US9320791B2 - Peptides from chaperonin 60.1 - Google Patents
Peptides from chaperonin 60.1 Download PDFInfo
- Publication number
 - US9320791B2 US9320791B2 US14/120,259 US201414120259A US9320791B2 US 9320791 B2 US9320791 B2 US 9320791B2 US 201414120259 A US201414120259 A US 201414120259A US 9320791 B2 US9320791 B2 US 9320791B2
 - Authority
 - US
 - United States
 - Prior art keywords
 - seq
 - peptide
 - amino acid
 - molecules
 - nucleic acid
 - Prior art date
 - Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
 - Active
 
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 110
 - 102000004196 processed proteins & peptides Human genes 0.000 title abstract description 65
 - 102000052603 Chaperonins Human genes 0.000 title abstract description 20
 - 108050001186 Chaperonin Cpn60 Proteins 0.000 title abstract description 19
 - 239000008194 pharmaceutical composition Substances 0.000 claims description 31
 - 239000000427 antigen Substances 0.000 claims description 25
 - 102000036639 antigens Human genes 0.000 claims description 25
 - 108091007433 antigens Proteins 0.000 claims description 25
 - 125000003275 alpha amino acid group Chemical group 0.000 claims description 24
 - 239000002671 adjuvant Substances 0.000 claims description 7
 - FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 6
 - 239000000546 pharmaceutical excipient Substances 0.000 claims description 5
 - 239000003814 drug Substances 0.000 abstract description 55
 - 229920001184 polypeptide Polymers 0.000 abstract description 44
 - 230000004968 inflammatory condition Effects 0.000 abstract description 8
 - 150000007523 nucleic acids Chemical group 0.000 description 34
 - 108091033319 polynucleotide Proteins 0.000 description 33
 - 102000040430 polynucleotide Human genes 0.000 description 33
 - 239000002157 polynucleotide Substances 0.000 description 33
 - 102000039446 nucleic acids Human genes 0.000 description 28
 - 108020004707 nucleic acids Proteins 0.000 description 28
 - 238000000034 method Methods 0.000 description 24
 - 108090000623 proteins and genes Proteins 0.000 description 23
 - 239000000203 mixture Substances 0.000 description 20
 - 208000002193 Pain Diseases 0.000 description 19
 - 229940079593 drug Drugs 0.000 description 18
 - 239000012634 fragment Substances 0.000 description 18
 - 230000036407 pain Effects 0.000 description 18
 - 235000001014 amino acid Nutrition 0.000 description 16
 - 229940024606 amino acid Drugs 0.000 description 15
 - 150000001413 amino acids Chemical class 0.000 description 15
 - 235000018102 proteins Nutrition 0.000 description 13
 - 102000004169 proteins and genes Human genes 0.000 description 13
 - 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 12
 - 230000002265 prevention Effects 0.000 description 12
 - 230000000694 effects Effects 0.000 description 11
 - 239000002773 nucleotide Substances 0.000 description 11
 - 125000003729 nucleotide group Chemical group 0.000 description 11
 - 238000009472 formulation Methods 0.000 description 10
 - 201000008827 tuberculosis Diseases 0.000 description 10
 - 108020004414 DNA Proteins 0.000 description 8
 - 210000004027 cell Anatomy 0.000 description 8
 - 239000003795 chemical substances by application Substances 0.000 description 8
 - 239000002299 complementary DNA Substances 0.000 description 8
 - 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 description 8
 - 230000035939 shock Effects 0.000 description 8
 - 239000000243 solution Substances 0.000 description 8
 - 208000023275 Autoimmune disease Diseases 0.000 description 7
 - 241000282414 Homo sapiens Species 0.000 description 7
 - 102000007079 Peptide Fragments Human genes 0.000 description 7
 - 108010033276 Peptide Fragments Proteins 0.000 description 7
 - 239000004480 active ingredient Substances 0.000 description 7
 - 230000004071 biological effect Effects 0.000 description 7
 - 239000002158 endotoxin Substances 0.000 description 7
 - 239000011148 porous material Substances 0.000 description 7
 - 238000006467 substitution reaction Methods 0.000 description 7
 - XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 7
 - LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
 - 108091034117 Oligonucleotide Proteins 0.000 description 6
 - DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 6
 - DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 6
 - 125000000539 amino acid group Chemical group 0.000 description 6
 - 206010003246 arthritis Diseases 0.000 description 6
 - 238000003556 assay Methods 0.000 description 6
 - 208000010668 atopic eczema Diseases 0.000 description 6
 - 230000001684 chronic effect Effects 0.000 description 6
 - 238000005859 coupling reaction Methods 0.000 description 6
 - 201000010099 disease Diseases 0.000 description 6
 - 208000035475 disorder Diseases 0.000 description 6
 - 230000006870 function Effects 0.000 description 6
 - 239000007924 injection Substances 0.000 description 6
 - 238000002347 injection Methods 0.000 description 6
 - 229920006008 lipopolysaccharide Polymers 0.000 description 6
 - 239000002245 particle Substances 0.000 description 6
 - 230000004044 response Effects 0.000 description 6
 - 239000000126 substance Substances 0.000 description 6
 - 239000000725 suspension Substances 0.000 description 6
 - 238000012360 testing method Methods 0.000 description 6
 - 206010027654 Allergic conditions Diseases 0.000 description 5
 - GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 5
 - 108091028043 Nucleic acid sequence Proteins 0.000 description 5
 - JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 5
 - 239000013543 active substance Substances 0.000 description 5
 - 230000001154 acute effect Effects 0.000 description 5
 - 230000004075 alteration Effects 0.000 description 5
 - 229940035676 analgesics Drugs 0.000 description 5
 - 239000000730 antalgic agent Substances 0.000 description 5
 - 208000006673 asthma Diseases 0.000 description 5
 - 238000009396 hybridization Methods 0.000 description 5
 - 230000028993 immune response Effects 0.000 description 5
 - 238000001727 in vivo Methods 0.000 description 5
 - 230000003533 narcotic effect Effects 0.000 description 5
 - 239000000843 powder Substances 0.000 description 5
 - 102100024341 10 kDa heat shock protein, mitochondrial Human genes 0.000 description 4
 - RZVAJINKPMORJF-UHFFFAOYSA-N Acetaminophen Chemical compound CC(=O)NC1=CC=C(O)C=C1 RZVAJINKPMORJF-UHFFFAOYSA-N 0.000 description 4
 - BSYNRYMUTXBXSQ-UHFFFAOYSA-N Aspirin Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O BSYNRYMUTXBXSQ-UHFFFAOYSA-N 0.000 description 4
 - 108010059013 Chaperonin 10 Proteins 0.000 description 4
 - 108020004705 Codon Proteins 0.000 description 4
 - 102000004127 Cytokines Human genes 0.000 description 4
 - 108090000695 Cytokines Proteins 0.000 description 4
 - PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 4
 - DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
 - 206010020751 Hypersensitivity Diseases 0.000 description 4
 - FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
 - DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 4
 - 229920002472 Starch Polymers 0.000 description 4
 - 229930003316 Vitamin D Natural products 0.000 description 4
 - QYSXJUFSXHHAJI-XFEUOLMDSA-N Vitamin D3 Natural products C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C/C=C1\C[C@@H](O)CCC1=C QYSXJUFSXHHAJI-XFEUOLMDSA-N 0.000 description 4
 - 229960001138 acetylsalicylic acid Drugs 0.000 description 4
 - 239000000443 aerosol Substances 0.000 description 4
 - 238000004458 analytical method Methods 0.000 description 4
 - 210000004369 blood Anatomy 0.000 description 4
 - 239000008280 blood Substances 0.000 description 4
 - 239000000872 buffer Substances 0.000 description 4
 - 230000008859 change Effects 0.000 description 4
 - AGVAZMGAQJOSFJ-WZHZPDAFSA-M cobalt(2+);[(2r,3s,4r,5s)-5-(5,6-dimethylbenzimidazol-1-yl)-4-hydroxy-2-(hydroxymethyl)oxolan-3-yl] [(2r)-1-[3-[(1r,2r,3r,4z,7s,9z,12s,13s,14z,17s,18s,19r)-2,13,18-tris(2-amino-2-oxoethyl)-7,12,17-tris(3-amino-3-oxopropyl)-3,5,8,8,13,15,18,19-octamethyl-2 Chemical compound [Co+2].N#[C-].[N-]([C@@H]1[C@H](CC(N)=O)[C@@]2(C)CCC(=O)NC[C@@H](C)OP(O)(=O)O[C@H]3[C@H]([C@H](O[C@@H]3CO)N3C4=CC(C)=C(C)C=C4N=C3)O)\C2=C(C)/C([C@H](C\2(C)C)CCC(N)=O)=N/C/2=C\C([C@H]([C@@]/2(CC(N)=O)C)CCC(N)=O)=N\C\2=C(C)/C2=N[C@]1(C)[C@@](C)(CC(N)=O)[C@@H]2CCC(N)=O AGVAZMGAQJOSFJ-WZHZPDAFSA-M 0.000 description 4
 - 238000012217 deletion Methods 0.000 description 4
 - 230000037430 deletion Effects 0.000 description 4
 - 230000001419 dependent effect Effects 0.000 description 4
 - 238000005516 engineering process Methods 0.000 description 4
 - 238000003780 insertion Methods 0.000 description 4
 - 230000037431 insertion Effects 0.000 description 4
 - 239000007788 liquid Substances 0.000 description 4
 - 210000004698 lymphocyte Anatomy 0.000 description 4
 - BQJCRHHNABKAKU-KBQPJGBKSA-N morphine Chemical compound O([C@H]1[C@H](C=C[C@H]23)O)C4=C5[C@@]12CCN(C)[C@@H]3CC5=CC=C4O BQJCRHHNABKAKU-KBQPJGBKSA-N 0.000 description 4
 - 210000000440 neutrophil Anatomy 0.000 description 4
 - 229960005489 paracetamol Drugs 0.000 description 4
 - 230000008569 process Effects 0.000 description 4
 - 206010039073 rheumatoid arthritis Diseases 0.000 description 4
 - 210000003491 skin Anatomy 0.000 description 4
 - 241000894007 species Species 0.000 description 4
 - 239000008107 starch Substances 0.000 description 4
 - 229940032147 starch Drugs 0.000 description 4
 - 235000019698 starch Nutrition 0.000 description 4
 - 208000024891 symptom Diseases 0.000 description 4
 - 239000003826 tablet Substances 0.000 description 4
 - RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical group CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 4
 - 235000019166 vitamin D Nutrition 0.000 description 4
 - 239000011710 vitamin D Substances 0.000 description 4
 - 150000003710 vitamin D derivatives Chemical class 0.000 description 4
 - 229940046008 vitamin d Drugs 0.000 description 4
 - 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
 - 102100038222 60 kDa heat shock protein, mitochondrial Human genes 0.000 description 3
 - WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
 - 108010058432 Chaperonin 60 Proteins 0.000 description 3
 - 208000006545 Chronic Obstructive Pulmonary Disease Diseases 0.000 description 3
 - 108091026890 Coding region Proteins 0.000 description 3
 - 206010012335 Dependence Diseases 0.000 description 3
 - 201000004624 Dermatitis Diseases 0.000 description 3
 - 108010010803 Gelatin Proteins 0.000 description 3
 - 241000282412 Homo Species 0.000 description 3
 - 235000010643 Leucaena leucocephala Nutrition 0.000 description 3
 - 240000007472 Leucaena leucocephala Species 0.000 description 3
 - 241001465754 Metazoa Species 0.000 description 3
 - 102000005431 Molecular Chaperones Human genes 0.000 description 3
 - 108010006519 Molecular Chaperones Proteins 0.000 description 3
 - 241000187479 Mycobacterium tuberculosis Species 0.000 description 3
 - 229930006000 Sucrose Natural products 0.000 description 3
 - CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 3
 - 206010051379 Systemic Inflammatory Response Syndrome Diseases 0.000 description 3
 - 210000001744 T-lymphocyte Anatomy 0.000 description 3
 - 238000010521 absorption reaction Methods 0.000 description 3
 - 239000000654 additive Substances 0.000 description 3
 - 230000000996 additive effect Effects 0.000 description 3
 - 208000026935 allergic disease Diseases 0.000 description 3
 - 230000000172 allergic effect Effects 0.000 description 3
 - 230000009285 allergic inflammation Effects 0.000 description 3
 - 230000036592 analgesia Effects 0.000 description 3
 - 230000003110 anti-inflammatory effect Effects 0.000 description 3
 - 230000001363 autoimmune Effects 0.000 description 3
 - 239000002775 capsule Substances 0.000 description 3
 - 230000001413 cellular effect Effects 0.000 description 3
 - 150000001875 compounds Chemical class 0.000 description 3
 - 230000008878 coupling Effects 0.000 description 3
 - 239000007822 coupling agent Substances 0.000 description 3
 - 238000010168 coupling process Methods 0.000 description 3
 - 230000007423 decrease Effects 0.000 description 3
 - 230000002526 effect on cardiovascular system Effects 0.000 description 3
 - 230000002496 gastric effect Effects 0.000 description 3
 - 239000008273 gelatin Substances 0.000 description 3
 - 229920000159 gelatin Polymers 0.000 description 3
 - 235000019322 gelatine Nutrition 0.000 description 3
 - 235000011852 gelatine desserts Nutrition 0.000 description 3
 - 208000015181 infectious disease Diseases 0.000 description 3
 - 230000002757 inflammatory effect Effects 0.000 description 3
 - 239000008101 lactose Substances 0.000 description 3
 - 210000000265 leukocyte Anatomy 0.000 description 3
 - 201000006417 multiple sclerosis Diseases 0.000 description 3
 - 239000002674 ointment Substances 0.000 description 3
 - 238000007911 parenteral administration Methods 0.000 description 3
 - 235000019271 petrolatum Nutrition 0.000 description 3
 - 230000003389 potentiating effect Effects 0.000 description 3
 - 239000002516 radical scavenger Substances 0.000 description 3
 - 239000011347 resin Substances 0.000 description 3
 - 229920005989 resin Polymers 0.000 description 3
 - 239000000523 sample Substances 0.000 description 3
 - 239000011780 sodium chloride Substances 0.000 description 3
 - 239000007921 spray Substances 0.000 description 3
 - 239000005720 sucrose Substances 0.000 description 3
 - 238000002560 therapeutic procedure Methods 0.000 description 3
 - ZGYICYBLPGRURT-UHFFFAOYSA-N tri(propan-2-yl)silicon Chemical compound CC(C)[Si](C(C)C)C(C)C ZGYICYBLPGRURT-UHFFFAOYSA-N 0.000 description 3
 - 239000011715 vitamin B12 Substances 0.000 description 3
 - 238000005406 washing Methods 0.000 description 3
 - VZQHRKZCAZCACO-PYJNHQTQSA-N (2s)-2-[[(2s)-2-[2-[[(2s)-2-[[(2s)-2-amino-5-(diaminomethylideneamino)pentanoyl]amino]propanoyl]amino]prop-2-enoylamino]-3-methylbutanoyl]amino]propanoic acid Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C(C)C)NC(=O)C(=C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCNC(N)=N VZQHRKZCAZCACO-PYJNHQTQSA-N 0.000 description 2
 - 206010002198 Anaphylactic reaction Diseases 0.000 description 2
 - VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 2
 - CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
 - 206010011091 Coronary artery thrombosis Diseases 0.000 description 2
 - 206010012442 Dermatitis contact Diseases 0.000 description 2
 - 206010051392 Diapedesis Diseases 0.000 description 2
 - 206010014950 Eosinophilia Diseases 0.000 description 2
 - 239000004471 Glycine Substances 0.000 description 2
 - 206010019233 Headaches Diseases 0.000 description 2
 - 208000007514 Herpes zoster Diseases 0.000 description 2
 - 102000002265 Human Growth Hormone Human genes 0.000 description 2
 - 108010000521 Human Growth Hormone Proteins 0.000 description 2
 - 239000000854 Human Growth Hormone Substances 0.000 description 2
 - 206010048643 Hypereosinophilic syndrome Diseases 0.000 description 2
 - HEFNNWSXXWATRW-UHFFFAOYSA-N Ibuprofen Chemical compound CC(C)CC1=CC=C(C(C)C(O)=O)C=C1 HEFNNWSXXWATRW-UHFFFAOYSA-N 0.000 description 2
 - 108060003951 Immunoglobulin Proteins 0.000 description 2
 - 241000699666 Mus <mouse, genus> Species 0.000 description 2
 - 206010029379 Neutrophilia Diseases 0.000 description 2
 - 108091093037 Peptide nucleic acid Proteins 0.000 description 2
 - 239000004264 Petrolatum Substances 0.000 description 2
 - 241000700159 Rattus Species 0.000 description 2
 - 108020004511 Recombinant DNA Proteins 0.000 description 2
 - 206010063837 Reperfusion injury Diseases 0.000 description 2
 - 201000007981 Reye syndrome Diseases 0.000 description 2
 - 206010039085 Rhinitis allergic Diseases 0.000 description 2
 - 229940124639 Selective inhibitor Drugs 0.000 description 2
 - 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 2
 - ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
 - 230000002378 acidificating effect Effects 0.000 description 2
 - 230000009471 action Effects 0.000 description 2
 - 230000002411 adverse Effects 0.000 description 2
 - 208000002205 allergic conjunctivitis Diseases 0.000 description 2
 - 201000010105 allergic rhinitis Diseases 0.000 description 2
 - 230000007815 allergy Effects 0.000 description 2
 - 230000003321 amplification Effects 0.000 description 2
 - 230000036783 anaphylactic response Effects 0.000 description 2
 - 208000003455 anaphylaxis Diseases 0.000 description 2
 - 238000010171 animal model Methods 0.000 description 2
 - 230000006907 apoptotic process Effects 0.000 description 2
 - 239000007864 aqueous solution Substances 0.000 description 2
 - 230000036760 body temperature Effects 0.000 description 2
 - 230000015556 catabolic process Effects 0.000 description 2
 - 210000000170 cell membrane Anatomy 0.000 description 2
 - 210000003169 central nervous system Anatomy 0.000 description 2
 - 210000001627 cerebral artery Anatomy 0.000 description 2
 - OROGSEYTTFOCAN-DNJOTXNNSA-N codeine Chemical compound C([C@H]1[C@H](N(CC[C@@]112)C)C3)=C[C@H](O)[C@@H]1OC1=C2C3=CC=C1OC OROGSEYTTFOCAN-DNJOTXNNSA-N 0.000 description 2
 - 208000002528 coronary thrombosis Diseases 0.000 description 2
 - 239000006071 cream Substances 0.000 description 2
 - 238000004163 cytometry Methods 0.000 description 2
 - OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 2
 - 238000006731 degradation reaction Methods 0.000 description 2
 - 210000004443 dendritic cell Anatomy 0.000 description 2
 - 238000011161 development Methods 0.000 description 2
 - 239000003085 diluting agent Substances 0.000 description 2
 - 238000012377 drug delivery Methods 0.000 description 2
 - -1 e.g. Proteins 0.000 description 2
 - 238000004520 electroporation Methods 0.000 description 2
 - 230000006353 environmental stress Effects 0.000 description 2
 - 239000000796 flavoring agent Substances 0.000 description 2
 - IRSCQMHQWWYFCW-UHFFFAOYSA-N ganciclovir Chemical compound O=C1NC(N)=NC2=C1N=CN2COC(CO)CO IRSCQMHQWWYFCW-UHFFFAOYSA-N 0.000 description 2
 - 239000000499 gel Substances 0.000 description 2
 - 230000002068 genetic effect Effects 0.000 description 2
 - 235000011187 glycerol Nutrition 0.000 description 2
 - UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 2
 - 231100000869 headache Toxicity 0.000 description 2
 - 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 2
 - 239000001863 hydroxypropyl cellulose Substances 0.000 description 2
 - 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 2
 - 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 2
 - 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 2
 - UFVKGYZPFZQRLF-UHFFFAOYSA-N hydroxypropyl methyl cellulose Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)O)C(CO)O1 UFVKGYZPFZQRLF-UHFFFAOYSA-N 0.000 description 2
 - 229940071676 hydroxypropylcellulose Drugs 0.000 description 2
 - 229960001680 ibuprofen Drugs 0.000 description 2
 - 230000001900 immune effect Effects 0.000 description 2
 - 102000018358 immunoglobulin Human genes 0.000 description 2
 - 238000000338 in vitro Methods 0.000 description 2
 - 238000000099 in vitro assay Methods 0.000 description 2
 - 230000006698 induction Effects 0.000 description 2
 - 201000010659 intrinsic asthma Diseases 0.000 description 2
 - 229940029329 intrinsic factor Drugs 0.000 description 2
 - 208000012947 ischemia reperfusion injury Diseases 0.000 description 2
 - 239000003446 ligand Substances 0.000 description 2
 - 239000006210 lotion Substances 0.000 description 2
 - 239000000314 lubricant Substances 0.000 description 2
 - 210000004072 lung Anatomy 0.000 description 2
 - HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
 - 239000000463 material Substances 0.000 description 2
 - 239000002480 mineral oil Substances 0.000 description 2
 - 235000010446 mineral oil Nutrition 0.000 description 2
 - 239000000178 monomer Substances 0.000 description 2
 - 229960005181 morphine Drugs 0.000 description 2
 - 206010028417 myasthenia gravis Diseases 0.000 description 2
 - 239000000041 non-steroidal anti-inflammatory agent Substances 0.000 description 2
 - 238000003199 nucleic acid amplification method Methods 0.000 description 2
 - 230000008506 pathogenesis Effects 0.000 description 2
 - 229940066842 petrolatum Drugs 0.000 description 2
 - 229920001223 polyethylene glycol Polymers 0.000 description 2
 - 238000002360 preparation method Methods 0.000 description 2
 - 239000003380 propellant Substances 0.000 description 2
 - 230000007115 recruitment Effects 0.000 description 2
 - 238000012552 review Methods 0.000 description 2
 - 201000005404 rubella Diseases 0.000 description 2
 - 150000003839 salts Chemical class 0.000 description 2
 - 239000001509 sodium citrate Substances 0.000 description 2
 - NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 2
 - 238000010532 solid phase synthesis reaction Methods 0.000 description 2
 - 239000000829 suppository Substances 0.000 description 2
 - 239000000375 suspending agent Substances 0.000 description 2
 - 230000002459 sustained effect Effects 0.000 description 2
 - 208000011580 syndromic disease Diseases 0.000 description 2
 - 201000000596 systemic lupus erythematosus Diseases 0.000 description 2
 - 230000001225 therapeutic effect Effects 0.000 description 2
 - 229940113082 thymine Drugs 0.000 description 2
 - 230000007306 turnover Effects 0.000 description 2
 - MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
 - KSDTXRUIZMTBNV-INIZCTEOSA-N (2s)-2-(9h-fluoren-9-ylmethoxycarbonylamino)butanedioic acid Chemical compound C1=CC=C2C(COC(=O)N[C@@H](CC(=O)O)C(O)=O)C3=CC=CC=C3C2=C1 KSDTXRUIZMTBNV-INIZCTEOSA-N 0.000 description 1
 - 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 1
 - YFMFNYKEUDLDTL-UHFFFAOYSA-N 1,1,1,2,3,3,3-heptafluoropropane Chemical compound FC(F)(F)C(F)C(F)(F)F YFMFNYKEUDLDTL-UHFFFAOYSA-N 0.000 description 1
 - LVGUZGTVOIAKKC-UHFFFAOYSA-N 1,1,1,2-tetrafluoroethane Chemical compound FCC(F)(F)F LVGUZGTVOIAKKC-UHFFFAOYSA-N 0.000 description 1
 - DDMOUSALMHHKOS-UHFFFAOYSA-N 1,2-dichloro-1,1,2,2-tetrafluoroethane Chemical compound FC(F)(Cl)C(F)(F)Cl DDMOUSALMHHKOS-UHFFFAOYSA-N 0.000 description 1
 - OKMWKBLSFKFYGZ-UHFFFAOYSA-N 1-behenoylglycerol Chemical compound CCCCCCCCCCCCCCCCCCCCCC(=O)OCC(O)CO OKMWKBLSFKFYGZ-UHFFFAOYSA-N 0.000 description 1
 - LEACJMVNYZDSKR-UHFFFAOYSA-N 2-octyldodecan-1-ol Chemical compound CCCCCCCCCCC(CO)CCCCCCCC LEACJMVNYZDSKR-UHFFFAOYSA-N 0.000 description 1
 - 101710149439 20 kDa chaperonin, chloroplastic Proteins 0.000 description 1
 - USSIQXCVUWKGNF-UHFFFAOYSA-N 6-(dimethylamino)-4,4-diphenylheptan-3-one Chemical compound C=1C=CC=CC=1C(CC(C)N(C)C)(C(=O)CC)C1=CC=CC=C1 USSIQXCVUWKGNF-UHFFFAOYSA-N 0.000 description 1
 - 206010001052 Acute respiratory distress syndrome Diseases 0.000 description 1
 - 208000026872 Addison Disease Diseases 0.000 description 1
 - 229930024421 Adenine Natural products 0.000 description 1
 - GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
 - 208000035285 Allergic Seasonal Rhinitis Diseases 0.000 description 1
 - 206010052613 Allergic bronchitis Diseases 0.000 description 1
 - GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
 - 208000028185 Angioedema Diseases 0.000 description 1
 - 239000004475 Arginine Substances 0.000 description 1
 - DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
 - 241000416162 Astragalus gummifer Species 0.000 description 1
 - 201000001320 Atherosclerosis Diseases 0.000 description 1
 - 208000030767 Autoimmune encephalitis Diseases 0.000 description 1
 - 208000008035 Back Pain Diseases 0.000 description 1
 - 208000010392 Bone Fractures Diseases 0.000 description 1
 - 206010006474 Bronchopulmonary aspergillosis allergic Diseases 0.000 description 1
 - 206010058019 Cancer Pain Diseases 0.000 description 1
 - 241000700199 Cavia porcellus Species 0.000 description 1
 - 108700021022 Chaperonins Proteins 0.000 description 1
 - 102000019034 Chemokines Human genes 0.000 description 1
 - 108010012236 Chemokines Proteins 0.000 description 1
 - VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
 - 206010008631 Cholera Diseases 0.000 description 1
 - 101710177832 Co-chaperonin GroES Proteins 0.000 description 1
 - 208000035473 Communicable disease Diseases 0.000 description 1
 - 206010010744 Conjunctivitis allergic Diseases 0.000 description 1
 - 108091035707 Consensus sequence Proteins 0.000 description 1
 - 206010010774 Constipation Diseases 0.000 description 1
 - 208000011231 Crohn disease Diseases 0.000 description 1
 - 229920002785 Croscarmellose sodium Polymers 0.000 description 1
 - 206010048843 Cytomegalovirus chorioretinitis Diseases 0.000 description 1
 - 206010012434 Dermatitis allergic Diseases 0.000 description 1
 - 206010012438 Dermatitis atopic Diseases 0.000 description 1
 - 239000004338 Dichlorodifluoromethane Substances 0.000 description 1
 - 208000005171 Dysmenorrhea Diseases 0.000 description 1
 - KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
 - 239000004150 EU approved colour Substances 0.000 description 1
 - 206010014020 Ear pain Diseases 0.000 description 1
 - 206010014596 Encephalitis Japanese B Diseases 0.000 description 1
 - 206010015218 Erythema multiforme Diseases 0.000 description 1
 - 241000588724 Escherichia coli Species 0.000 description 1
 - 208000009386 Experimental Arthritis Diseases 0.000 description 1
 - 208000004262 Food Hypersensitivity Diseases 0.000 description 1
 - 206010018258 Giant papillary conjunctivitis Diseases 0.000 description 1
 - WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
 - WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
 - 201000005569 Gout Diseases 0.000 description 1
 - 208000009329 Graft vs Host Disease Diseases 0.000 description 1
 - 208000035895 Guillain-Barré syndrome Diseases 0.000 description 1
 - 241000606768 Haemophilus influenzae Species 0.000 description 1
 - 208000030836 Hashimoto thyroiditis Diseases 0.000 description 1
 - 206010019851 Hepatotoxicity Diseases 0.000 description 1
 - 239000004705 High-molecular-weight polyethylene Substances 0.000 description 1
 - 102000006947 Histones Human genes 0.000 description 1
 - 108010033040 Histones Proteins 0.000 description 1
 - 208000004454 Hyperalgesia Diseases 0.000 description 1
 - 208000035154 Hyperesthesia Diseases 0.000 description 1
