USRE49099E1 - Humanized monoclonal antibodies against activated protein c and uses thereof - Google Patents
Humanized monoclonal antibodies against activated protein c and uses thereof Download PDFInfo
- Publication number
- USRE49099E1 USRE49099E1 US16/419,319 US201316419319A USRE49099E US RE49099 E1 USRE49099 E1 US RE49099E1 US 201316419319 A US201316419319 A US 201316419319A US RE49099 E USRE49099 E US RE49099E
- Authority
- US
- United States
- Prior art keywords
- antibody
- seq
- binding
- apc
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 229960000856 protein c Drugs 0.000 title claims abstract description 29
- 230000027455 binding Effects 0.000 claims abstract description 123
- 238000000034 method Methods 0.000 claims abstract description 76
- 101800004937 Protein C Proteins 0.000 claims abstract description 28
- 101800001700 Saposin-D Proteins 0.000 claims abstract description 28
- 230000002401 inhibitory effect Effects 0.000 claims abstract description 4
- 102100036546 Salivary acidic proline-rich phosphoprotein 1/2 Human genes 0.000 claims abstract 6
- 235000001014 amino acid Nutrition 0.000 claims description 22
- 150000001413 amino acids Chemical group 0.000 claims description 17
- 238000006467 substitution reaction Methods 0.000 claims description 14
- 125000000539 amino acid group Chemical group 0.000 claims description 13
- 208000009292 Hemophilia A Diseases 0.000 claims description 11
- 108010021625 Immunoglobulin Fragments Proteins 0.000 claims description 11
- 102000008394 Immunoglobulin Fragments Human genes 0.000 claims description 11
- 230000014508 negative regulation of coagulation Effects 0.000 claims description 11
- 150000007523 nucleic acids Chemical class 0.000 claims description 11
- 108020004707 nucleic acids Proteins 0.000 claims description 9
- 102000039446 nucleic acids Human genes 0.000 claims description 9
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims description 6
- 239000004475 Arginine Substances 0.000 claims description 5
- 208000031220 Hemophilia Diseases 0.000 claims description 5
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 claims description 5
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 claims description 5
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 claims description 5
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 claims description 5
- 230000023555 blood coagulation Effects 0.000 claims description 5
- 239000003937 drug carrier Substances 0.000 claims description 5
- 230000023597 hemostasis Effects 0.000 claims description 5
- 208000014674 injury Diseases 0.000 claims description 5
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 claims description 5
- 229960000310 isoleucine Drugs 0.000 claims description 5
- 230000008733 trauma Effects 0.000 claims description 5
- 239000004474 valine Substances 0.000 claims description 5
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 claims description 4
- 125000000637 arginyl group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 claims description 4
- 108010003723 Single-Domain Antibodies Proteins 0.000 claims description 3
- 208000007536 Thrombosis Diseases 0.000 claims description 3
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 claims description 3
- 125000001909 leucine group Chemical group [H]N(*)C(C(*)=O)C([H])([H])C(C([H])([H])[H])C([H])([H])[H] 0.000 claims description 3
- 235000004279 alanine Nutrition 0.000 claims description 2
- 230000003024 amidolytic effect Effects 0.000 claims description 2
- 230000001737 promoting effect Effects 0.000 claims 1
- 238000011282 treatment Methods 0.000 abstract description 11
- 239000000427 antigen Substances 0.000 description 68
- 102000036639 antigens Human genes 0.000 description 67
- 108091007433 antigens Proteins 0.000 description 67
- 239000000203 mixture Substances 0.000 description 65
- 108090000623 proteins and genes Proteins 0.000 description 41
- 108090000765 processed proteins & peptides Proteins 0.000 description 36
- 102000004169 proteins and genes Human genes 0.000 description 36
- 235000018102 proteins Nutrition 0.000 description 35
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 34
- 239000000243 solution Substances 0.000 description 28
- 230000037396 body weight Effects 0.000 description 25
- 239000003795 chemical substances by application Substances 0.000 description 24
- 229920001184 polypeptide Polymers 0.000 description 23
- 102000004196 processed proteins & peptides Human genes 0.000 description 23
- 102000017975 Protein C Human genes 0.000 description 22
- 230000000694 effects Effects 0.000 description 22
- 210000004027 cell Anatomy 0.000 description 20
- 239000003446 ligand Substances 0.000 description 19
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 18
- 239000012634 fragment Substances 0.000 description 17
- 238000009472 formulation Methods 0.000 description 16
- 239000000523 sample Substances 0.000 description 16
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 15
- 230000015572 biosynthetic process Effects 0.000 description 15
- 239000000306 component Substances 0.000 description 15
- 238000002347 injection Methods 0.000 description 15
- 239000007924 injection Substances 0.000 description 15
- 210000004602 germ cell Anatomy 0.000 description 13
- 239000002502 liposome Substances 0.000 description 13
- 230000001225 therapeutic effect Effects 0.000 description 13
- 238000002965 ELISA Methods 0.000 description 12
- 150000001875 compounds Chemical class 0.000 description 12
- 238000001514 detection method Methods 0.000 description 12
- 230000006870 function Effects 0.000 description 12
- 229940024606 amino acid Drugs 0.000 description 11
- 230000000903 blocking effect Effects 0.000 description 11
- 238000013461 design Methods 0.000 description 11
- 239000003814 drug Substances 0.000 description 11
- 238000001727 in vivo Methods 0.000 description 11
- 238000002360 preparation method Methods 0.000 description 11
- 239000004971 Cross linker Substances 0.000 description 10
- 108020004414 DNA Proteins 0.000 description 10
- 108060003951 Immunoglobulin Proteins 0.000 description 10
- 238000004458 analytical method Methods 0.000 description 10
- 102000018358 immunoglobulin Human genes 0.000 description 10
- 239000000758 substrate Substances 0.000 description 10
- -1 thiolate anions Chemical class 0.000 description 10
- 108010009900 Endothelial Protein C Receptor Proteins 0.000 description 9
- 102100030024 Endothelial protein C receptor Human genes 0.000 description 9
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 9
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 9
- 108010042591 activated protein C receptor Proteins 0.000 description 9
- 238000003556 assay Methods 0.000 description 9
- 229960002685 biotin Drugs 0.000 description 9
- 235000020958 biotin Nutrition 0.000 description 9
- 239000011616 biotin Substances 0.000 description 9
- 229940079593 drug Drugs 0.000 description 9
- 230000003993 interaction Effects 0.000 description 9
- 239000007788 liquid Substances 0.000 description 9
- 102000004190 Enzymes Human genes 0.000 description 8
- 108090000790 Enzymes Proteins 0.000 description 8
- 108010054218 Factor VIII Proteins 0.000 description 8
- 102000001690 Factor VIII Human genes 0.000 description 8
- 102000006947 Histones Human genes 0.000 description 8
- 108010033040 Histones Proteins 0.000 description 8
- 101000924577 Homo sapiens Adenomatous polyposis coli protein Proteins 0.000 description 8
- 238000000576 coating method Methods 0.000 description 8
- 229940088598 enzyme Drugs 0.000 description 8
- 229960000301 factor viii Drugs 0.000 description 8
- 229940127121 immunoconjugate Drugs 0.000 description 8
- 239000000463 material Substances 0.000 description 8
- 229920001223 polyethylene glycol Polymers 0.000 description 8
- 238000000746 purification Methods 0.000 description 8
- 239000011780 sodium chloride Substances 0.000 description 8
- 239000004094 surface-active agent Substances 0.000 description 8
- 102100022641 Coagulation factor IX Human genes 0.000 description 7
- 108010074105 Factor Va Proteins 0.000 description 7
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 7
- 239000002202 Polyethylene glycol Substances 0.000 description 7
- 239000007864 aqueous solution Substances 0.000 description 7
- 238000006243 chemical reaction Methods 0.000 description 7
- 238000011534 incubation Methods 0.000 description 7
- 238000001802 infusion Methods 0.000 description 7
- 210000002381 plasma Anatomy 0.000 description 7
- 239000000843 powder Substances 0.000 description 7
- 150000003839 salts Chemical class 0.000 description 7
- 239000002904 solvent Substances 0.000 description 7
- 239000000126 substance Substances 0.000 description 7
- 241000282693 Cercopithecidae Species 0.000 description 6
- 102100026735 Coagulation factor VIII Human genes 0.000 description 6
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 6
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- 201000003542 Factor VIII deficiency Diseases 0.000 description 6
- 208000032843 Hemorrhage Diseases 0.000 description 6
- 101000911390 Homo sapiens Coagulation factor VIII Proteins 0.000 description 6
- 108010079274 Thrombomodulin Proteins 0.000 description 6
- 102100026966 Thrombomodulin Human genes 0.000 description 6
- 239000004480 active ingredient Substances 0.000 description 6
- 125000003275 alpha amino acid group Chemical group 0.000 description 6
- 238000013459 approach Methods 0.000 description 6
- 208000034158 bleeding Diseases 0.000 description 6
- 230000000740 bleeding effect Effects 0.000 description 6
- 239000000969 carrier Substances 0.000 description 6
- 239000011248 coating agent Substances 0.000 description 6
- 230000007812 deficiency Effects 0.000 description 6
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 6
- 239000006185 dispersion Substances 0.000 description 6
- 238000010494 dissociation reaction Methods 0.000 description 6
- 230000005593 dissociations Effects 0.000 description 6
- 229960001484 edetic acid Drugs 0.000 description 6
- 238000003384 imaging method Methods 0.000 description 6
- 239000008194 pharmaceutical composition Substances 0.000 description 6
- 239000002953 phosphate buffered saline Substances 0.000 description 6
- 239000003755 preservative agent Substances 0.000 description 6
- 230000008569 process Effects 0.000 description 6
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- 108010076282 Factor IX Proteins 0.000 description 5
- 230000009471 action Effects 0.000 description 5
- 230000003321 amplification Effects 0.000 description 5
- 235000009697 arginine Nutrition 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 239000002775 capsule Substances 0.000 description 5
- 230000001413 cellular effect Effects 0.000 description 5
- 238000003776 cleavage reaction Methods 0.000 description 5
- 230000007547 defect Effects 0.000 description 5
- 210000003038 endothelium Anatomy 0.000 description 5
- 229960004222 factor ix Drugs 0.000 description 5
- 230000005764 inhibitory process Effects 0.000 description 5
- 150000002500 ions Chemical class 0.000 description 5
- 150000002632 lipids Chemical class 0.000 description 5
- 230000035772 mutation Effects 0.000 description 5
- 238000003199 nucleic acid amplification method Methods 0.000 description 5
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- 239000012146 running buffer Substances 0.000 description 5
- 230000007017 scission Effects 0.000 description 5
- 241000894007 species Species 0.000 description 5
- 239000000829 suppository Substances 0.000 description 5
- 210000001519 tissue Anatomy 0.000 description 5
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 4
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 4
- 108090001008 Avidin Proteins 0.000 description 4
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 4
- 102100023804 Coagulation factor VII Human genes 0.000 description 4
- 206010053567 Coagulopathies Diseases 0.000 description 4
- 108010023321 Factor VII Proteins 0.000 description 4
- 108010061932 Factor VIIIa Proteins 0.000 description 4
- 239000007995 HEPES buffer Substances 0.000 description 4
- 101000595198 Homo sapiens Podocalyxin Proteins 0.000 description 4
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 4
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 4
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 4
- 108010090804 Streptavidin Chemical class 0.000 description 4
- 108090000190 Thrombin Proteins 0.000 description 4
- 238000010521 absorption reaction Methods 0.000 description 4
- 239000000370 acceptor Substances 0.000 description 4
- 239000013543 active substance Substances 0.000 description 4
- 238000013357 binding ELISA Methods 0.000 description 4
- 239000011230 binding agent Substances 0.000 description 4
- 229940098773 bovine serum albumin Drugs 0.000 description 4
- 230000035602 clotting Effects 0.000 description 4
- 230000015271 coagulation Effects 0.000 description 4
- 238000005345 coagulation Methods 0.000 description 4
- 238000010168 coupling process Methods 0.000 description 4
- 239000003431 cross linking reagent Substances 0.000 description 4
- 239000002612 dispersion medium Substances 0.000 description 4
- 229940012413 factor vii Drugs 0.000 description 4
- 239000000796 flavoring agent Substances 0.000 description 4
- 239000012530 fluid Substances 0.000 description 4
- 235000013355 food flavoring agent Nutrition 0.000 description 4
- 229940072221 immunoglobulins Drugs 0.000 description 4
- 238000003780 insertion Methods 0.000 description 4
- 230000037431 insertion Effects 0.000 description 4
- 230000000670 limiting effect Effects 0.000 description 4
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 4
- 244000005700 microbiome Species 0.000 description 4
- 239000002773 nucleotide Substances 0.000 description 4
- 125000003729 nucleotide group Chemical group 0.000 description 4
- 239000002245 particle Substances 0.000 description 4
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 235000013930 proline Nutrition 0.000 description 4
- 238000003127 radioimmunoassay Methods 0.000 description 4
- 230000002829 reductive effect Effects 0.000 description 4
- 239000007787 solid Substances 0.000 description 4
- 235000000346 sugar Nutrition 0.000 description 4
- 125000003396 thiol group Chemical group [H]S* 0.000 description 4
- 229960004072 thrombin Drugs 0.000 description 4
- 238000001890 transfection Methods 0.000 description 4
- 238000005406 washing Methods 0.000 description 4
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 3
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 3
- 102000015081 Blood Coagulation Factors Human genes 0.000 description 3
- 108010039209 Blood Coagulation Factors Proteins 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 108010010803 Gelatin Proteins 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 208000024659 Hemostatic disease Diseases 0.000 description 3
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 3
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- 229920002873 Polyethylenimine Polymers 0.000 description 3
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 3
- 206010040047 Sepsis Diseases 0.000 description 3
- 201000004283 Shwachman-Diamond syndrome Diseases 0.000 description 3
- 239000000443 aerosol Substances 0.000 description 3
- 150000001412 amines Chemical class 0.000 description 3
- 239000003242 anti bacterial agent Substances 0.000 description 3
- 239000012736 aqueous medium Substances 0.000 description 3
- 239000012472 biological sample Substances 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 239000003114 blood coagulation factor Substances 0.000 description 3
- 238000011260 co-administration Methods 0.000 description 3
- 230000000295 complement effect Effects 0.000 description 3
- 239000013256 coordination polymer Substances 0.000 description 3
- 230000001120 cytoprotective effect Effects 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 3
- 239000000975 dye Substances 0.000 description 3
- 239000012636 effector Substances 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- 239000000284 extract Substances 0.000 description 3
- 235000003599 food sweetener Nutrition 0.000 description 3
- 125000000524 functional group Chemical group 0.000 description 3
- 239000008273 gelatin Substances 0.000 description 3
- 229920000159 gelatin Polymers 0.000 description 3
- 235000019322 gelatine Nutrition 0.000 description 3
- 235000011852 gelatine desserts Nutrition 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 208000031169 hemorrhagic disease Diseases 0.000 description 3
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 3
- 229910052739 hydrogen Inorganic materials 0.000 description 3
- 238000003018 immunoassay Methods 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 239000007951 isotonicity adjuster Substances 0.000 description 3
- 239000006193 liquid solution Substances 0.000 description 3
- 239000000314 lubricant Substances 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 238000007911 parenteral administration Methods 0.000 description 3
- 230000006320 pegylation Effects 0.000 description 3
- 230000035699 permeability Effects 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- 229920005862 polyol Polymers 0.000 description 3
- 150000003077 polyols Chemical class 0.000 description 3
- NLKNQRATVPKPDG-UHFFFAOYSA-M potassium iodide Chemical compound [K+].[I-] NLKNQRATVPKPDG-UHFFFAOYSA-M 0.000 description 3
- 230000002335 preservative effect Effects 0.000 description 3
- 150000003141 primary amines Chemical group 0.000 description 3
- 230000002285 radioactive effect Effects 0.000 description 3
- 102000005962 receptors Human genes 0.000 description 3
- 108020003175 receptors Proteins 0.000 description 3
- 230000009870 specific binding Effects 0.000 description 3
- 239000003381 stabilizer Substances 0.000 description 3
- 238000003860 storage Methods 0.000 description 3
- 150000008163 sugars Chemical class 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 239000003765 sweetening agent Substances 0.000 description 3
- 239000006188 syrup Substances 0.000 description 3
- 235000020357 syrup Nutrition 0.000 description 3
- 239000003826 tablet Substances 0.000 description 3
- 208000012908 vascular hemostatic disease Diseases 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- 238000001262 western blot Methods 0.000 description 3
- GKSPIZSKQWTXQG-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[1-(pyridin-2-yldisulfanyl)ethyl]benzoate Chemical group C=1C=C(C(=O)ON2C(CCC2=O)=O)C=CC=1C(C)SSC1=CC=CC=N1 GKSPIZSKQWTXQG-UHFFFAOYSA-N 0.000 description 2
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 2
- VGIRNWJSIRVFRT-UHFFFAOYSA-N 2',7'-difluorofluorescein Chemical compound OC(=O)C1=CC=CC=C1C1=C2C=C(F)C(=O)C=C2OC2=CC(O)=C(F)C=C21 VGIRNWJSIRVFRT-UHFFFAOYSA-N 0.000 description 2
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 229920002261 Corn starch Polymers 0.000 description 2
- 102000010911 Enzyme Precursors Human genes 0.000 description 2
- 108010062466 Enzyme Precursors Proteins 0.000 description 2
- 108010054265 Factor VIIa Proteins 0.000 description 2
- 241000233866 Fungi Species 0.000 description 2
- 101001098529 Homo sapiens Proteinase-activated receptor 1 Proteins 0.000 description 2
- 101000713169 Homo sapiens Solute carrier family 52, riboflavin transporter, member 2 Proteins 0.000 description 2
- 101000653189 Homo sapiens Tissue factor pathway inhibitor Proteins 0.000 description 2
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 2
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 2
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- QPCDCPDFJACHGM-UHFFFAOYSA-N N,N-bis{2-[bis(carboxymethyl)amino]ethyl}glycine Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(=O)O)CCN(CC(O)=O)CC(O)=O QPCDCPDFJACHGM-UHFFFAOYSA-N 0.000 description 2
- 230000004988 N-glycosylation Effects 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 102000001708 Protein Isoforms Human genes 0.000 description 2
- 108010029485 Protein Isoforms Proteins 0.000 description 2
- 102100037136 Proteinase-activated receptor 1 Human genes 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- 239000007801 affinity label Substances 0.000 description 2
- 230000002776 aggregation Effects 0.000 description 2
- 238000004220 aggregation Methods 0.000 description 2
- 125000003277 amino group Chemical group 0.000 description 2
- 230000003110 anti-inflammatory effect Effects 0.000 description 2
- 239000003146 anticoagulant agent Substances 0.000 description 2
- 229940127219 anticoagulant drug Drugs 0.000 description 2
- 229940121375 antifungal agent Drugs 0.000 description 2
- 239000003429 antifungal agent Substances 0.000 description 2
- 239000003963 antioxidant agent Substances 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 230000001588 bifunctional effect Effects 0.000 description 2
- 230000033228 biological regulation Effects 0.000 description 2
- 239000012503 blood component Substances 0.000 description 2
- AIYUHDOJVYHVIT-UHFFFAOYSA-M caesium chloride Chemical compound [Cl-].[Cs+] AIYUHDOJVYHVIT-UHFFFAOYSA-M 0.000 description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 2
- 239000005018 casein Substances 0.000 description 2
- BECPQYXYKAMYBN-UHFFFAOYSA-N casein, tech. Chemical compound NCCCCC(C(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(CC(C)C)N=C(O)C(CCC(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(C(C)O)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(COP(O)(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(N)CC1=CC=CC=C1 BECPQYXYKAMYBN-UHFFFAOYSA-N 0.000 description 2
- 235000021240 caseins Nutrition 0.000 description 2
- 230000003197 catalytic effect Effects 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 239000002738 chelating agent Substances 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 239000003593 chromogenic compound Substances 0.000 description 2
- 229910017052 cobalt Inorganic materials 0.000 description 2
- 239000010941 cobalt Substances 0.000 description 2
- GUTLYIVDDKVIGB-UHFFFAOYSA-N cobalt atom Chemical compound [Co] GUTLYIVDDKVIGB-UHFFFAOYSA-N 0.000 description 2
- 238000004440 column chromatography Methods 0.000 description 2
- 238000002648 combination therapy Methods 0.000 description 2
- 239000003636 conditioned culture medium Substances 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 239000008120 corn starch Substances 0.000 description 2
- 229940099112 cornstarch Drugs 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 239000007822 coupling agent Substances 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- UQLDLKMNUJERMK-UHFFFAOYSA-L di(octadecanoyloxy)lead Chemical compound [Pb+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O UQLDLKMNUJERMK-UHFFFAOYSA-L 0.000 description 2
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 238000006471 dimerization reaction Methods 0.000 description 2
- 208000035475 disorder Diseases 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- 210000002889 endothelial cell Anatomy 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- 229940012414 factor viia Drugs 0.000 description 2
- 239000012458 free base Substances 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 238000002873 global sequence alignment Methods 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- 208000009429 hemophilia B Diseases 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 238000002744 homologous recombination Methods 0.000 description 2
- 230000006801 homologous recombination Effects 0.000 description 2
- 102000055691 human APC Human genes 0.000 description 2
- 239000001257 hydrogen Substances 0.000 description 2
- 239000001863 hydroxypropyl cellulose Substances 0.000 description 2
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 2
- 230000003100 immobilizing effect Effects 0.000 description 2
- 230000002779 inactivation Effects 0.000 description 2
- APFVFJFRJDLVQX-AHCXROLUSA-N indium-111 Chemical compound [111In] APFVFJFRJDLVQX-AHCXROLUSA-N 0.000 description 2
- 239000007972 injectable composition Substances 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 229910052742 iron Inorganic materials 0.000 description 2
- 239000008101 lactose Substances 0.000 description 2
- 239000000787 lecithin Substances 0.000 description 2
- 235000010445 lecithin Nutrition 0.000 description 2
- 229940067606 lecithin Drugs 0.000 description 2
- 108010026228 mRNA guanylyltransferase Proteins 0.000 description 2
- 235000019359 magnesium stearate Nutrition 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 239000011159 matrix material Substances 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 239000002105 nanoparticle Substances 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 239000007800 oxidant agent Substances 0.000 description 2
- 230000005298 paramagnetic effect Effects 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 229960003330 pentetic acid Drugs 0.000 description 2
- 238000002823 phage display Methods 0.000 description 2
- CTRLRINCMYICJO-UHFFFAOYSA-N phenyl azide Chemical class [N-]=[N+]=NC1=CC=CC=C1 CTRLRINCMYICJO-UHFFFAOYSA-N 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 150000003904 phospholipids Chemical class 0.000 description 2
- 239000006187 pill Substances 0.000 description 2
- 238000007639 printing Methods 0.000 description 2
- 239000003805 procoagulant Substances 0.000 description 2
- 230000002035 prolonged effect Effects 0.000 description 2
- 238000001742 protein purification Methods 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 2
- CVHZOJJKTDOEJC-UHFFFAOYSA-N saccharin Chemical compound C1=CC=C2C(=O)NS(=O)(=O)C2=C1 CVHZOJJKTDOEJC-UHFFFAOYSA-N 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 2
- 239000007974 sodium acetate buffer Substances 0.000 description 2
- FVAUCKIRQBBSSJ-UHFFFAOYSA-M sodium iodide Inorganic materials [Na+].[I-] FVAUCKIRQBBSSJ-UHFFFAOYSA-M 0.000 description 2
- 238000001179 sorption measurement Methods 0.000 description 2
- 239000007921 spray Substances 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 238000010254 subcutaneous injection Methods 0.000 description 2
- 239000007929 subcutaneous injection Substances 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- ABZLKHKQJHEPAX-UHFFFAOYSA-N tetramethylrhodamine Chemical compound C=12C=CC(N(C)C)=CC2=[O+]C2=CC(N(C)C)=CC=C2C=1C1=CC=CC=C1C([O-])=O ABZLKHKQJHEPAX-UHFFFAOYSA-N 0.000 description 2
- 229940124597 therapeutic agent Drugs 0.000 description 2
- 230000007704 transition Effects 0.000 description 2
- 150000003626 triacylglycerols Chemical class 0.000 description 2
- GETQZCLCWQTVFV-UHFFFAOYSA-N trimethylamine Chemical compound CN(C)C GETQZCLCWQTVFV-UHFFFAOYSA-N 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 239000013598 vector Substances 0.000 description 2
- 235000015112 vegetable and seed oil Nutrition 0.000 description 2
- 239000008158 vegetable oil Substances 0.000 description 2
- OZFAFGSSMRRTDW-UHFFFAOYSA-N (2,4-dichlorophenyl) benzenesulfonate Chemical compound ClC1=CC(Cl)=CC=C1OS(=O)(=O)C1=CC=CC=C1 OZFAFGSSMRRTDW-UHFFFAOYSA-N 0.000 description 1
- KYRUKRFVOACELK-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(4-hydroxyphenyl)propanoate Chemical compound C1=CC(O)=CC=C1CCC(=O)ON1C(=O)CCC1=O KYRUKRFVOACELK-UHFFFAOYSA-N 0.000 description 1
- JWDFQMWEFLOOED-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(pyridin-2-yldisulfanyl)propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCSSC1=CC=CC=N1 JWDFQMWEFLOOED-UHFFFAOYSA-N 0.000 description 1
- PNDPGZBMCMUPRI-HVTJNCQCSA-N 10043-66-0 Chemical compound [131I][131I] PNDPGZBMCMUPRI-HVTJNCQCSA-N 0.000 description 1
- WUAPFZMCVAUBPE-NJFSPNSNSA-N 188Re Chemical compound [188Re] WUAPFZMCVAUBPE-NJFSPNSNSA-N 0.000 description 1
- 150000003923 2,5-pyrrolediones Chemical class 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- IVLXQGJVBGMLRR-UHFFFAOYSA-N 2-aminoacetic acid;hydron;chloride Chemical compound Cl.NCC(O)=O IVLXQGJVBGMLRR-UHFFFAOYSA-N 0.000 description 1
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 1
- ODHCTXKNWHHXJC-VKHMYHEASA-N 5-oxo-L-proline Chemical group OC(=O)[C@@H]1CCC(=O)N1 ODHCTXKNWHHXJC-VKHMYHEASA-N 0.000 description 1
- IDLISIVVYLGCKO-UHFFFAOYSA-N 6-carboxy-4',5'-dichloro-2',7'-dimethoxyfluorescein Chemical compound O1C(=O)C2=CC=C(C(O)=O)C=C2C21C1=CC(OC)=C(O)C(Cl)=C1OC1=C2C=C(OC)C(O)=C1Cl IDLISIVVYLGCKO-UHFFFAOYSA-N 0.000 description 1
- BZTDTCNHAFUJOG-UHFFFAOYSA-N 6-carboxyfluorescein Chemical compound C12=CC=C(O)C=C2OC2=CC(O)=CC=C2C11OC(=O)C2=CC=C(C(=O)O)C=C21 BZTDTCNHAFUJOG-UHFFFAOYSA-N 0.000 description 1
- 206010069754 Acquired gene mutation Diseases 0.000 description 1
- 101800001401 Activation peptide Proteins 0.000 description 1
- 102400000069 Activation peptide Human genes 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- 108010032595 Antibody Binding Sites Proteins 0.000 description 1
- 240000003291 Armoracia rusticana Species 0.000 description 1
- 235000011330 Armoracia rusticana Nutrition 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 241000416162 Astragalus gummifer Species 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 241000167854 Bourreria succulenta Species 0.000 description 1
- 238000009010 Bradford assay Methods 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 241000282836 Camelus dromedarius Species 0.000 description 1
- ZAMOUSCENKQFHK-UHFFFAOYSA-N Chlorine atom Chemical compound [Cl] ZAMOUSCENKQFHK-UHFFFAOYSA-N 0.000 description 1
- JPVYNHNXODAKFH-UHFFFAOYSA-N Cu2+ Chemical compound [Cu+2] JPVYNHNXODAKFH-UHFFFAOYSA-N 0.000 description 1
- 102100025698 Cytosolic carboxypeptidase 4 Human genes 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- 235000019739 Dicalciumphosphate Nutrition 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 239000012591 Dulbecco’s Phosphate Buffered Saline Substances 0.000 description 1
- 229910052692 Dysprosium Inorganic materials 0.000 description 1
- 229910052691 Erbium Inorganic materials 0.000 description 1
- 229940124135 Factor VIII inhibitor Drugs 0.000 description 1
- 108010074860 Factor Xa Proteins 0.000 description 1
- CWYNVVGOOAEACU-UHFFFAOYSA-N Fe2+ Chemical compound [Fe+2] CWYNVVGOOAEACU-UHFFFAOYSA-N 0.000 description 1
- 102000009123 Fibrin Human genes 0.000 description 1
- 108010073385 Fibrin Proteins 0.000 description 1
- BWGVNKXGVNDBDI-UHFFFAOYSA-N Fibrin monomer Chemical compound CNC(=O)CNC(=O)CN BWGVNKXGVNDBDI-UHFFFAOYSA-N 0.000 description 1
- 241000724791 Filamentous phage Species 0.000 description 1
- 229910052688 Gadolinium Inorganic materials 0.000 description 1
