US8663933B2 - Recombinant protein capable of binding specifically and quickly to troponin I derived from human myocardium - Google Patents

Recombinant protein capable of binding specifically and quickly to troponin I derived from human myocardium Download PDF

Info

Publication number
US8663933B2
US8663933B2 US13/680,925 US201213680925A US8663933B2 US 8663933 B2 US8663933 B2 US 8663933B2 US 201213680925 A US201213680925 A US 201213680925A US 8663933 B2 US8663933 B2 US 8663933B2
Authority
US
United States
Prior art keywords
seq
recombinant protein
antibody fragment
primer
variable region
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Expired - Fee Related
Application number
US13/680,925
Other versions
US20130158237A1 (en
Inventor
Atsushi Fukunaga
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
PHC Corp
Original Assignee
Panasonic Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from PCT/JP2012/001726 external-priority patent/WO2013088587A1/en
Application filed by Panasonic Corp filed Critical Panasonic Corp
Publication of US20130158237A1 publication Critical patent/US20130158237A1/en
Assigned to PANASONIC CORPORATION reassignment PANASONIC CORPORATION ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: FUKUNAGA, ATSUSHI
Assigned to PANASONIC HEALTHCARE CO., LTD. reassignment PANASONIC HEALTHCARE CO., LTD. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: PANASONIC CORPORATION
Application granted granted Critical
Publication of US8663933B2 publication Critical patent/US8663933B2/en
Expired - Fee Related legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the technical field relates to a recombinant protein capable of binding specifically and quickly to troponin I derived from human myocardium.
  • Non Patent Literature 1 and Non Patent Literature 2 disclose that a concentration of troponin I derived from myocardial tissue increases rapidly in the blood of a patient who has suffered acute myocardial infarction.
  • One non-limiting and exemplary embodiment provides a recombinant protein capable of binding specifically and quickly to troponin I derived from human myocardium.
  • the techniques disclosed here feature a recombinant protein which binds specifically to troponin I derived from human myocardium.
  • the recombinant protein includes a light chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 63, and a heavy chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 65.
  • the present disclosure provides a recombinant protein capable of binding specifically and quickly to troponin I derived from human myocardium.
  • the recombinant protein and the method of the present disclosure can be used for early detection of acute myocardial infarction.
  • FIG. 1 shows an antibody
  • FIG. 2 shows a PCR method in the step (c-2).
  • FIG. 1 shows an antibody.
  • the antibody 1 has a letter “Y” shape.
  • the antibody 1 has two Fab regions and one Fc region.
  • the antibody 1 consists of two heavy chains 2 and two light chains 3 .
  • Each heavy chain 2 consists of a heavy chain constant region 1 ( 22 ), a heavy chain constant region 2 ( 23 ), a heavy chain constant region 3 ( 24 ) and a heavy chain variable region 21 .
  • Each light chain 3 consists of a light chain variable region 31 and a light chain constant region 32 .
  • Each Fab region consists of the one heavy chain variable region 21 , the one heavy chain constant region 1 ( 22 ), the one light chain variable region 31 , and the one light chain constant region 32 .
  • the light chain 3 is connected to the heavy chain 2 through a linker 4 .
  • the one heavy variable region 21 is present at the end of the heavy chain 2 .
  • the one light chain variable region 31 is present at the end of the light chain 3 .
  • An antigen is specifically bound to the antibody 1 .
  • the antigen is bound specifically to the Fv region, which consists of the heavy chain variable region 21 and the light chain variable region 31 .
  • the antigen is troponin I derived from human myocardium.
  • the recombination protein according to the embodiment includes the light chain variable region 31 consisting of the amino acid sequence represented by SEQ ID NO: 63 and the heavy chain variable region 21 consists of the amino acid sequence represented by SEQ ID NO: 65.
  • the recombinant protein of the present disclosure binds specifically and quickly to the troponin I derived from human myocardium.
  • the recombinant protein of the present disclosure may be either an antibody or an antibody fragment.
  • the antibody has a shape of the form of the letter “Y” shown in FIG. 1 .
  • the light chain variable region 31 and the heavy chain variable region 21 both of which is included in the antibody of the present disclosure, consist of amino acid sequences represented by SEQ ID NO: 63 and SEQ ID NO: 65, respectively.
  • the light chain variable region 31 is connected to the heavy chain variable region 21 through a linker (not shown).
  • antibody fragment examples include a Fab antibody fragment, a F(ab′) 2 antibody fragment and an scFv antibody fragment.
  • the Fab antibody fragment consists of one Fab region.
  • the Fab antibody fragment consists of the one light chain variable region 31 (SEQ ID NO: 63), the one heavy chain variable region 21 (SEQ ID NO: 65), the one light chain constant region 32 , the one heavy chain constant region 1 ( 22 ), and the linker 4 .
  • the light chain constant region 32 is connected to the heavy chain constant region 1 ( 22 ) through the linker 4 .
  • the F(ab′) 2 antibody fragment consists of two Fab regions.