 - 206010061218 Inflammation Diseases 0.000 description 1
 - 208000022559 Inflammatory bowel disease Diseases 0.000 description 1
 - 208000029523 Interstitial Lung disease Diseases 0.000 description 1
 - 201000005807 Japanese encephalitis Diseases 0.000 description 1
 - 241000710842 Japanese encephalitis virus Species 0.000 description 1
 - XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
 - ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
 - QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
 - ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
 - DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
 - CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
 - WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
 - ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
 - HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
 - AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
 - ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
 - KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
 - FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
 - COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
 - AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
 - QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
 - OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
 - KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
 - 208000007914 Labor Pain Diseases 0.000 description 1
 - ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
 - 208000004852 Lung Injury Diseases 0.000 description 1
 - KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
 - 239000004472 Lysine Substances 0.000 description 1
 - 241000124008 Mammalia Species 0.000 description 1
 - 240000003183 Manihot esculenta Species 0.000 description 1
 - 235000016735 Manihot esculenta subsp esculenta Nutrition 0.000 description 1
 - 201000005505 Measles Diseases 0.000 description 1
 - 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
 - 206010049567 Miller Fisher syndrome Diseases 0.000 description 1
 - 101000686985 Mouse mammary tumor virus (strain C3H) Protein PR73 Proteins 0.000 description 1
 - 208000006670 Multiple fractures Diseases 0.000 description 1
 - 208000005647 Mumps Diseases 0.000 description 1
 - 241001529936 Murinae Species 0.000 description 1
 - 241000699670 Mus sp. Species 0.000 description 1
 - 241000186359 Mycobacterium Species 0.000 description 1
 - 206010028813 Nausea Diseases 0.000 description 1
 - 108010047956 Nucleosomes Proteins 0.000 description 1
 - 231100000220 OECD 429 (LLNA) Skin Sensitisation Toxicity 0.000 description 1
 - 102000015636 Oligopeptides Human genes 0.000 description 1
 - 108010038807 Oligopeptides Proteins 0.000 description 1
 - 229910019142 PO4 Inorganic materials 0.000 description 1
 - 208000016999 Parasitic Lung disease Diseases 0.000 description 1
 - 208000031845 Pernicious anaemia Diseases 0.000 description 1
 - 201000005702 Pertussis Diseases 0.000 description 1
 - 206010035664 Pneumonia Diseases 0.000 description 1
 - 208000000474 Poliomyelitis Diseases 0.000 description 1
 - 239000002202 Polyethylene glycol Substances 0.000 description 1
 - 229920001214 Polysorbate 60 Polymers 0.000 description 1
 - 208000004550 Postoperative Pain Diseases 0.000 description 1
 - ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
 - 206010037742 Rabies Diseases 0.000 description 1
 - 208000013616 Respiratory Distress Syndrome Diseases 0.000 description 1
 - 208000002200 Respiratory Hypersensitivity Diseases 0.000 description 1
 - 206010053879 Sepsis syndrome Diseases 0.000 description 1
 - 206010040070 Septic Shock Diseases 0.000 description 1
 - MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
 - 206010070835 Skin sensitisation Diseases 0.000 description 1
 - 244000061456 Solanum tuberosum Species 0.000 description 1
 - 235000002595 Solanum tuberosum Nutrition 0.000 description 1
 - 206010041349 Somnolence Diseases 0.000 description 1
 - HVUMOYIDDBPOLL-XWVZOOPGSA-N Sorbitan monostearate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O HVUMOYIDDBPOLL-XWVZOOPGSA-N 0.000 description 1
 - 239000004147 Sorbitan trioleate Substances 0.000 description 1
 - PRXRUNOAOLTIEF-ADSICKODSA-N Sorbitan trioleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCC\C=C/CCCCCCCC)[C@H]1OC[C@H](O)[C@H]1OC(=O)CCCCCCC\C=C/CCCCCCCC PRXRUNOAOLTIEF-ADSICKODSA-N 0.000 description 1
 - 235000021355 Stearic acid Nutrition 0.000 description 1
 - 206010042033 Stevens-Johnson syndrome Diseases 0.000 description 1
 - 231100000168 Stevens-Johnson syndrome Toxicity 0.000 description 1
 - 101000874347 Streptococcus agalactiae IgA FC receptor Proteins 0.000 description 1
 - 206010043376 Tetanus Diseases 0.000 description 1
 - AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
 - 239000004473 Threonine Substances 0.000 description 1
 - 208000004006 Tick-borne encephalitis Diseases 0.000 description 1
 - 229920001615 Tragacanth Polymers 0.000 description 1
 - 206010069363 Traumatic lung injury Diseases 0.000 description 1
 - QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
 - 208000037386 Typhoid Diseases 0.000 description 1
 - 208000025865 Ulcer Diseases 0.000 description 1
 - 208000024780 Urticaria Diseases 0.000 description 1
 - 206010046865 Vaccinia virus infection Diseases 0.000 description 1
 - KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
 - 241000700647 Variola virus Species 0.000 description 1
 - 208000012886 Vertigo Diseases 0.000 description 1
 - 208000003152 Yellow Fever Diseases 0.000 description 1
 - 240000008042 Zea mays Species 0.000 description 1
 - 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 1
 - 235000002017 Zea mays subsp mays Nutrition 0.000 description 1
 - 206010000269 abscess Diseases 0.000 description 1
 - DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
 - 239000002253 acid Substances 0.000 description 1
 - 229960000643 adenine Drugs 0.000 description 1
 - 201000000028 adult respiratory distress syndrome Diseases 0.000 description 1
 - 230000010085 airway hyperresponsiveness Effects 0.000 description 1
 - 208000037883 airway inflammation Diseases 0.000 description 1
 - 235000004279 alanine Nutrition 0.000 description 1
 - 208000037884 allergic airway inflammation Diseases 0.000 description 1
 - 201000009961 allergic asthma Diseases 0.000 description 1
 - 208000006778 allergic bronchopulmonary aspergillosis Diseases 0.000 description 1
 - 208000002029 allergic contact dermatitis Diseases 0.000 description 1
 - 208000030961 allergic reaction Diseases 0.000 description 1
 - 208000008445 altitude sickness Diseases 0.000 description 1
 - 230000000202 analgesic effect Effects 0.000 description 1
 - 239000005557 antagonist Substances 0.000 description 1
 - 229960002235 anthrax antigen Drugs 0.000 description 1
 - 230000000692 anti-sense effect Effects 0.000 description 1
 - 230000005875 antibody response Effects 0.000 description 1
 - 239000003963 antioxidant agent Substances 0.000 description 1
 - 235000006708 antioxidants Nutrition 0.000 description 1
 - 239000007900 aqueous suspension Substances 0.000 description 1
 - ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
 - 235000009582 asparagine Nutrition 0.000 description 1
 - 229960001230 asparagine Drugs 0.000 description 1
 - 235000003704 aspartic acid Nutrition 0.000 description 1
 - 208000024998 atopic conjunctivitis Diseases 0.000 description 1
 - 201000008937 atopic dermatitis Diseases 0.000 description 1
 - 206010069664 atopic keratoconjunctivitis Diseases 0.000 description 1
 - 230000003190 augmentative effect Effects 0.000 description 1
 - 210000003719 b-lymphocyte Anatomy 0.000 description 1
 - 208000019804 backache Diseases 0.000 description 1
 - 230000008901 benefit Effects 0.000 description 1
 - 235000019445 benzyl alcohol Nutrition 0.000 description 1
 - WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
 - OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
 - 239000011230 binding agent Substances 0.000 description 1
 - 229920002988 biodegradable polymer Polymers 0.000 description 1
 - 239000004621 biodegradable polymer Substances 0.000 description 1
 - 230000008827 biological function Effects 0.000 description 1
 - 229920001222 biopolymer Polymers 0.000 description 1
 - 210000000601 blood cell Anatomy 0.000 description 1
 - 201000009267 bronchiectasis Diseases 0.000 description 1
 - 239000008366 buffered solution Substances 0.000 description 1
 - 229910000019 calcium carbonate Inorganic materials 0.000 description 1
 - FUFJGUQYACFECW-UHFFFAOYSA-L calcium hydrogenphosphate Chemical compound [Ca+2].OP([O-])([O-])=O FUFJGUQYACFECW-UHFFFAOYSA-L 0.000 description 1
 - 239000001569 carbon dioxide Substances 0.000 description 1
 - 229910002092 carbon dioxide Inorganic materials 0.000 description 1
 - 230000003915 cell function Effects 0.000 description 1
 - 230000012292 cell migration Effects 0.000 description 1
 - 230000005754 cellular signaling Effects 0.000 description 1
 - 235000010980 cellulose Nutrition 0.000 description 1
 - 239000001913 cellulose Substances 0.000 description 1
 - 229920002678 cellulose Polymers 0.000 description 1
 - 229940081733 cetearyl alcohol Drugs 0.000 description 1
 - 238000006243 chemical reaction Methods 0.000 description 1
 - 208000025302 chronic primary adrenal insufficiency Diseases 0.000 description 1
 - 238000010367 cloning Methods 0.000 description 1
 - 229960004126 codeine Drugs 0.000 description 1
 - 238000004040 coloring Methods 0.000 description 1
 - 230000000295 complement effect Effects 0.000 description 1
 - 238000004590 computer program Methods 0.000 description 1
 - 208000018631 connective tissue disease Diseases 0.000 description 1
 - 208000010247 contact dermatitis Diseases 0.000 description 1
 - 238000013270 controlled release Methods 0.000 description 1
 - 238000007796 conventional method Methods 0.000 description 1
 - 235000005822 corn Nutrition 0.000 description 1
 - 229960001681 croscarmellose sodium Drugs 0.000 description 1
 - 235000010947 crosslinked sodium carboxy methyl cellulose Nutrition 0.000 description 1
 - 230000001186 cumulative effect Effects 0.000 description 1
 - XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
 - 235000018417 cysteine Nutrition 0.000 description 1
 - 208000001763 cytomegalovirus retinitis Diseases 0.000 description 1
 - 210000000805 cytoplasm Anatomy 0.000 description 1
 - 229940104302 cytosine Drugs 0.000 description 1
 - 231100000135 cytotoxicity Toxicity 0.000 description 1
 - 230000003013 cytotoxicity Effects 0.000 description 1
 - 230000006378 damage Effects 0.000 description 1
 - 230000003247 decreasing effect Effects 0.000 description 1
 - 238000004925 denaturation Methods 0.000 description 1
 - 230000036425 denaturation Effects 0.000 description 1
 - 239000007933 dermal patch Substances 0.000 description 1
 - 235000019700 dicalcium phosphate Nutrition 0.000 description 1
 - 229940095079 dicalcium phosphate anhydrous Drugs 0.000 description 1
 - PXBRQCKWGAHEHS-UHFFFAOYSA-N dichlorodifluoromethane Chemical compound FC(F)(Cl)Cl PXBRQCKWGAHEHS-UHFFFAOYSA-N 0.000 description 1
 - 235000019404 dichlorodifluoromethane Nutrition 0.000 description 1
 - 229940042935 dichlorodifluoromethane Drugs 0.000 description 1
 - 229940087091 dichlorotetrafluoroethane Drugs 0.000 description 1
 - 229960000920 dihydrocodeine Drugs 0.000 description 1
 - RBOXVHNMENFORY-DNJOTXNNSA-N dihydrocodeine Chemical compound C([C@H]1[C@H](N(CC[C@@]112)C)C3)C[C@H](O)[C@@H]1OC1=C2C3=CC=C1OC RBOXVHNMENFORY-DNJOTXNNSA-N 0.000 description 1
 - XYYVYLMBEZUESM-UHFFFAOYSA-N dihydrocodeine Natural products C1C(N(CCC234)C)C2C=CC(=O)C3OC2=C4C1=CC=C2OC XYYVYLMBEZUESM-UHFFFAOYSA-N 0.000 description 1
 - 206010013023 diphtheria Diseases 0.000 description 1
 - 208000037765 diseases and disorders Diseases 0.000 description 1
 - 239000007884 disintegrant Substances 0.000 description 1
 - 239000002552 dosage form Substances 0.000 description 1
 - 231100000673 dose–response relationship Toxicity 0.000 description 1
 - 239000003937 drug carrier Substances 0.000 description 1
 - 238000002651 drug therapy Methods 0.000 description 1
 - 229940112141 dry powder inhaler Drugs 0.000 description 1
 - 238000010410 dusting Methods 0.000 description 1
 - 239000000975 dye Substances 0.000 description 1
 - 201000006549 dyspepsia Diseases 0.000 description 1
 - 208000007176 earache Diseases 0.000 description 1
 - 230000005684 electric field Effects 0.000 description 1
 - 239000003995 emulsifying agent Substances 0.000 description 1
 - 230000001804 emulsifying effect Effects 0.000 description 1
 - 239000008387 emulsifying waxe Substances 0.000 description 1
 - 210000003038 endothelium Anatomy 0.000 description 1
 - 210000003979 eosinophil Anatomy 0.000 description 1
 - 230000002327 eosinophilic effect Effects 0.000 description 1
 - 201000009580 eosinophilic pneumonia Diseases 0.000 description 1
 - 230000001747 exhibiting effect Effects 0.000 description 1
 - 238000002474 experimental method Methods 0.000 description 1
 - 201000001155 extrinsic allergic alveolitis Diseases 0.000 description 1
 - 208000030533 eye disease Diseases 0.000 description 1
 - 239000000945 filler Substances 0.000 description 1
 - 235000020932 food allergy Nutrition 0.000 description 1
 - 235000013355 food flavoring agent Nutrition 0.000 description 1
 - 235000003599 food sweetener Nutrition 0.000 description 1
 - ZXQYGBMAQZUVMI-GCMPRSNUSA-N gamma-cyhalothrin Chemical compound CC1(C)[C@@H](\C=C(/Cl)C(F)(F)F)[C@H]1C(=O)O[C@H](C#N)C1=CC=CC(OC=2C=CC=CC=2)=C1 ZXQYGBMAQZUVMI-GCMPRSNUSA-N 0.000 description 1
 - 229960002963 ganciclovir Drugs 0.000 description 1
 - 239000007903 gelatin capsule Substances 0.000 description 1
 - 239000008103 glucose Substances 0.000 description 1
 - 235000013922 glutamic acid Nutrition 0.000 description 1
 - 239000004220 glutamic acid Substances 0.000 description 1
 - ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
 - 235000004554 glutamine Nutrition 0.000 description 1
 - 229940049654 glyceryl behenate Drugs 0.000 description 1
 - 208000024908 graft versus host disease Diseases 0.000 description 1
 - 239000008187 granular material Substances 0.000 description 1
 - 238000005469 granulation Methods 0.000 description 1
 - 230000003179 granulation Effects 0.000 description 1
 - 230000036541 health Effects 0.000 description 1
 - 208000007475 hemolytic anemia Diseases 0.000 description 1
 - 208000005252 hepatitis A Diseases 0.000 description 1
 - 208000002672 hepatitis B Diseases 0.000 description 1
 - 231100000334 hepatotoxic Toxicity 0.000 description 1
 - 230000003082 hepatotoxic effect Effects 0.000 description 1
 - 231100000304 hepatotoxicity Toxicity 0.000 description 1
 - 230000007686 hepatotoxicity Effects 0.000 description 1
 - 229920000140 heteropolymer Polymers 0.000 description 1
 - HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
 - 230000013632 homeostatic process Effects 0.000 description 1
 - OROGSEYTTFOCAN-UHFFFAOYSA-N hydrocodone Natural products C1C(N(CCC234)C)C2C=CC(O)C3OC2=C4C1=CC=C2OC OROGSEYTTFOCAN-UHFFFAOYSA-N 0.000 description 1
 - 150000005828 hydrofluoroalkanes Chemical class 0.000 description 1
 - 150000002433 hydrophilic molecules Chemical class 0.000 description 1
 - 230000002209 hydrophobic effect Effects 0.000 description 1
 - 208000022098 hypersensitivity pneumonitis Diseases 0.000 description 1
 - 230000008629 immune suppression Effects 0.000 description 1
 - 230000036039 immunity Effects 0.000 description 1
 - 230000016784 immunoglobulin production Effects 0.000 description 1
 - 229940072221 immunoglobulins Drugs 0.000 description 1
 - 230000001506 immunosuppresive effect Effects 0.000 description 1
 - 230000004054 inflammatory process Effects 0.000 description 1
 - 230000028709 inflammatory response Effects 0.000 description 1
 - 206010022000 influenza Diseases 0.000 description 1
 - 230000004941 influx Effects 0.000 description 1
 - 238000001802 infusion Methods 0.000 description 1
 - 239000004615 ingredient Substances 0.000 description 1
 - 230000002401 inhibitory effect Effects 0.000 description 1
 - 208000014674 injury Diseases 0.000 description 1
 - 239000002919 insect venom Substances 0.000 description 1
 - 230000000968 intestinal effect Effects 0.000 description 1
 - 239000007926 intracavernous injection Substances 0.000 description 1
 - 230000003834 intracellular effect Effects 0.000 description 1
 - 238000011835 investigation Methods 0.000 description 1
 - AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
 - 229960000310 isoleucine Drugs 0.000 description 1
 - 206010023332 keratitis Diseases 0.000 description 1
 - 201000010666 keratoconjunctivitis Diseases 0.000 description 1
 - 231100000225 lethality Toxicity 0.000 description 1
 - 208000032839 leukemia Diseases 0.000 description 1
 - 210000003041 ligament Anatomy 0.000 description 1
 - 229940057995 liquid paraffin Drugs 0.000 description 1
 - 230000033001 locomotion Effects 0.000 description 1
 - 239000007937 lozenge Substances 0.000 description 1
 - 231100000515 lung injury Toxicity 0.000 description 1
 - 235000019359 magnesium stearate Nutrition 0.000 description 1
 - 238000004519 manufacturing process Methods 0.000 description 1
 - 208000008585 mastocytosis Diseases 0.000 description 1
 - 239000011159 matrix material Substances 0.000 description 1
 - 230000007246 mechanism Effects 0.000 description 1
 - 230000001404 mediated effect Effects 0.000 description 1
 - 108020004999 messenger RNA Proteins 0.000 description 1
 - 229960001797 methadone Drugs 0.000 description 1
 - 229930182817 methionine Natural products 0.000 description 1
 - 230000000813 microbial effect Effects 0.000 description 1
 - 239000008108 microcrystalline cellulose Substances 0.000 description 1
 - 229940016286 microcrystalline cellulose Drugs 0.000 description 1
 - 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
 - 239000004005 microsphere Substances 0.000 description 1
 - 230000005012 migration Effects 0.000 description 1
 - 238000013508 migration Methods 0.000 description 1
 - 238000007799 mixed lymphocyte reaction assay Methods 0.000 description 1
 - 239000002324 mouth wash Substances 0.000 description 1
 - 208000010805 mumps infectious disease Diseases 0.000 description 1
 - 230000035772 mutation Effects 0.000 description 1
 - 210000004296 naive t lymphocyte Anatomy 0.000 description 1
 - 230000008693 nausea Effects 0.000 description 1
 - 201000008383 nephritis Diseases 0.000 description 1
 - 230000007935 neutral effect Effects 0.000 description 1
 - 231100000252 nontoxic Toxicity 0.000 description 1
 - 230000003000 nontoxic effect Effects 0.000 description 1
 - 210000001623 nucleosome Anatomy 0.000 description 1
 - 210000004940 nucleus Anatomy 0.000 description 1
 - 229940063149 nutropin Drugs 0.000 description 1
 - 208000007892 occupational asthma Diseases 0.000 description 1
 - GLDOVTGHNKAZLK-UHFFFAOYSA-N octadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCCCO GLDOVTGHNKAZLK-UHFFFAOYSA-N 0.000 description 1
 - QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
 - OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
 - 229940127240 opiate Drugs 0.000 description 1
 - 229940006093 opthalmologic coloring agent diagnostic Drugs 0.000 description 1
 - 210000000056 organ Anatomy 0.000 description 1
 - 235000010603 pastilles Nutrition 0.000 description 1
 - 230000004802 pathophysiological signal Effects 0.000 description 1
 - 230000035699 permeability Effects 0.000 description 1
 - 239000008024 pharmaceutical diluent Substances 0.000 description 1
 - 229940124531 pharmaceutical excipient Drugs 0.000 description 1
 - COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
 - NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
 - 239000010452 phosphate Substances 0.000 description 1
 - 239000013600 plasmid vector Substances 0.000 description 1
 - 235000010989 polyoxyethylene sorbitan monostearate Nutrition 0.000 description 1
 - 239000001818 polyoxyethylene sorbitan monostearate Substances 0.000 description 1
 - 229920002503 polyoxyethylene-polyoxypropylene Polymers 0.000 description 1
 - 229940113124 polysorbate 60 Drugs 0.000 description 1
 - 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
 - 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
 - 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
 - 239000003755 preservative agent Substances 0.000 description 1
 - 230000002335 preservative effect Effects 0.000 description 1
 - 238000012545 processing Methods 0.000 description 1
 - 230000002035 prolonged effect Effects 0.000 description 1
 - 235000013772 propylene glycol Nutrition 0.000 description 1
 - 201000009732 pulmonary eosinophilia Diseases 0.000 description 1
 - 208000036273 reactive airway disease Diseases 0.000 description 1
 - 230000001105 regulatory effect Effects 0.000 description 1
 - 238000011160 research Methods 0.000 description 1
 - 208000023504 respiratory system disease Diseases 0.000 description 1
 - RZJQGNCSTQAWON-UHFFFAOYSA-N rofecoxib Chemical compound C1=CC(S(=O)(=O)C)=CC=C1C1=C(C=2C=CC=CC=2)C(=O)OC1 RZJQGNCSTQAWON-UHFFFAOYSA-N 0.000 description 1
 - 229960000371 rofecoxib Drugs 0.000 description 1
 - 238000013341 scale-up Methods 0.000 description 1
 - 238000013077 scoring method Methods 0.000 description 1
 - 238000012216 screening Methods 0.000 description 1
 - 230000028327 secretion Effects 0.000 description 1
 - 230000036303 septic shock Effects 0.000 description 1
 - 235000004400 serine Nutrition 0.000 description 1
 - 206010040400 serum sickness Diseases 0.000 description 1
 - 150000004760 silicates Chemical class 0.000 description 1
 - 238000010181 skin prick test Methods 0.000 description 1
 - 231100000370 skin sensitisation Toxicity 0.000 description 1
 - FQENQNTWSFEDLI-UHFFFAOYSA-J sodium diphosphate Chemical compound [Na+].[Na+].[Na+].[Na+].[O-]P([O-])(=O)OP([O-])([O-])=O FQENQNTWSFEDLI-UHFFFAOYSA-J 0.000 description 1
 - 229940048086 sodium pyrophosphate Drugs 0.000 description 1
 - 229940080313 sodium starch Drugs 0.000 description 1
 - 210000004872 soft tissue Anatomy 0.000 description 1
 - 239000008247 solid mixture Substances 0.000 description 1
 - 239000007790 solid phase Substances 0.000 description 1
 - 239000002904 solvent Substances 0.000 description 1
 - 235000011076 sorbitan monostearate Nutrition 0.000 description 1
 - 239000001587 sorbitan monostearate Substances 0.000 description 1
 - 229940035048 sorbitan monostearate Drugs 0.000 description 1
 - 235000019337 sorbitan trioleate Nutrition 0.000 description 1
 - 229960000391 sorbitan trioleate Drugs 0.000 description 1
 - 210000004988 splenocyte Anatomy 0.000 description 1
 - 239000008117 stearic acid Substances 0.000 description 1
 - 210000000434 stratum corneum Anatomy 0.000 description 1
 - 230000035882 stress Effects 0.000 description 1
 - 231100000617 superantigen Toxicity 0.000 description 1
 - 230000004083 survival effect Effects 0.000 description 1
 - 238000013268 sustained release Methods 0.000 description 1
 - 239000012730 sustained-release form Substances 0.000 description 1
 - 239000003765 sweetening agent Substances 0.000 description 1
 - 230000008961 swelling Effects 0.000 description 1
 - 230000009885 systemic effect Effects 0.000 description 1
 - 239000000454 talc Substances 0.000 description 1
 - 229910052623 talc Inorganic materials 0.000 description 1
 - 230000008685 targeting Effects 0.000 description 1
 - 210000002435 tendon Anatomy 0.000 description 1
 - 125000004213 tert-butoxy group Chemical group [H]C([H])([H])C(O*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
 - MHXBHWLGRWOABW-UHFFFAOYSA-N tetradecyl octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCCCCCCCCCCCCCC MHXBHWLGRWOABW-UHFFFAOYSA-N 0.000 description 1
 - 235000019818 tetrasodium diphosphate Nutrition 0.000 description 1
 - 239000001577 tetrasodium phosphonato phosphate Substances 0.000 description 1
 - 239000002562 thickening agent Substances 0.000 description 1
 - 235000008521 threonine Nutrition 0.000 description 1
 - 206010043554 thrombocytopenia Diseases 0.000 description 1
 - 210000001519 tissue Anatomy 0.000 description 1
 - 208000004371 toothache Diseases 0.000 description 1
 - 238000011200 topical administration Methods 0.000 description 1
 - 230000000699 topical effect Effects 0.000 description 1
 - 231100000167 toxic agent Toxicity 0.000 description 1
 - 239000003440 toxic substance Substances 0.000 description 1
 - 231100000027 toxicology Toxicity 0.000 description 1
 - 235000010487 tragacanth Nutrition 0.000 description 1
 - 239000000196 tragacanth Substances 0.000 description 1
 - 229940116362 tragacanth Drugs 0.000 description 1
 - 230000002103 transcriptional effect Effects 0.000 description 1
 - 238000012546 transfer Methods 0.000 description 1
 - 230000005945 translocation Effects 0.000 description 1
 - 238000002054 transplantation Methods 0.000 description 1
 - 230000008733 trauma Effects 0.000 description 1
 - 230000000472 traumatic effect Effects 0.000 description 1
 - CYRMSUTZVYGINF-UHFFFAOYSA-N trichlorofluoromethane Chemical compound FC(Cl)(Cl)Cl CYRMSUTZVYGINF-UHFFFAOYSA-N 0.000 description 1
 - 229940029284 trichlorofluoromethane Drugs 0.000 description 1
 - 208000035408 type 1 diabetes mellitus 1 Diseases 0.000 description 1
 - 230000029069 type 2 immune response Effects 0.000 description 1
 - 201000008297 typhoid fever Diseases 0.000 description 1
 - 235000002374 tyrosine Nutrition 0.000 description 1
 - OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
 - 231100000397 ulcer Toxicity 0.000 description 1
 - 229940035893 uracil Drugs 0.000 description 1
 - 229960005486 vaccine Drugs 0.000 description 1
 - 208000007089 vaccinia Diseases 0.000 description 1
 - 239000004474 valine Substances 0.000 description 1
 - 231100000611 venom Toxicity 0.000 description 1
 - 208000034280 venom allergy Diseases 0.000 description 1
 - 231100000889 vertigo Toxicity 0.000 description 1
 - 239000013603 viral vector Substances 0.000 description 1
 - 230000003612 virological effect Effects 0.000 description 1
 - 208000009935 visceral pain Diseases 0.000 description 1
 - 229940053728 vitrasert Drugs 0.000 description 1
 - 239000008215 water for injection Substances 0.000 description 1
 - 239000003871 white petrolatum Substances 0.000 description 1
 