- 108010001515 Galectin 4 Proteins 0.000 description 1
- 102100039556 Galectin-4 Human genes 0.000 description 1
- GYHNNYVSQQEPJS-OIOBTWANSA-N Gallium-67 Chemical compound [67Ga] GYHNNYVSQQEPJS-OIOBTWANSA-N 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 239000004366 Glucose oxidase Substances 0.000 description 1
- 108010015776 Glucose oxidase Proteins 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 108010054964 H-hexahydrotyrosyl-alanyl-arginine-4-nitroanilide Proteins 0.000 description 1
- 208000016988 Hemorrhagic Stroke Diseases 0.000 description 1
- 101000932590 Homo sapiens Cytosolic carboxypeptidase 4 Proteins 0.000 description 1
- 101000840258 Homo sapiens Immunoglobulin J chain Proteins 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 102100029571 Immunoglobulin J chain Human genes 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- ZCYVEMRRCGMTRW-AHCXROLUSA-N Iodine-123 Chemical compound [123I] ZCYVEMRRCGMTRW-AHCXROLUSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- 108010023244 Lactoperoxidase Proteins 0.000 description 1
- 102000045576 Lactoperoxidases Human genes 0.000 description 1
- 240000007472 Leucaena leucocephala Species 0.000 description 1
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 1
- 239000000232 Lipid Bilayer Substances 0.000 description 1
- WAEMQWOKJMHJLA-UHFFFAOYSA-N Manganese(2+) Chemical compound [Mn+2] WAEMQWOKJMHJLA-UHFFFAOYSA-N 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 206010058858 Meningococcal bacteraemia Diseases 0.000 description 1
- 244000246386 Mentha pulegium Species 0.000 description 1
- 235000016257 Mentha pulegium Nutrition 0.000 description 1
- 235000004357 Mentha x piperita Nutrition 0.000 description 1
- 101100435060 Mus musculus Apc gene Proteins 0.000 description 1
- 101001033003 Mus musculus Granzyme F Proteins 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- VEQPNABPJHWNSG-UHFFFAOYSA-N Nickel(2+) Chemical compound [Ni+2] VEQPNABPJHWNSG-UHFFFAOYSA-N 0.000 description 1
- AWZJFZMWSUBJAJ-UHFFFAOYSA-N OG-514 dye Chemical compound OC(=O)CSC1=C(F)C(F)=C(C(O)=O)C(C2=C3C=C(F)C(=O)C=C3OC3=CC(O)=C(F)C=C32)=C1F AWZJFZMWSUBJAJ-UHFFFAOYSA-N 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 1
- 208000013544 Platelet disease Diseases 0.000 description 1
- 108010039918 Polylysine Proteins 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- BUGBHKTXTAQXES-UHFFFAOYSA-N Selenium Chemical compound [Se] BUGBHKTXTAQXES-UHFFFAOYSA-N 0.000 description 1
- 229920005654 Sephadex Polymers 0.000 description 1
- 239000012507 Sephadex™ Substances 0.000 description 1
- 206010040070 Septic Shock Diseases 0.000 description 1
- 229920001800 Shellac Polymers 0.000 description 1
- 239000005708 Sodium hypochlorite Substances 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 239000005864 Sulphur Substances 0.000 description 1
- 239000012505 Superdex™ Substances 0.000 description 1
- GKLVYJBZJHMRIY-OUBTZVSYSA-N Technetium-99 Chemical compound [99Tc] GKLVYJBZJHMRIY-OUBTZVSYSA-N 0.000 description 1
- 229910052771 Terbium Inorganic materials 0.000 description 1
- 229920001615 Tragacanth Polymers 0.000 description 1
- GYDJEQRTZSCIOI-UHFFFAOYSA-N Tranexamic acid Chemical compound NCC1CCC(C(O)=O)CC1 GYDJEQRTZSCIOI-UHFFFAOYSA-N 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- 108010046334 Urease Proteins 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- 229910052769 Ytterbium Inorganic materials 0.000 description 1
- VWQVUPCCIRVNHF-OUBTZVSYSA-N Yttrium-90 Chemical compound [90Y] VWQVUPCCIRVNHF-OUBTZVSYSA-N 0.000 description 1
- PNDPGZBMCMUPRI-XXSWNUTMSA-N [125I][125I] Chemical compound [125I][125I] PNDPGZBMCMUPRI-XXSWNUTMSA-N 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 238000003314 affinity selection Methods 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- HAXFWIACAGNFHA-UHFFFAOYSA-N aldrithiol Chemical compound C=1C=CC=NC=1SSC1=CC=CC=N1 HAXFWIACAGNFHA-UHFFFAOYSA-N 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 230000000172 allergic effect Effects 0.000 description 1
- 125000002344 aminooxy group Chemical group [H]N([H])O[*] 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 230000006909 anti-apoptosis Effects 0.000 description 1
- 230000002424 anti-apoptotic effect Effects 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000002022 anti-cellular effect Effects 0.000 description 1
- 230000000845 anti-microbial effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000010100 anticoagulation Effects 0.000 description 1
- 239000000729 antidote Substances 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 239000000739 antihistaminic agent Substances 0.000 description 1
- 229940125715 antihistaminic agent Drugs 0.000 description 1
- 239000007900 aqueous suspension Substances 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- RYXHOMYVWAEKHL-OUBTZVSYSA-N astatine-211 Chemical compound [211At] RYXHOMYVWAEKHL-OUBTZVSYSA-N 0.000 description 1
- 208000010668 atopic eczema Diseases 0.000 description 1
- 230000003190 augmentative effect Effects 0.000 description 1
- 125000000852 azido group Chemical group *N=[N+]=[N-] 0.000 description 1
- 238000003287 bathing Methods 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 239000012620 biological material Substances 0.000 description 1
- 229910052797 bismuth Inorganic materials 0.000 description 1
- JCXGWMGPZLAOME-UHFFFAOYSA-N bismuth atom Chemical compound [Bi] JCXGWMGPZLAOME-UHFFFAOYSA-N 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 150000001720 carbohydrates Chemical group 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 150000004697 chelate complex Chemical class 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 235000019693 cherries Nutrition 0.000 description 1
- 239000000460 chlorine Substances 0.000 description 1
- 229910052801 chlorine Inorganic materials 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 229910052804 chromium Inorganic materials 0.000 description 1
- 239000011651 chromium Substances 0.000 description 1
- BFGKITSFLPAWGI-UHFFFAOYSA-N chromium(3+) Chemical compound [Cr+3] BFGKITSFLPAWGI-UHFFFAOYSA-N 0.000 description 1
- 230000001886 ciliary effect Effects 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 238000012761 co-transfection Methods 0.000 description 1
- 239000000701 coagulant Substances 0.000 description 1
- XLJKHNWPARRRJB-UHFFFAOYSA-N cobalt(2+) Chemical compound [Co+2] XLJKHNWPARRRJB-UHFFFAOYSA-N 0.000 description 1
- 238000004883 computer application Methods 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 208000011664 congenital factor XI deficiency Diseases 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- RYGMFSIKBFXOCR-AKLPVKDBSA-N copper-67 Chemical compound [67Cu] RYGMFSIKBFXOCR-AKLPVKDBSA-N 0.000 description 1
- 230000009260 cross reactivity Effects 0.000 description 1
- WZHCOOQXZCIUNC-UHFFFAOYSA-N cyclandelate Chemical compound C1C(C)(C)CC(C)CC1OC(=O)C(O)C1=CC=CC=C1 WZHCOOQXZCIUNC-UHFFFAOYSA-N 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 229940124569 cytoprotecting agent Drugs 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000001212 derivatisation Methods 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 239000000032 diagnostic agent Substances 0.000 description 1
- 229940039227 diagnostic agent Drugs 0.000 description 1
- NEFBYIFKOOEVPA-UHFFFAOYSA-K dicalcium phosphate Chemical compound [Ca+2].[Ca+2].[O-]P([O-])([O-])=O NEFBYIFKOOEVPA-UHFFFAOYSA-K 0.000 description 1
- 229940038472 dicalcium phosphate Drugs 0.000 description 1
- 229910000390 dicalcium phosphate Inorganic materials 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 230000002222 downregulating effect Effects 0.000 description 1
- 239000006196 drop Substances 0.000 description 1
- KBQHZAAAGSGFKK-UHFFFAOYSA-N dysprosium atom Chemical compound [Dy] KBQHZAAAGSGFKK-UHFFFAOYSA-N 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 230000012202 endocytosis Effects 0.000 description 1
- 239000002158 endotoxin Substances 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- UYAHIZSMUZPPFV-UHFFFAOYSA-N erbium Chemical compound [Er] UYAHIZSMUZPPFV-UHFFFAOYSA-N 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- OGPBJKLSAFTDLK-IGMARMGPSA-N europium-152 Chemical compound [152Eu] OGPBJKLSAFTDLK-IGMARMGPSA-N 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 238000002270 exclusion chromatography Methods 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 239000003889 eye drop Substances 0.000 description 1
- 229940012356 eye drops Drugs 0.000 description 1
- 108010091897 factor V Leiden Proteins 0.000 description 1
- 201000007219 factor XI deficiency Diseases 0.000 description 1
- 229950003499 fibrin Drugs 0.000 description 1
- 239000012467 final product Substances 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 238000005194 fractionation Methods 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- UIWYJDYFSGRHKR-UHFFFAOYSA-N gadolinium atom Chemical compound [Gd] UIWYJDYFSGRHKR-UHFFFAOYSA-N 0.000 description 1
- 108010074605 gamma-Globulins Proteins 0.000 description 1
- 238000001641 gel filtration chromatography Methods 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 229940116332 glucose oxidase Drugs 0.000 description 1
- 235000019420 glucose oxidase Nutrition 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- CBMIPXHVOVTTTL-UHFFFAOYSA-N gold(3+) Chemical compound [Au+3] CBMIPXHVOVTTTL-UHFFFAOYSA-N 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 229910052736 halogen Inorganic materials 0.000 description 1
- 150000002367 halogens Chemical class 0.000 description 1
- 238000003505 heat denaturation Methods 0.000 description 1
- 239000012145 high-salt buffer Substances 0.000 description 1
- SCKNFLZJSOHWIV-UHFFFAOYSA-N holmium(3+) Chemical compound [Ho+3] SCKNFLZJSOHWIV-UHFFFAOYSA-N 0.000 description 1
- 230000013632 homeostatic process Effects 0.000 description 1
- 229920001519 homopolymer Polymers 0.000 description 1
- 235000001050 hortel pimenta Nutrition 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 235000011167 hydrochloric acid Nutrition 0.000 description 1
- 125000004435 hydrogen atom Chemical class [H]* 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 150000004679 hydroxides Chemical class 0.000 description 1
- 229910052588 hydroxylapatite Inorganic materials 0.000 description 1
- 238000012872 hydroxylapatite chromatography Methods 0.000 description 1
- 239000012216 imaging agent Substances 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 238000013115 immunohistochemical detection Methods 0.000 description 1
- 229940051026 immunotoxin Drugs 0.000 description 1
- 230000002637 immunotoxin Effects 0.000 description 1
- 239000002596 immunotoxin Substances 0.000 description 1
- 231100000608 immunotoxin Toxicity 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 230000036512 infertility Effects 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 150000007529 inorganic bases Chemical class 0.000 description 1
- 239000000543 intermediate Substances 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 208000020658 intracerebral hemorrhage Diseases 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 238000001155 isoelectric focusing Methods 0.000 description 1
- JJWLVOIRVHMVIS-UHFFFAOYSA-N isopropylamine Chemical compound CC(C)N JJWLVOIRVHMVIS-UHFFFAOYSA-N 0.000 description 1
- 150000002540 isothiocyanates Chemical class 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 210000002510 keratinocyte Anatomy 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 229940057428 lactoperoxidase Drugs 0.000 description 1
- CZMAIROVPAYCMU-UHFFFAOYSA-N lanthanum(3+) Chemical compound [La+3] CZMAIROVPAYCMU-UHFFFAOYSA-N 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- ZLNQQNXFFQJAID-UHFFFAOYSA-L magnesium carbonate Chemical compound [Mg+2].[O-]C([O-])=O ZLNQQNXFFQJAID-UHFFFAOYSA-L 0.000 description 1
- 239000001095 magnesium carbonate Substances 0.000 description 1
- 229910000021 magnesium carbonate Inorganic materials 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 208000022089 meningococcemia Diseases 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 150000001455 metallic ions Chemical class 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- DYQNRMCKBFOWKH-UHFFFAOYSA-N methyl 4-hydroxybenzenecarboximidate Chemical compound COC(=N)C1=CC=C(O)C=C1 DYQNRMCKBFOWKH-UHFFFAOYSA-N 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- OSWPMRLSEDHDFF-UHFFFAOYSA-N methyl salicylate Chemical compound COC(=O)C1=CC=CC=C1O OSWPMRLSEDHDFF-UHFFFAOYSA-N 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 239000002991 molded plastic Substances 0.000 description 1
- 230000009456 molecular mechanism Effects 0.000 description 1
- 238000000302 molecular modelling Methods 0.000 description 1
- 210000000865 mononuclear phagocyte system Anatomy 0.000 description 1
- 239000002088 nanocapsule Substances 0.000 description 1
- 229940037525 nasal preparations Drugs 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- QEFYFXOXNSNQGX-UHFFFAOYSA-N neodymium atom Chemical compound [Nd] QEFYFXOXNSNQGX-UHFFFAOYSA-N 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 210000000440 neutrophil Anatomy 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 102000026415 nucleotide binding proteins Human genes 0.000 description 1
- 108091014756 nucleotide binding proteins Proteins 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 239000006174 pH buffer Substances 0.000 description 1
- VYNDHICBIRRPFP-UHFFFAOYSA-N pacific blue Chemical compound FC1=C(O)C(F)=C2OC(=O)C(C(=O)O)=CC2=C1 VYNDHICBIRRPFP-UHFFFAOYSA-N 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- XYJRXVWERLGGKC-UHFFFAOYSA-D pentacalcium;hydroxide;triphosphate Chemical compound [OH-].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O XYJRXVWERLGGKC-UHFFFAOYSA-D 0.000 description 1
- 230000010412 perfusion Effects 0.000 description 1
- KHIWWQKSHDUIBK-UHFFFAOYSA-N periodic acid Chemical compound OI(=O)(=O)=O KHIWWQKSHDUIBK-UHFFFAOYSA-N 0.000 description 1
- 102000013415 peroxidase activity proteins Human genes 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 210000001539 phagocyte Anatomy 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 1
- 235000011007 phosphoric acid Nutrition 0.000 description 1
- 150000003016 phosphoric acids Chemical class 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 239000011574 phosphorus Substances 0.000 description 1
- 238000006303 photolysis reaction Methods 0.000 description 1
- 230000015843 photosynthesis, light reaction Effects 0.000 description 1
- 210000004180 plasmocyte Anatomy 0.000 description 1
- 229920000771 poly (alkylcyanoacrylate) Polymers 0.000 description 1
- 229920001515 polyalkylene glycol Polymers 0.000 description 1
- 229920000656 polylysine Polymers 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- DTBMTXYWRJNBGK-UHFFFAOYSA-L potassium;sodium;phthalate Chemical compound [Na+].[K+].[O-]C(=O)C1=CC=CC=C1C([O-])=O DTBMTXYWRJNBGK-UHFFFAOYSA-L 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 229940116317 potato starch Drugs 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 238000009117 preventive therapy Methods 0.000 description 1
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 1
- 229960004919 procaine Drugs 0.000 description 1
- 230000008742 procoagulation Effects 0.000 description 1
- 125000001500 prolyl group Chemical class [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 238000002331 protein detection Methods 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 239000002213 purine nucleotide Substances 0.000 description 1
- 239000002510 pyrogen Substances 0.000 description 1
- 229940043131 pyroglutamate Drugs 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 239000002096 quantum dot Substances 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 210000000664 rectum Anatomy 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000020964 regulation of blood coagulation Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 238000009256 replacement therapy Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 238000004366 reverse phase liquid chromatography Methods 0.000 description 1
- WUAPFZMCVAUBPE-IGMARMGPSA-N rhenium-186 Chemical compound [186Re] WUAPFZMCVAUBPE-IGMARMGPSA-N 0.000 description 1
- 229940081974 saccharin Drugs 0.000 description 1
- 235000019204 saccharin Nutrition 0.000 description 1
- 239000000901 saccharin and its Na,K and Ca salt Substances 0.000 description 1
- 210000003296 saliva Anatomy 0.000 description 1
- DOSGOCSVHPUUIA-UHFFFAOYSA-N samarium(3+) Chemical compound [Sm+3] DOSGOCSVHPUUIA-UHFFFAOYSA-N 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 229910052711 selenium Inorganic materials 0.000 description 1
- 239000011669 selenium Substances 0.000 description 1
- 210000000582 semen Anatomy 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 230000036303 septic shock Effects 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 239000004208 shellac Substances 0.000 description 1
- ZLGIYFNHBLSMPS-ATJNOEHPSA-N shellac Chemical compound OCCCCCC(O)C(O)CCCCCCCC(O)=O.C1C23[C@H](C(O)=O)CCC2[C@](C)(CO)[C@@H]1C(C(O)=O)=C[C@@H]3O ZLGIYFNHBLSMPS-ATJNOEHPSA-N 0.000 description 1
- 229940113147 shellac Drugs 0.000 description 1
- 235000013874 shellac Nutrition 0.000 description 1
- 238000004904 shortening Methods 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 238000009097 single-agent therapy Methods 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 238000001542 size-exclusion chromatography Methods 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- SUKJFIGYRHOWBL-UHFFFAOYSA-N sodium hypochlorite Chemical compound [Na+].Cl[O-] SUKJFIGYRHOWBL-UHFFFAOYSA-N 0.000 description 1
- 235000009518 sodium iodide Nutrition 0.000 description 1
- 239000007909 solid dosage form Substances 0.000 description 1
- 239000008247 solid mixture Substances 0.000 description 1
- 230000037439 somatic mutation Effects 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 125000001424 substituent group Chemical group 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-N succinic acid group Chemical group C(CCC(=O)O)(=O)O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 238000011477 surgical intervention Methods 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 210000001138 tear Anatomy 0.000 description 1
- 229910052713 technetium Inorganic materials 0.000 description 1
- GKLVYJBZJHMRIY-UHFFFAOYSA-N technetium atom Chemical compound [Tc] GKLVYJBZJHMRIY-UHFFFAOYSA-N 0.000 description 1
- GZCRRIHWUXGPOV-UHFFFAOYSA-N terbium atom Chemical compound [Tb] GZCRRIHWUXGPOV-UHFFFAOYSA-N 0.000 description 1
- MPLHNVLQVRSVEE-UHFFFAOYSA-N texas red Chemical compound [O-]S(=O)(=O)C1=CC(S(Cl)(=O)=O)=CC=C1C(C1=CC=2CCCN3CCCC(C=23)=C1O1)=C2C1=C(CCC1)C3=[N+]1CCCC3=C2 MPLHNVLQVRSVEE-UHFFFAOYSA-N 0.000 description 1
- 229940126585 therapeutic drug Drugs 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- CNHYKKNIIGEXAY-UHFFFAOYSA-N thiolan-2-imine Chemical compound N=C1CCCS1 CNHYKKNIIGEXAY-UHFFFAOYSA-N 0.000 description 1
- 150000003573 thiols Chemical group 0.000 description 1
- 206010043554 thrombocytopenia Diseases 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 238000003146 transient transfection Methods 0.000 description 1
- 239000011882 ultra-fine particle Substances 0.000 description 1
- 239000002691 unilamellar liposome Substances 0.000 description 1
- 210000003708 urethra Anatomy 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 210000001215 vagina Anatomy 0.000 description 1
- 229910052720 vanadium Inorganic materials 0.000 description 1
- LEONUFNNVUYDNQ-UHFFFAOYSA-N vanadium atom Chemical compound [V] LEONUFNNVUYDNQ-UHFFFAOYSA-N 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 238000011179 visual inspection Methods 0.000 description 1
- 235000012431 wafers Nutrition 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 239000009637 wintergreen oil Substances 0.000 description 1
- NAWDYIZEMPQZHO-UHFFFAOYSA-N ytterbium Chemical compound [Yb] NAWDYIZEMPQZHO-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/04—Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/573—Immunoassay; Biospecific binding assay; Materials therefor for enzymes or isoenzymes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/51—Complete heavy chain or Fd fragment, i.e. VH + CH1
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/567—Framework region [FR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/90—Enzymes; Proenzymes
- G01N2333/914—Hydrolases (3)
- G01N2333/948—Hydrolases (3) acting on peptide bonds (3.4)
- G01N2333/95—Proteinases, i.e. endopeptidases (3.4.21-3.4.99)
- G01N2333/964—Proteinases, i.e. endopeptidases (3.4.21-3.4.99) derived from animal tissue
- G01N2333/96425—Proteinases, i.e. endopeptidases (3.4.21-3.4.99) derived from animal tissue from mammals
- G01N2333/96427—Proteinases, i.e. endopeptidases (3.4.21-3.4.99) derived from animal tissue from mammals in general
- G01N2333/9643—Proteinases, i.e. endopeptidases (3.4.21-3.4.99) derived from animal tissue from mammals in general with EC number
- G01N2333/96433—Serine endopeptidases (3.4.21)
- G01N2333/96441—Serine endopeptidases (3.4.21) with definite EC number
- G01N2333/96461—Protein C (3.4.21.69)
Definitions
- Blood coagulation is a process consisting of a complex interaction of various blood components, or factors, which eventually give rise to a fibrin clot.
- blood components participating in the coagulation “cascade” are proenzymes or zymogens—enzymatically inactive proteins that are converted into an active form by action of an activator. Regulation of blood coagulation is largely accomplished enzymatically by proteolytic inactivation of the pro-coagulation factors Va and VIIIa achieved by activated protein C (aPC) (Esmon, 1989).
- Protein C is the precursor to aPC, a potent natural anticoagulant. Protein C is activated by thrombin in complex with thrombomodulin (TM). The activation is augmented by endothelial cell protein C receptor (EPCR). TM and EPCR can be down-regulated due to inflammatory mediators, such as tumor necrosis factor, reviewed by Esmon (1999). TM and EPCR have also been found to be reduced in some forms of septic shock, meningococcemia in particular. Since EPCR and TM are expressed on endothelium, it is not possible to directly determine how well they are functioning without removal of blood vessels.
- EPCR endothelial cell protein C receptor
- aPC functions as an anticoagulant by proteolytically cleaving and downregulating pro-coagulant factors.
- aPC also serves important functions as an anti-apoptosis agent, an anti-inflammatory molecule and a cytoprotectant.
- Bleeding disorders where homeostatis is dysregulated through a loss of a key factor, such as the absence of Factor VIII in hemophilia, or in trauma patients where the wound process results in a temporary loss of hemostasis can be treated by the removal of aPC.
- Such treatment could result in unwanted detrimental consequences of removing the beneficial functions of aPC in addition to the removal of the anti-coagulant activity. Therefore it is desirable to have a therapeutic that selectively targets the anti-coagulant activity of aPC while leaving other functions of the molecule intact.
- an antibody comprising (a) a heavy light chain comprising heavy light chain CDRs represented by SEQ ID NOS: 1, 2 and 3; and (b) a light heavy chain comprising light heavy chain CDRs represented by SEQ ID NOS: 4, 5 and 6.
- the antibody maybe a humanized antibody, and may have the following sequence composition:
- the heavy chain framework regions may be represented by SEQ ID NOS: 7, 8, 9 and 10, amino acid residues 1 to 30, 36 to 49, 69 to 100, and 108 to 118 of SEQ ID NO: 16 or having 5 or fewer conservative amino acid substitutions thereto, and/or the light chain framework regions may be represented by SEQ ID NOS: 11, 12, 13 and 14 amino residues 1 to 23, 39 to 53, 61 to 92 and 102 to 112 of SEQ ID NO: 26, or having 5 or fewer conservative amino acid substitutions thereto.
- residue 14 49 of SEQ ID NO: 8 16 may be substituted with Ala, and/or residues 11, 13 and 31 of SEQ ID NO: 9 79, 81 and 99 of SEQ ID NO: 16 may be substituted with Serine, Valine and Isoleucine, respectively; and/or the heavy chain may comprise SEQ ID NOS: 16-24 NO: 16, 17, 18, 19, 20, 21 or 22.
- residue 4 of SEQ ID NO: 11 26 may be substituted with Leucine; and/or residue 12 72 of SEQ ID NO: 13 26 may be substituted with Arginine; and/or the light chain comprises SEQ ID NOS: 26-30 NO: 26, 27, 28 or 29.
- the antibody may be a single-chain antibody or an antibody fragment, such as a Fab′, Fab, F(ab′) 2 , a single domain antibody, Fv, or scFv.
- a pharmaceutical composition comprising any of the foregoing embodiments dispersed in a pharmaceutically acceptable carrier.
- the disclosure also provides an expression construct, cell or cell line comprising a nucleic acid encoding an antibody comprising (a) a heavy light chain comprising heavy light chain CDRs represented by SEQ ID NOS: 1, 2 and 3; and (b) a light heavy chain comprising light heavy chain CDRs represented by SEQ ID NOS: 4, 5 and 6.
- the antibody may be a humanized antibody.
- the heavy chain framework regions may be represented by SEQ ID NOS: 7, 8, 9 and 10, amino acid residues 1 to 30, 36 to 49, 69 to 100, and 108 to 118 of SEQ ID NO: 16 or having 5 or fewer conservative amino acid substitutions thereto, and/or the light chain framework regions may be represented by SEQ ID NOS: 11, 12, 13 and 14, or having 5 or fewer conservative amino acid substitutions amino residues 1 to 23, 39 to 53, 61 to 92 and 102 to 112 of SEQ ID NO: 26.
- residue 14 49 of SEQ ID NO: 8 16 may be substituted with Ala, and/or residues 11, 13 and 31 of SEQ ID NO: 9 79, 81 and 99 of SEQ ID NO: 16 may be substituted with Serine, Valine and Isoleucine, respectively; and/or the heavy chain may comprise SEQ ID NOS: 16-24 NO: 16, 17, 18 , 19, 20, 21 or 22.
- residue 4 of SEQ ID NO: 11 26 may be substituted with Leucine; and/or residue 12 72 of SEQ ID NO: 13 26 may be substituted with Arginine; and/or the light chain comprises SEQ ID NOS: 26-30 NO: 26, 27, 28 or 29.
- the antibody may be a single-chain antibody or an antibody fragment, such as a Fab′, Fab, F(ab′) 2 , a single domain antibody, Fv, or scFv.
- Also provided is a method of inhibiting activated protein C amidolytic activity in a subject comprising administering an effective amount of an antibody according to the description above.
- Also provided is a method of treating a subject in need of blood coagulation comprising administering an effective amount of an antibody according to the description above.
- Also provided is a method of treating a subject suffering from sepsis comprising administering an effective amount of an antibody according to the description above.
- the method may further comprise administration of activated protein C.
- Also provided is a method of treating a subject suffering from hemophilia comprising administering an effective amount of an antibody according to the description above.
- the subject may be a trauma patient.
- kits comprising an antibody according to the description above.
- the antibody may be labeled, such as with a fluorophore, a radiolabel, a chemiluminescent label, a dye, a quantum dot, a bead or a chromophore.
- the kit may further comprise a buffer or diluent, and/or instructions on the use of said antibody.
- the antibody may be present in an aqueous suspension, or be lyophilized.
- FIG. 1 SEC analysis of 1573 humanized antibodies.
- FIG. 2 Immobilization of capture antibody to CM5 chip using amine coupling method.
- 9200 RU of anti-mouse FC IgG signal (top figure) and 6400 RU of anti-human FC IgG (bottom figure) were generated respectively.
- the running buffer was HBS-EP running buffer: 10 mM HEPES, pH 7.4, 150 mM NaCl, 3.4 mM EDTA, 0.005% surfactant P20.
- FIG. 3 SPR sensor-grams of binding of human aPC to 1573 antibodies: human aPC was injected over 1573 antibody at concentration of 0, 1.25, 2.5, 5, 10, 20 nM, respectively, at 30 ⁇ l/min for 180 s of association phase and 500 s of dissociation phase.
- FIG. 4 SPR sensor-grams of binding of cyno aPC to 1573 antibodies: cyno aPC was injected over 1573 antibody at concentration of 0, 5, 10, 20, 40, 80 nM respectively at 30 ⁇ l/min for 180 s of association phase and 420 s of dissociation phase.
- FIGS. 5 1573 humanized antibodies binding ELISA of human PC and aPC.
- FIGS. 6 1573 humanized antibodies binding ELISA of monkey PC and aPC.
- the present disclosure relates to the discovery of monoclonal antibodies that selectively bind to activated protein C, but not unactivated protein C, and specifically inhibit the anti-coagulation activity of activated protein C.
- Protein C or “PC” as used herein refers to any variant, isoform, and/or species homolog of Protein C in its zymogen form that is naturally expressed by cells and present in plasma and is distinct from the activated form of Protein C.
- activated Protein C or “aPC” as used herein refers to an activated form of Protein C that is characterized by the removal and absence of a 12 amino acid activation peptide present in Protein C as a result of a thrombin cleavage site.
- an “antibody” refers to a whole antibody and any antigen binding fragment (i.e., “antigen-binding portion”) or single chain thereof.
- the term includes a full-length immunoglobulin molecule (e.g., an IgG antibody) that is naturally occurring or formed by normal immunoglobulin gene fragment recombinatorial processes, or an immunologically active portion of an immunoglobulin molecule, such as an antibody fragment, that retains the specific binding activity.
- an antibody fragment binds with the same antigen that is recognized by the full-length antibody.
- an anti-aPC monoclonal antibody fragment binds to an epitope of aPC.
- the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- binding fragments encompassed within the term “antigen-binding portion” of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the V L , V H , C L and C H1 domains; (ii) a F(ab′) 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V H and C H1 domains; (iv) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a V H domain; (vi) an isolated complementarity determining region (CDR); (vii) minibodies, diabodies, triabodies, tetrabodies, and k
- the two domains of the Fv fragment, V L and V H are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
- single chain Fv single chain Fv
- Such single chain antibodies are also intended to be encompassed within the term “antigen-binding portion” of an antibody.