  • each Fab region consists of the one light chain variable region 31 (SEQ ID NO: 63), the one heavy chain variable region 21 (SEQ ID NO: 65), the one light chain constant region 32 , the one heavy chain constant region 1 ( 22 ), and the linker 4 .
  • These two Fab regions are connected to each other through another linker (not shown).
  • one heavy chain constant region 1 ( 22 ) is connected to the other heavy chain constant region 1 ( 22 ) through another linker (not shown).
  • the scFv antibody fragment consists of the light chain variable region 31 (SEQ ID NO: 63), the heavy chain variable region 21 (SEQ ID NO: 65), and a linker.
  • the light chain variable region 31 (SEQ ID NO: 63) is connected to the heavy chain variable region 21 (SEQ ID NO: 65) through a linker (not shown).
  • the linker connecting the light chain variable region 31 (SEQ ID NO: 63) and the heavy chain variable region 21 (SEQ ID NO: 65) is not specifically limited.
  • An example of the linker is a peptide consisting of 5-20 amino acids.
  • the linker is a peptide consisting of the amino acid sequence represented by GGGGSGGGGSGGGGS (SEQ ID NO: 64).
  • Another example of the linker is a disulfide bond (-sulfur atom (S)—sulfur atom (S)—).
  • the N-terminal of the light chain variable region 31 may be modified with an amino acid sequence.
  • the C-terminal thereof may be also modified.
  • the N-terminal of the heavy chain variable region 21 may be modified with an amino acid sequence.
  • the C-terminal thereof may be also modified.
  • An example of the amino acid sequence to modify the C-terminal of the heavy chain variable region 21 (SEQ ID NO: 65) is AAALEHHHHHH (SEQ ID NO: 66).
  • the recombinant protein of the present disclosure When the recombinant protein of the present disclosure is brought into contact with troponin I derived from human myocardium, the recombinant protein of the present disclosure binds specifically and quickly to the troponin I derived from human myocardium. For example, when the recombinant protein of the present disclosure is mixed with troponin I derived from human myocardium, the recombinant protein of the present disclosure binds specifically and quickly to the troponin I derived from human myocardium.
  • Detection of the binding of the recombinant protein of the present disclosure to the troponin I derived from human myocardium can be carried out by methods for detecting antigen-antibody binding which are well known to those skilled in the art. Examples of such methods include the ELISA sandwich method.
  • the recombinant protein of the present disclosure can be produced using an ordinal protein expression technique. For example, first, a vector including a gene sequence coding for the recombinant protein of the present disclosure is prepared. An example of the vector is a plasmid. Then, cells (e.g., Escherichia coli ) are transformed with this vector. These cells are incubated to produce the recombinant protein of the present disclosure.
  • a vector including a gene sequence coding for the recombinant protein of the present disclosure is prepared.
  • An example of the vector is a plasmid.
  • cells e.g., Escherichia coli
  • These cells are incubated to produce the recombinant protein of the present disclosure.
  • Non Patent Literature 3 discloses the refolding method.
  • a recombinant protein which binds specifically to troponin I derived from human myocardium includes a light chain variable region comprising the amino acid sequence represented by SEQ ID NO: 63, and a heavy chain variable region comprising the amino acid sequence represented by SEQ ID NO: 65.
  • the recombinant protein may be an antibody.
  • the recombinant protein may be an antibody fragment.
  • the antibody fragment may be a Fab antibody fragment.
  • the antibody fragment may be a F(ab′) 2 antibody fragment.
  • the antibody fragment may be an scFv antibody fragment.
  • a method for binding a recombinant protein specifically to troponin I derived from human myocardium includes the following steps.
  • a step (a) is a step of preparing the recombinant protein.
  • the recombinant protein includes a light chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 63, and a heavy chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 65.
  • a step (b) is a step of bringing the recombinant protein into contact with the troponin I derived from human myocardium to bind the recombinant protein specifically to the troponin I derived from human myocardium.
  • the step (b) may be carried out in vitro.
  • the recombinant protein may be an antibody.
  • the recombinant protein may be an antibody fragment.
  • the antibody fragment may be a Fab antibody fragment.
  • the antibody fragment may be a F(ab′) 2 antibody fragment.
  • the antibody fragment may be scFv antibody fragment.
  • Table 1 Table 2, Table 3, and Table 4 show the primers used in Example 1.
  • Table 1 shows the forward mixture primers (primers 1-21, SEQ ID NOS: 02-22) for amplifying a light chain variable region.
  • Table 2 shows the forward mixture primers (primers 22-44, SEQ ID NOS: 23-45) for amplifying a heavy chain variable region.
  • Table 3 shows the reverse mixture primers (primers 45-49, SEQ ID NOS: 46-50) for amplifying a light chain variable region.
  • Table 4 shows the reverse mixture primers (primers 50-55, SEQ ID NOS: 51-56) for amplifying a heavy chain variable region.