Images
Classifications
- 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
 - A61K39/00—Medicinal preparations containing antigens or antibodies
 - A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
 
 - 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
 - A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
 - A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
 
 - 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
 - A61P11/00—Drugs for disorders of the respiratory system
 
 - 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
 - A61P11/00—Drugs for disorders of the respiratory system
 - A61P11/06—Antiasthmatics
 
 - 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
 - A61P13/00—Drugs for disorders of the urinary system
 - A61P13/12—Drugs for disorders of the urinary system of the kidneys
 
 - 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
 - A61P19/00—Drugs for skeletal disorders
 - A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
 
 - 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
 - A61P21/00—Drugs for disorders of the muscular or neuromuscular system
 - A61P21/04—Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
 
 - 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
 - A61P25/00—Drugs for disorders of the nervous system
 
 - 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
 - A61P27/00—Drugs for disorders of the senses
 - A61P27/02—Ophthalmic agents
 
 - 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
 - A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
 
 - 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
 - A61P3/00—Drugs for disorders of the metabolism
 - A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
 - A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
 
 - 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
 - A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
 - A61P31/04—Antibacterial agents
 
 - 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
 - A61P37/00—Drugs for immunological or allergic disorders
 - A61P37/02—Immunomodulators
 
 - 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
 - A61P37/00—Drugs for immunological or allergic disorders
 - A61P37/02—Immunomodulators
 - A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
 
 - 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
 - A61P37/00—Drugs for immunological or allergic disorders
 - A61P37/08—Antiallergic agents
 
 - 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
 - A61P5/00—Drugs for disorders of the endocrine system
 - A61P5/14—Drugs for disorders of the endocrine system of the thyroid hormones, e.g. T3, T4
 
 - 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
 - A61P7/00—Drugs for disorders of the blood or the extracellular fluid
 - A61P7/04—Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
 
 - 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
 - A61P7/00—Drugs for disorders of the blood or the extracellular fluid
 - A61P7/06—Antianaemics
 
 - 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
 - A61P9/00—Drugs for disorders of the cardiovascular system
 - A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
 
 - 
        
- C—CHEMISTRY; METALLURGY
 - C07—ORGANIC CHEMISTRY
 - C07K—PEPTIDES
 - C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
 - C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
 - C07K14/35—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Mycobacteriaceae (F)
 
 - 
        
- C—CHEMISTRY; METALLURGY
 - C07—ORGANIC CHEMISTRY
 - C07K—PEPTIDES
 - C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
 - C07K7/04—Linear peptides containing only normal peptide links
 - C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
 
 - 
        
- C—CHEMISTRY; METALLURGY
 - C07—ORGANIC CHEMISTRY
 - C07K—PEPTIDES
 - C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
 - C07K7/04—Linear peptides containing only normal peptide links
 - C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
 
 - 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
 - A61K39/00—Medicinal preparations containing antigens or antibodies
 - A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
 - A61K2039/55511—Organic adjuvants
 - A61K2039/55516—Proteins; Peptides
 
 - 
        
- A—HUMAN NECESSITIES
 - A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
 - A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
 - A61K38/00—Medicinal preparations containing peptides
 
 - 
        
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
 - Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
 - Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
 - Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
 - Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
 