- an antigen binding fragment can be encompassed in an antibody mimetic.
- antibody mimetic or “mimetic” as used herein is meant a protein that exhibits binding similar to an antibody but is a smaller alternative antibody or a non-antibody protein. Such antibody mimetic can be comprised in a scaffold.
- scaffold refers to a polypeptide platform for the engineering of new products with tailored functions and characteristics.
- anti-aPC antibody refers to an antibody that specifically binds to an epitope of aPC.
- the anti-aPC antibodies disclosed herein augment one or more aspects of the blood clotting cascade.
- the terms “inhibits binding” and “blocks binding” are used interchangeably and encompass both partial and complete inhibition or blocking of a protein with its substrate, such as an inhibition or blocking by at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100%.
- “about” means+/ ⁇ 10% of the numerical value indicated.
- inhibition and blocking also include any measurable decrease in the binding affinity of aPC to a physiological substrate when in contact with an anti-aPC antibody as compared to aPC not in contact with an anti-aPC antibody, e.g., the blocking of the interaction of aPC with its substrates, including Factor Va or with Factor VIIIa, by at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100%.
- monoclonal antibody or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition.
- a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
- human monoclonal antibody refers to antibodies displaying a single binding specificity that have variable and constant regions derived from human germline immunoglobulin sequences.
- the human antibodies can include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
- an “isolated antibody,” as used herein, is intended to refer to an antibody which is substantially free of other biological molecules, including antibodies having different antigenic specificities (e.g., an isolated antibody that binds to aPC is substantially free of antibodies that bind antigens other than aPC).
- the isolated antibody is at least about 75%, about 80%, about 90%, about 95%, about 97%, about 99%, about 99.9% or about 100% pure by dry weight.
- purity can be measured by a method such as column chromatography, polyacrylamide gel electrophoresis, or HPLC analysis.
- an isolated antibody that binds to an epitope, isoform or variant of human aPC can, however, have cross-reactivity to other related antigens, e.g., from other species (e.g., aPC species homologs). Moreover, an isolated antibody can be substantially free of other cellular material and/or chemicals.
- “specific binding” refers to antibody binding to a predetermined antigen. Typically, an antibody that exhibits “specific binding” binds to an antigen with an affinity of at least about 10 5 M ⁇ 1 and binds to that antigen with an affinity that is higher, for example at least two-fold greater, than its binding affinity for an irrelevant antigen (e.g., BSA, casein).
- the phrases “an antibody recognizing an antigen” and “an antibody specific for an antigen” are used interchangeably herein with the term “an antibody which binds specifically to an antigen.”
- minimal binding refers to an antibody that does not bind to and/or exhibits low affinity to a specified antigen.
- an antibody having minimal binding to an antigen binds to that antigen with an affinity that is lower than about 10 2 M ⁇ 1 and does not bind to a predetermined antigen with higher affinity than it binds to an irrelevant antigen.
- the term “high affinity” for an antibody refers to a binding affinity of at least about 10 7 M ⁇ 1 , in at least one embodiment at least about 10 8 M ⁇ 1 , in some embodiments at least about 10 9 M ⁇ 1 , 10 10 M ⁇ 1 , 10 11 M ⁇ 1 or greater, e.g., up to 10 13 M ⁇ 1 or greater.
- “high affinity” binding can vary for other antibody isotypes.
- “high affinity” binding for an IgM isotype refers to a binding affinity of at least about 10 7 M ⁇ 1 .
- “isotype” refers to the antibody class (e.g., IgM or IgG1) that is encoded by heavy chain constant region genes.
- CDR complementarity-determining region
- CDRs are involved in antigen-antibody binding, and the CDR3 comprises a unique region specific for antigen-antibody binding.
- An antigen-binding site therefore, can include six CDRs, comprising the CDR regions from each of a heavy and a light chain V region.
- epitope refers to the area or region of an antigen to which an antibody specifically binds or interacts, which in some embodiments indicates where the antigen is in physical contact with the antibody.
- paratope refers to the area or region of the antibody on which the antigen specifically binds. Epitopes characterized by competition binding are said to be overlapping if the binding of the corresponding antibodies are mutually exclusive, i.e., binding of one antibody excludes simultaneous binding of another antibody. The epitopes are said to be separate (unique) if the antigen is able to accommodate binding of both corresponding antibodies simultaneously.
- “competing antibodies,” as used herein, refers to antibodies that bind to about, substantially or essentially the same, or even the same, epitope as an antibody against aPC as described herein. “Competing antibodies” include antibodies with overlapping epitope specificities. Competing antibodies are thus able to effectively compete with an antibody as described herein for binding to aPC. In some embodiments, the competing antibody can bind to the same epitope as the antibody described herein. Alternatively viewed, the competing antibody has the same epitope specificity as the antibody described herein.
- “conservative substitutions” refers to modifications of a polypeptide that involve the substitution of one or more amino acids for amino acids having similar biochemical properties that do not result in loss of a biological or biochemical function of the polypeptide.
- a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
- amino acids with basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g., aspartic acid, glutamic acid
- uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine
- nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan
- ⁇ -branched side chains e.g., threonine, valine, isoleucine
- aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine.
- Antibodies of the present disclosure can have one or more conservative amino acid substitutions yet retain antigen binding activity.
- nucleic acids and polypeptides the term “substantial homology” indicates that two nucleic acids or two polypeptides, or designated sequences thereof, when optimally aligned and compared, are identical, with appropriate nucleotide or amino acid insertions or deletions, in at least about 80% of the nucleotides or amino acids, usually at least about 85%, in some embodiments about 90%, 91%, 92%, 93%, 94%, or 95%, in at least one embodiment at least about 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, or 99.5% of the nucleotides or amino acids.
- nucleic acids Alternatively, substantial homology for nucleic acids exists when the segments will hybridize under selective hybridization conditions to the complement of the strand. Also included are nucleic acid sequences and polypeptide sequences having substantial homology to the specific nucleic acid sequences and amino acid sequences recited herein.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, such as without limitation the AlignXTM module of VectorNTITM (Invitrogen Corp., Carlsbad, Calif.).
- AlignXTM the default parameters of multiple alignment are: gap opening penalty: 10; gap extension penalty: 0.05; gap separation penalty range: 8; % identity for alignment delay: 40.
- Another method for determining the best overall match between a query sequence (a sequence of the present disclosure) and a subject sequence can be determined using the CLUSTALW computer program (Thompson et al., Nucleic Acids Res, 1994, 2(22): 4673-4680), which is based on the algorithm of Higgins et al., Computer Applications in the Biosciences (CABIOS), 1992, 8(2): 189-191).
- CLUSTALW computer program Thimpson et al., Nucleic Acids Res, 1994, 2(22): 4673-4680
- Higgins et al. Computer Applications in the Biosciences (CABIOS), 1992, 8(2): 189-191
- the result of said global sequence alignment is in percent identity.
- the nucleic acids can be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form.
- a nucleic acid is “isolated” or “rendered substantially pure” when purified away from other cellular components with which it is normally associated in the natural environment.
- standard techniques such as the following can be used: alkaline/SDS treatment, CsCl banding, column chromatography, agarose gel electrophoresis and others well known in the art.
- Protein C is activated by thrombin complexed with thrombomodulin on endothelium. Unlike the few-second transient life of active thrombin in vivo, human aPC has about a 20 minute half-life in circulation after its generation (Berg, et al., 2003). Therefore, one can feasibly measure a level of aPC in plasma to study its regulation under various pathophysical conditions.
- HAPC1573 Previously, a murine antibody HAPC1573 was developed which enhanced FL-aPC binding on the endothelial cells. HAPC1573 facilitated aPC internalization on endothelium through the interaction of Gla domain of aPC and EPCR on the cells, and this internalization could be blocked by either EPCR blocking Ab or Gla domain blocking Ab (HPC1575). HAPC1573 also dramatically altered the kinetic parameters of aPC toward its chromogenic substrate, Spectrozyme PCa.
- HAPC1573 This profound change of aPC toward small peptide substrate in the presence of HAPC1573 indicated that this mAb recognized an epitope near active site of aPC and the interaction of Ab and antigen dramatically increased the affinity of APC toward small peptide substrate but decreased the off rate of product from aPC catalytic site. HAPC1573 also almost completely diminished the prolongation effect of aPC in factor Xa initiated one-stage plasma clotting assay, suggesting that the interaction of HAPC1573 and aPC prevents aPC from cleaving factor Va. Surprisingly, HAPC1573 did not inhibit but actually enhanced aPC cleaving histone H3 and H4.
- HAPC1573 did not inhibit but slightly enhanced aPC cytoprotection activity on endothelium against histone H3 and H4. Finally, their results show that HAPC1573, recognizes aPC, but not Protein C. See U.S. Pat. No. 8,153,766.
- HAPC1573 altered aPC cleavage activity toward a chromogenic peptide substrate and also blocked aPC anticoagulant activity in a plasma clotting assay, suggesting this mAb recognizes an epitope near the aPC active site and alters its catalytic activity upon antibody-antigen binding.
- HAPC1573 actually enhanced aPC cleaving extracellular histones, and enhanced APC cytoprotection activity on endothelium against histones. This indicates that APC anticoagulant activity for cleaving activated factor V and VIII is not required for its cytoprotection activity by cleaving extracellular histones. Cleaving extracellular histones independent from its anticoagulant activity might be one of the molecular mechanisms of aPC regulation inflammation and cytoprotection.
- such antibodies against aPC can, for example, be used in treatment of hemophilia A patients.
- aPC cleaves both factor VIIIa and factor Va and thus negatively affects blood clotting.
- factor VIII levels are low and the inactivation of factor Va by aPC is probably a major pathway to regulate hemostasis and thrombosis in these patients.
- Blocking aPC anticoagulant activity toward factor Va in vivo with an antibody is an alternative approach for hemophilia A treatments, especially for those patients who have high level factor VIII inhibitors so that the factor VIII replacement therapy would not be very effective.
- Another possible clinical application for antibodies against aPC is in the treatment of trauma patients wherein homeostasis is disrupted, excessive bleeding is likely, and surgical intervention is delayed to regain homeostatis.
- Treatment with antibodies can selectively restore the pro-coagulant state without eliminating the cytoprotective or anti-inflammatory activities of APC.
- Antibodies comprise a large family of glycoproteins with common structural features.
- An antibody is comprised of four polypeptides that form a three dimensional structure.
- an antibody is comprised of two different polypeptides, the heavy chain and the light chain.
- An antibody molecule is comprised of one or more of these units, each unit comprising two heavy chains and two light chains.
- An antibody molecule typically consists of three functional domains: the Fc, Fab, and antigen-binding site.
- heavy chain polypeptides There are five different types of heavy chain polypeptides designated as ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ . There are two different types of light chain polypeptides designated ⁇ and ⁇ .
- An antibody typically contains only one type of heavy chain and only one type of light chain, although any light chain can associate with any heavy chain.
- each heavy chain polypeptide is known as the constant (Fc) region.
- the amino terminal of each heavy and light chain polypeptide is known as the variable (V) region.
- hypervariable regions known as complementarity determining regions (CDRs).
- CDRs complementarity determining regions
- the variable regions of one heavy chain and one light chain associate to form an antigen-binding site.
- Each heavy chain and each light chain includes three CDRs.
- the six CDRs of an antigen-binding site define the amino acid residues that form the actual binding site for the antigen. CDR variability accounts for the diversity of antigen recognition.
- Antibodies against aPC may be defined by sequences set forth in the following table:
- such molecules will comprise fragments (such as (F(ab′), F(ab′)2) that are produced, for example, by the proteolytic cleavage of the mAbs, or single-chain immunoglobulins producible, for example, via recombinant means.
- Such antibody derivatives are monovalent.
- such fragments can be combined with one another, or with other antibody fragments or receptor ligands to form “chimeric” binding molecules.
- such chimeric molecules can contain substituents capable of binding to different epitopes of the same molecule, or they can be capable of binding to an activated protein C epitope and a “non-activated protein C” epitope.
- a single-chain variable fragment is another form of antibody fragment. It comprises a fusion of the variable regions of the heavy and light chains of immunoglobulins, linked together with a short (usually serine, glycine) linker. This chimeric molecule retains the specificity of the original immunoglobulin, despite removal of the constant regions and the introduction of a linker peptide. These molecules were created historically to facilitate phage display where it is highly convenient to express the antigen binding domain as a single peptide. Alternatively, scFv can be created directly from subcloned heavy and light chains derived from a hybridoma.
- Single chain variable fragments lack the constant Fc region found in complete antibody molecules, and thus, the common binding sites (e.g., protein A/G) used to purify antibodies. These fragments can often be purified/immobilized using Protein L since Protein L interacts with the variable region of kappa light chains.
- Flexible linkers generally are comprised of helix- and turn-promoting amino acid residues such as alaine, serine and glycine. However, other residues can function as well.
- Tang et al. (1996) used phage display as a means of rapidly selecting tailored linkers for single-chain antibodies (scFvs) from protein linker libraries.
- scFvs single-chain antibodies
- a random linker library was constructed in which the genes for the heavy and light chain variable domains were linked by a segment encoding an 18-amino acid polypeptide of variable composition.
- the scFv repertoire (approx. 5 ⁇ 10 6 different members) was displayed on filamentous phage and subjected to affinity selection with hapten. The population of selected variants exhibited significant increases in binding activity but retained considerable sequence diversity.
- the recombinant antibodies against aPC can also involve sequences or moieties that permit dimerization or multimerization of the receptors.
- sequences include those derived from IgA, which permit formation of multimers in conjunction with the J chain.
- Another multimerization domain is the Gal4 dimerization domain.
- the chains can be modified with agents such as biotin/avidin, which permit the combination of two antibodies.
- a single-chain antibody can be created by joining receptor light and heavy chains using a non-peptide linker or chemical unit.
- the light and heavy chains will be produced in distinct cells, purified, and subsequently linked together in an appropriate fashion (i.e., the N-terminus of the heavy chain being attached to the C-terminus of the light chain via an appropriate chemical bridge).
- Cross-linking reagents are used to form molecular bridges that tie functional groups of two different molecules, e.g., a stabilizing and coagulating agent.
- dimers or multimers of the same analog or heteromeric complexes comprised of different analogs can be created.
- heterobifunctional cross-linkers can be used that eliminate unwanted homopolymer formation.
- An exemplary hetero-bifunctional cross-linker contains two reactive groups: one reacting with primary amine group (e.g., N-hydroxy succinimide) and the other reacting with a thiol group (e.g., pyridyl disulfide, maleimides, halogens, etc.).
- the cross-linker can react with the lysine residue(s) of one protein (e.g., the selected antibody or fragment) and through the thiol reactive group, the cross-linker, already tied up to the first protein, reacts with the cysteine residue (free sulfhydryl group) of the other protein (e.g., the selective agent).
- one protein e.g., the selected antibody or fragment
- the thiol reactive group the cross-linker, already tied up to the first protein, reacts with the cysteine residue (free sulfhydryl group) of the other protein (e.g., the selective agent).
- a cross-linker having reasonable stability in blood can be employed.
- Numerous types of disulfide-bond containing linkers are known that can be successfully employed to conjugate targeting and therapeutic/preventative agents.
- Linkers that contain a disulfide bond that is sterically hindered can prove to give greater stability in vivo, preventing release of the targeting peptide prior to reaching the site of action. These linkers are thus one group of linking agents.
- SMPT cross-linking reagent
- Another cross-linking reagent is SMPT, which is a bifunctional cross-linker containing a disulfide bond that is “sterically hindered” by an adjacent benzene ring and methyl groups. It is believed that steric hindrance of the disulfide bond serves a function of protecting the bond from attack by thiolate anions such as glutathione which can be present in tissues and blood, and thereby help in preventing decoupling of the conjugate prior to the delivery of the attached agent to the target site.
- thiolate anions such as glutathione which can be present in tissues and blood
- the SMPT cross-linking reagent lends the ability to cross-link functional groups such as the SH of cysteine or primary amines (e.g., the epsilon amino group of lysine).
- Another possible type of cross-linker includes the heterobifunctional photoreactive phenylazides containing a cleavable disulfide bond such as sulfosuccinimidyl-2-(p-azido salicylamido)ethyl-1,3′-dithiopropionate.
- the N-hydroxysuccinimidyl group reacts with primary amino groups and the phenylazide (upon photolysis) reacts non-selectively with any amino acid residue.
- non-hindered linkers also can be employed in accordance herewith.
- Other useful cross-linkers include SATA, SPDP and 2-iminothiolane (Wawrzynczak & Thorpe, 1987). The use of such cross-linkers is well understood in the art.
- Another embodiment involves the use of flexible linkers.
- 5,141,648 and 5,563,250 disclose cleavable conjugates containing a labile bond that is cleavable under a variety of mild conditions.
- This linker is particularly useful in that the agent of interest can be bonded directly to the linker, with cleavage resulting in release of the active agent.
- Particular uses include adding a free amino or free sulfhydryl group to a protein, such as an antibody, or a drug.
- U.S. Pat. No. 5,856,456 provides peptide linkers for use in connecting polypeptide constituents to make fusion proteins, e.g., single chain antibodies.
- the linker is up to about 50 amino acids in length, contains at 5 least one occurrence of a charged amino acid (e.g., arginine or lysine) followed by a proline, and is characterized by greater stability and reduced aggregation.
- U.S. Pat. No. 5,880,270 discloses aminooxy-containing linkers useful in a variety of immunodiagnostic and separative techniques.
- antibody conjugates For both diagnostic and therapeutic purposes, one can link or covalently bind or complex an agent to an antibody.
- a molecule or moiety can be, but is not limited to, at least one effector or reporter molecule.
- a reporter molecule is defined as any moiety which can be detected using an assay.
- Non-limiting examples of reporter molecules which have been conjugated to antibodies include enzymes, radiolabels, haptens, fluorescent labels, phosphorescent molecules, chemiluminescent molecules, chromophores, luminescent molecules, photoaffinity molecules, colored particles or ligands, such as biotin.
- antibody conjugates are those conjugates in which the antibody is linked to a detectable label.
- Detectable labels are compounds and/or elements that can be detected due to their specific functional properties, and/or chemical characteristics, the use of which allows the antibody to which they are attached to be detected, and/or further quantified if desired.
- Another such example is the formation of a conjugate comprising an antibody linked to a cytotoxic or anti cellular agent, and can be termed “immunotoxins.”
- Antibody conjugates are used as diagnostic agents. Antibody diagnostics generally fall within two classes, those for use in in vitro diagnostics, such as in a variety of immunoassays, and/or those for use in vivo diagnostic protocols, generally known as “antibody-directed imaging.”
- imaging agents are known in the art, as are methods for their attachment to antibodies (see, for e.g., U.S. Pat. Nos. 5,021,236; 4,938,948; and 4,472,509, each incorporated herein by reference).
- the imaging moieties used can be paramagnetic ions; radioactive isotopes; fluorochromes; NMR-detectable substances; X-ray imaging.
- paramagnetic ions such as chromium (III), manganese (II), iron (III), iron (II), cobalt (II), nickel (II), copper (II), neodymium (III), samarium (III), ytterbium (III), gadolinium (III), vanadium (II), terbium (III), dysprosium (III), holmium (III) and/or erbium (III).
- Ions useful in other contexts, such as X-ray imaging include but are not limited to lanthanum (III), gold (III), lead (II), and especially bismuth (III).
- radioactive isotopes for therapeutic and/or diagnostic application, one might mention astatine 211 , 14 car- bon, 51 chromium, 36 chlorine, 57 cobalt, 58 cobalt, copper 67 , 152 Eu, gallium 67 , 3 hydrogen, iodine 123 , iodine 125 , iodine 131 , indium 111 , 59 iron, 32 phosphorus, rhenium 186 , rhenium 188 , 75 selenium, 35 sulphur, technicium 99m and/or yttrium 90 .
- Radioactively labeled monoclonal antibodies can be produced according to well-known methods in the art. For instance, monoclonal antibodies can be iodinated by contact with sodium and/or potassium iodide and a chemical oxidizing agent such as sodium hypochlorite, or an enzymatic oxidizing agent, such as lactoperoxidase.
- Monoclonal antibodies can be labeled with technetium 99m by ligand exchange process, for example, by reducing pertechnate with stannous solution, chelating the reduced technetium onto a Sephadex column and applying the antibody to this column.
- direct labeling techniques can be used, e.g., by incubating pertechnate, a reducing agent such as SNCl 2 , a buffer solution such as sodium-potassium phthalate solution, and the antibody.
- Intermediary functional groups which are often used to bind radioisotopes which exist as metallic ions to antibody are diethylenetriaminepentaacetic acid (DTPA) or ethylene diaminetetracetic acid (EDTA).
- DTPA diethylenetriaminepentaacetic acid
- EDTA ethylene diaminetetracetic acid
- fluorescent labels contemplated for use as conjugates include Alexa 350, Alexa 430, AMCA, BODIPY 630/650, BODIPY 650/665, BODIPY-FL, BODIPY-R6G, BODIPY-TMR, BODIPY-TRX, Cascade Blue, Cy3, Cy5,6-FAM, Fluorescein Isothiocyanate, HEX, 6-JOE, Oregon Green 488, Oregon Green 500, Oregon Green 514, Pacific Blue, REG, Rhodamine Green, Rhodamine Red, Renographin, ROX, TAMRA, TET, Tetramethylrhodamine, and/or Texas Red.
- antibody conjugates contemplated are those intended primarily for use in vitro, where the antibody is linked to a secondary binding ligand and/or to an enzyme (an enzyme tag) that will generate a colored product upon contact with a chromogenic substrate.
- suitable enzymes include urease, alkaline phosphatase, (horseradish) hydrogen peroxidase or glucose oxidase.
- Secondary binding ligands are biotin and/or avidin and streptavidin compounds. The use of such labels is well known to those of skill in the art and are described, for example, in U.S. Pat. Nos. 3,817,837; 3,850,752; 3,939,350; 3,996,345; 4,277,437; 4,275,149 and 4,366,241; each incorporated herein by reference.
- hapten-based affinity labels react with amino acids in the antigen binding site, thereby destroying this site and blocking specific antigen reaction.
- this can not be advantageous since it results in loss of antigen binding by the antibody conjugate.
- Molecules containing azido groups can also be used to form covalent bonds to proteins through reactive nitrene intermediates that are generated by low intensity ultraviolet light (Potter & Haley, 1983).
- 2- and 8-azido analogues of purine nucleotides have been used as site-directed photoprobes to identify nucleotide binding proteins in crude cell extracts (Owens & Haley, 1987; Atherton et al., 1985).
- the 2- and 8-azido nucleotides have also been used to map nucleotide binding domains of purified proteins (Khatoon et al., 1989; King et al., 1989; and Dholakia et al., 1989) and can be used as antibody binding agents.
- attachment methods involve the use of a metal chelate complex employing, for example, an organic chelating agent such as described in U.S. Pat. Nos. 4,472,509 and 4,938,948, each incorporated herein by reference).
- Monoclonal antibodies can also be reacted with an enzyme in the presence of a coupling agent such as glutaraldehyde or periodate.
- Conjugates with fluorescein markers are prepared in the presence of these coupling agents or by reaction with an isothiocyanate.
- imaging of breast tumors is achieved using monoclonal antibodies and the detectable imaging moieties are bound to the antibody using linkers such as methyl-p-hydroxybenzimidate or N-succinimidyl-3-(4-hydroxyphenyl)propionate.
- linkers such as methyl-p-hydroxybenzimidate or N-succinimidyl-3-(4-hydroxyphenyl)propionate.
- derivatization of immunoglobulins by selectively introducing sulfhydryl groups in the Fc region of an immunoglobulin, using reaction conditions that do not alter the antibody combining site are contemplated.
- Antibody conjugates produced according to this methodology are disclosed to exhibit improved longevity, specificity and sensitivity (U.S. Pat. No. 5,196,066, incorporated herein by reference).
- Site-specific attachment of effector or reporter molecules, wherein the reporter or effector molecule is conjugated to a carbohydrate residue in the Fc region have also been disclosed in the literature (O'Shannessy et al., 1987). This approach has been reported to produce diagnostically and therapeutically promising antibodies which are currently in clinical evaluation.
- PEGylation is one such process that involves covalent attachment of polyethylene glycol (PEG) polymer chains to the antibody. PEGylation is routinely achieved by incubation of a reactive derivative of PEG with the target molecule. The covalent attachment of PEG can “mask” the antibody from the host's immune system (reduced immunogenicity and antigenicity), and increase the hydrodynamic size (size in solution) of the agent which prolongs its circulatory time by reducing renal clearance. PEGylation can also provide water solubility.
- Other polymers used to modify antibodies include polyethyleneimine and polylysine, often linked through succinic acid groups.
- immunodetection methods for binding, purifying, removing, quantifying and/or otherwise generally detecting biological components using antibodies that react immunologically with such components.
- Some immunodetection methods include enzyme linked immunosorbent assay (ELISA), radioimmunoassay (RIA), immunoradiometric assay, fluoroimmunoassay, chemiluminescent assay, bioluminescent assay, and Western blot to mention a few.
- ELISA enzyme linked immunosorbent assay
- RIA radioimmunoassay
- immunoradiometric assay immunoradiometric assay
- fluoroimmunoassay fluoroimmunoassay
- chemiluminescent assay chemiluminescent assay
- bioluminescent assay bioluminescent assay
- Western blot to mention a few.
- the steps of various useful immunodetection methods have been described in the scientific literature, such as, e.g., Doolittle and Ben-
- the immunobinding methods include obtaining a sample containing a target of interest, and contacting the sample with a first antibody that reacts immunologically with the target under conditions effective to allow the formation of immunocomplexes.
- the binding of the antibody to the target can then be assessed using a variety of different formats.
- the antibody can be linked to a solid support, such as in the form of a column matrix, and the sample suspected of containing the target will be applied to the immobilized antibody. The unwanted components will be washed from the column, leaving the target immunocomplexed to the immobilized antibody to be eluted.
- the immunobinding methods also include methods for detecting and quantifying the amount of an target in a sample and the detection and quantification of any immune complexes formed during the binding process.
- detecting and quantifying the amount of an target in a sample and the detection and quantification of any immune complexes formed during the binding process.
- one would obtain a sample suspected of containing a target and contact the sample with an antibody against the target, and then detect and quantify the amount of immune complexes formed under the specific conditions.
- the biological sample analyzed can be any sample that is suspected of containing a target, such as, for example, a body fluid like blood, serum, plasma, mucous, urine, saliva, tears or semen. Alternatively, a tissue can be used.
- a target such as, for example, a body fluid like blood, serum, plasma, mucous, urine, saliva, tears or semen.
- a tissue can be used.
- Contacting the chosen biological sample with the antibody under effective conditions and for a period of time sufficient to allow the formation of immune complexes (primary immune complexes) is generally a matter of simply adding the antibody composition to the sample and incubating the mixture for a period of time long enough for the antibodies to form immune complexes with, i.e., to bind to targets that react immunologically with antibodies present.
- sample-antibody composition such as a tissue section, ELISA plate, dot blot or western blot
- sample-antibody composition such as a tissue section, ELISA plate, dot blot or western blot
- the sample-antibody composition will generally be washed to remove any non-specifically bound species, allowing only those molecules specifically bound within the primary immune complexes to be detected.
- the antibody employed in the detection can itself be linked to a detectable label, wherein one would then simply detect this label, thereby allowing the amount of the primary immune complexes in the composition to be determined.
- the first antibody that becomes bound within the primary immune complexes can be detected by means of a second binding ligand that has binding affinity for the antibody.
- the second binding ligand can be linked to a detectable label.
- the second binding ligand is itself often an antibody, which can thus be termed a “secondary” antibody.
- the primary immune complexes are contacted with the labeled, secondary binding ligand, or antibody, under effective conditions and for a period of time sufficient to allow the formation of secondary immune complexes.
- the secondary immune complexes are then generally washed to remove any non-specifically bound labeled secondary antibodies or ligands, and the remaining label in the secondary immune complexes is then detected.
- Further methods include the detection of primary immune complexes by a two step approach.
- a second binding ligand such as an antibody, that has binding affinity for the antibody is used to form secondary immune complexes, as described above.
- the secondary immune complexes are contacted with a third binding ligand or antibody that has binding affinity for the second antibody, again under effective conditions and for a period of time sufficient to allow the formation of immune complexes (tertiary immune complexes).
- the third ligand or antibody is linked to a detectable label, allowing detection of the tertiary immune complexes thus formed. This system can provide for signal amplification if this is desired.
- One method of immunodetection designed by Charles Cantor uses two different antibodies.
- a first step biotinylated, monoclonal or polyclonal antibody is used to detect the target antigen(s), and a second step antibody is then used to detect the biotin attached to the complexed biotin.
- the sample to be tested is first incubated in a solution containing the first step antibody. If the target antigen is present, some of the antibody binds to the antigen to form a biotinylated antibody/antigen complex.
- the antibody/antigen complex is then amplified by incubation in successive solutions of streptavidin (or avidin), biotinylated DNA, and/or complementary biotinylated DNA, with each step adding additional biotin sites to the antibody/antigen complex.
- streptavidin or avidin
- biotinylated DNA and/or complementary biotinylated DNA
- the amplification steps are repeated until a suitable level of amplification is achieved, at which point the sample is incubated in a solution containing the second step antibody against biotin.
- This second step antibody is labeled, as for example with an enzyme that can be used to detect the presence of the antibody/antigen complex by histoenzymology using a chromogen substrate.
- a conjugate can be produced which is macroscopically visible.