  • Step (a-1) Preparation of a Hybridoma (Derived from Mouse Spleen) Capable of Producing Monoclonal Antibodies which Specifically Bind to Troponin I Derived from Human Myocardium
  • a peptide having an amino acid sequence (SEQ ID NO: 01, purchased from Sigma Aldrich Japan Co., Ltd.,
  • RPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAK contained in troponin I derived from human myocardium was connected to human serum albumin (purchased from Sigma Aldrich Japan Co. Ltd.) using a sulfo-SMCC cross linker (purchased from Servo Fischer Scientific Co., Ltd.).
  • the sulfo-SMCC cross linker (0.5 mg) was dissolved in 100 microliters of a phosphate buffered saline so as to obtain a first aqueous solution.
  • This first aqueous solution was left under a temperature of 50 degrees Celsius for ten minutes.
  • the human serum albumin (10 mg) was dissolved in one milliliter of a phosphate buffered saline to obtain a second aqueous solution.
  • the first aqueous solution was mixed with the second aqueous solution to obtain a mixture.
  • the mixture was left at rest for 30 minutes. In this way, the sulfo-SMCC cross linker was connected to the human serum albumin.
  • the mixture was passed through a column (purchased from GE health care, trade name: PD10) to remove the unreacted sulfo-SMCC cross linker.
  • the above-mentioned peptide (SEQ ID NO: 01, 1.5 mg) was dissolved in dimethylsulfoxide (hereinafter, referred to as “DMSO”) to obtain a DMSO solution.
  • DMSO dimethylsulfoxide
  • the DMSO solution 100 microliters was added to the mixture (1 mL) having a concentration of 2 mg/ml. Afterwards, the mixture was left overnight to connect the sulfo-SMCC cross linker to the peptide (SEQ ID NO: 01).
  • human serum albumin modified with the peptide having the amino acid sequence (SEQ ID NO: 01) contained in the troponin I was obtained.
  • this human serum albumin is referred to as “troponin-modified HSA”.
  • a complete Freud adjuvant (purchased from Wako Pure Chemical Industries Co., Ltd.) and the troponin-modified HSA were mixed to obtain a mixture. This mixture was injected to a BALB/c mouse.
  • the BALB/c mouse is a kind of albino mouse.
  • a mixture of phosphate buffered saline (hereinafter, referred to as “PBS”) and troponin-modified HSA was injected into the BALB/c mouse. This was repeated once again. In this way, the BALB/c mouse was immunized by troponin-modified HSA for one month. In other words, by administering the mixture to the BALB/c mouse, antibodies against troponin-modified HSA were produced in the body of the BALB/c mouse.
  • PBS phosphate buffered saline
  • the spleen of the immunized BALB/c mouse was taken out.
  • hybridomas were obtained. Afterwards, the hybridomas were incubated in a culture fluid. The number of hybridomas (cells) after the incubation was approximately 5 ⁇ 10 6 .
  • the hybridomas obtained in this way were capable of producing the monoclonal antibody which specifically bound to troponin I derived from human myocardium.
  • Step (a-2) Extraction of Total Mouse RNAs from the Hybridoma Cells
  • TRIzol Purchased from Invitrogen Co., Ltd.
  • the culture fluid was subjected to a centrifugal separation at an acceleration of gravity of 117600 m/s 2 under a temperature of 4 degrees Celsius for 15 minutes.
  • the supernatant 500 ⁇ L was acquired.
  • Isopropanol 500 ⁇ L was added to the obtained supernatant and left at rest under room temperature for ten minutes.
  • the culture fluid was again subject to a centrifugal separation having a condition identical to the above-mentioned condition to obtain a precipitate.
  • a seventy-five percent ethanol aqueous solution (1 mL) was added to the obtained precipitate so as to obtain an ethanol solution.
  • the ethanol solution was subjected to a centrifugal separation at an acceleration of gravity of 73500 m/s 2 for five minutes.
  • the precipitate was dried. In this way, total mouse RNAs were obtained.
  • Step (b-1) Extraction of mRNA from the Total Mouse RNAs
  • mRNA was extracted from the total mouse RNAs obtained in the step (a-2).
  • RNase-free water 100 ⁇ L was injected into a microtube. This microtube was set at a block incubator (purchased from ASTEC CO. LTD.) and heated under a temperature of 70 degrees Celsius for one hour.
  • the total mouse RNAs were dissolved in the RNase-free water (100 ⁇ L).
  • a 2 ⁇ binding buffered solution (100 ⁇ L) included in the kit and an oligotex (10 ⁇ L) included in the kit were mixed with the RNase-free water (100 ⁇ L). Subsequently, the mixture was left at rest under a temperature of 70 degrees Celsius for three minutes. Furthermore, the mixture was left at rest under room temperature for ten minutes.
  • the mixture was subjected to a centrifugal separation at an acceleration of gravity of 147000 m/s 2 for five minutes.
  • the supernatant was removed, and the precipitate was suspended in Wash buffer (350 ⁇ L) included in the kit.
