | Method for diagnosing kawasaki syndrome |
US5476767A (en) * | 1993-04-05 | 1995-12-19 | Regents Of The University Of Minnesota | Isolated nucleic acid molecule coding for toxin associated with Kawasaki Syndrome and uses thereof |
US5519114A (en) * | 1993-10-29 | 1996-05-21 | University Of Florida Research Foundation, Inc. | Retroviral superantigens, superantigen peptides, and methods of use |
US5601830A (en) * | 1995-03-31 | 1997-02-11 | Wisconsin Alumni Research Foundation | Staphylococcus aureus enterotoxin H and methods of use |
US5705151A (en) * | 1995-05-18 | 1998-01-06 | National Jewish Center For Immunology & Respiratory Medicine | Gene therapy for T cell regulation |
IL119938A (en) | 1996-12-30 | 2005-08-31 | Yissum Res Dev Co | Peptides capable of eliciting protective immunity against toxic shock induced by pyrogenic exotoxins or of antagonizing toxin-mediated activation of t cells |
US6075119A (en) * | 1997-04-07 | 2000-06-13 | The Rockefeller University | Peptides useful for reducing symptoms of toxic shock syndrome |
CA2295440A1 (en) | 1997-06-18 | 1998-12-23 | The Rockefeller University | Methods for identifying antibodies and peptides useful in the treatment of septic shock and experimental arthritis and uses thereof |
-
1997
- 1997-04-07 US US08/838,413 patent/US6075119A/en not_active Expired - Fee Related
-
1998
- 1998-04-01 CA CA002286346A patent/CA2286346A1/en not_active Abandoned
- 1998-04-01 WO PCT/US1998/006663 patent/WO1998045325A1/en not_active Application Discontinuation
- 1998-04-01 JP JP54294198A patent/JP2001523088A/en not_active Ceased
- 1998-04-01 AU AU69501/98A patent/AU744477B2/en not_active Ceased
- 1998-04-01 EP EP98915277A patent/EP0973803A1/en not_active Withdrawn
-
1999
- 1999-06-18 US US09/335,581 patent/US7115268B1/en not_active Expired - Fee Related
-
2006
- 2006-10-03 US US11/542,774 patent/US20080305109A1/en not_active Abandoned
Patent Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1991010680A1 (en) * | 1990-01-17 | 1991-07-25 | Terman David S | Tumor killing effects of enterotoxins and related compounds |
WO1993024136A1 (en) * | 1991-01-17 | 1993-12-09 | Terman David S | Tumor killing effects of enterotoxins, superantigens, and related compounds |
WO1994020124A1 (en) * | 1992-06-01 | 1994-09-15 | Terman David S | Method of cancer treatment |
WO1994025483A1 (en) * | 1993-05-03 | 1994-11-10 | The University Of British Columbia | Immunotherapeutic peptides derived from toxic shock syndrome toxin-1, antibodies thereto, their uses in pharmaceutical compositions and diagnosis |
WO1996036366A1 (en) * | 1995-05-18 | 1996-11-21 | National Jewish Center For Immunology And Respiratory Medicine | Gene therapy for effector cell regulation |
WO1996040930A1 (en) * | 1995-06-07 | 1996-12-19 | Regents Of The University Of Minnesota | Mutants of streptococcal toxin a and methods of use |
Non-Patent Citations (1)
Title |
---|
VAN DER BUSSCHE ET AL.,: "Molecular evolution of the staphylococcal and streptococcal pyrogenic toxin gene family", MOLECULAR PHYLOGENETICS AND EVOLUTION, vol. 2, no. 4, 1993, pages 281 - 292, XP002073580 * |
Cited By (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7115268B1 (en) | 1997-04-07 | 2006-10-03 | The Rockefeller University | Peptides useful for reducing symptoms of toxic shock syndrome and septic shock |
WO1999004820A2 (en) * | 1997-07-21 | 1999-02-04 | Pharmacia & Upjohn Ab | Cytolysis of target cells by superantigen conjugates inducing t-cell activation |
WO1999004820A3 (en) * | 1997-07-21 | 1999-08-12 | Pharmacia & Upjohn Ab | Cytolysis of target cells by superantigen conjugates inducing t-cell activation |
WO2000020598A1 (en) * | 1998-10-07 | 2000-04-13 | The Rockefeller University | Peptides useful for reducing symptoms of toxic shock syndrome and septic shock |
WO2000078790A2 (en) * | 1999-06-18 | 2000-12-28 | The Rockefeller University | Methods for inhibiting hiv replication |
WO2000078790A3 (en) * | 1999-06-18 | 2001-07-05 | Univ Rockefeller | Methods for inhibiting hiv replication |