- PCR Polymerase Chain Reaction
- the PCR method is similar to the Cantor method up to the incubation with biotinylated DNA, however, instead of using multiple rounds of streptavidin and biotinylated DNA incubation, the DNA/biotin/streptavidin/antibody complex is washed out with a low pH or high salt buffer that releases the antibody. The resulting wash solution is then used to carry out a PCR reaction with suitable primers with appropriate controls.
- the enormous amplification capability and specificity of PCR can be utilized to detect a single antigen molecule.
- Another ELISA in which the antigens are immobilized involves the use of antibody competition in the detection.
- labeled antibodies against an antigen are added to the wells, allowed to bind, and/or detected by means of their label.
- the amount of an antigen in an unknown sample is then determined by mixing the sample with the labeled antibodies against the antigen during incubation with coated wells.
- the presence of an antigen in the sample acts to reduce the amount of antibody against the antigen available for binding to the well and thus reduces the ultimate signal.
- This is also appropriate for detecting antibodies against an antigen in an unknown sample, where the unlabeled antibodies bind to the antigen-coated wells and also reduces the amount of antigen available to bind the labeled antibodies.
- immunoassays in their most simple and/or direct sense, are binding assays.
- Certain immunoassays are the various types of enzyme linked immunosorbent assays (ELISAs) and/or radioimmunoassays (RIA) known in the art. Immunohistochemical detection using tissue sections is also particularly useful. However, it will be readily appreciated that detection is not limited to such techniques, and/or western blotting, dot blotting, FACS analyses, and/or the like can also be used.
- ELISAs have certain features in common, such as coating, incubating and binding, washing to remove non-specifically bound species, and detecting the bound immune complexes. These are described below.
- a plate with either antigen or antibody In coating a plate with either antigen or antibody, one will generally incubate the wells of the plate with a solution of the antigen or antibody, either overnight or for a specified period of hours. The wells of the plate will then be washed to remove incompletely adsorbed material. Any remaining available surfaces of the wells are then “coated” with a non-specific protein that is antigenically neutral with regard to the test antisera. These include bovine serum albumin (BSA), casein or solutions of milk powder.
- BSA bovine serum albumin
- the coating allows for blocking of nonspecific adsorption sites on the immobilizing surface and thus reduces the background caused by nonspecific binding of antisera onto the surface.
- a secondary or tertiary detection means rather than a direct procedure.
- the immobilizing surface is contacted with the biological sample to be tested under conditions effective to allow immune complex (antigen/antibody) formation. Detection of the immune complex then requires a labeled secondary binding ligand or antibody, and a secondary binding ligand or antibody in conjunction with a labeled tertiary antibody or a third binding ligand.
- Under conditions effective to allow immune complex (antigen/antibody) formation means that the conditions can include diluting the antigens and/or antibodies with solutions such as BSA, bovine gamma globulin (BGG) or phosphate buffered saline (PBS)/Tween. These added agents also tend to assist in the reduction of nonspecific background.
- solutions such as BSA, bovine gamma globulin (BGG) or phosphate buffered saline (PBS)/Tween.
- suitable conditions also mean that the incubation is at a temperature or for a period of time sufficient to allow effective binding. Incubation steps are typically from about 1 to 2 to 4 hours or so, at temperatures on the order of 25° C. to 27° C., or can be overnight at about 4° C. or so.
- the antibodies against aPC can be purified.
- purified is intended to refer to a composition, isolatable from other components, wherein the protein is purified to any degree relative to its naturally-obtainable state.
- a purified protein therefore also refers to a protein, free from the environment in which it can naturally occur.
- substantially purified this designation will refer to a composition in which the protein or peptide forms the major component of the composition, such as constituting about 50%, about 60%, about 70%, about 80%, about 90%, about 95% or more of the proteins in the composition.
- Protein purification techniques are well known to those of skill in the art. These techniques involve, at one level, the crude fractionation of the cellular milieu to polypeptide and non-polypeptide fractions. Having separated the polypeptide from other proteins, the polypeptide of interest can be further purified using chromatographic and electrophoretic techniques to achieve partial or complete purification (or purification to homogeneity).
- Analytical methods particularly suited to the preparation of a pure peptide are ion-exchange chromatography, exclusion chromatography; polyacrylamide gel electrophoresis; isoelectric focusing.
- Other methods for protein purification include, precipitation with ammonium sulfate, PEG, antibodies and the like or by heat denaturation, followed by centrifugation; gel filtration, reverse phase, hydroxylapatite and affinity chromatography; and combinations of such and other techniques.
- polypeptide In purifying an antibody against aPC, it can be desirable to express the polypeptide in a prokaryotic or eukaryotic expression system and extract the protein using denaturing conditions.
- the polypeptide can be purified from other cellular components using an affinity column, which binds to a tagged portion of the polypeptide.
- affinity column which binds to a tagged portion of the polypeptide.
- antibodies are fractionated utilizing agents (i.e., protein A) that bind the Fc portion of the antibody.
- agents i.e., protein A
- antigens can be used to simultaneously purify and select appropriate antibodies.
- Such methods often utilize the selection agent bound to a support, such as a column, filter or bead.
- the antibodies is bound to a support, contaminants removed, and the antibodies released by applying conditions (salt, heat, etc.).
- compositions A. Compositions
- compositions can comprise an effective amount of one or more antibodies, therapeutic agents or additional agent dissolved or dispersed in a pharmaceutically acceptable carrier.
- Aqueous compositions comprise an effective amount of the antibody, dissolved or dispersed in a pharmaceutically acceptable carrier or aqueous medium.
- pharmaceutically or pharmacologically acceptable refer to molecular entities and compositions that do not produce an adverse, allergic or other untoward reaction when administered to an animal, or a human, as appropriate.
- “pharmaceutically acceptable carrier” includes any and all solvents, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g., antibacterial agents, antifungal agents), isotonic agents, absorption delaying agents, salts, preservatives, drugs, drug stabilizers, gels, binders, excipients, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, such like materials and combinations thereof, as would be known to one of ordinary skill in the art (see, for example, Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, pp. 1289-1329, incorporated herein by reference). The use of such media and agents for pharmaceutical active substances is well known in the art.
- compositions should meet sterility, pyrogenicity, general safety and purity standards as required by FDA Office of Biologic Standards.
- the biological material should be extensively dialyzed to remove undesired small molecular weight molecules and/or lyophilized for more ready formulation into a desired vehicle, where appropriate.
- the active compounds will then generally be formulated for parenteral administration, e.g., formulated for injection via the intravenous, intramuscular, sub-cutaneous, intranasal, or intraperitoneal routes.
- parenteral administration e.g., formulated for injection via the intravenous, intramuscular, sub-cutaneous, intranasal, or intraperitoneal routes.
- such compositions can be prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for using to prepare solutions or suspensions upon the addition of a liquid prior to injection can also be prepared; and the preparations can also be emulsified.
- the pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions; formulations including sesame oil, peanut oil or aqueous propylene glycol; and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
- the form must be sterile and must be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
- Solutions of the active compounds as free base or pharmacologically acceptable salts can be prepared in water suitably mixed with a surfactant, such as hydroxypropylcellulose. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
- the antibodies against aPC can be formulated into a composition in a free base, in a neutral or salt form.
- Pharmaceutically acceptable salts include the acid addition salts (formed with the free amino groups of the protein) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, histidine, procaine and the like.
- the carrier can also be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetable oils.
- the proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- the prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like. In many cases, isotonic agents can be included, for example, sugars or sodium chloride. Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.
- Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with various of the other ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
- the methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- the preparation of more, or highly, concentrated solutions for direct injection is also contemplated, where the use of DMSO as solvent is envisioned to result in extremely rapid penetration, delivering high concentrations of the active agents to a small area.
- solutions Upon formulation, solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective.
- the formulations are easily administered in a variety of dosage forms, such as the type of injectable solutions described above, but drug release capsules and the like can also be employed.
- aqueous solutions For parenteral administration in an aqueous solution, for example, the solution should be suitably buffered if necessary and the liquid diluent first rendered isotonic with sufficient saline or glucose.
- aqueous solutions are especially suitable for intravenous, intramuscular, subcutaneous, intranasal, and intraperitoneal administration.
- sterile aqueous media which can be employed will be known to those of skill in the art in light of the present disclosure.
- one dosage could be dissolved in 1 ml of isotonic NaCl solution and either added to 1000 ml of hypodermoclysis fluid or injected at the proposed site of infusion, (see for example, “Remington's Pharmaceutical Sciences” 15th Edition, pages 1035-1038 and 1570-1580). Some variation in dosage will necessarily occur depending on the condition of the subject being treated. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject.
- other pharmaceutically acceptable forms include, e.g., tablets or other solids for oral administration; liposomal formulations; time release capsules; and any other form currently used, including cremes.
- liposomes and/or nanoparticles are contemplated for the formulation and administration of the antibodies and/or analogs thereof.
- the formation and use of liposomes is generally known to those of skill in the art, and is also described below.
- Nanocapsules can generally entrap compounds in a stable and reproducible way. To avoid side effects due to intracellular polymeric overloading, such ultrafine particles (sized around 0.1 ⁇ m) should be designed using polymers able to be degraded in vivo. Biodegradable polyalkyl-cyanoacrylate nanoparticles that meet these requirements are contemplated for use, and such particles are easily made.
- Liposomes are formed from phospholipids that are dispersed in an aqueous medium and spontaneously form multilamellar concentric bilayer vesicles (also termed multilamellar vesicles (MLVs).
- MLVs generally have diameters of from 25 nm to 4 ⁇ m. Sonication of MLVs results in the formation of small unilamellar vesicles (SUVs) with diameters in the range of 200-500 ⁇ , containing an aqueous solution in the core.
- SUVs small unilamellar vesicles
- Phospholipids can form a variety of structures other than liposomes when dispersed in water, depending on the molar ratio of lipid to water. At low ratios the liposome is the recommended structure.
- the physical characteristics of liposomes depend on pH, ionic strength and the presence of divalent cations. Liposomes can show low permeability to ionic and polar substances, but at elevated temperatures undergo a phase transition which markedly alters their permeability. The phase transition involves a change from a closely packed, ordered structure, known as the gel state, to a loosely packed, less-ordered structure, known as the fluid state. This occurs at a characteristic phase-transition temperature and results in an increase in permeability to ions, sugars and drugs.
- Liposomes interact with cells via four different mechanisms: Endocytosis by phagocytic cells of the reticuloendothelial system such as macrophages and neutrophils; adsorption to the cell surface, either by nonspecific weak hydrophobic or electrostatic forces, or by specific interactions with cell-surface components; fusion with the plasma cell membrane by insertion of the lipid bilayer of the liposome into the plasma membrane, with simultaneous release of liposomal contents into the cytoplasm; and by transfer of liposomal lipids to cellular or subcellular membranes, or vice versa, without any association of the liposome contents. Varying the liposome formulation can alter which mechanism is operative, although more than one can operate at the same time.
- the therapeutic agent can comprise different types of carriers depending on whether it is to be administered in solid, liquid or aerosol form, and whether it needs to be sterile for such routes of administration as injection.
- the antibodies against aPC can be administered intravenously, intradermally, intraarterially, intraperitoneally, intralesionally, intracranially, intraarticularly, intraprostaticaly, intrapleurally, intratracheally, intranasally, intravitreally, intravaginally, intrarectally, topically, intramuscularly, intraperitoneally, subcutaneously, subconjunctival, intravesicularlly, mucosally, intrapericardially, intraumbilically, intraocularally, orally, topically, locally, by inhalation (e.g., aerosol inhalation), by injection, by infusion, by continuous infusion, localized perfusion bathing target cells directly, via a catheter, via a lavage, in cremes, in lipid compositions (e.g., liposomes), or by
- the actual dosage amount of a composition administered to an animal patient can be determined by physical and physiological factors such as body weight, severity of condition, the type of disease being treated, previous or concurrent therapeutic interventions, idiopathy of the patient and the route of administration.
- the practitioner responsible for administration will, in any event, determine the concentration of active ingredient(s) in a composition and appropriate dose(s) for the individual subject.
- compositions can comprise, for example, at least about 0.1% of an active compound.
- an active compound can comprise between about 2% to about 75% of the weight of the unit, or between about 25% to about 60%, for example, and any range derivable therein.
- a dose can also comprise from about 1 microgram/kg/body weight, about 5 microgram/kg/body weight, about 10 microgram/kg/body weight, about 50 microgram/kg/body weight, about 100 microgram/kg/body weight, about 200 microgram/kg/body weight, about 350 microgram/kg/body weight, about 500 microgram/kg/body weight, about 1 milligram/kg/body weight, about 5 milligram/kg/body weight, about 10 milligram/kg/body weight, about 50 milligram/kg/body weight, about 100 milligram/kg/body weight, about 200 milligram/kg/body weight, about 350 milligram/kg/body weight, about 500 milligram/kg/body weight, to about 1000 mg/kg/body weight or more per administration, and any range derivable therein.
- a range of about 5 mg/kg/body weight to about 100 mg/kg/body weight, about 5 microgram/kg/body weight to about 500 milligram/kg/body weight, etc. can be administered, based on the numbers described above.
- composition can comprise various antioxidants to retard oxidation of one or more component.
- a carrier can be a solvent or dispersion medium comprising but not limited to, water, ethanol, polyol (e.g., glycerol, propylene glycol, liquid polyethylene glycol, etc.), lipids (e.g., triglycerides, vegetable oils, liposomes) and combinations thereof.
- the proper fluidity can be maintained, for example, by the use of a coating, such as lecithin; by the maintenance of the required particle size by dispersion in carriers such as, for example liquid polyol or lipids; by the use of surfactants such as, for example hydroxypropylcellulose; or combinations thereof.
- isotonic agents can be included, such as, for example, sugars, sodium chloride or combinations thereof.
- nasal solutions are usually aqueous solutions designed to be administered to the nasal passages in drops or sprays.
- Nasal solutions are prepared so that they are similar in many respects to nasal secretions, so that normal ciliary action is maintained.
- the aqueous nasal solutions usually are isotonic or slightly buffered to maintain a pH of about 5.5 to about 6.5.
- antimicrobial preservatives similar to those used in ophthalmic preparations, drugs, or appropriate drug stabilizers, if required, can be included in the formulation.
- various commercial nasal preparations are known and include drugs such as antibiotics or antihistamines.
- the antibodies are prepared for administration by such routes as oral ingestion.
- the solid composition can comprise, for example, solutions, suspensions, emulsions, tablets, pills, capsules (e.g., hard or soft shelled gelatin capsules), sustained release formulations, buccal compositions, troches, elixirs, suspensions, syrups, wafers, or combinations thereof.
- Oral compositions can be incorporated directly with the food of the diet.
- Carriers for oral administration comprise inert diluents, assimilable edible carriers or combinations thereof.
- the oral composition can be prepared as a syrup or elixir.
- a syrup or elixir can comprise, for example, at least one active agent, a sweetening agent, a preservative, a flavoring agent, a dye, a preservative, or combinations thereof.
- an oral composition can comprise one or more binders, excipients, disintegration agents, lubricants, flavoring agents, and combinations thereof.
- a composition can comprise one or more of the following: a binder, such as, for example, gum tragacanth, acacia, cornstarch, gelatin or combinations thereof; an excipient, such as, for example, dicalcium phosphate, mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate or combinations thereof; a disintegrating agent, such as, for example, corn starch, potato starch, alginic acid or combinations thereof; a lubricant, such as, for example, magnesium stearate; a sweetening agent, such as, for example, sucrose, lactose, saccharin or combinations thereof; a flavoring agent, such as, for example peppermint, oil of wintergreen, cherry flavoring, orange flavoring, etc.; or combinations of the fore
- the dosage unit form When the dosage unit form is a capsule, it can contain, in addition to materials of the above type, carriers such as a liquid carrier. Various other materials can be present as coatings or to otherwise modify the physical form of the dosage unit. For instance, tablets, pills, or capsules can be coated with shellac, sugar or both.
- suppositories are solid dosage forms of various weights and shapes, usually medicated, for insertion into the rectum, vagina or urethra. After insertion, suppositories soften, melt or dissolve in the cavity fluids.
- traditional carriers can include, for example, polyalkylene glycols, triglycerides or combinations thereof.
- suppositories can be formed from mixtures containing, for example, the active ingredient in the range of about 0.5% to about 10%, and about 1% to about 2%.
- composition must be stable under the conditions of manufacture and storage, and preserved against the contaminating action of microorganisms, such as bacteria and fungi. It will be appreciated that endotoxin contamination should be kept minimally at a safe level, for example, less that 0.5 ng/mg protein.
- prolonged absorption of an injectable composition can be brought about by the use in the compositions of agents delaying absorption, such as, for example, aluminum monostearate, gelatin or combinations thereof.
- the monoclonal antibody can be used for therapeutic purposes for treating genetic and acquired deficiencies or defects in coagulation.
- the monoclonal antibodies in the embodiments described above can be used to block the interaction of aPC with its substrate, which can include Factor Va or Factor VIIIa.
- the monoclonal antibodies have therapeutic use in the treatment of disorders of hemostasis such as thrombocytopenia, platelet disorders and bleeding disorders (e.g., hemophilia A, hemophilia B and hemophilia C). Such disorders can be treated by administering a therapeutically effective amount of the anti-aPC monoclonal antibody to a patient in need thereof.
- the monoclonal antibodies also have therapeutic use in the treatment of uncontrolled bleeds in indications such as trauma and hemorrhagic stroke.
- a method for shortening the bleeding time comprising administering a therapeutically effective amount of an anti-aPC monoclonal antibody to a patient in need thereof.
- the anti-aPC antibody can be useful as an antidote for aPC-treated patients, including for example wherein aPC is used for the treatment of sepsis or bleeding disorder.
- the antibodies can be used as monotherapy or in combination with other therapies to address a hemostatic disorder.
- co-administration of one or more antibodies with a clotting factor such as factor VIIa, factor VIII or factor IX is believed useful for treating hemophilia.
- a method for treating genetic and acquired deficiencies or defects in coagulation comprising administering (a) a first amount of a monoclonal antibody that binds to human tissue factor pathway inhibitor and (b) a second amount of factor VIII or factor IX, wherein said first and second amounts together are effective for treating said deficiencies or defects.
- a method for treating genetic and acquired deficiencies or defects in coagulation comprising administering (a) a first amount of a monoclonal antibody that binds to human tissue factor pathway inhibitor and (b) a second amount of factor VIII or factor IX, wherein said first and second amounts together are effective for treating said deficiencies or defects, and further wherein factor VII is not coadministered.
- a pharmaceutical composition comprising a therapeutically effective amount of the combination of a monoclonal antibody and factor VIII or factor IX, wherein the composition does not contain factor VII.
- Factor VII includes factor VII and factor VIIa.
- one or more antibodies described herein can be used in combination to address a hemostatic disorder.
- co-administration of two or more of the antibodies described herein is believed useful for treating hemophilia or other hemostatic disorder.
- compositions can be parenterally administered to subjects suffering from hemophilia A or B at a dosage and frequency that can vary with the severity of the bleeding episode or, in the case of prophylactic therapy, can vary with the severity of the patient's clotting deficiency.
- compositions can be administered to patients in need as a bolus or by continuous infusion.
- a bolus administration of an inventive antibody present as a Fab fragment can be in an amount of from 0.0025 to 100 mg/kg body weight, 0.025 to 0.25 mg/kg, 0.010 to 0.10 mg/kg or 0.10-0.50 mg/kg.
- an inventive antibody present as an Fab fragment can be administered at 0.001 to 100 mg/kg body weight/minute, 0.0125 to 1.25 mg/kg/min., 0.010 to 0.75 mg/kg/min., 0.010 to 1.0 mg/kg/min. or 0.10-0.50 mg/kg/min.
- dosage amounts can be about 1-10 mg/kg body weight, 2-8 mg/kg, or 5-6 mg/kg.
- Such full-length antibodies would typically be administered by infusion extending for a period of thirty minutes to three hours.
- the frequency of the administration would depend upon the severity of the condition. Frequency could range from three times per week to once every two weeks to six months.
- compositions can be administered to patients via subcutaneous injection.
- a dose of 10 to 100 mg anti-aPC antibody can be administered to patients via subcutaneous injection weekly, biweekly or monthly.
- therapeutically effective amount means an amount of an anti-aPC monoclonal antibody or of a combination of such antibody and factor VIII or factor IX that is needed to effectively increase the clotting time in vivo or otherwise cause a measurable benefit in vivo to a patient in need.
- the precise amount will depend upon numerous factors, including, but not limited to the components and physical characteristics of the therapeutic composition, intended patient population, individual patient considerations, and the like, and can readily be determined by one skilled in the art.
- kits will thus comprise, in suitable container, an antibody and/or an additional agent.
- Other components can be included in a kit.
- Diagnostic and therapeutic kits comprise in suitable container, a pharmaceutically acceptable formulation of an antibody in a pharmaceutically acceptable formulation.
- the kit can have a single container, and/or it can have distinct container for each compound.
- the liquid solution is an aqueous solution, with a sterile aqueous solution being one example of a particular embodiment.
- the antibody can also be formulated into a syringeable composition, in which case, the container can itself be a syringe, pipette, and/or other such like apparatus, from which the formulation can be applied to an infected area of the body, injected into an animal, and/or even applied to and/or mixed with the other components of the kit.
- the components of the kit can be provided as dried powder(s).
- the powder can be reconstituted by the addition of a suitable solvent. It is envisioned that the solvent can also be provided in another container.
- the container will generally include at least one vial, test tube, flask, bottle, syringe and/or other container, into which the antibody/antibody formulation is placed, suitably allocated.
- the kits can also comprise a second container for containing a sterile, pharmaceutically acceptable buffer and/or other diluent.
- kits can also include a means for containing the vials in close confinement for commercial sale, such as, e.g., injection and/or blow-molded plastic containers into which the desired vials are retained.
- a means for containing the vials in close confinement for commercial sale such as, e.g., injection and/or blow-molded plastic containers into which the desired vials are retained.
- kits can also comprise, and/or be packaged with, an instrument for assisting with the injection/administration and/or placement of the ultimate antibody within the body of an animal.
- an instrument can be a syringe, pipette, forceps, and/or any such medically approved delivery vehicle.
- VH/VL CDR residues were determined and annotated with Kabat numbering system (world-wide-web at bioinf.org.uk/abs/#kabatnum).
- the canonical structures of the VH/VL CDRs were determined based on reports in literature (1-2). Based on VH/VL CDR canonical structures, the human germline framework acceptors with the same canonical structures were selected.
- 1573 sequence was used to blast search PDB database and obtain known antibody structures sharing the highest sequence identities with the target antibody. Based on the output of blast search and sequence identity ratio, 1M71, 1M7D, and 1M7I were selected as template for VH modeling, while 1IQW, 11T9 and 2GCY were selected as template for VL chain modeling. Schrodinger suite software was used to build homology models for VL and VH chains, with loop optimization. Then the output models were analyzed with software “contact” in CCP4 suite to give a list of all residues in framework regions that interact with residues from CDR regions within 4 ⁇ . Based on the output of software and visual inspection with the model, the following residues in framework were identified as residues that contribute to the supporting of CDR loops.
- the human JH region was selected based on best sequence homology.
- the humanized VL sequences were also designed based on such method stated above.
- Humanized V-region sequences were built using gene de novo synthesis approach.
- the PCR amplified VHs were cloned into pCP-hCgl expression vector by homologous recombination.
- Amplified Vks were cloned into pCP-hck vector using same method.
- variable regions of chimera HC and LC were PCR-amplified from 1573.
- Gel-purified PCR product was cloned into the same vectors as humanized V-region by homologous recombination.
- FreeStyleTM 293E Approximately 24 hrs before transfection, pass FreeStyleTM 293E at 0.5 ⁇ 10 6 cells/ml and cells were sharked at 120 rpm/min, at 37° C., 8% CO 2 . On the day of transfection, the cell density should be about 1.0-1.2 ⁇ 10 6 /ml. The cells were split to 1 ⁇ 10 6 /ml with growth medium. To ensure optimal transfection, viability of the cells was determined to be >95%. DNA was diluted in FreeStyleTM 293 expression medium (293E) in a volume equivalent to one-tenth of culture transfected. PEI was added into DNA; the mixture was vortex immediately and incubated for 10 min at room temperature prior to its addition to the cells. The final concentration of DNA to PEI ratio was 1:2.
- Conditioned medium above on day 6 was loaded onto a 1 ml Protein A column, which was pre-equilibrated by 10 ml PBS, pH7.0. The column was then washed with equilibrating buffer to baseline after sample loading. After washed, the column was eluted with 100 mM Glycin-HCl pH3.0, followed with immediate addition of 1M Tris-HCl solution to adjust pH value to 8.0. The final product was dialyzed against PBS solution. Protein purity was analyzed by SDS-PAGE, SEC and its concentration was determined by Bradford method.
- SEC for analyzing purified antibody was carried out with a Superdex 200 5/150, GL column using a HPLC system (LC-20AD, Shimadzu) at ambient temperature. PBS buffer pH 7.0, at a flow rate 0.3 mL/min was used as the mobile phase. The protein detection was under 280 nm.
- a CM5 sensor chip was activated in FC2 by 6-min injection (10 ⁇ l/min) of freshly prepared 1:1 50 mM NHS: 200 mM EDC. Then anti mouse FC antibody in 10 mM sodium acetate buffer PH 5.0 (1.4 ⁇ l diluted in 90 ⁇ l NaAc, pH 5.0) was injected onto the activated chip at 5 ⁇ l/min (HBS-EP running buffer: 10 mM HEPES, pH 7.4, 150 mM NaCl, 3.4 mM EDTA, 0.005% surfactant P20). The remaining active coupling sites were blocked with 7 min injection of 1M ethanolamine at 10 ⁇ l/min. About 9200 RU was produced.
- a CM5 sensor chip was activated in FC2 by 7-min injection (10 ⁇ l/min) of freshly prepared 1:1 50 mM NHS: 200 mM EDC. Then anti human FC antibody in 10 mM sodium acetate buffer PH 5.0 (2.5 ⁇ l diluted in 90 ⁇ l NaAc, pH 5.0) was injected onto the activated chip at 5 ⁇ l/min (HBS-EP running buffer: 10 mM HEPES, pH 7.4, 150 mM NaCl, 3.4 mM EDTA, 0.005% surfactant P20). The remaining active coupling sites were blocked with 7 min injection of 1M ethanolamine at 10 ⁇ l/min. About 6400 RU was produced.
- 1573 antibody was first captured on the anti-human FC IgG coated CM5 chip, followed by injection of antigen human aPC at concentration of 0, 1.25, 2.5, 5, 10 and 20 nM. Cycle conditions were as follows: 30 ⁇ l/min for 180 s of association phase and 500 s of dissociation phase. The surface was regenerated with a 30 s injection of Gly pH1.5 at 10 ⁇ l/min. HBS-EP running buffer: 10 mM HEPES, pH 7.4, 150 mM NaCl, 3.4 mM EDTA, 0.005% surfactant P20. Kinetics was calculated with Biacore X100 evaluation software ver2.0.
- 1573 antibody was first captured on the anti-human FC IgG-coated CM5 chip, followed by injection of antigen cyno aPC at concentration of 0, 5, 10, 20, 40, 80 nM. Cycle conditions were as follows: 30 ⁇ l/min for 180 s of association phase and 420 s of dissociation phase. The surface was regenerated with a 45 s injection of Gly pH1.5 at 10 ⁇ l/min. Kinetics was calculated with Biacore X100 evaluation software ver2.0.
- Plates were washed 5 ⁇ with PBST. 100 ⁇ l of anti-hIgG Fc-HRP (Sigma, cat#A0170) diluted 1:10000 in PBST was added to each well. Plates were washed and 100 ⁇ l/well of TMB substrate was added and incubated at room temperature for 5 min. 100 ⁇ l/well of 1N HCl was added to terminate reaction. The plate was read with an ELISA plate reader (Biotek, Elx405) at 450 nm wavelength.
- VH (SEQ ID NO: 31; DNA is SEQ ID NO: 33) EVKLEESGGGLVQPGGSMKLSCVASGFTFS NYYLN WVRQSPEKGLEWVA D IRLKSNNYEKHYAESVKG RFTISRDDSKSSVYLQMNNLRAEDTGIYYCIR EGDYFDY WGQGTTLTVSS VL: (SEQ ID NO: 32; DNA is SEQ ID NO: 34) NIVLTQSPASLAVSLGQRATISC RASESVDSFGATFMH WYQQKPGQPPKL LIY LASNLES GVPARFSGSGSRTDFTLTIDPVEADDAATYYC QQNNEDPY T FGGGTKLEIKR 1573 VH canonical structure: 1-4-based on H1 and H2 canonical structures, the VH can be humanized to subset of the VH3 germline framework sequences. 1573 Vk canonical structure: 4-1-1-based on a 4-1-1 Vk CDR canon
- Germline VH3-72 had the best overall homology with the 1573 VH sequence. It was selected as the acceptor human germline framework for grafting 1573 VH CDR sequences. hJH6 will be used for 1573 humanization due to best homology. All possible back-mutations are listed below.
- Vk germline A2 had the best overall homology to the 1573 Vk sequence. It was selected as the acceptor human germline framework for grafting 1573 Vk CDR sequences. hJk2 will be used for 1573 humanization due to best homology. Residues important for loop conformation and VH/VL interface are highlighted in yellow and the CDRs with the Kabat numbers in red.
- aPC was immobilized directly onto a new CM5 chip using amine coupling method. After overnight equilibrium, 100 nM 1573 antibodies were injected over the surface and strong signal was detected. Therefore, the affinity determination was done using this chip. Each of antibody was injected over the chip surfaces respectively at 30 ⁇ l/min for 180 s of association phase and 300 s of dissociation phase.