  • the suspension liquid was supplied to a column included in the kit.
  • the column was subjected to a centrifugal separation at an acceleration of gravity of 147000 m/s 2 for 30 seconds.
  • the Wash buffer (350 ⁇ L) was supplied to the column to wash the column.
  • the column was subjected to a centrifugal separation at an acceleration of gravity of 147000 m/s 2 again for 30 seconds.
  • a microtube for sample collection was attached to the bottom of the column.
  • RNase-free water (20 ⁇ L) contained in the microtube was supplied to the column. Subsequently, the column was subjected to a centrifugal separation at an acceleration of gravity of 147000 m/s 2 for three minutes. Again, RNase-free water (20 ⁇ L) was supplied to the column, and the column was subjected to a centrifugal separation at an acceleration of gravity of 147000 m/s 2 for three minutes.
  • the extract liquid containing the mRNA was obtained in the microtube.
  • Step b-2 Reverse-Transcription from mRNA to cDNA
  • the mRNA contained in the obtained extract liquid was reverse-transcripted with a reverse-transcriptase (purchased from Takara bio Co., Ltd, trade name: Primersript) to obtain a solution containing cDNA.
  • a reverse-transcriptase purchased from Takara bio Co., Ltd, trade name: Primersript
  • Step (b-3-1) Amplification of the Gene Coding for the Light Chain Variable Region Using the cDNA
  • VL gene fragment The gene fragment (SEQ ID NO: 58, hereinafter, referred to as “VL gene fragment”) coding for the light chain variable region of the above-mentioned monoclonal antibody was amplified by a PCR method using the cDNA contained in the solution, the forward primers 1-21 (SEQ ID NOS: 02-22), and the reverse primers 1-5 (SEQ ID NOS: 23-27).
  • the polymerase used in this PCR method was purchased from Takara bio Co., Ltd under a trade name of TaKaRa Ex Taq Hot start Version.
  • This PCR solution contained the amplified VL gene fragment (SEQ ID NO: 58).
  • the obtained PCR solution was subjected to an electrophoresis using a gel containing agarose having a concentration of 2% by weight.
  • Step (b-3-2) Amplification of the Gene Coding for the Heavy Chain Variable Region Using the cDNA
  • VH gene fragment The gene fragment (SEQ ID NO: 57, hereinafter, referred to as “VH gene fragment”) coding for the heavy chain variable region of the above-mentioned monoclonal antibody was amplified by a PCR method using the cDNA contained in the solution, the forward primers 22-44 (SEQ ID NOS: 28-50), and the reverse primers 6-11 (SEQ ID NOS: 51-56).
  • the polymerase used in this PCR method was purchased from Takara bio Co., Ltd under a trade name of TaKaRa Ex Tag Hot start Version.
  • This PCR solution contained the amplified VH gene fragment (SEQ ID NO: 57).
  • the obtained PCR solution was subjected to an electrophoresis using a gel containing agarose having a concentration of 2% by weight.
  • the purified VH gene fragment (SEQ ID NO: 57) was connected to the purified VL gene fragment (SEQ ID NO: 58) using an overlap extension PCR method.
  • the gene fragment (SEQ ID NO: 59, hereinafter, referred to as “scFv gene fragment”) coding for the scFv antibody fragment of the above-mentioned monoclonal antibody was obtained.
  • the obtained gene fragment (SEQ ID NO: 59) was modified with restriction enzyme sites Nco1 and Not 1 at the 5′-end and 3′-end thereof, respectively.
  • Step (c-1) Introduction of the Gene to a Vector
  • the scFv gene fragment was ligated into a protein expression vector (purchased from Takara bio Co., Ltd, trade name: pET22b(+)). The detail of the ligation is described below.
  • the scFv gene fragment was treated with restriction enzymes Nco1 and Not1 (both of which were purchased from Takara bio Co., Ltd.).
  • the scFv gene fragment was purified by an electrophoresis method to obtain an aqueous solution containing the scFv gene fragment.
  • the protein expression vector was also treated with restriction enzymes Nco1 and Not1 (both of which were purchased from Takara bio Co., Ltd.).
  • the protein expression vector was also purified by an electrophoresis method to obtain an aqueous solution containing the protein expression vector.
  • Escherichia coli cells purchased from Takara bio Co., Ltd., trade name; DH5 ⁇ competent cell
  • Escherichia coli cells purchased from Takara bio Co., Ltd., trade name; DH5 ⁇ competent cell
  • the Escherichia coli cells were incubated for sixteen hours on an LB plate culture medium containing ampicillin having a concentration of 100 ⁇ g/mL. After the incubation, a single colony formed on the LB plate culture medium was picked up. The single colony was supplied to an LB liquid culture medium (5 mL) containing ampicillin having a concentration of 100 ⁇ g/mL, and the colony was incubated for 16 hours.
  • the protein expression vector pET22b(+) was extracted from this LB liquid culture medium using a kit (QIAGEN Co., Ltd. trade name: QIAprep spin miniprep kit).