 
Definitions
- the present invention relates to novel peptides derivable from the polypeptide chaperonin 60.1 and to their use in medicine, such as for the prevention and/or treatment of inflammatory conditions.
 - Heat shock polypeptides are a family of molecules found in all organisms, whose function is to aid the biological processing and stability of biological molecules (Zugel & Kauffman (1999) Role of heat shock polypeptides in protection from and pathogenesis of infectious diseases . Clin. Microbiol. Rev. (12)1: 19-39; Ranford et al. (2000) Chaperonins are cell signalling polypeptides:—the unfolding biology of molecular chaperones . Exp. Rev. Mol. Med., 15 September, www.ermn.cbcu.cam.ac.uk/).
 - Heat shock polypeptides are located in every cellular compartment, and possess the ability to interact with a wide range of biological molecules.
 - the heat shock polypeptides aid and influence polypeptide folding and polypeptide translocation at any time from assembly through to disassembly of the polypeptide and any complexes thereof.
 - the helper nature of the heat shock polypeptides has led to them to also being known as molecular chaperones (Laskey et al. (1978) Nucleosomes are assembled by an acidic polypeptide, which binds histones and transfers them to DNA . Nature (275): 416-420).
 - Heat shock polypeptides are synthesised by cells in response to environmental stress, which includes, but is not limited to temperature changes (both increases and decreases), and pathophysiological signals such as cytokines.
 - environmental stress includes, but is not limited to temperature changes (both increases and decreases), and pathophysiological signals such as cytokines.
 - heat shock polypeptides use their ability to process other polypeptides to protect such polypeptides from any denaturation that may occur due to the presence of the stress. This mechanism also serves to protect cells which contain the protein.
 - Chaperonin polypeptides are a subgroup of heat shock polypeptides whose role in polypeptide folding is well known. There are two families of chaperonin polypeptide, the chaperonin 60 (approximately 60 kDa) and chaperonin 10 (approximately 10 kDa) families (Ranford, 2000). The best characterised chaperonins are those derived from E. coli , from which the characteristic structure of chaperonin 60 and chaperonin 10 has been established. The chaperonin complexes of most other organisms also substantially conform to this characteristic structure.
 - chaperonins The characteristic structure of chaperonins is a complex formed from two heptamer rings (composed of seven chaperonin 60 monomers) which face one another and are capped by a heptamer ring composed of chaperonin 10 monomers.
 - chaperonins assist polypeptide folding when the target polypeptide enters the central core of the ringed heptamers, and on the subsequent release of energy from ATP the target polypeptide is released from the central core by a conformational change in the chaperonin structure (Ranson et al. (1998) Review Article: Chaperones . Biochem. J. (333): 233-242).
 - M. tuberculosis Mycobacterium tuberculosis ( M. tuberculosis ) produces Chaperonin 60.1 (Cpn60.1), a polypeptide that is named based on its amino acid sequence identity to other known chaperonins. Further M. tuberculosis chaperonin polypeptides are chaperonin 10 (Cpn10) and chaperonin 60.2 (Cpn60.2). Cpn60.2 exhibits 59.6% amino acid sequence identity and 65.6% nucleic acid sequence identity to Cpn60.1.
 - Peptide 4 having an amino acid sequence: DGSVVVNKVSELPAGHGLNVNTLSYGDLAAD. (SEQ ID NO: 1). Peptide 4 exhibits anti-inflammatory activity and has been shown to significantly reduce the recruitment of eosinophils in an animal model of allergic airway inflammation.
 - the present invention is based upon the unexpected finding that certain novel sub-fragments of DGSVVVNKVSELPAGHGLNVNTLSYGDLAAD (SEQ ID NO: 1) exhibit biological activity, in particular an ability to inhibit leukocyte diapedesis.
 - the novel peptides of the present invention are particularly suited for development as pharmaceuticals owing to their comparatively short amino acid chain length which renders them convenient to prepare and isolate in high yield. They also indicated to possess improved biological stability in vivo relative to MtCpn60.1 and known peptide fragments thereof.
 - the invention provides an isolated or recombinant peptide molecule consisting of an amino acid sequence selected from the group:
 - SEQ ID NO: 2 (i) DGSVVVNKVSELPAGH; (SEQ ID NO: 3) (ii) GLNVNTLSYGDLAAD; (SEQ ID NO: 4) (iii) SELPAGHGLNVNLTS; (SEQ ID NO: 5) (iv) DGSVVVNKVS; (SEQ ID NO: 6) (v) ELPAGHGLNV; and (SEQ ID NO: 7) (vi) NTLSYGDLAAD; or a functionally equivalent fragment or variant thereof.
 - SEQ ID NO: 2 (i) DGSVVVNKVSELPAGH; (SEQ ID NO: 3) (ii) GLNVNTLSYGDLAAD; and (SEQ ID NO: 4) (iii) SELPAGHGLNVNLTS; or a functionally equivalent fragment or variant thereof.
 - peptide and/or variant or fragment thereof which possesses a function (e.g. biological activity) that is identical or substantially similar to any function displayed by or attributed to one or more of the defined amino acid sequences (i) to (vi).
 - peptides consisting of the amino acid sequences defined in (i) to (vi) exhibit anti-inflammatory properties permitting their use in the prevention and/or treatment of a variety of diseases and disorders, including arthritis and pain.
 - Functional equivalence in respect of a particular biological activity can be measured using conventional models and methods; for example, by measuring paw latency on a heated plate or measuring the release of inflammatory cytokines in vivo or in vitro.
 - variant is meant a peptide having an amino acid sequence which has or 70% or more, such as 75%, 80%, 85%, 90% or 95% identity to a sequence defined in any of the sequence lists (i) to (vi) above.
 - variant refers to polypeptides and peptides differing from naturally occurring molecules by amino acid insertions, deletions, and substitutions, created using, e.g., recombinant DNA techniques.
 - Guidance in determining which amino acid residues may be replaced, added or deleted without abolishing activities of interest may be found by comparing the sequence of the particular polypeptide with that of homologous peptides and minimizing the number of amino acid sequence changes made in regions of high homology (conserved regions) or by replacing amino acids with consensus sequence.
 - recombinant variants encoding these same or similar polypeptides may be synthesized or selected by making use of the “redundancy” in the genetic code.
 - Various codon substitutions such as the silent changes which produce various restriction sites, may be introduced to optimize cloning into a plasmid or viral vector or expression in a particular prokaryotic or eukaryotic system.
 - Mutations in the polynucleotide sequence may be reflected in the polypeptide or domains of other peptides added to the polypeptide to modify the properties of any part of the polypeptide, to change characteristics such as ligand-binding affinities, interchain affinities, or degradation/turnover rate.
 - amino acid “substitutions” are the result of replacing one amino acid with another amino acid having similar structural and/or chemical properties, i.e., conservative amino acid replacements. “Conservative” amino acid substitutions may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues involved.
 - nonpolar (hydrophobic) amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan, and methionine; polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine, and glutamine; positively charged (basic) amino acids include arginine, lysine, and histidine; and negatively charged (acidic) amino acids include aspartic acid and glutamic acid.
 - “Insertions” or “deletions” are preferably in the range of about 1 to 10 amino acids, more preferably 1 to 5 amino acids, such as 1, 2, 3, 4 or 5 amino acids. The variation allowed may be experimentally determined by systematically making insertions, deletions, or substitutions of amino acids in a polypeptide molecule using recombinant DNA techniques and assaying the resulting recombinant variants for biological activity.
 - insertions, deletions or non-conservative alterations can be engineered to produce altered polypeptides.
 - Such alterations can, for example, alter one or more of the biological functions or biochemical characteristics of the polypeptides of the invention.
 - such alterations may change polypeptide characteristics such as ligand-binding affinities, interchain affinities, or degradation/turnover rate.
 - such alterations can be selected so as to generate polypeptides that are better suited for expression, scale up and the like in the host cells chosen for expression.
 - Fragments of the peptides of the present invention which are capable of exhibiting biological activity are also encompassed by the present invention.
 - Such fragments may be in linear form or they may be cyclized using known methods, for example, as described in H. U. Saragovi, et al., Bio/Technology 10, 773-778 (1992) and in R. S. McDowell, et al., J. Amer. Chem. Soc. 114, 9245-9253 (1992), both of which are incorporated herein by reference.
 - Such fragments may be fused to carrier molecules such as immunoglobulins for many purposes, including increasing the valency of protein binding sites.
 - the present invention further provides an isolated or recombinant nucleic acid molecule consisting of a polynucleotide sequence selected from the group consisting of:
 - polynucleotide refers to a heteropolymer of nucleotides or the sequence of these nucleotides. It also refers to DNA or RNA of genomic or synthetic origin which may be single-stranded or double-stranded and may represent the sense or the antisense strand, to peptide nucleic acid (PNA) or to any DNA-like or RNA-like material.
 - PNA peptide nucleic acid
 - A is adenine
 - C cytosine
 - T thymine
 - G guanine
 - N A, C, G or T (U).
 - nucleic acid segments provided by this invention may be assembled from fragments of the genome and short oligonucleotide linkers, or from a series of oligonucleotides, or from individual nucleotides, to provide a synthetic nucleic acid which is capable of being expressed in a recombinant transcriptional unit comprising regulatory elements derived from a microbial or viral operon, or a eukaryotic gene.
 - the polynucleotides of the invention include naturally occurring or wholly or partially synthetic DNA, e.g., cDNA and genomic DNA, and RNA, e.g., mRNA.
 - the polynucleotides may include the entire coding region of the cDNA or may represent a portion of the coding region of the cDNA.
 - the present invention also provides genes corresponding to the cDNA sequences disclosed herein.
 - the corresponding genes can be isolated in accordance with known methods using the sequence information disclosed herein. Such methods include the preparation of probes or primers from the disclosed sequence information for identification and/or amplification of genes in appropriate genomic libraries or other sources of genomic materials. Further 5′ and 3′ sequence can be obtained using methods known in the art.
 - full length cDNA or genomic DNA that corresponds to any of the polynucleotides of the invention can be obtained by screening appropriate cDNA or genomic DNA libraries under suitable hybridization conditions using any of the polynucleotides of the invention or a portion thereof as a probe.
 - the polynucleotides of the invention may be used as the basis for suitable primer(s) that allow identification and/or amplification of genes in appropriate genomic DNA or cDNA libraries.
 - the nucleic acid sequences of the invention can be assembled from ESTs and sequences (including cDNA and genomic sequences) obtained from one or more public databases, such as dbEST, gbpri, and UniGene.
 - the EST sequences can provide identifying sequence information, representative fragment or segment information, or novel segment information for the full-length gene.
 - polynucleotides of the invention also provide polynucleotides including nucleotide sequences that are substantially equivalent to the polynucleotides recited above.
 - Polynucleotides according to the invention can have, e.g., at least about 65%, at least about 70%, at least about 75%, at least about 80%, 81%, 82%, 83%, 84%, more typically at least about 85%, 86%, 87%, 88%, 89%, more typically at least about 90%, 91%, 92%, 93%, 94%, and even more typically at least about 95%, 96%, 97%, 98%, 99% sequence identity to a polynucleotide recited above.
 - nucleic acid sequence fragments that hybridize under stringent conditions to any of the nucleotide sequences of the invention, or complements thereof, which fragment is greater than about 5 nucleotides, preferably 7 nucleotides, more preferably greater than 9 nucleotides and most preferably greater than 17 nucleotides. Fragments of, for example 15, 17, or 20 nucleotides or more that are selective for (i.e. specifically hybridize to) any one of the polynucleotides of the invention are contemplated.
 - Probes capable of specifically hybridizing to a polynucleotide can differentiate polynucleotide sequences of the invention from other polynucleotide sequences in the same family of genes or can differentiate human genes from genes of other species, and are preferably based on unique nucleotide sequences.
 - sequences falling within the scope of the present invention are not limited to these specific sequences, but also include allelic and species variations thereof. Allelic and species variations can be routinely determined by comparing the sequence provided in the invention, a representative fragment thereof, or a nucleotide sequence at least 90% identical, preferably 95% identical, to the invention with a sequence from another isolate of the same species. Furthermore, to accommodate codon variability, the invention includes nucleic acid molecules coding for the same amino acid sequences as do the specific ORFs disclosed herein. In other words, in the coding region of an ORF, substitution of one codon for another codon that encodes the same amino acid is expressly contemplated.
 - stringent is used to refer to conditions that are commonly understood in the art as stringent.
 - Stringent conditions can include highly stringent conditions (i.e., hybridization to filter-bound DNA in 0.5 M NaHPO 4 , 7% sodium dodecyl sulfate (SDS), 1 mM EDTA at 65° C., and washing in 0.1.times. SSC/0.1% SDS at 68° C.), and moderately stringent conditions (i.e., washing in 0.2.times. SSC/0.1% SDS at 42° C.).
 - highly stringent conditions i.e., hybridization to filter-bound DNA in 0.5 M NaHPO 4 , 7% sodium dodecyl sulfate (SDS), 1 mM EDTA at 65° C., and washing in 0.1.times. SSC/0.1% SDS at 68° C.
 - moderately stringent conditions i.e., washing in 0.2.times. SSC/0.1% SDS at 42° C.
 - additional exemplary stringent hybridization conditions include washing in 6 times. SSC/0.05% sodium pyrophosphate at 37° C. (for 14-base oligonucleotides), 48° C. (for 17-base oligonucleotides), 55° C. (for 20-base oligonucleotides) and 60° C. (for 23-base oligonucleotides).
 - SSC is defined as 0.15M NaCl, 0.015M Sodium Citrate, pH 7.2.
 - identity is meant the number or percentage (dependent on presentation of the results) of amino acid residues or nucleic acid residues in a candidate sequence that are identical with the amino acid residues or nucleic acid residues of the sequence of interest, after aligning the sequences and introducing gaps, if necessary to achieve maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity.
 - the percentage sequence identity between two polynucleotides or polypeptides may be determined using suitable computer programs, for example the GAP program of the University of Wisconsin Genetic Computing Group and it will be appreciated that percent identity is calculated in relation to polypeptides whose sequence has been aligned optimally.
 - the alignment may alternatively be carried out using the Clustal W program (Thompson et al., (1994) Nucleic Acids Res. 22, 4673-80).
 - the parameters used may be as follows: fast pairwise alignment parameters: K-tuple (word) size; 1, window size; 5, gap penalty; 3, number of top diagonals; 5. Scoring method: x percent; multiple alignment parameters: gap open penalty; 10, gap extension penalty; 0.05. Scoring matrix: BLOSUM.
 - Sequence identity may be determined, e.g., using the Jotun Hein method (Hein, J. (1990) Methods Enzymol. 183:626-645). Identity between sequences can also be determined by other methods known in the art, e.g. by varying hybridization conditions.
 - MtCpn60.1 may be cloned and expressed using the methods described in T.H. Kong et al., Proc. Natl. Acad. Sci., 1993, 90, 2608-2612 and J. C. Lewthwaite et al, Infection and Immunity, 2001, 69(12), 7349-7355. MtCpn60.1 is also commercially available from Lionex (Germany).
 - the peptides of the present invention may be prepared and/or isolated using conventional methods known in the art. For example, by solution or solid phase synthesis using traditional methods or using a solid phase automated synthesizer, for example as described in I. Coin, Nature Protocols, 2007, 2, 3247-3256.
 - the peptides of the present invention are prepared by Fmoc solid phase synthesis using methods analogous to those described in G.B. Fields and R.L. Noble, Int. J. Peptide Protein Res., 1990, 35(3), 161-214.
 - a peptide or nucleic acid molecule as defined herein for use in medicine is provided.
 - the invention provides the use of a peptide or nucleic acid molecule as defined herein for the modulation of diapedesis, i.e. the movement or passage of blood cells, preferably white blood cells, through intact capillary walls into surrounding body tissue, in a human subject.
 - the peptide and nucleic acid molecules of the present invention are also indicated to be useful in the prevention and/or treatment of any condition, disease and/or disorder in a human subject which is associated with an increase in the flow of white blood cells across the endothelium.
 - conditions include, but are not limited to, acute and/or chronic inflammatory conditions such as ischemia-reperfusion injury (including coronary thrombosis and cerebral artery blockage), autoimmune diseases such as multiple sclerosis, allergic conditions such as asthma, chronic obstructive pulmonary disease and altitude sickness.
 - the peptide or nucleic acid molecule of the present invention is used for the treatment and/or prevention of acute and/or chronic inflammatory conditions, particularly non-allergic inflammation.
 - inflammatory conditions which may be prevented and/or treated with the peptide or nucleic acid molecules of the present invention include conditions associated with eosinophila and/or neutrophilia.
 - Preferred examples of acute and/or chronic inflammatory conditions include intimation associated with infection (such as septic shock, sepsis or systemic inflammatory response syndrome (SIRS)), ischemia-reperfusion injury including coronary thrombosis and cerebral artery blockage, shock lung syndrome, endotoxin lethality, arthritis (particularly rheumatoid arthritis or chronic inflammatory arthritis), complement-mediated hyperacute rejection, nephritis, cytokine or chemokine-induced lung injury, non-allergic asthma, inflammatory bowel disease and Crohn's disease.
 - infection such as septic shock, sepsis or systemic inflammatory response syndrome (SIRS)
 - ischemia-reperfusion injury including coronary thrombosis and cerebral artery blockage
 - shock lung syndrome such as endotoxin lethality
 - arthritis particularly rheumatoid arthritis or chronic inflammatory arthritis
 - complement-mediated hyperacute rejection such as nephritis, cytokine or
 - the invention further provides a method of preventing and/or treating an acute and/or chronic inflammatory condition which comprises administering to a mammal, including man, a peptide or nucleic acid molecule as defined herein.
 - the invention still further provides the use of a peptide or nucleic acid molecule as defined herein in the manufacture of a medicament for the prevention and/or treatment of an acute and/or chronic inflammatory condition.
 - the present invention provides the use of a peptide or nucleic acid molecule as defined herein for the prevention and/or treatment of chronic obstructive pulmonary disease.
 - an isolated or recombinant polypeptide comprising the amino acid sequence of FIG. 1 (i.e. MtCpn60.1) or a functionally equivalent fragment or variant thereof for the prevention and/or treatment of chronic obstructive pulmonary disease.
 - Preferred peptide fragments of MtCpn60.1 are between 6 and 400 residues in length.
 - Particularly preferred peptide fragments of MtCpn60.1 are between 15 to 100 residues in length.
 - Examples of particularly preferred peptide fragments of MtCpn60.1 include peptides consisting of or comprising the following amino acid sequences:
 - nucleic acid molecule comprising the nucleotide sequence of FIG. 1 (i.e. MtCpn60.1); or a polynucleotide sequence which has more than 70%, such as 75%, 80%, 85%, 90% or 95% identity to a polynucleotide sequence of FIG. 1 ; or a polynucleotide sequence which hybridizes to the polynucleotide sequence of FIG. 1 under conditions of 2 ⁇ SSC, 65° C.; or a fragment of a polynucleotide sequence as defined in FIG. 1 ; which polynucleotide sequence encodes a polypeptide having an amino acid sequence as defined in FIG. 1 or a functionally equivalent fragment or variant thereof.
 - the present invention provides the use of a peptide or nucleic acid molecule as defined herein for the prevention and/or treatment of autoimmune disorders.
 - autoimmune disorders are included conditions where it can be shown that the autoimmune process contributes to the pathogenesis of a disease. Such disorders are typically associated with a T helper lymphocyte-1 (Th-1) type immune response.
 - Th-1 T helper lymphocyte-1
 - Preferred autoimmune disorders include rheumatoid arthritis and multiple sclerosis.
 - the immunosuppressive effects of the peptide or nucleic acid molecules of the present invention against rheumatoid arthritis may be determined in an experimental animal model system.
 - the experimental model system is adjuvant induced arthritis in rats, and the protocol is described by J. Holoshitz, et at., 1983 , Science, 219:56, or by B. Waksman et al., 1963, Int. Arch. Allergy Appl. Immunol., 23:129.
 - Induction of the disease can be caused by a single injection, generally intradermally, of a suspension of killed Mycobacterium tuberculosis in complete Freund's adjuvant (CFA).
 - CFA complete Freund's adjuvant
 - the route of injection can vary, but rats may be injected at the base of the tail with an adjuvant mixture.
 - the polypeptide is administered in phosphate buffered solution (PBS) at a dose of about 1-5 mg/kg.
 - PBS phosphate buffered solution
 - the control consists of administering PBS only.
 - the procedure for testing the effects of the test compound would consist of intradermally injecting killed Mycobacterium tuberculosis in CFA followed by immediately administering the test compound and subsequent treatment every other day until day 24.
 - an overall arthritis score may be obtained as described by J. Holoskitz above. An analysis of the data would reveal that the test compound would have a dramatic affect on the swelling of the joints as measured by a decrease of the arthritis score.
 - the present invention provides the use of a peptide or nucleic acid molecule as defined herein for the prevention and/or treatment of allergic conditions.
 - allergic conditions and disorders which may be prevented and/or treated with the peptide or nucleic acid molecules of the present invention include eczema, dermatitis, allergic rhinitis (hay fever), allergic airways diseases, hyper-eosinophilic syndrome, contact dermatitis; respiratory diseases characterized by eosinophilic airway inflammation and airway hyper-responsiveness, such as asthma, including allergic asthma and intrinsic asthma, allergic bronchopulmonary aspergillosis, eosinophilic pneumonia, allergic bronchitis bronchiectasis, occupational asthma, reactive airway disease syndrome, interstitial lung disease, hyper-eosinophilic syndrome, parasitic lung disease; anaphylaxis, serum sickness, drug reactions, food allergies, insect venom allergies, mastocytosis, hypersensitivity pneumonitis, urticaria, angioe
 - Suitable allergic disorders and conditions include asthma, allergic rhinitis, eczema and anaphylaxis.