US7659255B2 (en) * | 2001-10-26 | 2010-02-09 | Paivi Liesi | Methods of inhibiting glutamate receptors by administering the tripeptide KDI |
US7741436B2 (en) | 2001-10-26 | 2010-06-22 | Liesi Paeivi | Biologically active peptides and their use for repairing injured nerves |
WO2004087742A2 (en) * | 2003-03-28 | 2004-10-14 | The Rockefeller University | Peptides for reducing symptoms of toxic shock syndrome and septic shck |
WO2004087742A3 (en) * | 2003-03-28 | 2005-09-01 | Univ Rockefeller | Peptides for reducing symptoms of toxic shock syndrome and septic shck |
Also Published As
Publication number | Publication date |
---|---|
US7115268B1 (en) | 2006-10-03 |
EP0973803A1 (en) | 2000-01-26 |
JP2001523088A (en) | 2001-11-20 |
US20080305109A1 (en) | 2008-12-11 |
CA2286346A1 (en) | 1998-10-15 |
AU744477B2 (en) | 2002-02-28 |
US6075119A (en) | 2000-06-13 |
AU6950198A (en) | 1998-10-30 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20080305109A1 (en) | Method of passive immunization | |
US8067202B2 (en) | Bacterial superantigen vaccines | |
Pruksakorn et al. | Conserved T and B cell epitopes on the M protein of group A streptococci. Induction of bactericidal antibodies. | |
US7750132B2 (en) | Altered superantigen toxins | |
Takahashi et al. | Immunogenicity and protective effect against oral colonization by Streptococcus mutans of synthetic peptides of a streptococcal surface protein antigen. | |
JP3245298B2 (en) | Epitope region of pneumococcal surface protein A | |
JP2001517069A (en) | Compounds and methods for immunotherapy and diagnosis of tuberculosis | |
US20030157122A1 (en) | Streptococcal streptolysin S vaccines | |
US20160074497A1 (en) | Staphylococcus live cell vaccines | |
US20020086023A1 (en) | Streptococcal streptolysin S vaccines | |
EP1105154B1 (en) | Bacterial superantigen vaccines | |
HU220101B (en) | Compositions for the treatment of rheumatoid arthritis | |
Nishi et al. | B cell epitope mapping of the bacterial superantigen staphylococcal enterotoxin B: the dominant epitope region recognized by intravenous IgG. | |
WO2000020598A1 (en) | Peptides useful for reducing symptoms of toxic shock syndrome and septic shock | |
AU747197B2 (en) | Epitopes of shigella like toxin and their use as vaccine and in diagnosis | |
US11278609B2 (en) | Polypeptides derived from Enterococcus and their use for vaccination and the generation of therapeutic antibodies | |
CA2506538A1 (en) | Bacterial superantigen vaccines | |
Elvin | Monoclonal Antibodies Against Toxic Shock Syndrome Toxin-1 and Their Use in Diagnosis | |
JP2007524378A (en) | Peptides and mimetics that alleviate toxic shock syndrome and septic shock symptoms |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A1 Designated state(s): AL AM AT AU AZ BA BB BG BR BY CA CH CN CU CZ DE DK EE ES FI GB GE GH GM GW HU ID IL IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT UA UG UZ VN YU ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): GH GM KE LS MW SD SZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN ML MR NE SN TD TG |
|
DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
ENP | Entry into the national phase |
Ref document number: 2286346 Country of ref document: CA Ref country code: CA Ref document number: 2286346 Kind code of ref document: A Format of ref document f/p: F Ref country code: JP Ref document number: 1998 542941 Kind code of ref document: A Format of ref document f/p: F |
|
WWE | Wipo information: entry into national phase |
Ref document number: 69501/98 Country of ref document: AU |
|
WWE | Wipo information: entry into national phase |
Ref document number: 1998915277 Country of ref document: EP |
|
WWP | Wipo information: published in national office |
Ref document number: 1998915277 Country of ref document: EP |
|
REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
WWG | Wipo information: grant in national office |
Ref document number: 69501/98 Country of ref document: AU |
|
WWW | Wipo information: withdrawn in national office |
Ref document number: 1998915277 Country of ref document: EP |