  • a kit QIAGEN Co., Ltd. trade name: QIAprep spin miniprep kit.
  • the signal sequence DNA sequence, SEQ ID NO: 60
  • the expression vector coding for the wild type scFv antibody fragment was obtained.
  • the expression vector obtained in the step (c-1) included the scFv gene fragment (SEQ ID NO: 59).
  • the 729 bases constituting the scFv gene fragment (SEQ ID NO: 59) included in the expression vector seven bases were substituted.
  • the 589th adenine (A), the 590th cytosine (C), the 607th thymine (T), the 608th cytosine (C), the 609th cytosine (C), the 613th adenine (A), and the 615th cytosine (C) were substituted with guanine (G), adenine (A), guanine (G), adenine (A), thymine (T), guanine (G), and thymine (T), respectively.
  • a PCR method using the primer 58 (SEQ ID NO: 69), the primer 59 (SEQ ID NO: 70) and the expression vector obtained in the step (c-1) was performed.
  • the primer 58 (SEQ ID NO: 69) was complementary to the gene sequence from 579 th base to 626 th base included in the scFv gene fragment (SEQ ID NO: 59) except for the seven bases to be substituted.
  • the primer 59 (SEQ ID NO: 70) was complementary to the gene sequence from 579 th base to 626 th base included in the gene fragment complimentary to the scFv gene fragment (SEQ ID NO: 59) except for the seven bases to be substituted.
  • Escherichia coli cells purchased from Takara bio Co., Ltd, trade name: BL21(DE3)
  • the Escherichia coli cells were incubated on an LB plate culture medium containing ampicillin having a concentration of 100 ⁇ g/mL under a temperature of 37 degrees Celsius for 16 hours.
  • a single colony formed on the LB plate culture medium was picked up.
  • the single colony was supplied to an LB liquid culture medium containing ampicillin (500 mL) having a concentration of 100 ⁇ g/mL.
  • ampicillin 500 mL
  • the Escherichia coli cells contained in the single colony were propagated in such a manner that the absorbance of the LB liquid culture medium at a wavelength of 600 nanometers was adjusted to 0.5.
  • aqueous solution of isopropyl beta-D-thiogalactopyranoside (0.5 mL) having a concentration of 1 M was added to the LB liquid culture medium. Afterwards, the Escherichia coli cells were incubated with shaking under a temperature of 37 degrees Celsius for five hours. In this way, a culture fluid was obtained.
  • the obtained culture fluid was subjected to a centrifugal separation at an acceleration of gravity of 49000 m/s 2 under a temperature of 4 degrees Celsius for five minutes.
  • the precipitation containing the Escherichia coli cells was again suspended in a phosphate buffered saline (50 mL).
  • the suspension was subjected to an ultrasonic treatment to crush the Escherichia coli cells.
  • the solution containing the crushed Escherichia coli cells was subjected to a centrifugal separation at an acceleration of gravity of 98000 m/s 2 under a temperature of 4 degrees Celsius for thirty minutes. In this way, the precipitation was obtained.
  • the precipitation was washed twice with a phosphate buffered saline containing a surface active agent (purchased from Wako Pure Chemical Industries Co., Ltd., trade name: Triton X-100) having a concentration of 4%.
  • the precipitation was further washed with a phosphate buffered saline without containing a surface active agent.
  • the aqueous solution A had a pH of 6.
  • the aqueous solution A was left under a temperature of 4 degrees Celsius for eighteen hours. In this way, the precipitation was dissolved.
  • the aqueous solution A was passed through a filter (purchased from Sartorius, trade name: Minisart) having a mesh size of 0.45 ⁇ m to remove the residue. In this way, the filtrate was obtained.
  • a filter purchased from Sartorius, trade name: Minisart
  • the aqueous solution B had a pH of 8.0. In this way, an aqueous solution having a volume of 3 mL was obtained.
  • the aqueous solution (3 mL) was added dropwise to an aqueous solution having a volume of one liter which contained the chemical reagents shown in Table 7. Afterwards, the obtained aqueous solution was stirred under a temperature of 4 degrees Celsius for 96 hours. In this way, the mutant scFv antibody fragment (SEQ ID NO: 61) was obtained.
  • the solution was concentrated using a filtration unit (purchased from Sartorius, trade name: VIVAFLOW50) so that the solution had a volume of 10 milliliters.
  • the mutant scFv antibody fragment contained in the solution was purified with a column (purchased from GE healthcare, trade name: HiLoad 26/60 Superdex 75 pg).