 - allergic disorders and “allergic conditions” as used herein are included conditions associated with a T helper lymphocyte-2 (Th-2) type immune response.
 - Th-2 T helper lymphocyte-2
 - IgE levels occur and Th-2 immune responses predominate over Th-1 responses, resulting in inflammatory response.
 - the therapeutic effects of the polypeptides or antagonists thereof on allergic reactions can be evaluated by in vivo animals models such as the cumulative contact enhancement test (Lastborn et al., Toxicology 125: 59-66, 1998), skin prick test (Hoffmann et al., Allergy 54: 446-54, 1999), guinea pig skin sensitization test (Vohr et al., Arch. Toxocol. 73: 501-9), and murine local lymph node assay (Kimber et al., J. Toxicol. Environ. Health 53: 563-79).
 - Suitable assays for thymocyte or splenocyte cytotoxicity include, without limitation, those described in: Current Protocols in Immunology, Ed by J. E. Coligan et al., Strober, Pub. Greene Publishing Associates and Wiley-Interscience (Chapter 3, In vitro assays for Mouse Lymphocyte Function 3.1-3.19; Chapter 7, Immunologic studies in Humans); Herrmann et al., Proc. Natl. Acad. Sci. USA 78:2488-2492, 1981; Herrmann et al., J. Immunol. 128:1968-1974, 1982; Handa et al., J. Immunol. 135:1564-1572, 1985; Takai et al., I. Immunol.
 - T-cell-dependent immunoglobulin responses and isotype switching (which will identify, among others, proteins that modulate T-cell dependent antibody responses and that affect Th1/Th2 profiles) include, without limitation, those described in: Maliszewski, J. Immunol. 144:3028-3033, 1990; and Assays for B cell function: In vitro antibody production, Mond, J. J. and Brunswick, M. In Current Protocols in Immunology. J. E. Coligan et al., eds. Vol 1 pp. 3.8.1-3.8.16, John Wiley and Sons, Toronto. 1994.
 - MLR Mixed lymphocyte reaction
 - Dendritic cell-dependent assays (which will identify, among others, proteins expressed by dendritic cells that activate naive T-cells) include, without limitation, those described in: Guery et al.; J. Immunol. 134:536-544, 1995; Inaba et al., J. Experimental Medicine 173:549-559, 1991; Macatonia et al., J. Immunol. 154:5071-5079, 1995; Porgador et al., J. Experimental Medicine 182:255-260, 1995; Nair et al., J. Virology 67:4062-4069, 1993; Huang et al., Science 264:961-965, 1994; Macatonia et al., J. Experimental Medicine 169:1255-1264, 1989; Bhardwaj et al., J. Clinical Investigation 94:797-807, 1994; and Inaba et al., J. Experimental Medicine 172:631-640, 1990.
 - lymphocyte survival/apoptosis (which will identify, among others, proteins that prevent apoptosis after superantigen induction and proteins that regulate lymphocyte homeostasis) include, without limitation, those described in: Darzynkiewicz et al., Cytometry 13:795-808, 1992; Gorczyca et al., Leukemia 7:659-670, 1993; Gorczyca et al., Cancer Research 53:1945-1951, 1993; Itoh et al., Cell 66:233-243, 1991; Zacharchuk, J. Immunol. 145:4037-4045, 1990; Zamai et al., Cytometry 14:891-897, 1993; Gorczyca et al., Int. J. Oncol. 1:639-648, 1992.
 - Assays for proteins that influence early steps of T-cell commitment and development include, without limitation, those described in: Antica et al., Blood 84:111-117, 1994; Fine et al., Cellular Immunology 155:111-122, 1994; Galy et al., Blood 85:2770-2778, 1995; Toki et al., Proc. Natl. Acad. Sci. USA 88:7548-7551, 1991.
 - the present invention provides the use of a peptide or nucleic acid molecule as defined herein for the prevention and/or treatment of pain.
 - pain includes analgesia and/or hyperanalgesia.
 - hyperanalgesia means an earlier onset, an increase in the severity, an increase of the duration, and/or increased susceptibility to the feeling of pain.
 - Examples of pain which may be prevented and/or treated with the peptide or nucleic acid molecules of the present invention include backache; headache; toothache; earache; arthritis; gout; soft tissue trauma; ligament and/or tendon traumatic damage; broken bones; cancer pain; post-operative pain; menstrual pain; obstetric pain; renal tract pain; visceral pain; burns; abscesses; and other infections.
 - the medicament further comprises at least one additive for assisting or augmenting the action of the peptide molecule or nucleic acid molecule.
 - the additive is selected from at least one of paracetamol, aspirin, ibuprofen, other non-steroidal anti-inflammatory drugs (NSAIDS), cylooxygenase-2-selective inhibitors (CSIs), opiates.
 - additive is meant an ingredient that is provided in addition to the main medicament and that is pharmacologically active either independently or in combination with the main medicament, whereby its presence in the medicament assists or augments the action of the main medicament.
 - the medicament provides prolonged or sustained pain relief.
 - Pain relief is usually achieved by oral or parenteral medication. Effective pain relief can be achieved in most cases with widely known pain relief drugs such as paracetamol, aspirin and other non-steroidal anti-inflammatory drugs (NSAIDS) such as ibuprofen, and cylooxygenase-2-selective inhibitors (CSIs).
 - NNSAIDS non-steroidal anti-inflammatory drugs
 - CSIs cylooxygenase-2-selective inhibitors
 - Narcotic analgesics act on specific receptors in the Central Nervous System (CNS). Codeine and dihydrocodeine are moderately potent narcotic analgesics and have a low potential for addiction. Other more potent narcotic analgesics, such as morphine and methadone can be used to control severe pain.
 - chaperonins as pain relief agents over current pain relief drugs is that they may have fewer adverse side-effects. It has been estimated that two billion people carry M. tuberculosis without developing tuberculosis. Carriage of M. tuberculosis has not been associated with the side effects which are seen with commonly known pain-relief medication such as gastro-intestinal side-effects, cardiovascular complications, hepatotoxicity, Reye Syndrome or addiction. In addition, the analgesic effect of chaperonins is indicated to be of longer duration than that of conventional pain relief agents.
 - treatment means reducing alleviating or eliminating one or more symptoms of the condition which is being treated, relative to the symptoms prior to treatment.
 - symptoms which may be affected include eosinophilia, decreased secretion of particular cytokines, a Th2-baised immune response, allergic response and the presence of autoantibodies.
 - prevention means delaying or preventing the onset of a condition or reducing its severity, as assessed by the appearance or extent of one or more symptoms of said condition.
 - the invention provides a pharmaceutical composition comprising or consisting of a peptide or nucleic acid molecule of the present invention and a pharmaceutically-acceptable excipient.
 - the molecules, medicaments and pharmaceutical compositions of the present invention may be delivered using an injectable sustained-release drug delivery system. These are designed specifically to reduce the frequency of injections.
 - Nutropin Depot which encapsulates recombinant human growth hormone (rhGH) in biodegradable microspheres that, once injected, release rhGH slowly over a sustained period.
 - delivery is performed intra-muscularly (i.m.) and/or sub-cutaneously (s.c.) and/or intravenously (i.v.).
 - the molecules, medicaments and pharmaceutical compositions of the present invention can be administered by a surgically implanted device that releases the drug directly to the required site.
 - a surgically implanted device that releases the drug directly to the required site.
 - Vitrasert releases ganciclovir directly into the eye to treat CMV retinitis.
 - the direct application of this toxic agent to the site of disease achieves effective therapy without the drug's significant systemic side-effects.
 - Electroporation therapy (EPT) systems can also be employed for the administration of the agents, medicaments and pharmaceutical compositions of the invention.
 - EPT Electroporation therapy
 - a device which delivers a pulsed electric field to cells increases the permeability of the cell membranes to the drug, resulting in a significant enhancement of intracellular drug delivery.
 - EI electroincorporation
 - EI occurs when small particles of up to 30 microns in diameter on the surface of the skin experience electrical pulses identical or similar to those used in electroporation. In EI, these particles are driven through the stratum corneum and into deeper layers of the skin.
 - the particles can be loaded or coated with drugs or genes or can simply act as “bullets” that generate pores in the skin through which the drugs can enter.
 - ReGel injectable system that is thermo-sensitive. Below body temperature, ReGel is an injectable liquid while at body temperature it immediately forms a gel reservoir that slowly erodes and dissolves into known, safe, biodegradable polymers. The active substance is delivered over time as the biopolymers dissolve.
 - the molecules, medicaments and pharmaceutical compositions of the invention can also be delivered orally.
 - the process may employ a natural process for oral uptake of vitamin B 12 and/or vitamin D in the body to co-deliver proteins and peptides.
 - the nucleic acids, molecules and pharmaceutical formulations of the invention can move through the intestinal wall.
 - Complexes are synthesised between vitamin B 12 analogues and/or vitamin D analogues and the drug that retain both significant affinity for intrinsic factor (IF) in the vitamin B 12 portion/vitamin D portion of the complex and significant bioactivity of the active substance of the complex.
 - IF intrinsic factor
 - the molecules, medicaments and pharmaceutical compositions of the invention can be introduced to cells by “Trojan peptides”. These are a class of polypeptides called penetratins which have translocating properties and are capable of carrying hydrophilic compounds across the plasma membrane. This system allows direct targeting of oligopeptides to the cytoplasm and nucleus, and may be non-cell type specific and highly efficient. See Derossi et al. (1998), Trends Cell Biol 8, 84-87.
 - the medicament and/or pharmaceutical composition of the present invention is a unit dosage containing a daily dose or unit, daily sub-dose or an appropriate fraction thereof, of the active ingredient.
 - compositions of the invention will normally be administered orally or by any parenteral route, in the form of a pharmaceutical composition comprising the active ingredient, optionally in the form of a non-toxic organic, or inorganic, acid, or base, addition salt, in a pharmaceutically acceptable dosage form.
 - a pharmaceutical composition comprising the active ingredient, optionally in the form of a non-toxic organic, or inorganic, acid, or base, addition salt, in a pharmaceutically acceptable dosage form.
 - the compositions may be administered at varying doses.
 - the molecules, medicaments and pharmaceutical compositions of the invention can be administered alone but will generally be administered in admixture with a suitable pharmaceutical excipient, diluent or carrier selected with regard to the intended route of administration and standard pharmaceutical practice.
 - the molecules, medicaments and pharmaceutical compositions of the invention can be administered orally, buccally or sublingually in the form of tablets, capsules, ovules, elixirs, solutions or suspensions, which may contain flavouring or colouring agents, for immediate-, delayed- or controlled-release applications.
 - the molecules, medicaments and pharmaceutical compositions of the invention may also be administered via intracavernosal injection.
 - Such tablets may contain excipients such as microcrystalline cellulose, lactose, sodium citrate, calcium carbonate, dibasic calcium phosphate and glycine, disintegrants such as starch (preferably corn, potato or tapioca starch), sodium starch glycollate, croscarmellose sodium and certain complex silicates, and granulation binders such as polyvinylpyrrolidone, hydroxypropylmethylcellulose (HPMC), hydroxy-propylcellulose (HPC), sucrose, gelatin and acacia. Additionally, lubricating agents such as magnesium stearate, stearic acid, glyceryl behenate and talc may be included.
 - Solid compositions of a similar type may also be employed as fillers in gelatin capsules.
 - Preferred excipients in this regard include lactose, starch, cellulose, milk sugar or high molecular weight polyethylene glycols.
 - the agents of the invention may be combined with various sweetening or flavouring agents, colouring matter or dyes, with emulsifying and/or suspending agents and with diluents such as water, ethanol, propylene glycol and glycerin, and combinations thereof.
 - the molecules, medicaments and pharmaceutical compositions of the invention can also be administered parenterally, for example, intravenously, intra-arterially, intraperitoneally, intra-thecally, intraventricularly, intrasternally, intracranially, intra-muscularly or subcutaneously, or they may be administered by infusion techniques. They are best used in the form of a sterile aqueous solution which may contain other substances, for example, enough salts or glucose to make the solution isotonic with blood.
 - the aqueous solutions should be suitably buffered (preferably to a pH of from 3 to 9), if necessary.
 - the preparation of suitable parenteral formulations under sterile conditions is readily accomplished by standard pharmaceutical techniques well-known to those skilled in the art.
 - Medicaments and pharmaceutical compositions suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents.
 - the medicaments and compositions may be presented in unit-dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze-dried (lyophilised) condition requiring only the addition of the sterile liquid carrier, for example water for injections, immediately prior to use.
 - Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules and tablets of the kind previously described.
 - the daily dosage level of the molecules, medicaments and pharmaceutical compositions of the invention will usually be from 0.1 to 100 mg per adult per day administered in single or divided doses.
 - the tablets or capsules of the molecules of the invention may contain from 0.1 mg to 100 mg of active agent for administration singly or two or more at a time, as appropriate.
 - the physician in any event will determine the actual dosage which will be most suitable for any individual patient and it will vary with the age, weight and response of the particular patient.
 - the above dosages are exemplary of the average case. There can, of course, be individual instances where higher or lower dosage ranges are merited and such are within the scope of this invention.
 - the molecules, medicaments and pharmaceutical compositions of the invention can also be administered intranasally or by inhalation and are conveniently delivered in the form of a dry powder inhaler or an aerosol spray presentation from a pressurised container, pump, spray or nebuliser with the use of a suitable propellant, e.g. dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoro-ethane, a hydrofluoroalkane such as 1,1,1,2-tetrafluoroethane (HFA 134A3 or 1,1,1,2,3,3,3-heptafluoropropane (HFA 227EA3), carbon dioxide or other suitable gas.
 - a suitable propellant e.g. dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoro-ethane, a hydrofluoroalkane such as 1,1,1,2-tetrafluoroethane (H
 - the dosage unit may be determined by providing a valve to deliver a metered amount.
 - the pressurised container, pump, spray or nebuliser may contain a solution or suspension of the active agent, e.g. using a mixture of ethanol and the propellant as the solvent, which may additionally contain a lubricant, e.g. sorbitan trioleate.
 - a lubricant e.g. sorbitan trioleate.
 - Capsules and cartridges (made, for example, from gelatin) for use in an inhaler or insufflator may be formulated to contain a powder mix of a agent of the invention and a suitable powder base such as lactose or starch.
 - Aerosol or dry powder formulations are preferably arranged so that each metered dose or “puff” contains at least 0.1 mg of a molecule of the invention for delivery to the patient. It will be appreciated that he overall daily dose with an aerosol will vary from patient to patient, and may be administered in a single dose or, more usually, in divided doses throughout the day.
 - the molecules, medicaments and pharmaceutical compositions of the invention can be administered in the form of a suppository or pessary, or they may be applied topically in the form of a lotion, solution, cream, gel, ointment or dusting powder.
 - the molecules, medicaments and pharmaceutical compositions of the invention may also be transdermally administered, for example, by the use of a skin patch. They may also be administered by the ocular route, particularly for treating diseases of the eye.
 - the molecules, medicaments and pharmaceutical compositions of the invention can be formulated as micronised suspensions in isotonic, pH adjusted, sterile saline, or, preferably, as solutions in isotonic, pH adjusted, sterile saline, optionally in combination with a preservative such as a benzylalkonium chloride.
 - a preservative such as a benzylalkonium chloride.
 - they may be formulated in an ointment such as petrolatum.
 - the molecules, medicaments and pharmaceutical compositions of the invention can be formulated as a suitable ointment containing the active agent suspended or dissolved in, for example, a mixture with one or more of the following: mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene polyoxypropylene agent, emulsifying wax and water.
 - ком ⁇ онентs can be formulated as a suitable lotion or cream, suspended or dissolved in, for example, a mixture of one or more of the following: mineral oil, sorbitan monostearate, a polyethylene glycol, liquid paraffin, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.
 - Formulations suitable for topical administration in the mouth include lozenges comprising the active ingredient in a flavoured basis, usually sucrose and acacia or tragacanth; pastilles comprising the active ingredient in an inert basis such as gelatin and glycerin, or sucrose and acacia; and mouth-washes comprising the active ingredient in a suitable liquid carrier.
 - oral or parenteral administration of the molecules, medicaments and pharmaceutical compositions of the invention agents of the invention is the preferred route, being the most convenient.
 - the molecules, medicaments and pharmaceutical compositions of the invention is administered as a suitably acceptable formulation in accordance with normal veterinary practice and the veterinary surgeon will determine the dosing regimen and route of administration which will be most appropriate for a particular animal.
 - the formulation is a pharmaceutical formulation.
 - the formulation is a veterinary formulation.
 - the daily dosage level will be from 0.0001 to 100,000 mg, administered in single or divided doses; preferably, the daily dosage level is 0.0001 to 1000 mg.
 - Preferred pharmaceutical formulations include those in which the active ingredient is present in at least 1% (such as at least 10%, preferably in at least 30% and most preferably in at least 50%) by weight. That is, the ratio of active ingredient to the other components (i.e. the addition of adjuvant, diluent and carrier) of the pharmaceutical composition is at least 1:99 (e.g. at least 10:90, preferably at least 30:70 and most preferably at least 50:50) by weight.
 - the time between dose administration to the patient is between six and twelve hours; in a preferred embodiment, the time between dose administration to the patient is between nine and twelve hours after the previous dose; more preferably, the time between dose administration to the patient is between twelve hours and twelve days; even more preferably, the time between dose administration to the patient is between twelve days and six months.
 - the invention provides a use wherein the medicament of the invention is used to relieve pain in a human or animal patient.
 - the pharmaceutical composition or the medicament of the invention is formulated to permit administration by at least one route selected from the group comprising or consisting of: intranasal; oral; parenteral; topical; ophthalmic; suppository; pessary; or inhalation routes.
 - routes selected from the group comprising or consisting of: intranasal; oral; parenteral; topical; ophthalmic; suppository; pessary; or inhalation routes.
 - Formulations suitable for such administration routes are well known to those in the art of pharmacy and medicine and exemplary formulations are described above and in the accompanying examples.
 - the invention provides the use of a peptide molecule according to the invention and/or a nucleic acid molecule according to the invention as an adjuvant.
 - adjuvant means any substance which, when incorporated into or administered simultaneously with antigen, potentiates the immune response.
 - the invention provides an adjuvant system comprising (i) a peptide molecule according to the invention and/or a nucleic acid molecule according to the invention and (ii) an antigen.
 - the antigen is selected from the group comprising or consisting of: anthrax antigen; cholera antigen; diphtheria antigen; haemophilus influenza b (Hib) antigen; hepatitis A antigen; hepatitis B antigen; influenza antigen; Japanese encephalitis antigen; measles, mumps and rubella (MMR) antigen; meningococcal antigen; pertussis antigen; pneumococcal antigen; poliomyelitis antigen; rabies antigen; rubella antigen; smallpox and/or vaccinia antigen; tetanus antigen; tick-borne encephalitis antigen; tuberculosis antigen; typhoid antigen; varicella/herpes zoster antigen; yellow fever antigen; and veterinary vaccine antigen.
 - anthrax antigen cholera antigen
 - diphtheria antigen haemophilus influenza b (Hib) antigen
 - FIG. 1 A first figure.
 - the peptides F1-F3 were synthesized and isolated according to the following procedures:
 - the peptide was synthesised on Fmoc-His(trt)-Wang L L resin (200 mg) from Merck Chemicals. A Protein Technologies Symphony Automated synthesiser was used to add the remaining amino acid residues. All coupling reactions were 10 minute double couplings with HBTU coupling agent.
 - the peptide was cleaved in 100% Trifluoroacetic Acid in the presence of a scavenger mix containing 1:1 v/v Triisopropylsilane:Water.
 - the peptide was purified upon a LC-ABZ+(Supelcosil) column, 5 micron particle size, 110 Angstrom pore size, 250 mm ⁇ 10 mm, from Supelco. Analysis was performed with the same buffers, but using a C-18, 3.5 micron, 90 angstrom pore size, 4.6 mm ⁇ 150 mm column from agilent.
 - the peptide was synthesised on Fmoc-Asp(OtBu)-Wang L L resin (150 mg) from Merck Chemicals. A Protein Technologies Symphony Automated synthesiser was used to add the remaining amino acid residues. All coupling reactions were 10 minute double couplings with HBTU coupling agent.
 - the peptide was cleaved in 100% Trifluoroacetic Acid in the presence of a scavenger mix containing 1:1 v/v Triisopropylsilane:Water.
 - the peptide was purified upon a LC-ABZ+(Supelcosil) column, 5 micron particle size, 110 Angstrom pore size, 250 mm ⁇ 10 mm, from Supelco. Analysis was performed with the same buffers, but using a C-18, 3.5 micron, 90 angstrom pore size, 4.6 mm ⁇ 150 mm column from agilent.
 - the peptide was synthesised on Fmoc-Ser(tBu)-Wang L L resin (150 mg) from Merck Chemicals. A Protein Technologies Symphony Automated synthesiser was used to add the remaining amino acid residues. All coupling reactions were 10 minute double couplings with HBTU coupling agent.
 - the peptide was cleaved in 100% Trifluoroacetic Acid in the presence of a scavenger mix containing 1:1 v/v Triisopropylsilane:Water.
 - the peptide was purified upon a LC-ABZ+(Supelcosil) column, 5 micron particle size, 110 Angstrom pore size, 250 mm ⁇ 10 mm, from Supelco. Analysis was performed with the same buffers, but using a C-18, 3.5 micron, 90 angstrom pore size, 4.6 mm ⁇ 150 mm column from agilent.
 - mice Female Balb/c mice (Charles River, UK) were pre-treated intranasally with F1, F2 or F3 (5 pg or 0.5 pg). After 15 minutes, LPS (25 ⁇ g) was administered intranasally. Neutrophil influx in the lungs was determined by bronchoalveolar lavage 4 hours later.
 - the peptides of the present invention (F1-F3) have been shown to inhibit neutrophil cell migration in vivo.
 - the observed biological activity is indicative of a direct anti-inflammatory effect in non-allergic inflammation.
 