- humanized antibodies at different concentrations showed very weak response. They have no binding to the human PC and monkey PC antigen. The results were showed in FIG. 5 and FIG. 6 .
- human aPC and monkey aPC all the humanized antibodies showed good binding affinity, it confirmed the Biacore analysis (Table 4). With the dilution curve of humanized antibodies, the inventors also calculated the EC 50 of each antibody, which are shown in Table 5.
- Chimera and humanized 1573 are cloned in CP's expression vector and generated in CP.
- the interaction between aPC and antibodies including chimera and humanized are characterized as fast association and fast dissociation by Biacore assay.
- all the humanized 1573 variants fulfilled affinity criteria.
- Hu1573-1, 2, 5, 8, 10 could be good candidates, as they have affinity higher than 5 nM and with only 2-3 back-mutations.
- compositions and/or methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods have been described in terms of specific embodiments, it will be apparent to those of skill in the art that variations can be applied to the compositions and/or methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the disclosure. More specifically, it will be apparent that certain agents which are both chemically and physiologically related can be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept as defined by the appended claims.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Hematology (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- Biophysics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Public Health (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Diabetes (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Physics & Mathematics (AREA)
- Cell Biology (AREA)
- Food Science & Technology (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- General Engineering & Computer Science (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Plant Pathology (AREA)
Abstract
Provided are humanized antibodies that selectively bind to and inhibit activated protein C without binding to or inhibiting unactivated protein C. Methods of treatment employing these antibodies are described herein.
Description
This application is a national phase application under 35 U.S.C. §371 of International Application No. PCT/US2013/072137, filed Nov. 27, 2013, which claims benefit of priority to U.S. Provisional Application Ser. No. 61/731,368, filed Nov. 29, 2012. The entire contents of the above-referenced disclosures are specifically incorporated herein by reference.
Pursuant to 37 C.F.R. 1.821(c), a sequence listing is submitted herewith as an ASCII compliant text file named “BAYRP0002US_ST25.txt”, created on May 1, 2015 and having a size of ˜25 kilobytes. The content of the aforementioned file is hereby incorporated by reference in its entirety.
Blood coagulation is a process consisting of a complex interaction of various blood components, or factors, which eventually give rise to a fibrin clot. Generally, blood components participating in the coagulation “cascade” are proenzymes or zymogens—enzymatically inactive proteins that are converted into an active form by action of an activator. Regulation of blood coagulation is largely accomplished enzymatically by proteolytic inactivation of the pro-coagulation factors Va and VIIIa achieved by activated protein C (aPC) (Esmon, 1989).
Protein C is the precursor to aPC, a potent natural anticoagulant. Protein C is activated by thrombin in complex with thrombomodulin (TM). The activation is augmented by endothelial cell protein C receptor (EPCR). TM and EPCR can be down-regulated due to inflammatory mediators, such as tumor necrosis factor, reviewed by Esmon (1999). TM and EPCR have also been found to be reduced in some forms of septic shock, meningococcemia in particular. Since EPCR and TM are expressed on endothelium, it is not possible to directly determine how well they are functioning without removal of blood vessels.
aPC functions as an anticoagulant by proteolytically cleaving and downregulating pro-coagulant factors. aPC also serves important functions as an anti-apoptosis agent, an anti-inflammatory molecule and a cytoprotectant. Bleeding disorders where homeostatis is dysregulated through a loss of a key factor, such as the absence of Factor VIII in hemophilia, or in trauma patients where the wound process results in a temporary loss of hemostasis, can be treated by the removal of aPC. Such treatment, however, could result in unwanted detrimental consequences of removing the beneficial functions of aPC in addition to the removal of the anti-coagulant activity. Therefore it is desirable to have a therapeutic that selectively targets the anti-coagulant activity of aPC while leaving other functions of the molecule intact.
Thus, there is provided an antibody comprising (a) a heavy light chain comprising heavy light chain CDRs represented by SEQ ID NOS: 1, 2 and 3; and (b) a light heavy chain comprising light heavy chain CDRs represented by SEQ ID NOS: 4, 5 and 6. The antibody maybe a humanized antibody, and may have the following sequence composition:
| TABLE 1 |
| Antibody Sequences |
| FR1 | CDR1 | FR2 | CDR2 | FR3 | CDR3 | FR4 | |
| Light Chain | |||||||
| CDR | |||||||
| SEQ ID NO: | 1 | 2 | 3 | ||||
| Heavy Chain | |||||||
| CDR | |||||||
| SEQ ID NO: | 4 | 5 | 6 | ||||
| Light Chain | |||||||
| Framework | |||||||
| Residues* | 1-23 | 39- | 61- | 102- | |||
| 53 | 92 | 112 | |||||
| Heavy Chain | |||||||
| Framework | |||||||
| Residues** | 1-30 | 36- | 69- | 108- | |||
| 49 | 100 | 118 | |||||
| *Residues in reference to SEQ ID NO: 26 | |||||||
| **Residues in reference to SEQ ID NO: 16 | |||||||
The heavy chain framework regions may be represented by SEQ ID NOS: 7, 8, 9 and 10, amino acid residues 1 to 30, 36 to 49, 69 to 100, and 108 to 118 of SEQ ID NO: 16 or having 5 or fewer conservative amino acid substitutions thereto, and/or the light chain framework regions may be represented by SEQ ID NOS: 11, 12, 13 and 14 amino residues 1 to 23, 39 to 53, 61 to 92 and 102 to 112 of SEQ ID NO: 26, or having 5 or fewer conservative amino acid substitutions thereto. For example residue 14 49 of SEQ ID NO: 8 16 may be substituted with Ala, and/or residues 11, 13 and 31 of SEQ ID NO: 9 79, 81 and 99 of SEQ ID NO: 16 may be substituted with Serine, Valine and Isoleucine, respectively; and/or the heavy chain may comprise SEQ ID NOS: 16-24 NO: 16, 17, 18, 19, 20, 21 or 22. Also for example, residue 4 of SEQ ID NO: 11 26 may be substituted with Leucine; and/or residue 12 72 of SEQ ID NO: 13 26 may be substituted with Arginine; and/or the light chain comprises SEQ ID NOS: 26-30 NO: 26, 27, 28 or 29. The antibody may be a single-chain antibody or an antibody fragment, such as a Fab′, Fab, F(ab′)2, a single domain antibody, Fv, or scFv. Also provided is a pharmaceutical composition comprising any of the foregoing embodiments dispersed in a pharmaceutically acceptable carrier.
The disclosure also provides an expression construct, cell or cell line comprising a nucleic acid encoding an antibody comprising (a) a heavy light chain comprising heavy light chain CDRs represented by SEQ ID NOS: 1, 2 and 3; and (b) a light heavy chain comprising light heavy chain CDRs represented by SEQ ID NOS: 4, 5 and 6. The antibody may be a humanized antibody. The heavy chain framework regions may be represented by SEQ ID NOS: 7, 8, 9 and 10, amino acid residues 1 to 30, 36 to 49, 69 to 100, and 108 to 118 of SEQ ID NO: 16 or having 5 or fewer conservative amino acid substitutions thereto, and/or the light chain framework regions may be represented by SEQ ID NOS: 11, 12, 13 and 14, or having 5 or fewer conservative amino acid substitutions amino residues 1 to 23, 39 to 53, 61 to 92 and 102 to 112 of SEQ ID NO: 26. For example residue 14 49 of SEQ ID NO: 8 16 may be substituted with Ala, and/or residues 11, 13 and 31 of SEQ ID NO: 9 79, 81 and 99 of SEQ ID NO: 16 may be substituted with Serine, Valine and Isoleucine, respectively; and/or the heavy chain may comprise SEQ ID NOS: 16-24 NO: 16, 17, 18 , 19, 20, 21 or 22. Also for example, residue 4 of SEQ ID NO: 11 26 may be substituted with Leucine; and/or residue 12 72 of SEQ ID NO: 13 26 may be substituted with Arginine; and/or the light chain comprises SEQ ID NOS: 26-30 NO: 26, 27, 28 or 29. The antibody may be a single-chain antibody or an antibody fragment, such as a Fab′, Fab, F(ab′)2, a single domain antibody, Fv, or scFv.
Also provided is method of inhibiting activated protein C anticoagulant activity in a subject, comprising administering an effective amount of an antibody according to the description above.
Also provided is a method of inhibiting activated protein C amidolytic activity in a subject comprising administering an effective amount of an antibody according to the description above.
Also provided is a method of treating a subject in need of blood coagulation comprising administering an effective amount of an antibody according to the description above.
Also provided is a method of treating a subject suffering from sepsis comprising administering an effective amount of an antibody according to the description above. The method may further comprise administration of activated protein C.
Also provided is a method of treating a subject suffering from hemophilia comprising administering an effective amount of an antibody according to the description above.
Also provided is a method of modulating hemostasis in a subject, comprising administering an effective amount of an antibody according to the description above. The subject may be a trauma patient.
Also provided is a method of modulating thrombosis in a subject, comprising administering an effective amount of an antibody according to the description above.
Yet another embodiment includes a kit comprising an antibody according to the description above. The antibody may be labeled, such as with a fluorophore, a radiolabel, a chemiluminescent label, a dye, a quantum dot, a bead or a chromophore. The kit may further comprise a buffer or diluent, and/or instructions on the use of said antibody. The antibody may be present in an aqueous suspension, or be lyophilized.
It is contemplated that any embodiment discussed in this specification can be implemented with respect to any compound, method, or composition, and vice versa.
Other objects, features and advantages will become apparent from the following detailed description. It should be understood, however, that the detailed description and the specific examples, while indicating specific embodiments, are given by way of illustration only, since various changes and modifications within the spirit and scope will become apparent to those skilled in the art from this detailed description.
The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present disclosure. The disclosure may be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.
The present disclosure relates to the discovery of monoclonal antibodies that selectively bind to activated protein C, but not unactivated protein C, and specifically inhibit the anti-coagulation activity of activated protein C.
Whenever appropriate, terms used in the singular will also include the plural and vice versa. In the event that any definition set forth below conflicts with the usage of that word in any other document, including any document incorporated herein by reference, the definition set forth below shall always control for purposes of interpreting this specification and its associated claims unless a contrary meaning is clearly intended (for example in the document where the term is originally used). The use of “or” means “and/or” unless stated otherwise. The use of “a” herein means “one or more” unless stated otherwise or where the use of “one or more” is clearly inappropriate. The use of “comprise,” “comprises,” “comprising,” “include,” “includes,” and “including” are interchangeable and are not limiting. For example, the term “including” shall mean “including, but not limited to.”
The term “Protein C” or “PC” as used herein refers to any variant, isoform, and/or species homolog of Protein C in its zymogen form that is naturally expressed by cells and present in plasma and is distinct from the activated form of Protein C.
The term “activated Protein C” or “aPC” as used herein refers to an activated form of Protein C that is characterized by the removal and absence of a 12 amino acid activation peptide present in Protein C as a result of a thrombin cleavage site.
As used herein, an “antibody” refers to a whole antibody and any antigen binding fragment (i.e., “antigen-binding portion”) or single chain thereof. The term includes a full-length immunoglobulin molecule (e.g., an IgG antibody) that is naturally occurring or formed by normal immunoglobulin gene fragment recombinatorial processes, or an immunologically active portion of an immunoglobulin molecule, such as an antibody fragment, that retains the specific binding activity. Regardless of structure, an antibody fragment binds with the same antigen that is recognized by the full-length antibody. For example, an anti-aPC monoclonal antibody fragment binds to an epitope of aPC. The antigen-binding function of an antibody can be performed by fragments of a full-length antibody. Examples of binding fragments encompassed within the term “antigen-binding portion” of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab′)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; (vi) an isolated complementarity determining region (CDR); (vii) minibodies, diabodies, triabodies, tetrabodies, and kappa bodies (see, e.g., Ill et al., Protein Eng 1997; 10:949-57); (viii) camel IgG; and (ix) IgNAR. Furthermore, although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883). Such single chain antibodies are also intended to be encompassed within the term “antigen-binding portion” of an antibody. These antibody fragments are obtained using conventional techniques known to those with skill in the art, and the fragments are analyzed for utility in the same manner as are intact antibodies.
Furthermore, it is contemplated that an antigen binding fragment can be encompassed in an antibody mimetic. The term “antibody mimetic” or “mimetic” as used herein is meant a protein that exhibits binding similar to an antibody but is a smaller alternative antibody or a non-antibody protein. Such antibody mimetic can be comprised in a scaffold. The term “scaffold” refers to a polypeptide platform for the engineering of new products with tailored functions and characteristics.
As used herein, the term “anti-aPC antibody” refers to an antibody that specifically binds to an epitope of aPC. When bound in vivo to an epitope of aPC, the anti-aPC antibodies disclosed herein augment one or more aspects of the blood clotting cascade.
As used herein, the terms “inhibits binding” and “blocks binding” (e.g., referring to inhibition/blocking of binding of aPC substrate to aPC) are used interchangeably and encompass both partial and complete inhibition or blocking of a protein with its substrate, such as an inhibition or blocking by at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100%. As used herein, “about” means+/−10% of the numerical value indicated.
In reference to the inhibition and/or blocking of binding of aPC substrate to aPC, the terms inhibition and blocking also include any measurable decrease in the binding affinity of aPC to a physiological substrate when in contact with an anti-aPC antibody as compared to aPC not in contact with an anti-aPC antibody, e.g., the blocking of the interaction of aPC with its substrates, including Factor Va or with Factor VIIIa, by at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100%.
The terms “monoclonal antibody” or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition. A monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope. Accordingly, the term “human monoclonal antibody” refers to antibodies displaying a single binding specificity that have variable and constant regions derived from human germline immunoglobulin sequences. The human antibodies can include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
An “isolated antibody,” as used herein, is intended to refer to an antibody which is substantially free of other biological molecules, including antibodies having different antigenic specificities (e.g., an isolated antibody that binds to aPC is substantially free of antibodies that bind antigens other than aPC). In some embodiments, the isolated antibody is at least about 75%, about 80%, about 90%, about 95%, about 97%, about 99%, about 99.9% or about 100% pure by dry weight. In some embodiments, purity can be measured by a method such as column chromatography, polyacrylamide gel electrophoresis, or HPLC analysis. An isolated antibody that binds to an epitope, isoform or variant of human aPC can, however, have cross-reactivity to other related antigens, e.g., from other species (e.g., aPC species homologs). Moreover, an isolated antibody can be substantially free of other cellular material and/or chemicals. As used herein, “specific binding” refers to antibody binding to a predetermined antigen. Typically, an antibody that exhibits “specific binding” binds to an antigen with an affinity of at least about 105 M−1 and binds to that antigen with an affinity that is higher, for example at least two-fold greater, than its binding affinity for an irrelevant antigen (e.g., BSA, casein). The phrases “an antibody recognizing an antigen” and “an antibody specific for an antigen” are used interchangeably herein with the term “an antibody which binds specifically to an antigen.”
As used herein, the term “minimal binding” refers to an antibody that does not bind to and/or exhibits low affinity to a specified antigen. Typically, an antibody having minimal binding to an antigen binds to that antigen with an affinity that is lower than about 102 M−1 and does not bind to a predetermined antigen with higher affinity than it binds to an irrelevant antigen.
As used herein, the term “high affinity” for an antibody, such as an IgG antibody refers to a binding affinity of at least about 107M−1, in at least one embodiment at least about 108M−1, in some embodiments at least about 109M−1, 1010M−1, 1011M−1 or greater, e.g., up to 1013M−1 or greater. However, “high affinity” binding can vary for other antibody isotypes. For example, “high affinity” binding for an IgM isotype refers to a binding affinity of at least about 107M−1. As used herein, “isotype” refers to the antibody class (e.g., IgM or IgG1) that is encoded by heavy chain constant region genes.
“Complementarity-determining region” or “CDR” refers to one of three hypervariable regions within the variable region of the heavy chain or the variable region of the light chain of an antibody molecule that form the N-terminal antigen-binding surface that is complementary to the three-dimensional structure of the bound antigen. Proceeding from the N-terminus of a heavy or light chain, these complementarity-determining regions are denoted as “CDR1,” “CDR2,” and “CDR3,” respectively [Wu T T, Kabat E A, Bilofsky H, Proc Natl Acad Sci USA. 1975 December; 72(12):5107 and Wu T T, Kabat E A, J Exp Med. 1970 Aug. 1; 132(2):211]. CDRs are involved in antigen-antibody binding, and the CDR3 comprises a unique region specific for antigen-antibody binding. An antigen-binding site, therefore, can include six CDRs, comprising the CDR regions from each of a heavy and a light chain V region.
The term “epitope” refers to the area or region of an antigen to which an antibody specifically binds or interacts, which in some embodiments indicates where the antigen is in physical contact with the antibody. Conversely, the term “paratope” refers to the area or region of the antibody on which the antigen specifically binds. Epitopes characterized by competition binding are said to be overlapping if the binding of the corresponding antibodies are mutually exclusive, i.e., binding of one antibody excludes simultaneous binding of another antibody. The epitopes are said to be separate (unique) if the antigen is able to accommodate binding of both corresponding antibodies simultaneously.
The term “competing antibodies,” as used herein, refers to antibodies that bind to about, substantially or essentially the same, or even the same, epitope as an antibody against aPC as described herein. “Competing antibodies” include antibodies with overlapping epitope specificities. Competing antibodies are thus able to effectively compete with an antibody as described herein for binding to aPC. In some embodiments, the competing antibody can bind to the same epitope as the antibody described herein. Alternatively viewed, the competing antibody has the same epitope specificity as the antibody described herein.
As used herein, “conservative substitutions” refers to modifications of a polypeptide that involve the substitution of one or more amino acids for amino acids having similar biochemical properties that do not result in loss of a biological or biochemical function of the polypeptide. A “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), β-branched side chains (e.g., threonine, valine, isoleucine), and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Antibodies of the present disclosure can have one or more conservative amino acid substitutions yet retain antigen binding activity.
For nucleic acids and polypeptides, the term “substantial homology” indicates that two nucleic acids or two polypeptides, or designated sequences thereof, when optimally aligned and compared, are identical, with appropriate nucleotide or amino acid insertions or deletions, in at least about 80% of the nucleotides or amino acids, usually at least about 85%, in some embodiments about 90%, 91%, 92%, 93%, 94%, or 95%, in at least one embodiment at least about 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, or 99.5% of the nucleotides or amino acids. Alternatively, substantial homology for nucleic acids exists when the segments will hybridize under selective hybridization conditions to the complement of the strand. Also included are nucleic acid sequences and polypeptide sequences having substantial homology to the specific nucleic acid sequences and amino acid sequences recited herein.
The percent identity between two sequences is a function of the number of identical positions shared by the sequences (i.e., % homology=# of identical positions/total # of positions×100), taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, such as without limitation the AlignX™ module of VectorNTI™ (Invitrogen Corp., Carlsbad, Calif.). For AlignX™, the default parameters of multiple alignment are: gap opening penalty: 10; gap extension penalty: 0.05; gap separation penalty range: 8; % identity for alignment delay: 40. (further details found at the world-wide-web at invitrogen.com/site/us/en/home/LINNEA-Online-Guides/LINNEA-Communities/Vector-NTI-Community/Sequence-analysis-and-data-management-software-for-PCs/AlignX-Module-for-Vector-NTI-Advance.reg.us.html).
Another method for determining the best overall match between a query sequence (a sequence of the present disclosure) and a subject sequence, also referred to as a global sequence alignment, can be determined using the CLUSTALW computer program (Thompson et al., Nucleic Acids Res, 1994, 2(22): 4673-4680), which is based on the algorithm of Higgins et al., Computer Applications in the Biosciences (CABIOS), 1992, 8(2): 189-191). In a sequence alignment the query and subject sequences are both DNA sequences. The result of said global sequence alignment is in percent identity. Parameters that can be used in a CLUSTALW alignment of DNA sequences to calculate percent identity via pairwise alignments are: Matrix=IUB, k-tuple=1, Number of Top Diagonals=5, Gap Penalty=3, Gap Open Penalty=10, Gap Extension Penalty=0.1. For multiple alignments, the following CLUSTALW parameters can be used: Gap Opening Penalty=10, Gap Extension Parameter=0.05; Gap Separation Penalty Range=8; % Identity for Alignment Delay=40.
The nucleic acids can be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form. A nucleic acid is “isolated” or “rendered substantially pure” when purified away from other cellular components with which it is normally associated in the natural environment. To isolate a nucleic acid, standard techniques such as the following can be used: alkaline/SDS treatment, CsCl banding, column chromatography, agarose gel electrophoresis and others well known in the art.
A. Activated Protein C
Protein C is activated by thrombin complexed with thrombomodulin on endothelium. Unlike the few-second transient life of active thrombin in vivo, human aPC has about a 20 minute half-life in circulation after its generation (Berg, et al., 2003). Therefore, one can feasibly measure a level of aPC in plasma to study its regulation under various pathophysical conditions.
B. Antibodies to aPC
Previously, a murine antibody HAPC1573 was developed which enhanced FL-aPC binding on the endothelial cells. HAPC1573 facilitated aPC internalization on endothelium through the interaction of Gla domain of aPC and EPCR on the cells, and this internalization could be blocked by either EPCR blocking Ab or Gla domain blocking Ab (HPC1575). HAPC1573 also dramatically altered the kinetic parameters of aPC toward its chromogenic substrate, Spectrozyme PCa. This profound change of aPC toward small peptide substrate in the presence of HAPC1573 indicated that this mAb recognized an epitope near active site of aPC and the interaction of Ab and antigen dramatically increased the affinity of APC toward small peptide substrate but decreased the off rate of product from aPC catalytic site. HAPC1573 also almost completely diminished the prolongation effect of aPC in factor Xa initiated one-stage plasma clotting assay, suggesting that the interaction of HAPC1573 and aPC prevents aPC from cleaving factor Va. Surprisingly, HAPC1573 did not inhibit but actually enhanced aPC cleaving histone H3 and H4. Consistently, HAPC1573 did not inhibit but slightly enhanced aPC cytoprotection activity on endothelium against histone H3 and H4. Finally, their results show that HAPC1573, recognizes aPC, but not Protein C. See U.S. Pat. No. 8,153,766.
Recent studies have shown that anticoagulant activity of aPC is dispensable for its cytoprotective function, but aPC cleavage activity toward PAR1 might be essential for its anti-apoptotic effect (Mosnier et al., 2004). However, the cytoprotection effect of aPC has been shown not only in endothelial cells which express EPCR, but also on other cells such as neuron and keratinocytes which do not express EPCR on their cell surfaces (Guo et al., 2004; Berg et al., 2003), indicating other mechanisms than PAR1 mediated aPC signaling might exist.
C. Applications of the Technology
The ability to distinguish between Protein C and aPC demonstrates the utility of antibodies in a convenient ELISA method for measuring aPC level in plasma in vivo. Typically, it takes less than 4 hours to measure a plasma sample containing 1 ng/ml APC with this method compared to 19 hours or even weeks with enzyme capture assays (Gruber and Griffen, 1992; Liaw et al., 2003).
Also, as discussed above, HAPC1573 altered aPC cleavage activity toward a chromogenic peptide substrate and also blocked aPC anticoagulant activity in a plasma clotting assay, suggesting this mAb recognizes an epitope near the aPC active site and alters its catalytic activity upon antibody-antigen binding. At the same time, HAPC1573 actually enhanced aPC cleaving extracellular histones, and enhanced APC cytoprotection activity on endothelium against histones. This indicates that APC anticoagulant activity for cleaving activated factor V and VIII is not required for its cytoprotection activity by cleaving extracellular histones. Cleaving extracellular histones independent from its anticoagulant activity might be one of the molecular mechanisms of aPC regulation inflammation and cytoprotection.
Thus, such antibodies against aPC can, for example, be used in treatment of hemophilia A patients. aPC cleaves both factor VIIIa and factor Va and thus negatively affects blood clotting. In hemophilia A patients, factor VIII levels are low and the inactivation of factor Va by aPC is probably a major pathway to regulate hemostasis and thrombosis in these patients. Recent clinical reports demonstrated factor V Leiden mutant which is resistant to aPC cleavage was beneficial to hemophilia A patients regarding their bleeding symptom (van't Zant et al., 1997). Blocking aPC anticoagulant activity toward factor Va in vivo with an antibody is an alternative approach for hemophilia A treatments, especially for those patients who have high level factor VIII inhibitors so that the factor VIII replacement therapy would not be very effective.
In other embodiments, another possible clinical application for antibodies against aPC is in the treatment of trauma patients wherein homeostasis is disrupted, excessive bleeding is likely, and surgical intervention is delayed to regain homeostatis. Treatment with antibodies can selectively restore the pro-coagulant state without eliminating the cytoprotective or anti-inflammatory activities of APC.
Yet another clinical application of antibodies against aPC is in combination with aPC in sepsis treatment. Its bleeding side effect in patients is due to aPC anticoagulant activity. Because HAPC1573 blocked aPC anticoagulant activity while maintaining, and even enhancing, aPC cytoprotective effect, the mAb-aPC complex can be a better therapeutic than aPC alone regarding its bleeding side effect.
Antibodies comprise a large family of glycoproteins with common structural features. An antibody is comprised of four polypeptides that form a three dimensional structure. Typically, an antibody is comprised of two different polypeptides, the heavy chain and the light chain. An antibody molecule is comprised of one or more of these units, each unit comprising two heavy chains and two light chains. An antibody molecule typically consists of three functional domains: the Fc, Fab, and antigen-binding site.
There are five different types of heavy chain polypeptides designated as α, δ, ε, γ, and μ. There are two different types of light chain polypeptides designated κ and λ. An antibody typically contains only one type of heavy chain and only one type of light chain, although any light chain can associate with any heavy chain.
The carboxyl terminal of each heavy chain polypeptide is known as the constant (Fc) region. The amino terminal of each heavy and light chain polypeptide is known as the variable (V) region. Within the variable regions of the chains are hypervariable regions known as complementarity determining regions (CDRs). The variable regions of one heavy chain and one light chain associate to form an antigen-binding site. Each heavy chain and each light chain includes three CDRs. The six CDRs of an antigen-binding site define the amino acid residues that form the actual binding site for the antigen. CDR variability accounts for the diversity of antigen recognition.
Antibodies against aPC may be defined by sequences set forth in the following table:
| TABLE 1 |
| Antibody Sequences |
| FR1 | CDR1 | FR2 | CDR2 | FR3 | CDR3 | FR4 | |
| Light Chain | |||||||
| CDR | |||||||
| SEQ ID NO: | 1 | 2 | 3 | ||||
| Heavy Chain | |||||||
| CDR | |||||||
| SEQ ID NO: | 4 | 5 | 6 | ||||
| Light Chain | |||||||
| Framework | |||||||
| Residues* | 1- | 39- | 61- | 102- | |||
| 23 | 53 | 92 | 112 | ||||
| Heavy Chain | |||||||
| Framework | |||||||
| Residues** | 1- | 36- | 69- | 108- | |||
| 30 | 49 | 100 | 118 | ||||
| *Residues in reference to SEQ ID NO: 26 | |||||||
| **Residues in reference to SEQ ID NO: 16 | |||||||
A. Antibody Fragments
Thus, in one embodiment, such molecules will comprise fragments (such as (F(ab′), F(ab′)2) that are produced, for example, by the proteolytic cleavage of the mAbs, or single-chain immunoglobulins producible, for example, via recombinant means. Such antibody derivatives are monovalent. In one embodiment, such fragments can be combined with one another, or with other antibody fragments or receptor ligands to form “chimeric” binding molecules. Significantly, such chimeric molecules can contain substituents capable of binding to different epitopes of the same molecule, or they can be capable of binding to an activated protein C epitope and a “non-activated protein C” epitope.
A single-chain variable fragment (scFv) is another form of antibody fragment. It comprises a fusion of the variable regions of the heavy and light chains of immunoglobulins, linked together with a short (usually serine, glycine) linker. This chimeric molecule retains the specificity of the original immunoglobulin, despite removal of the constant regions and the introduction of a linker peptide. These molecules were created historically to facilitate phage display where it is highly convenient to express the antigen binding domain as a single peptide. Alternatively, scFv can be created directly from subcloned heavy and light chains derived from a hybridoma. Single chain variable fragments lack the constant Fc region found in complete antibody molecules, and thus, the common binding sites (e.g., protein A/G) used to purify antibodies. These fragments can often be purified/immobilized using Protein L since Protein L interacts with the variable region of kappa light chains.
Flexible linkers generally are comprised of helix- and turn-promoting amino acid residues such as alaine, serine and glycine. However, other residues can function as well. Tang et al. (1996) used phage display as a means of rapidly selecting tailored linkers for single-chain antibodies (scFvs) from protein linker libraries. A random linker library was constructed in which the genes for the heavy and light chain variable domains were linked by a segment encoding an 18-amino acid polypeptide of variable composition. The scFv repertoire (approx. 5×106 different members) was displayed on filamentous phage and subjected to affinity selection with hapten. The population of selected variants exhibited significant increases in binding activity but retained considerable sequence diversity. Screening 1054 individual variants subsequently yielded a catalytically active scFv that was produced efficiently in soluble form. Sequence analysis revealed a conserved proline in the linker two residues after the VH C terminus and an abundance of arginines and prolines at other positions as the only common features of the selected tethers.
The recombinant antibodies against aPC can also involve sequences or moieties that permit dimerization or multimerization of the receptors. Such sequences include those derived from IgA, which permit formation of multimers in conjunction with the J chain. Another multimerization domain is the Gal4 dimerization domain. In other embodiments, the chains can be modified with agents such as biotin/avidin, which permit the combination of two antibodies.