  • Light chain variable region (SEQ ID NO: 63): DVVLTQSPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLV SKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPLTFGAGTKLEIKR
  • Linker (SEQ ID NO: 64): GGGGSGGGGSGGGGS Heavy chain variable region (SEQ ID NO: 65): QLQLQQSGAELVRSGASVKLSCTASGFNIKDYYMNWVKQRPEQGLE WIGWIDPANGDTAYAPRFQVKADMTADKDSDTAYLQLSSLTSEDTAVYYC NADLPMDQWGQGTSVTVSS
  • AAALEHHHHHH SEQ ID NO: 66
  • Troponin I (purchased from Funakoshi) derived from human myocardium having approximately 500 RU (Resonance Unit) was fixed on a CM5 chip (purchased from GE health care company). This CM5 chip was set in the Biacore T100. Then, aqueous solutions (concentrations: 100 nM, 50 nM, 25 nM, 12.5 nM, and 6.25 nM; volume: 150 microliters) containing the mutant scFv antibody fragment were flowed through the Biacore T100. The association rate constant and the dissociation rate constant measured with the intermolecular interaction analyzer Biacore T100 are shown in Table 9.
  • Example 1 In Comparative Example 1, the experiment similar to Example 1 was conducted except that the step (c-2) was not conducted. In this way, the wild type scFv antibody fragment consisting of the amino acid sequence represented by SEQ ID NO: 62 was obtained. Similarly to Example 1, the association rate constant and the dissociation rate constant of the wild-type scFv antibody fragment were measured. The results are shown in Table 9.
  • the mutant scFv antibody fragment according to Example 1 has a higher association rate constant than that of the wild-type scFv antibody fragment according to Comparative Example 1. This means that the mutant scFv antibody fragment bound specifically to troponin I derived from human myocardium more quickly than the wild-type scFv antibody fragment.
  • the recombinant protein and the method according to the present disclosure can be used for a sensor for detecting acute myocardial infarction.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

Provided is a recombination protein which binds specifically to troponin I derived from human myocardium. The recombinant protein includes a light chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 63; and a heavy chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 65.

Description

CROSS-REFERENCE TO RELATED APPLICATIONS
This is a continuation application of International Application No. PCT/JP2012/001726, with an international filing date of Mar. 13, 2012, which claims priority of Japanese Patent Application No. 2011-275413, filed on Dec. 16, 2011, the entire contents of each of which are incorporated herein by reference.
The Sequence listing in “SEQUENCE LISTING.TXT” created on Feb. 8, 2013 and being 21.0 KB in size is incorporated by reference and is identical to the sequence information in the instant application.
FIELD
The technical field relates to a recombinant protein capable of binding specifically and quickly to troponin I derived from human myocardium.
BACKGROUND
Non Patent Literature 1 and Non Patent Literature 2 disclose that a concentration of troponin I derived from myocardial tissue increases rapidly in the blood of a patient who has suffered acute myocardial infarction.
CITATION LIST Non Patent Literature
Non Patent Literature 1
Aleksei G. Katrukha et. al., “Troponin I is released in bloodstream of patients with acute myocardial infarction not in free form but as complex”, Clinical Chemistry, Vol. 43, Issue 8, p.p. 1379-1385 (1997)
Non Patent Literature 2
Till Keller et. al., “Sensitive Troponin I Assay in Early Diagnosis of Acute Myocardinal Infarction”, The NEW ENGLAND JOURNAL of MEDICINE, Vol. 361, pages 868-877 (2009)
SUMMARY
One non-limiting and exemplary embodiment provides a recombinant protein capable of binding specifically and quickly to troponin I derived from human myocardium.
Additional benefits and advantages of the disclosed embodiments will be apparent from the specification and Figures. The benefits and/or advantages may be individually provided by the various embodiments and features of the specification and drawings disclosure, and need not all be provided in order to obtain one or more of the same.
In one general aspect, the techniques disclosed here feature a recombinant protein which binds specifically to troponin I derived from human myocardium. The recombinant protein includes a light chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 63, and a heavy chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 65.
The present disclosure provides a recombinant protein capable of binding specifically and quickly to troponin I derived from human myocardium.
The recombinant protein and the method of the present disclosure can be used for early detection of acute myocardial infarction.
BRIEF DESCRIPTION OF THE DRAWINGS
FIG. 1 shows an antibody.
FIG. 2 shows a PCR method in the step (c-2).
DETAILED DESCRIPTION
The embodiment of the present disclosure is described below.
(Explanation of Terms)
First, the terms used in the present specification are described.
FIG. 1 shows an antibody. The antibody 1 has a letter “Y” shape. The antibody 1 has two Fab regions and one Fc region. The antibody 1 consists of two heavy chains 2 and two light chains 3. Each heavy chain 2 consists of a heavy chain constant region 1 (22), a heavy chain constant region 2 (23), a heavy chain constant region 3 (24) and a heavy chain variable region 21. Each light chain 3 consists of a light chain variable region 31 and a light chain constant region 32.
Each Fab region consists of the one heavy chain variable region 21, the one heavy chain constant region 1 (22), the one light chain variable region 31, and the one light chain constant region 32. The light chain 3 is connected to the heavy chain 2 through a linker 4. The one heavy variable region 21 is present at the end of the heavy chain 2. The one light chain variable region 31 is present at the end of the light chain 3. An antigen is specifically bound to the antibody 1. In more detail, the antigen is bound specifically to the Fv region, which consists of the heavy chain variable region 21 and the light chain variable region 31. In the present specification, the antigen is troponin I derived from human myocardium.