Landscapes
- Health & Medical Sciences (AREA)
 - Chemical & Material Sciences (AREA)
 - Organic Chemistry (AREA)
 - Life Sciences & Earth Sciences (AREA)
 - Medicinal Chemistry (AREA)
 - General Health & Medical Sciences (AREA)
 - Animal Behavior & Ethology (AREA)
 - Chemical Kinetics & Catalysis (AREA)
 - General Chemical & Material Sciences (AREA)
 - Veterinary Medicine (AREA)
 - Public Health (AREA)
 - Pharmacology & Pharmacy (AREA)
 - Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
 - Bioinformatics & Cheminformatics (AREA)
 - Engineering & Computer Science (AREA)
 - Immunology (AREA)
 - Diabetes (AREA)
 - Biochemistry (AREA)
 - Biophysics (AREA)
 - Genetics & Genomics (AREA)
 - Molecular Biology (AREA)
 - Proteomics, Peptides & Aminoacids (AREA)
 - Pulmonology (AREA)
 - Hematology (AREA)
 - Gastroenterology & Hepatology (AREA)
 - Endocrinology (AREA)
 - Urology & Nephrology (AREA)
 - Rheumatology (AREA)
 - Physical Education & Sports Medicine (AREA)
 - Neurology (AREA)
 - Orthopedic Medicine & Surgery (AREA)
 - Microbiology (AREA)
 - Epidemiology (AREA)
 - Mycology (AREA)
 - Emergency Medicine (AREA)
 - Obesity (AREA)
 - Neurosurgery (AREA)
 - Oncology (AREA)
 - Communicable Diseases (AREA)
 - Pain & Pain Management (AREA)
 