In a separate embodiment, a single-chain antibody can be created by joining receptor light and heavy chains using a non-peptide linker or chemical unit. Generally, the light and heavy chains will be produced in distinct cells, purified, and subsequently linked together in an appropriate fashion (i.e., the N-terminus of the heavy chain being attached to the C-terminus of the light chain via an appropriate chemical bridge).
Cross-linking reagents are used to form molecular bridges that tie functional groups of two different molecules, e.g., a stabilizing and coagulating agent. However, it is contemplated that dimers or multimers of the same analog or heteromeric complexes comprised of different analogs can be created. To link two different compounds in a step-wise manner, heterobifunctional cross-linkers can be used that eliminate unwanted homopolymer formation. An exemplary hetero-bifunctional cross-linker contains two reactive groups: one reacting with primary amine group (e.g., N-hydroxy succinimide) and the other reacting with a thiol group (e.g., pyridyl disulfide, maleimides, halogens, etc.). Through the primary amine reactive group, the cross-linker can react with the lysine residue(s) of one protein (e.g., the selected antibody or fragment) and through the thiol reactive group, the cross-linker, already tied up to the first protein, reacts with the cysteine residue (free sulfhydryl group) of the other protein (e.g., the selective agent).
A cross-linker having reasonable stability in blood can be employed. Numerous types of disulfide-bond containing linkers are known that can be successfully employed to conjugate targeting and therapeutic/preventative agents. Linkers that contain a disulfide bond that is sterically hindered can prove to give greater stability in vivo, preventing release of the targeting peptide prior to reaching the site of action. These linkers are thus one group of linking agents.
Another cross-linking reagent is SMPT, which is a bifunctional cross-linker containing a disulfide bond that is “sterically hindered” by an adjacent benzene ring and methyl groups. It is believed that steric hindrance of the disulfide bond serves a function of protecting the bond from attack by thiolate anions such as glutathione which can be present in tissues and blood, and thereby help in preventing decoupling of the conjugate prior to the delivery of the attached agent to the target site. The SMPT cross-linking reagent, as with many other known cross-linking reagents, lends the ability to cross-link functional groups such as the SH of cysteine or primary amines (e.g., the epsilon amino group of lysine). Another possible type of cross-linker includes the heterobifunctional photoreactive phenylazides containing a cleavable disulfide bond such as sulfosuccinimidyl-2-(p-azido salicylamido)ethyl-1,3′-dithiopropionate. The N-hydroxysuccinimidyl group reacts with primary amino groups and the phenylazide (upon photolysis) reacts non-selectively with any amino acid residue.
In addition to hindered cross-linkers, non-hindered linkers also can be employed in accordance herewith. Other useful cross-linkers, not considered to contain or generate a protected disulfide, include SATA, SPDP and 2-iminothiolane (Wawrzynczak & Thorpe, 1987). The use of such cross-linkers is well understood in the art. Another embodiment involves the use of flexible linkers. U.S. Pat. No. 4,680,338, describes bifunctional linkers useful for producing conjugates of ligands with amine-containing polymers and/or proteins, especially for forming antibody conjugates with chelators, drugs, enzymes, detectable labels and the like. U.S. Pat. Nos. 5,141,648 and 5,563,250 disclose cleavable conjugates containing a labile bond that is cleavable under a variety of mild conditions. This linker is particularly useful in that the agent of interest can be bonded directly to the linker, with cleavage resulting in release of the active agent. Particular uses include adding a free amino or free sulfhydryl group to a protein, such as an antibody, or a drug.
U.S. Pat. No. 5,856,456 provides peptide linkers for use in connecting polypeptide constituents to make fusion proteins, e.g., single chain antibodies. The linker is up to about 50 amino acids in length, contains at 5 least one occurrence of a charged amino acid (e.g., arginine or lysine) followed by a proline, and is characterized by greater stability and reduced aggregation. U.S. Pat. No. 5,880,270 discloses aminooxy-containing linkers useful in a variety of immunodiagnostic and separative techniques.
B. Antibody Conjugates
Further provided are antibody conjugates. For both diagnostic and therapeutic purposes, one can link or covalently bind or complex an agent to an antibody. Such a molecule or moiety can be, but is not limited to, at least one effector or reporter molecule. A reporter molecule is defined as any moiety which can be detected using an assay. Non-limiting examples of reporter molecules which have been conjugated to antibodies include enzymes, radiolabels, haptens, fluorescent labels, phosphorescent molecules, chemiluminescent molecules, chromophores, luminescent molecules, photoaffinity molecules, colored particles or ligands, such as biotin.
Certain examples of antibody conjugates are those conjugates in which the antibody is linked to a detectable label. “Detectable labels” are compounds and/or elements that can be detected due to their specific functional properties, and/or chemical characteristics, the use of which allows the antibody to which they are attached to be detected, and/or further quantified if desired. Another such example is the formation of a conjugate comprising an antibody linked to a cytotoxic or anti cellular agent, and can be termed “immunotoxins.”
Antibody conjugates are used as diagnostic agents. Antibody diagnostics generally fall within two classes, those for use in in vitro diagnostics, such as in a variety of immunoassays, and/or those for use in vivo diagnostic protocols, generally known as “antibody-directed imaging.”
Many appropriate imaging agents are known in the art, as are methods for their attachment to antibodies (see, for e.g., U.S. Pat. Nos. 5,021,236; 4,938,948; and 4,472,509, each incorporated herein by reference). The imaging moieties used can be paramagnetic ions; radioactive isotopes; fluorochromes; NMR-detectable substances; X-ray imaging.
In the case of paramagnetic ions, one might mention by way of example ions such as chromium (III), manganese (II), iron (III), iron (II), cobalt (II), nickel (II), copper (II), neodymium (III), samarium (III), ytterbium (III), gadolinium (III), vanadium (II), terbium (III), dysprosium (III), holmium (III) and/or erbium (III). Ions useful in other contexts, such as X-ray imaging, include but are not limited to lanthanum (III), gold (III), lead (II), and especially bismuth (III).
In the case of radioactive isotopes for therapeutic and/or diagnostic application, one might mention astatine211, 14car- bon, 51chromium, 36chlorine, 57cobalt, 58cobalt, copper67, 152Eu, gallium67, 3hydrogen, iodine 123, iodine125, iodine 131, indium111, 59iron, 32phosphorus, rhenium186, rhenium188, 75selenium, 35sulphur, technicium99m and/or yttrium90. 125I is often being commonly used in certain embodiments, and technicium99m and/or indium111 are also often used due to their low energy and suitability for long range detection. Radioactively labeled monoclonal antibodies can be produced according to well-known methods in the art. For instance, monoclonal antibodies can be iodinated by contact with sodium and/or potassium iodide and a chemical oxidizing agent such as sodium hypochlorite, or an enzymatic oxidizing agent, such as lactoperoxidase. Monoclonal antibodies can be labeled with technetium99m by ligand exchange process, for example, by reducing pertechnate with stannous solution, chelating the reduced technetium onto a Sephadex column and applying the antibody to this column. Alternatively, direct labeling techniques can be used, e.g., by incubating pertechnate, a reducing agent such as SNCl2, a buffer solution such as sodium-potassium phthalate solution, and the antibody. Intermediary functional groups which are often used to bind radioisotopes which exist as metallic ions to antibody are diethylenetriaminepentaacetic acid (DTPA) or ethylene diaminetetracetic acid (EDTA).
Among the fluorescent labels contemplated for use as conjugates include Alexa 350, Alexa 430, AMCA, BODIPY 630/650, BODIPY 650/665, BODIPY-FL, BODIPY-R6G, BODIPY-TMR, BODIPY-TRX, Cascade Blue, Cy3, Cy5,6-FAM, Fluorescein Isothiocyanate, HEX, 6-JOE, Oregon Green 488, Oregon Green 500, Oregon Green 514, Pacific Blue, REG, Rhodamine Green, Rhodamine Red, Renographin, ROX, TAMRA, TET, Tetramethylrhodamine, and/or Texas Red.
Another type of antibody conjugates contemplated are those intended primarily for use in vitro, where the antibody is linked to a secondary binding ligand and/or to an enzyme (an enzyme tag) that will generate a colored product upon contact with a chromogenic substrate. Examples of suitable enzymes include urease, alkaline phosphatase, (horseradish) hydrogen peroxidase or glucose oxidase. Secondary binding ligands are biotin and/or avidin and streptavidin compounds. The use of such labels is well known to those of skill in the art and are described, for example, in U.S. Pat. Nos. 3,817,837; 3,850,752; 3,939,350; 3,996,345; 4,277,437; 4,275,149 and 4,366,241; each incorporated herein by reference.
Yet another known method of site-specific attachment of molecules to antibodies comprises the reaction of antibodies with hapten-based affinity labels. Essentially, hapten-based affinity labels react with amino acids in the antigen binding site, thereby destroying this site and blocking specific antigen reaction. However, this can not be advantageous since it results in loss of antigen binding by the antibody conjugate.
Molecules containing azido groups can also be used to form covalent bonds to proteins through reactive nitrene intermediates that are generated by low intensity ultraviolet light (Potter & Haley, 1983). In particular, 2- and 8-azido analogues of purine nucleotides have been used as site-directed photoprobes to identify nucleotide binding proteins in crude cell extracts (Owens & Haley, 1987; Atherton et al., 1985). The 2- and 8-azido nucleotides have also been used to map nucleotide binding domains of purified proteins (Khatoon et al., 1989; King et al., 1989; and Dholakia et al., 1989) and can be used as antibody binding agents.
Several methods are known in the art for the attachment or conjugation of an antibody to its conjugate moiety. Some attachment methods involve the use of a metal chelate complex employing, for example, an organic chelating agent such as described in U.S. Pat. Nos. 4,472,509 and 4,938,948, each incorporated herein by reference). Monoclonal antibodies can also be reacted with an enzyme in the presence of a coupling agent such as glutaraldehyde or periodate. Conjugates with fluorescein markers are prepared in the presence of these coupling agents or by reaction with an isothiocyanate. In U.S. Pat. No. 4,938,948, imaging of breast tumors is achieved using monoclonal antibodies and the detectable imaging moieties are bound to the antibody using linkers such as methyl-p-hydroxybenzimidate or N-succinimidyl-3-(4-hydroxyphenyl)propionate.
In other embodiments, derivatization of immunoglobulins by selectively introducing sulfhydryl groups in the Fc region of an immunoglobulin, using reaction conditions that do not alter the antibody combining site are contemplated. Antibody conjugates produced according to this methodology are disclosed to exhibit improved longevity, specificity and sensitivity (U.S. Pat. No. 5,196,066, incorporated herein by reference). Site-specific attachment of effector or reporter molecules, wherein the reporter or effector molecule is conjugated to a carbohydrate residue in the Fc region have also been disclosed in the literature (O'Shannessy et al., 1987). This approach has been reported to produce diagnostically and therapeutically promising antibodies which are currently in clinical evaluation.
In another embodiment, one may choose to modify the immunoglobulins to improve their stability and half-life in vivo. PEGylation is one such process that involves covalent attachment of polyethylene glycol (PEG) polymer chains to the antibody. PEGylation is routinely achieved by incubation of a reactive derivative of PEG with the target molecule. The covalent attachment of PEG can “mask” the antibody from the host's immune system (reduced immunogenicity and antigenicity), and increase the hydrodynamic size (size in solution) of the agent which prolongs its circulatory time by reducing renal clearance. PEGylation can also provide water solubility. Other polymers used to modify antibodies include polyethyleneimine and polylysine, often linked through succinic acid groups.
C. Immunodetection Methods
In still further embodiments, also provided are immunodetection methods for binding, purifying, removing, quantifying and/or otherwise generally detecting biological components using antibodies that react immunologically with such components. Some immunodetection methods include enzyme linked immunosorbent assay (ELISA), radioimmunoassay (RIA), immunoradiometric assay, fluoroimmunoassay, chemiluminescent assay, bioluminescent assay, and Western blot to mention a few. The steps of various useful immunodetection methods have been described in the scientific literature, such as, e.g., Doolittle and Ben-Zeev (1999); Gulbis and Galand (1993); De Jager et al. (1993); and Nakamura et al. (1987), each incorporated herein by reference.
In general, the immunobinding methods include obtaining a sample containing a target of interest, and contacting the sample with a first antibody that reacts immunologically with the target under conditions effective to allow the formation of immunocomplexes. The binding of the antibody to the target can then be assessed using a variety of different formats.
In one format, the antibody can be linked to a solid support, such as in the form of a column matrix, and the sample suspected of containing the target will be applied to the immobilized antibody. The unwanted components will be washed from the column, leaving the target immunocomplexed to the immobilized antibody to be eluted.
The immunobinding methods also include methods for detecting and quantifying the amount of an target in a sample and the detection and quantification of any immune complexes formed during the binding process. Here, one would obtain a sample suspected of containing a target, and contact the sample with an antibody against the target, and then detect and quantify the amount of immune complexes formed under the specific conditions.
In terms of antigen detection, the biological sample analyzed can be any sample that is suspected of containing a target, such as, for example, a body fluid like blood, serum, plasma, mucous, urine, saliva, tears or semen. Alternatively, a tissue can be used. Contacting the chosen biological sample with the antibody under effective conditions and for a period of time sufficient to allow the formation of immune complexes (primary immune complexes) is generally a matter of simply adding the antibody composition to the sample and incubating the mixture for a period of time long enough for the antibodies to form immune complexes with, i.e., to bind to targets that react immunologically with antibodies present. After this time, the sample-antibody composition, such as a tissue section, ELISA plate, dot blot or western blot, will generally be washed to remove any non-specifically bound species, allowing only those molecules specifically bound within the primary immune complexes to be detected.
In general, the detection of immunocomplex formation is well known in the art and can be achieved through the application of numerous approaches. These methods are generally based upon the detection of a label or marker, such as any of those radioactive, fluorescent, biological and enzymatic tags. U.S. Patents concerning the use of such labels include U.S. Pat. Nos. 3,817,837; 3,850,752; 3,939,350; 3,996,345; 4,277,437; 4,275,149 and 4,366,241, each incorporated herein by reference. Of course, one can find additional advantages through the use of a secondary binding ligand such as a second antibody and/or a biotin/avidin ligand binding arrangement, as is known in the art.
The antibody employed in the detection can itself be linked to a detectable label, wherein one would then simply detect this label, thereby allowing the amount of the primary immune complexes in the composition to be determined. Alternatively, the first antibody that becomes bound within the primary immune complexes can be detected by means of a second binding ligand that has binding affinity for the antibody. In these cases, the second binding ligand can be linked to a detectable label. The second binding ligand is itself often an antibody, which can thus be termed a “secondary” antibody. The primary immune complexes are contacted with the labeled, secondary binding ligand, or antibody, under effective conditions and for a period of time sufficient to allow the formation of secondary immune complexes. The secondary immune complexes are then generally washed to remove any non-specifically bound labeled secondary antibodies or ligands, and the remaining label in the secondary immune complexes is then detected.
Further methods include the detection of primary immune complexes by a two step approach. A second binding ligand, such as an antibody, that has binding affinity for the antibody is used to form secondary immune complexes, as described above. After washing, the secondary immune complexes are contacted with a third binding ligand or antibody that has binding affinity for the second antibody, again under effective conditions and for a period of time sufficient to allow the formation of immune complexes (tertiary immune complexes). The third ligand or antibody is linked to a detectable label, allowing detection of the tertiary immune complexes thus formed. This system can provide for signal amplification if this is desired.
One method of immunodetection designed by Charles Cantor uses two different antibodies. A first step biotinylated, monoclonal or polyclonal antibody is used to detect the target antigen(s), and a second step antibody is then used to detect the biotin attached to the complexed biotin. In that method the sample to be tested is first incubated in a solution containing the first step antibody. If the target antigen is present, some of the antibody binds to the antigen to form a biotinylated antibody/antigen complex. The antibody/antigen complex is then amplified by incubation in successive solutions of streptavidin (or avidin), biotinylated DNA, and/or complementary biotinylated DNA, with each step adding additional biotin sites to the antibody/antigen complex. The amplification steps are repeated until a suitable level of amplification is achieved, at which point the sample is incubated in a solution containing the second step antibody against biotin. This second step antibody is labeled, as for example with an enzyme that can be used to detect the presence of the antibody/antigen complex by histoenzymology using a chromogen substrate. With suitable amplification, a conjugate can be produced which is macroscopically visible.
Another known method of immunodetection takes advantage of the immuno-PCR (Polymerase Chain Reaction) methodology. The PCR method is similar to the Cantor method up to the incubation with biotinylated DNA, however, instead of using multiple rounds of streptavidin and biotinylated DNA incubation, the DNA/biotin/streptavidin/antibody complex is washed out with a low pH or high salt buffer that releases the antibody. The resulting wash solution is then used to carry out a PCR reaction with suitable primers with appropriate controls. At least in theory, the enormous amplification capability and specificity of PCR can be utilized to detect a single antigen molecule.
Another ELISA in which the antigens are immobilized, involves the use of antibody competition in the detection. In this ELISA, labeled antibodies against an antigen are added to the wells, allowed to bind, and/or detected by means of their label. The amount of an antigen in an unknown sample is then determined by mixing the sample with the labeled antibodies against the antigen during incubation with coated wells. The presence of an antigen in the sample acts to reduce the amount of antibody against the antigen available for binding to the well and thus reduces the ultimate signal. This is also appropriate for detecting antibodies against an antigen in an unknown sample, where the unlabeled antibodies bind to the antigen-coated wells and also reduces the amount of antigen available to bind the labeled antibodies.
As detailed above, immunoassays, in their most simple and/or direct sense, are binding assays. Certain immunoassays are the various types of enzyme linked immunosorbent assays (ELISAs) and/or radioimmunoassays (RIA) known in the art. Immunohistochemical detection using tissue sections is also particularly useful. However, it will be readily appreciated that detection is not limited to such techniques, and/or western blotting, dot blotting, FACS analyses, and/or the like can also be used. Irrespective of the format employed, ELISAs have certain features in common, such as coating, incubating and binding, washing to remove non-specifically bound species, and detecting the bound immune complexes. These are described below.
In coating a plate with either antigen or antibody, one will generally incubate the wells of the plate with a solution of the antigen or antibody, either overnight or for a specified period of hours. The wells of the plate will then be washed to remove incompletely adsorbed material. Any remaining available surfaces of the wells are then “coated” with a non-specific protein that is antigenically neutral with regard to the test antisera. These include bovine serum albumin (BSA), casein or solutions of milk powder. The coating allows for blocking of nonspecific adsorption sites on the immobilizing surface and thus reduces the background caused by nonspecific binding of antisera onto the surface.
In ELISAs, it is probably more customary to use a secondary or tertiary detection means rather than a direct procedure. Thus, after binding of a protein or antibody to the well, coating with a non-reactive material to reduce background, and washing to remove unbound material, the immobilizing surface is contacted with the biological sample to be tested under conditions effective to allow immune complex (antigen/antibody) formation. Detection of the immune complex then requires a labeled secondary binding ligand or antibody, and a secondary binding ligand or antibody in conjunction with a labeled tertiary antibody or a third binding ligand.
“Under conditions effective to allow immune complex (antigen/antibody) formation” means that the conditions can include diluting the antigens and/or antibodies with solutions such as BSA, bovine gamma globulin (BGG) or phosphate buffered saline (PBS)/Tween. These added agents also tend to assist in the reduction of nonspecific background.
The “suitable” conditions also mean that the incubation is at a temperature or for a period of time sufficient to allow effective binding. Incubation steps are typically from about 1 to 2 to 4 hours or so, at temperatures on the order of 25° C. to 27° C., or can be overnight at about 4° C. or so.
D. Purification
In certain embodiments, the antibodies against aPC can be purified. The term “purified,” as used herein, is intended to refer to a composition, isolatable from other components, wherein the protein is purified to any degree relative to its naturally-obtainable state. A purified protein therefore also refers to a protein, free from the environment in which it can naturally occur. Where the term “substantially purified” is used, this designation will refer to a composition in which the protein or peptide forms the major component of the composition, such as constituting about 50%, about 60%, about 70%, about 80%, about 90%, about 95% or more of the proteins in the composition.
Protein purification techniques are well known to those of skill in the art. These techniques involve, at one level, the crude fractionation of the cellular milieu to polypeptide and non-polypeptide fractions. Having separated the polypeptide from other proteins, the polypeptide of interest can be further purified using chromatographic and electrophoretic techniques to achieve partial or complete purification (or purification to homogeneity).
Analytical methods particularly suited to the preparation of a pure peptide are ion-exchange chromatography, exclusion chromatography; polyacrylamide gel electrophoresis; isoelectric focusing. Other methods for protein purification include, precipitation with ammonium sulfate, PEG, antibodies and the like or by heat denaturation, followed by centrifugation; gel filtration, reverse phase, hydroxylapatite and affinity chromatography; and combinations of such and other techniques.
In purifying an antibody against aPC, it can be desirable to express the polypeptide in a prokaryotic or eukaryotic expression system and extract the protein using denaturing conditions. The polypeptide can be purified from other cellular components using an affinity column, which binds to a tagged portion of the polypeptide. As is generally known in the art, it is believed that the order of conducting the various purification steps can be changed, or that certain steps can be omitted, and still result in a suitable method for the preparation of a substantially purified protein or peptide.
Commonly, complete antibodies are fractionated utilizing agents (i.e., protein A) that bind the Fc portion of the antibody. Alternatively, antigens can be used to simultaneously purify and select appropriate antibodies. Such methods often utilize the selection agent bound to a support, such as a column, filter or bead. The antibodies is bound to a support, contaminants removed, and the antibodies released by applying conditions (salt, heat, etc.).
Various methods for quantifying the degree of purification of the protein or peptide will be known to those of skill in the art in light of the present disclosure. These include, for example, determining the specific activity of an active fraction, or assessing the amount of polypeptides within a fraction by SDS/PAGE analysis. Another method for assessing the purity of a fraction is to calculate the specific activity of the fraction, to compare it to the specific activity of the initial extract, and to thus calculate the degree of purity. The actual units used to represent the amount of activity will, of course, be dependent upon the particular assay technique chosen to follow the purification and whether or not the expressed protein or peptide exhibits a detectable activity.
It is known that the migration of a polypeptide can vary, sometimes significantly, with different conditions of SDS/PAGE (Capaldi et al., 1977). It will therefore be appreciated that under differing electrophoresis conditions, the apparent molecular weights of purified or partially purified expression products can vary.
A. Compositions
Pharmaceutical compositions can comprise an effective amount of one or more antibodies, therapeutic agents or additional agent dissolved or dispersed in a pharmaceutically acceptable carrier. Aqueous compositions comprise an effective amount of the antibody, dissolved or dispersed in a pharmaceutically acceptable carrier or aqueous medium. The phrases “pharmaceutically or pharmacologically acceptable” refer to molecular entities and compositions that do not produce an adverse, allergic or other untoward reaction when administered to an animal, or a human, as appropriate.
As used herein, “pharmaceutically acceptable carrier” includes any and all solvents, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g., antibacterial agents, antifungal agents), isotonic agents, absorption delaying agents, salts, preservatives, drugs, drug stabilizers, gels, binders, excipients, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, such like materials and combinations thereof, as would be known to one of ordinary skill in the art (see, for example, Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, pp. 1289-1329, incorporated herein by reference). The use of such media and agents for pharmaceutical active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in the therapeutic compositions is contemplated. Supplementary active ingredients can also be incorporated into the compositions. For human administration, preparations should meet sterility, pyrogenicity, general safety and purity standards as required by FDA Office of Biologic Standards.
The biological material should be extensively dialyzed to remove undesired small molecular weight molecules and/or lyophilized for more ready formulation into a desired vehicle, where appropriate. The active compounds will then generally be formulated for parenteral administration, e.g., formulated for injection via the intravenous, intramuscular, sub-cutaneous, intranasal, or intraperitoneal routes. Typically, such compositions can be prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for using to prepare solutions or suspensions upon the addition of a liquid prior to injection can also be prepared; and the preparations can also be emulsified.
The pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions; formulations including sesame oil, peanut oil or aqueous propylene glycol; and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. In all cases the form must be sterile and must be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
Solutions of the active compounds as free base or pharmacologically acceptable salts can be prepared in water suitably mixed with a surfactant, such as hydroxypropylcellulose. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
The antibodies against aPC can be formulated into a composition in a free base, in a neutral or salt form. Pharmaceutically acceptable salts, include the acid addition salts (formed with the free amino groups of the protein) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, histidine, procaine and the like.
The carrier can also be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetable oils. The proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. The prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like. In many cases, isotonic agents can be included, for example, sugars or sodium chloride. Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.
Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with various of the other ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof. The preparation of more, or highly, concentrated solutions for direct injection is also contemplated, where the use of DMSO as solvent is envisioned to result in extremely rapid penetration, delivering high concentrations of the active agents to a small area.
Upon formulation, solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective. The formulations are easily administered in a variety of dosage forms, such as the type of injectable solutions described above, but drug release capsules and the like can also be employed.
For parenteral administration in an aqueous solution, for example, the solution should be suitably buffered if necessary and the liquid diluent first rendered isotonic with sufficient saline or glucose. These particular aqueous solutions are especially suitable for intravenous, intramuscular, subcutaneous, intranasal, and intraperitoneal administration. In this connection, sterile aqueous media which can be employed will be known to those of skill in the art in light of the present disclosure. For example, one dosage could be dissolved in 1 ml of isotonic NaCl solution and either added to 1000 ml of hypodermoclysis fluid or injected at the proposed site of infusion, (see for example, “Remington's Pharmaceutical Sciences” 15th Edition, pages 1035-1038 and 1570-1580). Some variation in dosage will necessarily occur depending on the condition of the subject being treated. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject.
In addition to the compounds formulated for parenteral administration, such as intravenous or intramuscular injection, other pharmaceutically acceptable forms include, e.g., tablets or other solids for oral administration; liposomal formulations; time release capsules; and any other form currently used, including cremes.
In certain embodiments, the use of liposomes and/or nanoparticles is contemplated for the formulation and administration of the antibodies and/or analogs thereof. The formation and use of liposomes is generally known to those of skill in the art, and is also described below.
Nanocapsules can generally entrap compounds in a stable and reproducible way. To avoid side effects due to intracellular polymeric overloading, such ultrafine particles (sized around 0.1 μm) should be designed using polymers able to be degraded in vivo. Biodegradable polyalkyl-cyanoacrylate nanoparticles that meet these requirements are contemplated for use, and such particles are easily made.
Liposomes are formed from phospholipids that are dispersed in an aqueous medium and spontaneously form multilamellar concentric bilayer vesicles (also termed multilamellar vesicles (MLVs). MLVs generally have diameters of from 25 nm to 4 μm. Sonication of MLVs results in the formation of small unilamellar vesicles (SUVs) with diameters in the range of 200-500 Å, containing an aqueous solution in the core.
The following information can also be utilized in generating liposomal formulations. Phospholipids can form a variety of structures other than liposomes when dispersed in water, depending on the molar ratio of lipid to water. At low ratios the liposome is the recommended structure. The physical characteristics of liposomes depend on pH, ionic strength and the presence of divalent cations. Liposomes can show low permeability to ionic and polar substances, but at elevated temperatures undergo a phase transition which markedly alters their permeability. The phase transition involves a change from a closely packed, ordered structure, known as the gel state, to a loosely packed, less-ordered structure, known as the fluid state. This occurs at a characteristic phase-transition temperature and results in an increase in permeability to ions, sugars and drugs.
Liposomes interact with cells via four different mechanisms: Endocytosis by phagocytic cells of the reticuloendothelial system such as macrophages and neutrophils; adsorption to the cell surface, either by nonspecific weak hydrophobic or electrostatic forces, or by specific interactions with cell-surface components; fusion with the plasma cell membrane by insertion of the lipid bilayer of the liposome into the plasma membrane, with simultaneous release of liposomal contents into the cytoplasm; and by transfer of liposomal lipids to cellular or subcellular membranes, or vice versa, without any association of the liposome contents. Varying the liposome formulation can alter which mechanism is operative, although more than one can operate at the same time.
The therapeutic agent can comprise different types of carriers depending on whether it is to be administered in solid, liquid or aerosol form, and whether it needs to be sterile for such routes of administration as injection. The antibodies against aPC can be administered intravenously, intradermally, intraarterially, intraperitoneally, intralesionally, intracranially, intraarticularly, intraprostaticaly, intrapleurally, intratracheally, intranasally, intravitreally, intravaginally, intrarectally, topically, intramuscularly, intraperitoneally, subcutaneously, subconjunctival, intravesicularlly, mucosally, intrapericardially, intraumbilically, intraocularally, orally, topically, locally, by inhalation (e.g., aerosol inhalation), by injection, by infusion, by continuous infusion, localized perfusion bathing target cells directly, via a catheter, via a lavage, in cremes, in lipid compositions (e.g., liposomes), or by other methods or any combination of the foregoing as would be known to one of ordinary skill in the art (see, for example, Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, incorporated herein by reference).
The actual dosage amount of a composition administered to an animal patient can be determined by physical and physiological factors such as body weight, severity of condition, the type of disease being treated, previous or concurrent therapeutic interventions, idiopathy of the patient and the route of administration. The practitioner responsible for administration will, in any event, determine the concentration of active ingredient(s) in a composition and appropriate dose(s) for the individual subject.