The recombination protein according to the embodiment includes the light chain variable region 31 consisting of the amino acid sequence represented by SEQ ID NO: 63 and the heavy chain variable region 21 consists of the amino acid sequence represented by SEQ ID NO: 65. The recombinant protein of the present disclosure binds specifically and quickly to the troponin I derived from human myocardium.
The recombinant protein of the present disclosure may be either an antibody or an antibody fragment.
The antibody has a shape of the form of the letter “Y” shown in FIG. 1. The light chain variable region 31 and the heavy chain variable region 21, both of which is included in the antibody of the present disclosure, consist of amino acid sequences represented by SEQ ID NO: 63 and SEQ ID NO: 65, respectively. In the antibody, the light chain variable region 31 is connected to the heavy chain variable region 21 through a linker (not shown).
Examples of the antibody fragment include a Fab antibody fragment, a F(ab′)2 antibody fragment and an scFv antibody fragment.
The Fab antibody fragment consists of one Fab region. In other words, the Fab antibody fragment consists of the one light chain variable region 31 (SEQ ID NO: 63), the one heavy chain variable region 21 (SEQ ID NO: 65), the one light chain constant region 32, the one heavy chain constant region 1 (22), and the linker 4. The light chain constant region 32 is connected to the heavy chain constant region 1 (22) through the linker 4.
The F(ab′)2 antibody fragment consists of two Fab regions. As above, each Fab region consists of the one light chain variable region 31 (SEQ ID NO: 63), the one heavy chain variable region 21 (SEQ ID NO: 65), the one light chain constant region 32, the one heavy chain constant region 1 (22), and the linker 4. These two Fab regions are connected to each other through another linker (not shown). For example, one heavy chain constant region 1 (22) is connected to the other heavy chain constant region 1 (22) through another linker (not shown).
The scFv antibody fragment consists of the light chain variable region 31 (SEQ ID NO: 63), the heavy chain variable region 21 (SEQ ID NO: 65), and a linker. The light chain variable region 31 (SEQ ID NO: 63) is connected to the heavy chain variable region 21 (SEQ ID NO: 65) through a linker (not shown).
As long as the recombination protein is capable of binding specifically and quickly to troponin I derived from human myocardium, the linker connecting the light chain variable region 31 (SEQ ID NO: 63) and the heavy chain variable region 21 (SEQ ID NO: 65) is not specifically limited. An example of the linker is a peptide consisting of 5-20 amino acids. For example, the linker is a peptide consisting of the amino acid sequence represented by GGGGSGGGGSGGGGS (SEQ ID NO: 64). Another example of the linker is a disulfide bond (-sulfur atom (S)—sulfur atom (S)—).
As long as the recombination protein is capable of binding specifically and quickly to troponin I derived from human myocardium, the N-terminal of the light chain variable region 31 (SEQ ID NO: 63) may be modified with an amino acid sequence. The C-terminal thereof may be also modified.
As long as the recombination protein is capable of binding specifically and quickly to troponin I derived from human myocardium, the N-terminal of the heavy chain variable region 21 (SEQ ID NO: 65) may be modified with an amino acid sequence. The C-terminal thereof may be also modified. An example of the amino acid sequence to modify the C-terminal of the heavy chain variable region 21 (SEQ ID NO: 65) is AAALEHHHHHH (SEQ ID NO: 66).
When the recombinant protein of the present disclosure is brought into contact with troponin I derived from human myocardium, the recombinant protein of the present disclosure binds specifically and quickly to the troponin I derived from human myocardium. For example, when the recombinant protein of the present disclosure is mixed with troponin I derived from human myocardium, the recombinant protein of the present disclosure binds specifically and quickly to the troponin I derived from human myocardium.
Detection of the binding of the recombinant protein of the present disclosure to the troponin I derived from human myocardium can be carried out by methods for detecting antigen-antibody binding which are well known to those skilled in the art. Examples of such methods include the ELISA sandwich method.
The recombinant protein of the present disclosure can be produced using an ordinal protein expression technique. For example, first, a vector including a gene sequence coding for the recombinant protein of the present disclosure is prepared. An example of the vector is a plasmid. Then, cells (e.g., Escherichia coli) are transformed with this vector. These cells are incubated to produce the recombinant protein of the present disclosure.
In order to obtain the scFv antibody fragment efficiently, it is beneficial that the recombinant protein of the present disclosure is produced by a refolding method. Non Patent Literature 3 discloses the refolding method.
Non Patent Literature 3
Jun Kamishikiryo et. al., “Molecular Basis for LLT1 Protein Recognition by Human CD161 Protein (NKRP1A/KLRB1)”, THE JOURNAL OF BIOLOGICAL CHEMISTRY, VOL. 286, NO. 27, p.p. 23823-23830.
Examples of the technique of the present disclosure are as follows.