Abstract
Description
| (SEQ ID NO: 2) | |
| (i) | DGSVVVNKVSELPAGH; | 
| (SEQ ID NO: 3) | |
| (ii) | GLNVNTLSYGDLAAD; | 
| (SEQ ID NO: 4) | |
| (iii) | SELPAGHGLNVNLTS; | 
| (SEQ ID NO: 5) | |
| (iv) | DGSVVVNKVS; | 
| (SEQ ID NO: 6) | |
| (v) | ELPAGHGLNV; | 
| and | |
| (SEQ ID NO: 7) | |
| (vi) | NTLSYGDLAAD; | 
or a functionally equivalent fragment or variant thereof.
| (SEQ ID NO: 2) | |
| (i) | DGSVVVNKVSELPAGH; | 
| (SEQ ID NO: 3) | |
| (ii) | GLNVNTLSYGDLAAD; | 
| and | |
| (SEQ ID NO: 4) | |
| (iii) | SELPAGHGLNVNLTS; | 
or a functionally equivalent fragment or variant thereof.
| (SEQ ID NO: 5) | |
| (i) | DGSVVVNKVS; | 
| (SEQ ID NO: 6) | |
| (ii) | ELPAGHGLNV; | 
| and | |
| (SEQ ID NO: 7) | |
| (iii) | NTLSYGDLAAD; | 
or a functionally equivalent fragment or variant thereof.
-  
- (a) a polynucleotide sequence which encodes a peptide consisting of an amino acid sequence selected from the group:
 
 
| (SEQ ID NO: 2) | |
| 1. | DGSVVVNKVSELPAGH; | 
| (SEQ ID NO: 3) | |
| 2. | GLNVNTLSYGDLAAD; | 
| (SEQ ID NO: 4) | |
| 3. | SELPAGHGLNVNLTS; | 
| (SEQ ID NO: 5) | |
| 4. | DGSVVVNKVS; | 
| (SEQ ID NO: 6) | |
| 5. | ELPAGHGLNV; | 
| and | |
| (SEQ ID NO: 7) | |
| 6. | NTLSYGDLAAD; | 
- 
          