In certain embodiments, pharmaceutical compositions can comprise, for example, at least about 0.1% of an active compound. In other embodiments, an active compound can comprise between about 2% to about 75% of the weight of the unit, or between about 25% to about 60%, for example, and any range derivable therein. In other non-limiting examples, a dose can also comprise from about 1 microgram/kg/body weight, about 5 microgram/kg/body weight, about 10 microgram/kg/body weight, about 50 microgram/kg/body weight, about 100 microgram/kg/body weight, about 200 microgram/kg/body weight, about 350 microgram/kg/body weight, about 500 microgram/kg/body weight, about 1 milligram/kg/body weight, about 5 milligram/kg/body weight, about 10 milligram/kg/body weight, about 50 milligram/kg/body weight, about 100 milligram/kg/body weight, about 200 milligram/kg/body weight, about 350 milligram/kg/body weight, about 500 milligram/kg/body weight, to about 1000 mg/kg/body weight or more per administration, and any range derivable therein. In non-limiting examples of a derivable range from the numbers listed herein, a range of about 5 mg/kg/body weight to about 100 mg/kg/body weight, about 5 microgram/kg/body weight to about 500 milligram/kg/body weight, etc., can be administered, based on the numbers described above.
In any case, the composition can comprise various antioxidants to retard oxidation of one or more component.
In embodiments where the composition is in a liquid form, a carrier can be a solvent or dispersion medium comprising but not limited to, water, ethanol, polyol (e.g., glycerol, propylene glycol, liquid polyethylene glycol, etc.), lipids (e.g., triglycerides, vegetable oils, liposomes) and combinations thereof. The proper fluidity can be maintained, for example, by the use of a coating, such as lecithin; by the maintenance of the required particle size by dispersion in carriers such as, for example liquid polyol or lipids; by the use of surfactants such as, for example hydroxypropylcellulose; or combinations thereof. In many cases, isotonic agents can be included, such as, for example, sugars, sodium chloride or combinations thereof.
In other embodiments, one can use eye drops, nasal solutions or sprays, aerosols or inhalants. Such compositions are generally designed to be compatible with the target tissue type. In a non-limiting example, nasal solutions are usually aqueous solutions designed to be administered to the nasal passages in drops or sprays. Nasal solutions are prepared so that they are similar in many respects to nasal secretions, so that normal ciliary action is maintained. Thus, in some embodiments the aqueous nasal solutions usually are isotonic or slightly buffered to maintain a pH of about 5.5 to about 6.5. In addition, antimicrobial preservatives, similar to those used in ophthalmic preparations, drugs, or appropriate drug stabilizers, if required, can be included in the formulation. For example, various commercial nasal preparations are known and include drugs such as antibiotics or antihistamines.
In certain embodiments the antibodies are prepared for administration by such routes as oral ingestion. In these embodiments, the solid composition can comprise, for example, solutions, suspensions, emulsions, tablets, pills, capsules (e.g., hard or soft shelled gelatin capsules), sustained release formulations, buccal compositions, troches, elixirs, suspensions, syrups, wafers, or combinations thereof. Oral compositions can be incorporated directly with the food of the diet. Carriers for oral administration comprise inert diluents, assimilable edible carriers or combinations thereof. In other embodiments, the oral composition can be prepared as a syrup or elixir. A syrup or elixir, can comprise, for example, at least one active agent, a sweetening agent, a preservative, a flavoring agent, a dye, a preservative, or combinations thereof.
In certain embodiments an oral composition can comprise one or more binders, excipients, disintegration agents, lubricants, flavoring agents, and combinations thereof. In certain embodiments, a composition can comprise one or more of the following: a binder, such as, for example, gum tragacanth, acacia, cornstarch, gelatin or combinations thereof; an excipient, such as, for example, dicalcium phosphate, mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate or combinations thereof; a disintegrating agent, such as, for example, corn starch, potato starch, alginic acid or combinations thereof; a lubricant, such as, for example, magnesium stearate; a sweetening agent, such as, for example, sucrose, lactose, saccharin or combinations thereof; a flavoring agent, such as, for example peppermint, oil of wintergreen, cherry flavoring, orange flavoring, etc.; or combinations of the foregoing. When the dosage unit form is a capsule, it can contain, in addition to materials of the above type, carriers such as a liquid carrier. Various other materials can be present as coatings or to otherwise modify the physical form of the dosage unit. For instance, tablets, pills, or capsules can be coated with shellac, sugar or both.
Additional formulations which are suitable for other modes of administration include suppositories. Suppositories are solid dosage forms of various weights and shapes, usually medicated, for insertion into the rectum, vagina or urethra. After insertion, suppositories soften, melt or dissolve in the cavity fluids. In general, for suppositories, traditional carriers can include, for example, polyalkylene glycols, triglycerides or combinations thereof. In certain embodiments, suppositories can be formed from mixtures containing, for example, the active ingredient in the range of about 0.5% to about 10%, and about 1% to about 2%.
The composition must be stable under the conditions of manufacture and storage, and preserved against the contaminating action of microorganisms, such as bacteria and fungi. It will be appreciated that endotoxin contamination should be kept minimally at a safe level, for example, less that 0.5 ng/mg protein.
In particular embodiments, prolonged absorption of an injectable composition can be brought about by the use in the compositions of agents delaying absorption, such as, for example, aluminum monostearate, gelatin or combinations thereof.
B. Pharmaceutical Uses
The monoclonal antibody can be used for therapeutic purposes for treating genetic and acquired deficiencies or defects in coagulation. For example, the monoclonal antibodies in the embodiments described above can be used to block the interaction of aPC with its substrate, which can include Factor Va or Factor VIIIa.
The monoclonal antibodies have therapeutic use in the treatment of disorders of hemostasis such as thrombocytopenia, platelet disorders and bleeding disorders (e.g., hemophilia A, hemophilia B and hemophilia C). Such disorders can be treated by administering a therapeutically effective amount of the anti-aPC monoclonal antibody to a patient in need thereof. The monoclonal antibodies also have therapeutic use in the treatment of uncontrolled bleeds in indications such as trauma and hemorrhagic stroke. Thus, also provided is a method for shortening the bleeding time comprising administering a therapeutically effective amount of an anti-aPC monoclonal antibody to a patient in need thereof.
In another embodiment, the anti-aPC antibody can be useful as an antidote for aPC-treated patients, including for example wherein aPC is used for the treatment of sepsis or bleeding disorder.
The antibodies can be used as monotherapy or in combination with other therapies to address a hemostatic disorder. For example, co-administration of one or more antibodies with a clotting factor such as factor VIIa, factor VIII or factor IX is believed useful for treating hemophilia. In one embodiment, provided is a method for treating genetic and acquired deficiencies or defects in coagulation comprising administering (a) a first amount of a monoclonal antibody that binds to human tissue factor pathway inhibitor and (b) a second amount of factor VIII or factor IX, wherein said first and second amounts together are effective for treating said deficiencies or defects. In another embodiment, provided is a method for treating genetic and acquired deficiencies or defects in coagulation comprising administering (a) a first amount of a monoclonal antibody that binds to human tissue factor pathway inhibitor and (b) a second amount of factor VIII or factor IX, wherein said first and second amounts together are effective for treating said deficiencies or defects, and further wherein factor VII is not coadministered. Also included is a pharmaceutical composition comprising a therapeutically effective amount of the combination of a monoclonal antibody and factor VIII or factor IX, wherein the composition does not contain factor VII. “Factor VII” includes factor VII and factor VIIa. These combination therapies are likely to reduce the necessary infusion frequency of the clotting factor. By co-administration or combination therapy is meant administration of the two therapeutic drugs each formulated separately or formulated together in one composition, and, when formulated separately, administered either at approximately the same time or at different times, but over the same therapeutic period.
In some embodiments, one or more antibodies described herein can be used in combination to address a hemostatic disorder. For example, co-administration of two or more of the antibodies described herein is believed useful for treating hemophilia or other hemostatic disorder.
The pharmaceutical compositions can be parenterally administered to subjects suffering from hemophilia A or B at a dosage and frequency that can vary with the severity of the bleeding episode or, in the case of prophylactic therapy, can vary with the severity of the patient's clotting deficiency.
The compositions can be administered to patients in need as a bolus or by continuous infusion. For example, a bolus administration of an inventive antibody present as a Fab fragment can be in an amount of from 0.0025 to 100 mg/kg body weight, 0.025 to 0.25 mg/kg, 0.010 to 0.10 mg/kg or 0.10-0.50 mg/kg. For continuous infusion, an inventive antibody present as an Fab fragment can be administered at 0.001 to 100 mg/kg body weight/minute, 0.0125 to 1.25 mg/kg/min., 0.010 to 0.75 mg/kg/min., 0.010 to 1.0 mg/kg/min. or 0.10-0.50 mg/kg/min. for a period of 1-24 hours, 1-12 hours, 2-12 hours, 6-12 hours, 2-8 hours, or 1-2 hours. For administration of an inventive antibody present as a full-length antibody (with full constant regions), dosage amounts can be about 1-10 mg/kg body weight, 2-8 mg/kg, or 5-6 mg/kg. Such full-length antibodies would typically be administered by infusion extending for a period of thirty minutes to three hours. The frequency of the administration would depend upon the severity of the condition. Frequency could range from three times per week to once every two weeks to six months.
Additionally, the compositions can be administered to patients via subcutaneous injection. For example, a dose of 10 to 100 mg anti-aPC antibody can be administered to patients via subcutaneous injection weekly, biweekly or monthly.
As used herein, “therapeutically effective amount” means an amount of an anti-aPC monoclonal antibody or of a combination of such antibody and factor VIII or factor IX that is needed to effectively increase the clotting time in vivo or otherwise cause a measurable benefit in vivo to a patient in need. The precise amount will depend upon numerous factors, including, but not limited to the components and physical characteristics of the therapeutic composition, intended patient population, individual patient considerations, and the like, and can readily be determined by one skilled in the art.
Any of the compositions described herein can be comprised in a kit. The kits will thus comprise, in suitable container, an antibody and/or an additional agent. Other components can be included in a kit. Diagnostic and therapeutic kits comprise in suitable container, a pharmaceutically acceptable formulation of an antibody in a pharmaceutically acceptable formulation. The kit can have a single container, and/or it can have distinct container for each compound.
When the components of the kit are provided in one and/or more liquid solutions, the liquid solution is an aqueous solution, with a sterile aqueous solution being one example of a particular embodiment. The antibody can also be formulated into a syringeable composition, in which case, the container can itself be a syringe, pipette, and/or other such like apparatus, from which the formulation can be applied to an infected area of the body, injected into an animal, and/or even applied to and/or mixed with the other components of the kit.
However, the components of the kit can be provided as dried powder(s). When reagents and/or components are provided as a dry powder, the powder can be reconstituted by the addition of a suitable solvent. It is envisioned that the solvent can also be provided in another container.
The container will generally include at least one vial, test tube, flask, bottle, syringe and/or other container, into which the antibody/antibody formulation is placed, suitably allocated. The kits can also comprise a second container for containing a sterile, pharmaceutically acceptable buffer and/or other diluent.
The kits can also include a means for containing the vials in close confinement for commercial sale, such as, e.g., injection and/or blow-molded plastic containers into which the desired vials are retained.
Irrespective of the number and/or type of containers, the kits can also comprise, and/or be packaged with, an instrument for assisting with the injection/administration and/or placement of the ultimate antibody within the body of an animal. Such an instrument can be a syringe, pipette, forceps, and/or any such medically approved delivery vehicle.
The following examples are included to demonstrate embodiments. It should be appreciated by those of skill in the art that the techniques disclosed in the examples which follow represent techniques discovered by the inventor to function well in the practice, and thus can be considered to constitute modes for its practice. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope.
Design of Humanized 1573 VH/VL.
Protein and DNA sequences information of mouse aPC monoclonal antibody were obtained. The humanization design was done using the following method: The VH/VL CDR residues were determined and annotated with Kabat numbering system (world-wide-web at bioinf.org.uk/abs/#kabatnum). The canonical structures of the VH/VL CDRs were determined based on reports in literature (1-2). Based on VH/VL CDR canonical structures, the human germline framework acceptors with the same canonical structures were selected.
1573 sequence was used to blast search PDB database and obtain known antibody structures sharing the highest sequence identities with the target antibody. Based on the output of blast search and sequence identity ratio, 1M71, 1M7D, and 1M7I were selected as template for VH modeling, while 1IQW, 11T9 and 2GCY were selected as template for VL chain modeling. Schrodinger suite software was used to build homology models for VL and VH chains, with loop optimization. Then the output models were analyzed with software “contact” in CCP4 suite to give a list of all residues in framework regions that interact with residues from CDR regions within 4 Å. Based on the output of software and visual inspection with the model, the following residues in framework were identified as residues that contribute to the supporting of CDR loops. Those were: light chain residues Asp70, Tyr36, Thr69, Phe71, Ile2 and Tyr49; heavy chain residues Arg94, Arg38, Glu46, Trp47, Asp73, Arg71, and Trp102. For the design of humanized VH, residues supporting loop structures and VH/VL interface were identified (International Application No. WO2008021156). Residues important for loop conformation and VH/VL interface were to be back-mutated. Then the VH sequences with the back-mutations were aligned with the selected germline sub-family. The identities and similarities to each individual human germline framework sequences within the same canonical subsets were analyzed and the germline sequence with the best overall homology to the murine VH sequence was identified. It was selected as the acceptor human germline framework for grafting VH CDRs. Additional considerations for mutations included a Q1E mutation used to eliminate N-terminal pyroglutamate formation. Mutations also included those to maintain consensus within the selected VH family, for CDR canonical structures and VH/VL interface. Mutations might also include those identified as within 4 Å from the CDR binding region according to molecular modeling. Analysis was performed to make sure no N-linked glycosylation pattern (N-{P}-S/T) was found in the proposed humanized construct.
The human JH region was selected based on best sequence homology. The humanized VL sequences were also designed based on such method stated above.
Generation of HC and LC Expression Plasmids.
Humanized V-region sequences were built using gene de novo synthesis approach. The PCR amplified VHs were cloned into pCP-hCgl expression vector by homologous recombination. Amplified Vks were cloned into pCP-hck vector using same method.
The variable regions of chimera HC and LC (VH and VL) were PCR-amplified from 1573. Gel-purified PCR product was cloned into the same vectors as humanized V-region by homologous recombination.
Transient Transfection of HEK293 Cells.
Approximately 24 hrs before transfection, pass FreeStyle™ 293E at 0.5×106 cells/ml and cells were sharked at 120 rpm/min, at 37° C., 8% CO2. On the day of transfection, the cell density should be about 1.0-1.2×106/ml. The cells were split to 1×106/ml with growth medium. To ensure optimal transfection, viability of the cells was determined to be >95%. DNA was diluted in FreeStyle™ 293 expression medium (293E) in a volume equivalent to one-tenth of culture transfected. PEI was added into DNA; the mixture was vortex immediately and incubated for 10 min at room temperature prior to its addition to the cells. The final concentration of DNA to PEI ratio was 1:2.
Purification of Humanized 1573 IgG Antibodies.
Conditioned medium above on day 6 was loaded onto a 1 ml Protein A column, which was pre-equilibrated by 10 ml PBS, pH7.0. The column was then washed with equilibrating buffer to baseline after sample loading. After washed, the column was eluted with 100 mM Glycin-HCl pH3.0, followed with immediate addition of 1M Tris-HCl solution to adjust pH value to 8.0. The final product was dialyzed against PBS solution. Protein purity was analyzed by SDS-PAGE, SEC and its concentration was determined by Bradford method.
Size Exclusion Chromatography Analysis of the Purified Antibodies.
SEC for analyzing purified antibody was carried out with a Superdex 200 5/150, GL column using a HPLC system (LC-20AD, Shimadzu) at ambient temperature. PBS buffer pH 7.0, at a flow rate 0.3 mL/min was used as the mobile phase. The protein detection was under 280 nm.
Immobilization of Anti-Mouse FC Antibody onto CM5 Chip.
A CM5 sensor chip was activated in FC2 by 6-min injection (10 μl/min) of freshly prepared 1:1 50 mM NHS: 200 mM EDC. Then anti mouse FC antibody in 10 mM sodium acetate buffer PH 5.0 (1.4 μl diluted in 90 μl NaAc, pH 5.0) was injected onto the activated chip at 5 μl/min (HBS-EP running buffer: 10 mM HEPES, pH 7.4, 150 mM NaCl, 3.4 mM EDTA, 0.005% surfactant P20). The remaining active coupling sites were blocked with 7 min injection of 1M ethanolamine at 10 μl/min. About 9200 RU was produced.
Immobilization of Anti-Human FC Antibody onto CM5 Chip.
A CM5 sensor chip was activated in FC2 by 7-min injection (10 μl/min) of freshly prepared 1:1 50 mM NHS: 200 mM EDC. Then anti human FC antibody in 10 mM sodium acetate buffer PH 5.0 (2.5 μl diluted in 90 μl NaAc, pH 5.0) was injected onto the activated chip at 5 μl/min (HBS-EP running buffer: 10 mM HEPES, pH 7.4, 150 mM NaCl, 3.4 mM EDTA, 0.005% surfactant P20). The remaining active coupling sites were blocked with 7 min injection of 1M ethanolamine at 10 μl/min. About 6400 RU was produced.
Biacore Analysis of Human aPC Binding to 1573 Antibodies.
1573 antibody was first captured on the anti-human FC IgG coated CM5 chip, followed by injection of antigen human aPC at concentration of 0, 1.25, 2.5, 5, 10 and 20 nM. Cycle conditions were as follows: 30 μl/min for 180 s of association phase and 500 s of dissociation phase. The surface was regenerated with a 30 s injection of Gly pH1.5 at 10 μl/min. HBS-EP running buffer: 10 mM HEPES, pH 7.4, 150 mM NaCl, 3.4 mM EDTA, 0.005% surfactant P20. Kinetics was calculated with Biacore X100 evaluation software ver2.0.
Biacore Analysis of Cyno aPC Binding to 1573 Antibodies.
1573 antibody was first captured on the anti-human FC IgG-coated CM5 chip, followed by injection of antigen cyno aPC at concentration of 0, 5, 10, 20, 40, 80 nM. Cycle conditions were as follows: 30 μl/min for 180 s of association phase and 420 s of dissociation phase. The surface was regenerated with a 45 s injection of Gly pH1.5 at 10 μl/min. Kinetics was calculated with Biacore X100 evaluation software ver2.0.
Binding ELISA of Purified Antibodies.
Plates (Nunc, cat#442404) were coated with 100 μl of human aPC (1 ng/ml), hPC (2 ng/ml), monkey aPC (2 ng/ml), or monkey PC (2 ng/ml) diluted in DPBS (Gibco, cat#14040) overnight (o/n) at 4° C. After washing, the ELISA plate was blocked with 200 μl MPBST for 1 hr at RT, and tapped dry on a stack of paper towels. To each well 100 μl of IgG to be tested was added, and incubated 1 hr at RT (for EC50 determination start at 20 nM and do 1:3 dilutions).
Plates were washed 5× with PBST. 100 μl of anti-hIgG Fc-HRP (Sigma, cat#A0170) diluted 1:10000 in PBST was added to each well. Plates were washed and 100 μl/well of TMB substrate was added and incubated at room temperature for 5 min. 100 μl/well of 1N HCl was added to terminate reaction. The plate was read with an ELISA plate reader (Biotek, Elx405) at 450 nm wavelength.
Design and Sequence Analysis of Chimera and Humanized 1573 Antibody.
Variable region sequence annotations with Kabat numbering (world-wide-web at bioinf.org.uk/abs/#kabatnum) CDR residues are underlined:
| VH: |
| (SEQ ID NO: 31; DNA is SEQ ID NO: 33) |
| EVKLEESGGGLVQPGGSMKLSCVASGFTFSNYYLNWVRQSPEKGLEWVAD |
| IRLKSNNYEKHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCIR |
| EGDYFDYWGQGTTLTVSS |
| VL: |
| (SEQ ID NO: 32; DNA is SEQ ID NO: 34) |
| NIVLTQSPASLAVSLGQRATISCRASESVDSFGATFMHWYQQKPGQPPKL |
| LIYLASNLESGVPARFSGSGSRTDFTLTIDPVEADDAATYYCQQNNEDPY |
| TFGGGTKLEIKR |
1573 VH canonical structure: 1-4-based on H1 and H2 canonical structures, the VH can be humanized to subset of the VH3 germline framework sequences. 1573 Vk canonical structure: 4-1-1-based on a 4-1-1 Vk CDR canonical structure, the Vk can be humanized to subset of the VKII germline framework sequences.
1573 VH Humanization Design.
Germline VH3-72 had the best overall homology with the 1573 VH sequence. It was selected as the acceptor human germline framework for grafting 1573 VH CDR sequences. hJH6 will be used for 1573 humanization due to best homology. All possible back-mutations are listed below.
-
- G49A—Vernier Zone residue, canonical residue (effect CDR H2, score 3), human residue.
- N76S—Canonical residue (effect CDRH1, score 3), human residue
- L78V—Vernier Zone residue, canonical residue (effect CDRH1, score 3), human residue
- A93I—Vernier zone residue. Canonical residue (effect CDR H3, score 3), human residue.
Humanized 1573 VH design with CDRs underlined and back-mutations double-underlined:
| 1573 VH |
| (SEQ ID NO: 15) |
| EVKLEESGGGLVQPGGSMKLSCVASGFTFSNYYLNWVRQSPEKGLEWVAD |
| IRLKSNNYEKHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCIR |
| EGDYFDYWGQGTTLTVSS |
| H1573 VH.1 |
| (SEQ ID NO: 16) |
| EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYLNWVRQAPGKGLEWVGD |
| IRLKSNNYEKHYAESVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCAR |
| EGDYFDYWGQGTTVTVSS |
| H1573 VH.1A |
| (SEQ ID NO: 17) |
| EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYLNWVRQAPGKGLEWVGD |
| IRLKSNNYEKHYAESVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYC R |
| EGDYFDYWGQGTTVTVSS |
| H1573 VH.1B |
| (SEQ ID NO: 18) |
| EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYLNWVRQAPGKGLEWVGD |
| IRLKSNNYEKHYAESVKGRFTISRDDSKNS YLQMNSLKTEDTAVYYC R |
| EGDYFDYWGQGTTVTVSS |
| H1573 VH.1C |
| (SEQ ID NO: 19) |
| EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYLNWVRQAPGKGLEWV D |
| IRLKSNNYEKHYAESVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYC R |
| EGDYFDYWGQGTTVTVSS |
| H1573 VH.1D |
| (SEQ ID NO: 20) |
| EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYLNWVRQAPGKGLEWVGD |
| IRLKSNNYEKHYAESVKGRFTISRDDSK SLYLQMNSLKTEDTAVYYC R |
| EGDYFDYWGQGTTVTVSS |
| H1573 VH.1E |
| (SEQ ID NO: 21) |
| EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYLNWVRQAPGKGLEWVA D |
| IRLKSNNYEKHYAESVKGRFTISRDDSKNS YLQMNSLKTEDTAVYYC R |
| EGDYFDYWGQGTTVTVSS |
| H1573 VH.1F |
| (SEQ ID NO: 22) |
| EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYYLNWVRQAPGKGLEWVA D |
| IRLKSNNYEKHYAESVKGRFTISRDDSK S YLQMNSLKTEDTAVYYC R |
| EGDYFDYWGQGTTVTVSS |
| VH3-72 |
| (SEQ ID NO: 23) |
| EVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVGR |
| TRNKANSYTTEYAASVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCAR |
| VH3-72/JH6 |
| (SEQ ID NO: 24) |
| EVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVGR |
| TRNKANSYTTEYAASVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCAR |
| -------WGQGTTVTVSS |
1573 Vk Humanization Design.
The Vk germline A2 had the best overall homology to the 1573 Vk sequence. It was selected as the acceptor human germline framework for grafting 1573 Vk CDR sequences. hJk2 will be used for 1573 humanization due to best homology. Residues important for loop conformation and VH/VL interface are highlighted in yellow and the CDRs with the Kabat numbers in red.
Possible back-mutations in 1573Vk humanization design:
M4L—Vernier zone residue (effect CDRL1, 3, score 3), human residue
G68R—Vernier zone residue
Humanized 1573 Vk design with CDR's underlined and back-mutations in double-underline:
| 1573 Vk |
| (SEQ ID NO: 25) |
| NIVLTQSPASLAVSLGQRATISCRASESVDSFGATFMH- |
| WYQQKPGQPPKLLIYLASNLESGVPARFSGSGSRTDFTLTIDPVEADDAA |
| TYYCQQNNEDPYTFGGGTKLEIKR |
| H1573Vk.2 |
| (SEQ ID NO: 26) |
| DIVMTQTPLSLSVTPGQPASISCRASESVDSFGATFMH- |
| WYLQKPGQPPQLLIYLASNLESGVPDRFSGSGSGTDFTLKISRVEAEDVG |
| VYYCQQNNEDPYTFGQGTKLEIKR |
| H1573Vk.2A |
| (SEQ ID NO: 27) |
| DIV TQTPLSLSVTPGQPASISCRASESVDSFGATFMH- |
| WYLQKPGQPPQLLIYLASNLESGVPDRFSGSGSGTDFTLKISRVEAEDVG |
| VYYCQQNNEDPYTFGQGTKLEIKR |
| H1573Vk.2B |
| (SEQ ID NO: 28) |
| DIVMTQTPLSLSVTPGQPASISCRASESVDSFGATFMH- |
| WYLQKPGQPPQLLIYLASNLESGVPDRFSGSGS TDFTLKISRVEAEDVG |
| VYYCQQNNEDPYTFGQGTKLEIKR |
| H1573Vk.2C |
| (SEQ ID NO: 29) |
| DIV TQTPLSLSVTPGQPASISCRASESVDSFGATFMH- |
| WYLQKPGQPPQLLIYLASNLESGVPDRFSGSGS TDFTLKISRVEAEDVG |
| VYYCQQNNEDPYTFGQGTKLEIKR |
| A2 |
| (SEQ ID NO: 30) |
| DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQPPQ |
| LLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIQLP |
No N-linked glycosylation pattern (N-{P}-S/T) was found in the proposed humanized construct in both VH and VL.
Humanized VH and VL Cloning.
All humanized VH and VL were built by gene de novo synthesis approach and clone them into 293 expression vector pCp. Constructs for humanized antibody are summarized in Table 2:
| TABLE 2 |
| Construct summary for 1573 humanization |
| VH (VH3-72) + | Construction | VL (A2) + | Construction |
| JH6/FW4 | status | JK2/FW4 | status |
| H1573VH.1 | ✓ | H1573Vk.2 | ✓ |
| H1573VH.1A | ✓ | H1573Vk.2A | ✓ |
| H1573VH.1B | ✓ | H1573Vk.2B | ✓ |
| H1573VH.1C | ✓ | H1573Vk.2C | ✓ |
| H1573VH.1D | ✓ | 1573Vk (chimeric) | ✓ |
| H1573VH.1E | ✓ | ||
| H1573VH.1F | ✓ | ||
| 1573VH (chimeric) | ✓ | ||
Expression and Purification of Chimera and Humanized 1573 Antibody.
293 transfection designs were summarized in Table 3. Conditioned medium (Method 3.3) on day 6 was loaded onto a 1 ml Protein A column. Recombinant 1573 antibody was collected, purified. The chimera and humanized 1573 IgG proteins all showed good expression levels.
| TABLE 3 |
| HEK293 co-transfection design |
| VH |
| 1573VH | ||||||||
| VK | H1573VH.1 | H1573VH.1A | H1573VH.1B | H1573VH.1C | H1573VH.1D | H1573VH.1E | H1573VH.1F | chimeric |
| H1573Vk.2 | Hu1573-3 | Hu1573-6 | Hu1573-9 | Hu1573-12 | Hu1573-15 | |||
| H1573Vk.2A | Hu1573-4 | Hu1573-7 | Hu1573-10 | Hu1573-13 | Hu1573-16 | |||
| H1573Vk.2B | Hu1573-5 | Hu1573-8 | Hu1573-11 | Hu1573-14 | Hu1573-17 | |||
| H1573Vk.2C | Hu1573-1 | Hu1573-2 | ||||||
| 1573Vk | ||||||||
| chimetric | ||||||||
SEC Characterization of Purified Chimera and Humanized 1573 Antibody.
To evaluate the purity and percentage of aggregation of the purified chimera 1573 and humanized antibodies, the samples were loaded onto SEC respectively (FIG. 1 ). All CP generated antibodies was eluted as a single sharp peak around 5.75 min with PBS pH 7.0 buffer. The elution time is very close to that of one of the protein markers (158 kDa, elution time is 5.85 min), suggesting most of them show more than 90% of monomer, two antibodies show more than 80% monomer.
Biacore Analysis of 1573 Binding to the Humanized Antibodies.
aPC was immobilized directly onto a new CM5 chip using amine coupling method. After overnight equilibrium, 100 nM 1573 antibodies were injected over the surface and strong signal was detected. Therefore, the affinity determination was done using this chip. Each of antibody was injected over the chip surfaces respectively at 30 μl/min for 180 s of association phase and 300 s of dissociation phase.
| TABLE 4 |
| Kinetic parameters for interaction between 1573 antibodies and antigen hAPC |
| cyno APC determined by surface plasmon resonance (data fit using |
| 1:1 binding model) |
| Binding to human APC | Binding to cyno APC |
| Overall | Overall | |||||
| Antibody | affinity | affinity | ||||
| Code | ka (1/Ms) | kd (1/s) | KD (M) | ka (1/Ms) | kd (1/s) | KD (M) |
| 1573 Chimeric | 2.32E+06 | 0.008112 | 3.49E−09 | 5.55E+05 | 0.007664 | 1.38E−08 |
| 1573 mouse | 9.48E+05 | 0.005199 | 5.49E−09 | 3.44E+05 | 0.007254 | 2.11E−08 |
| Hu 1573-1 | 1.46E+06 | 0.005538 | 3.80E−09 | 2.40E+05 | 0.004016 | 1.67E−08 |
| Hu 1573-2 | 1.35E+06 | 0.00624 | 4.61E−09 | 2.35E+05 | 0.003843 | 1.64E−08 |
| Hu 1573-3 | 1.44E+06 | 0.008182 | 5.70E−09 | 7.43E+05 | 0.01053 | 1.42E−08 |
| Hu 1573-4 | 1.52E+06 | 0.007723 | 5.10E−09 | 7.43E+05 | 0.01053 | 1.42E−08 |
| Hu 1573-5 | 1.54E+06 | 0.006397 | 4.16E−09 | 2.02E+05 | 0.002926 | 1.45E−08 |
| Hu 1573-6 | 1.43E+06 | 0.008477 | 5.94E−09 | 6.27E+05 | 0.007074 | 1.13E−08 |
| Hu 1573-7 | 1.36E+06 | 0.008574 | 6.33E−09 | 2.55E+05 | 0.004707 | 1.85E−08 |
| Hu 1573-8 | 1.49E+06 | 0.005995 | 4.03E−09 | 3.63E+05 | 0.004466 | 1.23E−08 |
| Hu 1573-9 | 1.45E+06 | 0.008152 | 5.63E−09 | 4.75E+05 | 0.007239 | 1.52E−08 |
| Hu 1573-10 | 1.45E+06 | 0.006364 | 4.38E−09 | 4.34E+05 | 0.004786 | 1.10E−08 |
| Hu 1573-11 | 1.38E+06 | 0.008958 | 6.49E−09 | 2.69E+05 | 0.004199 | 1.56E−08 |
| Hu 1573-12 | 1.40E+06 | 0.008443 | 6.03E−09 | 3.37E+05 | 0.005404 | 1.61E−08 |
| Hu 1573-13 | 1.40E+06 | 0.006553 | 4.69E−09 | 2.29E+05 | 0.00343 | 1.50E−08 |
| Hu 1573-14 | 1.40E+06 | 0.008559 | 6.13E−09 | 2.99E+05 | 0.005241 | 1.76E−08 |
| Hu 1573-15 | 1.37E+06 | 0.008448 | 6.15E−09 | 2.25E+05 | 0.004524 | 2.02E−08 |
| Hu 1573-16 | 1.42E+06 | 0.006434 | 4.52E−09 | 2.36E+05 | 0.003725 | 1.58E−08 |
| Hu 1573-17 | 1.45E+06 | 0.008329 | 5.75E−09 | 2.69E+05 | 0.004199 | 1.56E−08 |
Binding ELISA of Purified Antibodies.
For human PC and monkey PC as negative controls, humanized antibodies at different concentrations showed very weak response. They have no binding to the human PC and monkey PC antigen. The results were showed in FIG. 5 and FIG. 6 . For human aPC and monkey aPC, all the humanized antibodies showed good binding affinity, it confirmed the Biacore analysis (Table 4). With the dilution curve of humanized antibodies, the inventors also calculated the EC50 of each antibody, which are shown in Table 5.
Chimera and humanized 1573 are cloned in CP's expression vector and generated in CP. The interaction between aPC and antibodies including chimera and humanized are characterized as fast association and fast dissociation by Biacore assay. Furthermore, all the humanized 1573 variants fulfilled affinity criteria. Hu1573-1, 2, 5, 8, 10 could be good candidates, as they have affinity higher than 5 nM and with only 2-3 back-mutations.
| TABLE 5 |
| EC50 of 1573 humanized antibodies |
| Cyno-APC | Cyno-PC | Human-APC | Human-PC | |
| Humanized Ab | EC50 (nM) | EC50 (nM) | EC50 (nM) | EC50 (nM) |
| 1573 chimeric | 0.8302 | No binding | 0.3337 | No binding |
| Hu1573-1 | 0.8647 | No binding | 0.3693 | No binding |
| Hu1573-2 | 0.7745 | No binding | 0.2652 | No binding |
| Hu1573-3 | 0.8723 | No binding | 0.5915 | No binding |
| Hu1573-4 | 0.9041 | No binding | 0.5834 | No binding |
| Hu1573-5 | 1.0350 | No binding | 0.5520 | No binding |
| Hu1573-6 | 0.8996 | No binding | 0.2741 | No binding |
| Hu1573-7 | 0.8525 | No binding | 0.4446 | No binding |
| Hu1573-8 | 0.7129 | No binding | 0.6972 | No binding |
| Hu1573-9 | 0.9857 | No binding | 0.3134 | No binding |
| Hu1573-10 | 0.6800 | No binding | 0.5752 | No binding |
| Hu1573-11 | 1.466 | No binding | 0.6868 | No binding |
| Hu1573-12 | 0.6418 | No binding | 0.3394 | No binding |
| Hu1573-13 | 0.8045 | No binding | 0.2356 | No binding |
| Hu1573-14 | 0.9838 | No binding | 0.2247 | No binding |
| Hu1573-15 | 0.8891 | No binding | 0.2880 | No binding |
| Hu1573-16 | 1.2290 | No binding | 0.2328 | No binding |
| Hu1573-17 | 1.2100 | No binding | 0.6267 | No binding |
All of the compositions and/or methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods have been described in terms of specific embodiments, it will be apparent to those of skill in the art that variations can be applied to the compositions and/or methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the disclosure. More specifically, it will be apparent that certain agents which are both chemically and physiologically related can be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept as defined by the appended claims.
Claims (19)
1. A humanized antibody binding to activated protein C comprising:
(a) a heavy light chain comprising heavy light chain CDRs represented by SEQ ID NOS: 1, 2 and 3; and wherein the light chain framework regions are represented by amino acid residues 1 to 23, 39 to 53, 61 to 92 and 102 to 112 of SEQ ID NO: 26, or having 5 or fewer conservative amino acid substitutions to SEQ ID NO: 26 framework regions, and
(b) a light heavy chain comprising light heavy chain CDRs represented by SEQ ID NOS: 4, 5 and 6 and wherein the heavy chain framework regions are represented by amino acid residues 1 to 30, 36 to 49, 69 to 100 and 108 to 118 of SEQ ID NO: 16, or having 5 or fewer conservative amino acid substitutions to SEQ ID NO: 16 framework regions.
2. The antibody of claim 1 , wherein the heavy chain framework regions are represented by SEQ ID NOS: 7, 8, 9 and 10, or having 5 or fewer conservative amino acid substitutions.
3. The antibody of claim 1 , wherein the light chain framework regions are represented by SEQ ID NOS: 11, 12, 13 and 14, or having 5 or fewer conservative amino acid substitutions.
4. The antibody of claim 2 1, wherein residue 14 49 of SEQ ID NO: 8 16 is substituted with Alanine.
5. The antibody of claim 2 1, wherein residues 11, 13 and 31 of SEQ ID NO: 9 79, 81 and 99 of SEQ ID NO: 16 are is substituted with one or more of Serine (residue 11 79), Valine (residue 13 81) and Isoleucine (residue 31 99).
6. The antibody of claim 1 , wherein said heavy chain comprises SEQ ID NOS: 16-24 NO: 16, 17, 18, 19, 20, 21 or 22.
7. The antibody of claim 3 1, wherein residue 4 of SEQ ID NO: 11 26 is substituted with Leucine.
8. The antibody of claim 3 1, wherein residue 12 72 of SEQ ID NO: 13 26 is substituted with Arginine.
9. The antibody of claim 1 , wherein said light chain comprises SEQ ID NOS: 26-30 NO: 26, 27, 28 or 29.
10. The antibody of claim 1 , wherein the antibody is a single-chain antibody or antibody fragment binding activated protein C.
11. The antibody of claim 10 , wherein the antibody fragment is further defined as Fab′, Fab, F(ab′)2, a single domain antibody, Fv, or scFv.
12. A cell or cell line comprising a nucleic acid encoding a humanized antibody binding to activated protein C comprising:
(a) a heavy light chain comprising heavy light chain CDRs represented by SEQ ID NOS: 1, 2 and 3; and wherein the light chain framework regions are represented by amino acid residues 1 to 23, 39 to 53, 61 to 92 and 102 to 112 of SEQ ID NO: 26, or having 5 or fewer conservative amino acid substitutions to SEQ ID NO: 26 framework regions, and
(b) a light heavy chain comprising light heavy chain CDRs represented by SEQ ID NOS: 4, 5 and 6, wherein the heavy chain framework regions are represented by amino acid residues 1 to 30, 36 to 49, 69 to 100 and 108 to 118 of SEQ ID NO: 16, or having 5 or fewer conservative amino acid substitutions to SEQ ID NO: 16 framework regions.
13. The antibody of claim 1 , dispersed in a pharmaceutically acceptable carrier.
14. A method of inhibiting activated protein C anticoagulant activity and/or amidolytic activity in a subject, comprising administering an effective amount of an antibody according to claim 1 to said subject.
15. A method of treating a subject in need of blood coagulation comprising administering an effective amount of an antibody according to claim 1 to said subject.
16. The method of claim 15 , wherein said subject is suffering from hemophilia.
17. A method of promoting hemostasis or thrombosis in a subject, comprising administrating administering an effective amount of an antibody according to claim 1 to said subject.
18. The method of claim 17 , wherein the subject is a trauma patient.
19. A kit comprising an antibody according to claim 1 .
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/419,319 USRE49099E1 (en) | 2012-11-29 | 2013-11-27 | Humanized monoclonal antibodies against activated protein c and uses thereof |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201261731368P | 2012-11-29 | 2012-11-29 | |
| PCT/US2013/072137 WO2014085527A1 (en) | 2012-11-29 | 2013-11-27 | Humanized monoclonal antibodies against activated protein c and uses thereof |
| US14/443,696 US9657111B2 (en) | 2012-11-29 | 2013-11-27 | Humanized monoclonal antibodies against activated protein C and uses thereof |
| US16/419,319 USRE49099E1 (en) | 2012-11-29 | 2013-11-27 | Humanized monoclonal antibodies against activated protein c and uses thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| USRE49099E1 true USRE49099E1 (en) | 2022-06-07 |
Family
ID=50828440
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/419,319 Active USRE49099E1 (en) | 2012-11-29 | 2013-11-27 | Humanized monoclonal antibodies against activated protein c and uses thereof |
| US14/443,696 Ceased US9657111B2 (en) | 2012-11-29 | 2013-11-27 | Humanized monoclonal antibodies against activated protein C and uses thereof |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/443,696 Ceased US9657111B2 (en) | 2012-11-29 | 2013-11-27 | Humanized monoclonal antibodies against activated protein C and uses thereof |
Country Status (17)
| Country | Link |
|---|---|
| US (2) | USRE49099E1 (en) |
| EP (1) | EP2925360A4 (en) |
| JP (1) | JP2016501875A (en) |
| KR (1) | KR20150088853A (en) |
| CN (1) | CN104936618A (en) |
| AR (1) | AR093672A1 (en) |
| AU (1) | AU2013352260A1 (en) |
| BR (1) | BR112015012458A2 (en) |
| CA (1) | CA2892748A1 (en) |
| HK (1) | HK1215174A1 (en) |
| IL (1) | IL238920A0 (en) |
| MX (1) | MX2015006738A (en) |
| RU (1) | RU2015125343A (en) |
| SG (1) | SG11201504035PA (en) |
| TW (1) | TW201437229A (en) |
| UY (1) | UY35160A (en) |
| WO (1) | WO2014085527A1 (en) |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2015179435A1 (en) * | 2014-05-19 | 2015-11-26 | Bayer Healthcare Llc | Optimized humanized monoclonal antibodies against activated protein c and uses thereof |
| WO2017087391A1 (en) * | 2015-11-17 | 2017-05-26 | Bayer Healthcare, Llc | Epitope of optimized humanized monoclonal antibodies against activated protein c and uses thereof |
| WO2020051277A1 (en) | 2018-09-06 | 2020-03-12 | Board Of Regents, The University Of Texas System | Treatment and prevention of hemophilic arthropathy with an antibody against endothelial cell protein c receptor (epcr) |
| CN115611986B (en) * | 2021-07-13 | 2025-08-12 | 上海莱士血液制品股份有限公司 | Monoclonal antibody aiming at human activated protein C and preparation and application thereof |
Citations (22)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1993000102A1 (en) | 1991-06-24 | 1993-01-07 | The Scripps Research Institute | Apc polypeptides and anti-peptide antibodies, diagnostic methods and systems for inhibitng apc, and therapeutic methods |
| US5202253A (en) | 1988-12-30 | 1993-04-13 | Oklahoma Medical Research Foundation | Monoclonal antibody specific for protein C and antibody purification method |
| WO1996005303A1 (en) | 1994-08-12 | 1996-02-22 | Oklahoma Medical Research Foundation | Cloning and regulation of an endothelial cell protein c/activated protein c receptor |
| WO2002029015A1 (en) | 2000-10-02 | 2002-04-11 | Oklahoma Medical Research Foundation | Assay for rapid detection of human activated protein c and highly specific monoclonal antibody therefor |
| WO2003091415A2 (en) | 2002-04-24 | 2003-11-06 | The Regents Of The University Of California | Fluorobodies and chromobodies: binding ligands with intrinsic fluorescence and color |
| WO2004073656A2 (en) | 2003-02-20 | 2004-09-02 | Seattle Genetics, Inc. | Anti-cd70 antibody-drug conjugates and their use for the treatment of cancer and immune disorders |
| US6838437B2 (en) | 1996-04-24 | 2005-01-04 | University Of Michigan | Inactivation resistant factor VIII |
| EP1544214A1 (en) | 2002-07-22 | 2005-06-22 | Chugai Seiyaku Kabushiki Kaisha | Non-neutralizing anti-apc antibodies |
| US6953568B1 (en) | 1998-08-25 | 2005-10-11 | Oklahoma Medical Research Foundation | Targeting of molecules to large vessel endothelium using EPCR |
| WO2006052591A2 (en) | 2004-11-03 | 2006-05-18 | Abgenix, Inc. | Anti-properdin antibodies, and methods for making and using same |
| JP2006197930A (en) | 2004-12-22 | 2006-08-03 | Hiroshima Pref Gov | Human antibody enzyme and method for producing the same |
| WO2007070750A1 (en) | 2005-12-13 | 2007-06-21 | Eli Lilly And Company | Anti-il-17 antibodies |
| WO2007076524A2 (en) | 2005-12-29 | 2007-07-05 | Centocor, Inc. | Human anti-il-23 antibodies, compositions, methods and uses |
| US7244430B2 (en) | 2004-12-20 | 2007-07-17 | Crucell Holland B.V. | Binding molecules capable of neutralizing West Nile virus and uses thereof |
| US7247453B1 (en) | 1988-12-30 | 2007-07-24 | Oklahoma Medical Research Foundation | Calcium binding recombinant antibody against protein C |
| WO2008021156A2 (en) | 2006-08-11 | 2008-02-21 | Schering Corporation | Antibodies to il-17a |
| US20090068178A1 (en) | 2002-05-08 | 2009-03-12 | Genentech, Inc. | Compositions and Methods for the Treatment of Tumor of Hematopoietic Origin |
| US20090110683A1 (en) | 2007-10-26 | 2009-04-30 | Oklahoma Medical Research Foundation | Monoclonal antibodies against activated protein c |
| US20100291106A1 (en) | 2009-05-06 | 2010-11-18 | Novartis Ag | Compositions and methods for antibodies targeting complement protein c3b |
| US7879322B2 (en) | 2007-10-12 | 2011-02-01 | Novartis Ag | Compositions and methods for use for antibodies against sclerostin |
| US8039597B2 (en) | 2007-09-07 | 2011-10-18 | Agensys, Inc. | Antibodies and related molecules that bind to 24P4C12 proteins |
| WO2012007516A1 (en) | 2010-07-13 | 2012-01-19 | Bioinvent International Ab | Use of antibodies against icam-1 in the treatment of patients with relapsed cancer |
-
2013
- 2013-11-27 EP EP13857737.4A patent/EP2925360A4/en not_active Ceased
- 2013-11-27 AU AU2013352260A patent/AU2013352260A1/en not_active Abandoned
- 2013-11-27 MX MX2015006738A patent/MX2015006738A/en unknown
- 2013-11-27 HK HK16103170.8A patent/HK1215174A1/en unknown
- 2013-11-27 WO PCT/US2013/072137 patent/WO2014085527A1/en not_active Ceased
- 2013-11-27 SG SG11201504035PA patent/SG11201504035PA/en unknown
- 2013-11-27 BR BR112015012458A patent/BR112015012458A2/en not_active Application Discontinuation
- 2013-11-27 US US16/419,319 patent/USRE49099E1/en active Active
- 2013-11-27 US US14/443,696 patent/US9657111B2/en not_active Ceased
- 2013-11-27 RU RU2015125343A patent/RU2015125343A/en not_active Application Discontinuation
- 2013-11-27 JP JP2015545419A patent/JP2016501875A/en active Pending
- 2013-11-27 CA CA2892748A patent/CA2892748A1/en not_active Abandoned
- 2013-11-27 CN CN201380071700.3A patent/CN104936618A/en active Pending
- 2013-11-27 KR KR1020157016868A patent/KR20150088853A/en not_active Withdrawn
- 2013-11-29 TW TW102143763A patent/TW201437229A/en unknown
- 2013-11-29 AR ARP130104418A patent/AR093672A1/en unknown
- 2013-11-29 UY UY0001035160A patent/UY35160A/en unknown
-
2015
- 2015-05-20 IL IL238920A patent/IL238920A0/en unknown
Patent Citations (25)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7247453B1 (en) | 1988-12-30 | 2007-07-24 | Oklahoma Medical Research Foundation | Calcium binding recombinant antibody against protein C |
| US5202253A (en) | 1988-12-30 | 1993-04-13 | Oklahoma Medical Research Foundation | Monoclonal antibody specific for protein C and antibody purification method |
| US5279956A (en) | 1991-06-24 | 1994-01-18 | The Scripps Research Institute | Activated protein C polypeptides and anti-peptide antibodies, diagnostic methods and systems for inhibiting activated protein C |
| WO1993000102A1 (en) | 1991-06-24 | 1993-01-07 | The Scripps Research Institute | Apc polypeptides and anti-peptide antibodies, diagnostic methods and systems for inhibitng apc, and therapeutic methods |
| WO1996005303A1 (en) | 1994-08-12 | 1996-02-22 | Oklahoma Medical Research Foundation | Cloning and regulation of an endothelial cell protein c/activated protein c receptor |
| US6838437B2 (en) | 1996-04-24 | 2005-01-04 | University Of Michigan | Inactivation resistant factor VIII |
| US6953568B1 (en) | 1998-08-25 | 2005-10-11 | Oklahoma Medical Research Foundation | Targeting of molecules to large vessel endothelium using EPCR |
| WO2002029015A1 (en) | 2000-10-02 | 2002-04-11 | Oklahoma Medical Research Foundation | Assay for rapid detection of human activated protein c and highly specific monoclonal antibody therefor |
| US6989241B2 (en) | 2000-10-02 | 2006-01-24 | Oklahoma Medical Research Foundation | Assay for rapid detection of human activated protein C and highly specific monoclonal antibody therefor |
| WO2003091415A2 (en) | 2002-04-24 | 2003-11-06 | The Regents Of The University Of California | Fluorobodies and chromobodies: binding ligands with intrinsic fluorescence and color |
| US20090068178A1 (en) | 2002-05-08 | 2009-03-12 | Genentech, Inc. | Compositions and Methods for the Treatment of Tumor of Hematopoietic Origin |
| EP1544214A1 (en) | 2002-07-22 | 2005-06-22 | Chugai Seiyaku Kabushiki Kaisha | Non-neutralizing anti-apc antibodies |
| WO2004073656A2 (en) | 2003-02-20 | 2004-09-02 | Seattle Genetics, Inc. | Anti-cd70 antibody-drug conjugates and their use for the treatment of cancer and immune disorders |
| WO2006052591A2 (en) | 2004-11-03 | 2006-05-18 | Abgenix, Inc. | Anti-properdin antibodies, and methods for making and using same |
| US7244430B2 (en) | 2004-12-20 | 2007-07-17 | Crucell Holland B.V. | Binding molecules capable of neutralizing West Nile virus and uses thereof |
| JP2006197930A (en) | 2004-12-22 | 2006-08-03 | Hiroshima Pref Gov | Human antibody enzyme and method for producing the same |
| WO2007070750A1 (en) | 2005-12-13 | 2007-06-21 | Eli Lilly And Company | Anti-il-17 antibodies |
| WO2007076524A2 (en) | 2005-12-29 | 2007-07-05 | Centocor, Inc. | Human anti-il-23 antibodies, compositions, methods and uses |
| WO2008021156A2 (en) | 2006-08-11 | 2008-02-21 | Schering Corporation | Antibodies to il-17a |
| US8039597B2 (en) | 2007-09-07 | 2011-10-18 | Agensys, Inc. | Antibodies and related molecules that bind to 24P4C12 proteins |
| US7879322B2 (en) | 2007-10-12 | 2011-02-01 | Novartis Ag | Compositions and methods for use for antibodies against sclerostin |
| US20090110683A1 (en) | 2007-10-26 | 2009-04-30 | Oklahoma Medical Research Foundation | Monoclonal antibodies against activated protein c |
| WO2009055669A2 (en) | 2007-10-26 | 2009-04-30 | Oklahoma Medical Research Foundation | Monoclonal antibodies against activated and unactivated protein c |
| US20100291106A1 (en) | 2009-05-06 | 2010-11-18 | Novartis Ag | Compositions and methods for antibodies targeting complement protein c3b |
| WO2012007516A1 (en) | 2010-07-13 | 2012-01-19 | Bioinvent International Ab | Use of antibodies against icam-1 in the treatment of patients with relapsed cancer |
Non-Patent Citations (29)
| Title |
|---|
| Cheng T et al. "Activated Protein C Blocks p53-Mediated Apoptosis in Ischemic Human Brain Endothelium and its Neuroprotective", Nature Medicine, Nature Publishing Group, New York, NY vol. 9, No. 3, Mar. 1, 2003 (Mar. 1, 2003), pp. 338-342, XP002998642, ISSN: 1078-8956, DOI: 10.1038/NM826. |
| CHENG T, ET AL.: "Activated Protein C Blocks p53-Mediated Apoptosis in Ischemic Human Brain Endothelium and its Neuroprotective", NATURE MEDICINE, NATURE PUBLISHING GROUP US, NEW YORK, vol. 9, no. 3, 1 March 2003 (2003-03-01), New York, pages 338 - 342, XP002998642, ISSN: 1078-8956, DOI: 10.1038/nm826 |
| Chognot et al., "Identification of protein C epitopes altered during its nanoencapsulation," Journal of Protein Chemistry, 18:779-784, 1999. |
| Extended European Search Report for corresponding application EP 1357737 (9 pages); dated Jun. 10, 2016. |
| Extended European Search Report for corresponding application EP 13857737 (9 pages); dated Jun. 10, 2016. |
| Gale et al., "Nonenzymatic anticoagulant activity of the mutant serine protease Ser360Ala-activated protein C mediated by factor Va," Protein Science, 6(1):132-140, 1997. |
| Green, "Antibody engineering via genetic engineering of the mouse: XenoMouse strains are a vehicle for facile generation of therapeutic human monoclonal antibodies," J. Immunological Methods, 231: 11-23, 1999. |
| Liaw et al., "A monoclonal antibody against activated protein C allows rapid detection of activated protein C in plasma and reveals a calcium ion dependent epitope involved in factor Va inactivation," J. Throbm. Haemost., 1(4):662-70, 2003. |
| Liaw et al., "Identification of the Protein C/Activated Protein C Binding Sites on the Endothelial Cell Protein C Receptor," The Journal of Biological Chemistry, vol. 276, No. 11, pp. 8364-8370, 2001. |
| Mosnier et al., "Activated protein C variants with normal cytoprotective but reduced anticoagulant activity," Blood, 104:1740-1744, 2004. |
| Office Communication issued in Australian Patent Application No. 2013202464, dated Jul. 29, 2014. |
| Office Communication issued in Japanese Patent Application No. 2012-263561, dated Mar. 5, 2014. (English translation of Japanese text). |
| Office Communication issued in Japanese Patent Application No. 2015-545419, dated Aug. 29, 2017. (English translation of Japanese text). |
| Office Communication issued in Russian Patent Application No. 2010121148/10, dated Apr. 7, 2014. (English translation of Russian patent document). |
| Office Communication issued in U.S. Appl. No. 12/257,706, dated Jun. 24, 2010. |
| Office Communication issued in U.S. Appl. No. 12/257,706, dated Mar. 15, 2011. |
| Office Communication issued in U.S. Appl. No. 12/257,706, dated Nov. 15, 2010. |
| Office Communication issued in U.S. Appl. No. 12/257,706, dated Oct. 18, 2011. |
| Owens and Young, "The genetic engineering of monoclonal antibodies," J. Immunological Methods, 168: 149-165, 1994. |
| PCT International International Search Report and Written Opinion issued in International Patent Application No. PCT/US2013/072243, dated Mar. 10, 2014. |
| PCT International Partial Search Report issued in Application No. PCT/US2008/081110, dated Feb. 16, 2009. |
| PCT International Search Report and Written Opinion issued in Application No. PCT/US2008/081110, dated Jul. 8, 2009. |
| PCT International Search Report and Written Opinion issued in International Patent Application No. PCT/US2013/072137, dated Feb. 21, 2014. |
| Preston et al., "Multifunctional specificity of the protein C/activated protein C Gla domain," J. Biol. Chem., 281(39):28850-7, 2006. |
| Rezaie and Esmon, "The function of calcium in protein C activation by thrombin and the thrombin-thrombomodulin complex can be distinguished by mutational analysis of protein C derivatives," J. Biol. Chem., 267:26104-26109, 1992. |
| Stearns-Kurosawa et al., "The endothelial cell protein C receptor augments protein C activation by the thrombin-thrombomodulin complex" Proc. Natl. Acad. Sci. USA, vol. 93, pp. 10212-10216, 1996. |
| The Merck Manuals Online Medical Library. [online]. Whitehouse Station, NJ; Merck Research Laboratories, 2006-2007. [retrieved on Nov. 19, 2007]. Retrieved from the Internet: <URL: http://www.merck.com/mmpe/print/sec06/ch068/ch068a.html>. Sepsis and Septic Shock. See pp. 1-5. |
| Xu et al., "Reconstitution of the Human Endothelial Cell Protein C Receptor with Thrombomodulin in Phosphatidylcholine Vesicles Enhances Protein C Activation," The Journal of Biological Chemistry, vol. 274, No. 10, pp. 6704-6710, 1999. |
| Zhang and Castellino, "Generation of an antibody with a designed specificity difference for protein C and activated protein C," J. Protein Chem., 8(4):471-480, 1989. (Abstract only). |
Also Published As
| Publication number | Publication date |
|---|---|
| US20150322164A1 (en) | 2015-11-12 |
| UY35160A (en) | 2014-06-30 |
| EP2925360A4 (en) | 2016-07-13 |
| US9657111B2 (en) | 2017-05-23 |
| MX2015006738A (en) | 2015-08-05 |
| CA2892748A1 (en) | 2014-06-05 |
| SG11201504035PA (en) | 2015-06-29 |
| RU2015125343A (en) | 2017-01-11 |
| BR112015012458A2 (en) | 2018-02-06 |
| IL238920A0 (en) | 2015-07-30 |
| TW201437229A (en) | 2014-10-01 |
| CN104936618A (en) | 2015-09-23 |
| KR20150088853A (en) | 2015-08-03 |
| HK1215174A1 (en) | 2016-08-19 |
| AR093672A1 (en) | 2015-06-17 |
| EP2925360A1 (en) | 2015-10-07 |
| JP2016501875A (en) | 2016-01-21 |
| WO2014085527A1 (en) | 2014-06-05 |
| AU2013352260A1 (en) | 2015-06-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN106163556B (en) | Matrix metalloproteinase substrates and other cleavable moieties and methods of use thereof | |
| CN107531758B (en) | Matrix metalloprotease cleavable and serine protease cleavable substrates and methods of use thereof | |
| JP5851842B2 (en) | Modified antibody composition and methods of making and using the same | |
| US9574013B2 (en) | Antibodies against factor XII and uses thereof | |
| CA2955947A1 (en) | Anti-cd3 antibodies, activatable anti-cd3 antibodies, multispecific anti-cd3 antibodies, multispecific activatable anti-cd3 antibodies, and methods of using the same | |
| USRE49099E1 (en) | Humanized monoclonal antibodies against activated protein c and uses thereof | |
| US20230022143A1 (en) | Humanized anti-glycoprotein ib alpha (gpibalpha) antibodies | |
| US11077187B2 (en) | Epitope of optimized humanized monoclonal antibodies against activated protein C and uses thereof | |
| WO2015179435A1 (en) | Optimized humanized monoclonal antibodies against activated protein c and uses thereof | |
| TWI857319B (en) | Monoclonal antibody against human activated protein c and its preparation and application | |
| EP4431526A1 (en) | Anti-gpvi antibodies and functional fragments thereof | |
| RU2824515C1 (en) | Monoclonal antibody to activated protein from human and production and use thereof | |
| TW201609809A (en) | Optimized humanized monoclonal antibodies against activated protein C and uses thereof | |
| TW201609808A (en) | Epitope mapping of humanized monoclonal antibodies against activated protein C and uses thereof | |
| HK40081269A (en) | Monoclonal antibody against human activated protein c and preparation and use thereof | |
| HK40038870A (en) | Humanized anti-glycoprotein ib alpha antibodies and use thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| FEPP | Fee payment procedure |
Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY |
|
| MAFP | Maintenance fee payment |
Free format text: PAYMENT OF MAINTENANCE FEE, 8TH YEAR, LARGE ENTITY (ORIGINAL EVENT CODE: M1552); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY Year of fee payment: 8 |