- (b) a polynucleotide sequence which has more than 70%, such as 75%, 80%, 85%, 90% or 95% identity to a polynucleotide sequence defined in (a); or a polynucleotide sequence which hybridizes to a polynucleotide sequence defined in (a) under conditions of 2×SSC, 65° C.; which polynucleotide sequence encodes a peptide having an amino acid sequence as defined in any of (1) to (6); and
 - (c) a fragment of a polynucleotide sequence defined in (a) or (b); which polynucleotide sequence encodes a peptide having an amino acid sequence as defined in any of (1) to (6).
 
 
| (SEQ ID NO: 8) | |
| (i) | MSKLIEYDETARRAMEVGMDKLADTVRVT; | 
| (SEQ ID NO: 9) | |
| (ii) | LGPRGRHVVLAKAFGGPTVTN; | 
| (SEQ ID NO: 10) | |
| (iii) | DGVTVAREIELEDPFEDLGAQLVKSVATKTNDV; | 
| (SEQ ID NO: 11) | |
| (iv) | AGDGTTTATILAQALIKGGLRLVAAGVN; | 
| (SEQ ID NO: 12) | |
| (v) | PIALGVGIGKAADAVSEALLASATP; | 
| (SEQ ID NO: 13) | |
| (vi) | EEGIVPGGGASLIHQARKALTELRASL; | 
| (SEQ ID NO: 14) | |
| (vii) | TGDEVLGVDVFSEALAAPLFWIAANAGL; | 
| (SEQ ID NO: 1) | |
| (viii) | DGSVVVNKVSELPAGHGLNVNTLSYGDLAAD; | 
| (SEQ ID NO: 15) | |
| (ix) | GVIDPVKVTRSAVLNASSVARMVLTTETVVV; | 
| and | |
| (SEQ ID NO: 16) | |
| (x) | LTTETVVVDKPAKAEDHDHHHGHAH. | 
| (SEQ ID NO: 2) | 
| F1-DGSVVVNKVSELPAGH | 
| (SEQ ID NO: 3) | 
| F2-GLNVNTLSYGDLAAD | 
| (SEQ ID NO: 4) | 
| F3-SELPAGHGLNVNLTS | 
- absorption 216 nm, 
flow rate 1 mL/min 
| t = 0, 0% B | ||
| t = 2, 0% B | ||
| t = 22, 80% B | ||
| % Yield = 31% | ||
F2
- absorption 216 nm, 
flow rate 1 mL/min 
| t = 0, 0% B | ||
| t = 2, 0% B | ||
| t = 22, 80% B | ||
| % Yield = 23% | ||
F3
- absorption 216 nm, 
flow rate 1 mL/min 
| t = 0, 0% B | ||
| t = 2, 0% B | ||
| t = 22, 80% B | ||
| % Yield = 34% | ||
Claims (6)
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title | 
|---|---|---|---|
| GB1118201.1 | 2011-10-21 | ||
| GBGB1118201.1A GB201118201D0 (en) | 2011-10-21 | 2011-10-21 | Novel peptides | 
| PCT/GB2012/052586 WO2013057499A1 (en) | 2011-10-21 | 2012-10-19 | Novel peptides | 
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date | 
|---|---|---|---|
| PCT/GB2012/052586 Continuation WO2013057499A1 (en) | 2011-10-21 | 2012-10-19 | Novel peptides | 
Publications (2)
| Publication Number | Publication Date | 
|---|---|
| US20140341932A1 US20140341932A1 (en) | 2014-11-20 | 
| US9320791B2 true US9320791B2 (en) | 2016-04-26 | 
Family
ID=45373221
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date | 
|---|---|---|---|
| US14/120,259 Active US9320791B2 (en) | 2011-10-21 | 2014-05-14 | Peptides from chaperonin 60.1 | 
Country Status (7)
| Country | Link | 
|---|---|
| US (1) | US9320791B2 (en) | 
| EP (1) | EP2768850B1 (en) | 
| JP (1) | JP6199296B2 (en) | 
| CA (1) | CA2852381C (en) | 
| ES (1) | ES2770438T3 (en) | 
| GB (1) | GB201118201D0 (en) | 
| WO (1) | WO2013057499A1 (en) | 
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title | 
|---|---|---|---|---|
| WO2023223015A1 (en) | 2022-05-16 | 2023-11-23 | Revolo Biotherapeutics Limited | Methods and compositions for preventing or treating food allergies | 
| WO2024218571A1 (en) | 2023-04-18 | 2024-10-24 | Revolo Biotherapeutics Limited | Methods and compositions for preventing or treating eosinophilic esophagitis | 
| WO2025037259A1 (en) | 2023-08-15 | 2025-02-20 | Revolo Biotherapeutics Limited | Methods and compositions for preventing or treating severe asthma | 
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title | 
|---|---|---|---|---|
| GB201700557D0 (en) | 2017-01-12 | 2017-03-01 | Peptinnovate Ltd | Novel peptides | 
| US12358957B2 (en) | 2017-01-12 | 2025-07-15 | Revolo Biotherapeutics Limited | Method for the acute treatment of atopic dermatitis and allergic skin hypersensitivity | 
| GB201700555D0 (en) * | 2017-01-12 | 2017-03-01 | Peptinnovate Ltd | Method for the treatment of a relapsing-remitting condition | 
| US12331088B2 (en) | 2017-01-12 | 2025-06-17 | Revolo Biotherapeutics Limited | Method for the treatment of a relapsing-remitting condition | 
| CN111944060B (en) * | 2020-07-29 | 2022-02-25 | 中国农业大学 | Multifunctional hybrid peptide with antibacterial, anti-inflammatory and detoxifying activities and application thereof | 
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title | 
|---|---|---|---|---|
| US6887481B1 (en) | 1998-12-16 | 2005-05-03 | Agency For Science, Technology And Research | Bacterial-derived molecules and therapeutic and diagnostic uses therefor | 
| US20060252681A1 (en) * | 2002-11-08 | 2006-11-09 | Coates Anthony R M | Pain relief agents | 
| WO2007096388A1 (en) | 2006-02-21 | 2007-08-30 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Polypeptides, pharmaceutical compositions and methods for the prevention and the therapeutic treatment of inflammatory disorders | 
| WO2009106819A2 (en) | 2008-02-25 | 2009-09-03 | Helperby Therapeutics Limited | Biological materials and uses thereof | 
| WO2010006059A1 (en) | 2008-07-08 | 2010-01-14 | Abbott Laboratories | Prostaglandin e2 binding proteins and uses thereof | 
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title | 
|---|---|---|---|---|
| GB0028122D0 (en) * | 2000-11-17 | 2001-01-03 | St Georges Entpr Ltd | Method | 
- 
        2011
        
- 2011-10-21 GB GBGB1118201.1A patent/GB201118201D0/en not_active Ceased
 
 - 
        2012
        
- 2012-10-19 EP EP12775541.1A patent/EP2768850B1/en active Active
 - 2012-10-19 WO PCT/GB2012/052586 patent/WO2013057499A1/en active Application Filing
 - 2012-10-19 ES ES12775541T patent/ES2770438T3/en active Active
 - 2012-10-19 JP JP2014536330A patent/JP6199296B2/en active Active
 - 2012-10-19 CA CA2852381A patent/CA2852381C/en active Active
 
 - 
        2014
        
- 2014-05-14 US US14/120,259 patent/US9320791B2/en active Active
 
 
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title | 
|---|---|---|---|---|
| US6887481B1 (en) | 1998-12-16 | 2005-05-03 | Agency For Science, Technology And Research | Bacterial-derived molecules and therapeutic and diagnostic uses therefor | 
| US20060252681A1 (en) * | 2002-11-08 | 2006-11-09 | Coates Anthony R M | Pain relief agents | 
| WO2007096388A1 (en) | 2006-02-21 | 2007-08-30 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Polypeptides, pharmaceutical compositions and methods for the prevention and the therapeutic treatment of inflammatory disorders | 
| WO2009106819A2 (en) | 2008-02-25 | 2009-09-03 | Helperby Therapeutics Limited | Biological materials and uses thereof | 
| WO2010006059A1 (en) | 2008-07-08 | 2010-01-14 | Abbott Laboratories | Prostaglandin e2 binding proteins and uses thereof | 
Non-Patent Citations (6)
| Title | 
|---|
| Hu, Yamnin, Anthony R.M. Coates, Alexander Liu, Peter A. Lund, and Brian Henderson. "Identification of the monocyte activating motif in Mycobacterium tuberculosis chaperonin 60.1." Tuberculosis 93 (2013) 442-447. | 
| International Search Report of PCT/GB2012/052586, mailed Mar. 5, 2013, the whole document. | 
| Kong TH, Coates ARM, Butcher PD, Hickman CJ, Shinnick TM, "Mycobacterium tuberculosis expresses two chaperonin-60 homologs," Proc., Natl. Acad. Sci. USA, Apr. 1993, 90: 2608-2612. * | 
| Qamra, Rohini, Volety Srinivas, and Shekhar C. Mande. "Mycobacterium tuberculosis GroEL Homologues Usually Exist as Lower Oligomers and Retain the Ability to Suppress Aggregation of Substrate Proteins." J. Mol. Biol. (2004) 342, 605-617. | 
| Tormay, Peter, Anthony R. M. Coates, and Brian Henderson. "The Intercellular Signaling Activity of the Mycobacterium tuberculosis Chaperonin 60.1 Protein Resides in the Equatorial Domain." The Journal of Biological Chemistry. vol. 280, No. 14, Issue of (Apr. 8, 2005) 14272-14277. | 
| Water is natural product, from http://www.biology-online.org/dictionary/Water, pp. 1-3. Accessed Apr. 24, 2014. * | 
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title | 
|---|---|---|---|---|
| WO2023223015A1 (en) | 2022-05-16 | 2023-11-23 | Revolo Biotherapeutics Limited | Methods and compositions for preventing or treating food allergies | 
| WO2024218571A1 (en) | 2023-04-18 | 2024-10-24 | Revolo Biotherapeutics Limited | Methods and compositions for preventing or treating eosinophilic esophagitis | 
| WO2025037259A1 (en) | 2023-08-15 | 2025-02-20 | Revolo Biotherapeutics Limited | Methods and compositions for preventing or treating severe asthma | 
Also Published As
| Publication number | Publication date | 
|---|---|
| US20140341932A1 (en) | 2014-11-20 | 
| CA2852381C (en) | 2020-12-29 | 
| EP2768850A1 (en) | 2014-08-27 | 
| JP6199296B2 (en) | 2017-09-20 | 
| GB201118201D0 (en) | 2011-12-07 | 
| EP2768850B1 (en) | 2019-11-27 | 
| JP2014532395A (en) | 2014-12-08 | 
| ES2770438T3 (en) | 2020-07-01 | 
| CA2852381A1 (en) | 2013-04-25 | 
| WO2013057499A1 (en) | 2013-04-25 | 
Similar Documents
| Publication | Publication Date | Title | 
|---|---|---|
| US9320791B2 (en) | Peptides from chaperonin 60.1 | |
| AU2009219992B2 (en) | Biological materials and uses thereof | |
| JP7252895B2 (en) | Mycobacterium tuberculosis chaperonin 60.1 peptide and uses thereof | |
| US11834478B2 (en) | Method for the treatment of a relapsing-remitting condition | |
| HK1150614B (en) | Biological materials and uses thereof | 
Legal Events
| Date | Code | Title | Description | 
|---|---|---|---|
| AS | Assignment | 
             Owner name: PEPTINNOVATE LIMITED, UNITED KINGDOM Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:COATES, ANTHONY ROBERT MILNES;TORMAY, PETER;LIGHTFOOT, ANDREW;SIGNING DATES FROM 20150313 TO 20150323;REEL/FRAME:035362/0143  | 
        |
| STCF | Information on status: patent grant | 
             Free format text: PATENTED CASE  | 
        |
| MAFP | Maintenance fee payment | 
             Free format text: PAYMENT OF MAINTENANCE FEE, 4TH YEAR, LARGE ENTITY (ORIGINAL EVENT CODE: M1551); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY Year of fee payment: 4  | 
        |
| AS | Assignment | 
             Owner name: LIMITED, REVOLO BIOTHERAPEUTICS, GREAT BRITAIN Free format text: CHANGE OF NAME;ASSIGNOR:IMMUNE REGULATION LIMITED;REEL/FRAME:059196/0255 Effective date: 20210227  | 
        |
| AS | Assignment | 
             Owner name: IMMUNE REGULATION LIMITED, GREAT BRITAIN Free format text: CHANGE OF NAME;ASSIGNOR:PEPTINNOVATE LIMITED;REEL/FRAME:060665/0283 Effective date: 20181003  | 
        |
| MAFP | Maintenance fee payment | 
             Free format text: PAYMENT OF MAINTENANCE FEE, 8TH YEAR, LARGE ENTITY (ORIGINAL EVENT CODE: M1552); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY Year of fee payment: 8  |