1st aspect: A recombinant protein which binds specifically to troponin I derived from human myocardium. The recombinant protein includes a light chain variable region comprising the amino acid sequence represented by SEQ ID NO: 63, and a heavy chain variable region comprising the amino acid sequence represented by SEQ ID NO: 65.
2nd aspect: In the recombinant protein according to the 1st aspect, the recombinant protein may be an antibody.
3rd aspect: In the recombinant protein according to the 1st aspect, the recombinant protein may be an antibody fragment.
4th aspect: In the recombinant protein according to the 3rd aspect, the antibody fragment may be a Fab antibody fragment.
5th aspect: In the recombinant protein according to the 3rd aspect, the antibody fragment may be a F(ab′)2 antibody fragment.
6th aspect: In the recombinant protein according to the 3rd aspect, the antibody fragment may be an scFv antibody fragment.
7th aspect: A method for binding a recombinant protein specifically to troponin I derived from human myocardium, includes the following steps. A step (a) is a step of preparing the recombinant protein. The recombinant protein includes a light chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 63, and a heavy chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 65. A step (b) is a step of bringing the recombinant protein into contact with the troponin I derived from human myocardium to bind the recombinant protein specifically to the troponin I derived from human myocardium. In this aspect, for example, the step (b) may be carried out in vitro.
8th aspect: In the method according to the 7th aspect, the recombinant protein may be an antibody.
9th aspect: In the method according to the 7th aspect, the recombinant protein may be an antibody fragment.
10th aspect: In the method according to the 9th aspect, the antibody fragment may be a Fab antibody fragment.
11th aspect: In the method according to the 9th aspect, the antibody fragment may be a F(ab′)2 antibody fragment.
12th aspect: In the method according to the 9th aspect, the antibody fragment may be scFv antibody fragment.
EXAMPLES
An example for supporting an exemplary embodiment of the present disclosure is described below.
Example 1
Table 1, Table 2, Table 3, and Table 4 show the primers used in Example 1.
Table 1 shows the forward mixture primers (primers 1-21, SEQ ID NOS: 02-22) for amplifying a light chain variable region.
Table 2 shows the forward mixture primers (primers 22-44, SEQ ID NOS: 23-45) for amplifying a heavy chain variable region.
Table 3 shows the reverse mixture primers (primers 45-49, SEQ ID NOS: 46-50) for amplifying a light chain variable region.
Table 4 shows the reverse mixture primers (primers 50-55, SEQ ID NOS: 51-56) for amplifying a heavy chain variable region.
TABLE 1
Primer 1 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYATTG
02 TWCTCWCCCARTC
Primer
 2 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYATTS
03 TGMTSACYCAGTC
Primer
 3 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYATTG
04 TGMTMACTCAGTC
Primer 4 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYATTG
05 TGHTRWCACAGTC
Primer
 5 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYATTG
06 TRATGACMCAGTC
Primer 6 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYATTM
07 AGATRAMCCAGTC
Primer 7 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYATTC
08 AGATGAYDCAGTC
Primer 8 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYATTT
09 TGCTGACTCAGTC
Primer 9 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYATTG
10 TTCTCAWCCAGTC
Primer 10 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYATTG
11 WGCTSACCCAATC
Primer 11 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYATTS
12 TRATGACCCARTC
Primer 12 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYRTTK
13 TGATGACCCAVAC
Primer 13 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYATYC
14 AGATGACACAGAC
Primer 14 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYATTG
15 TGATGACACAACC
Primer 15 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYATCC
16 AGCTGACTCAGCC
Primer 16 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYATTG
17 TGATGACBCAGKC
Primer 17 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYATTG
18 TGATAACYCAGGA
Primer 18 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYATTG
19 TGATGACCCAGWT
Primer 19 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYGTGS
20 TGMTSACYCAGTC
Primer 20 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYGCTG
21 TTGTACTCAGGAATC
Primer
 21 SEQ ID NO: CCTTTCTATGCGGCCCAGCCGGCCATGGCCGAYATTG
22 TDHTVWCHCAGTC
TABLE 2
Primer 22 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCG
23 AKGTRMAGCTTCAGGAGYC
Primer
 23 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCG
24 AGGTNCAGCTBCAGCAGTC
Primer
 24 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCC
25 AGGTGCAGCTGAAGSASTC
Primer 25 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCC
26 AGSTBCAGCTGCAGCAGTC
Primer 26 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCG
27 AGGTYCAGCTYCAGCAGTC
Primer 27 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCG
28 ARGTCCARCTGCAACARTC
Primer 28 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCC
29 AGGTYCAGCTBCAGCARTC
Primer 29 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCC
30 AGGTYCARCTKCAGCAGTC
Primer 30 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCC
31 AGGTCCACGTGAAGCAGTC
Primer
 31 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCG
32 AGGTGAASSTGGTGGARTC
Primer
 32 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCG
33 AVGTGAWGYTGGTGGAGTC
Primer 33 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCG
34 AGGTGAAGGTCATCGAGTC
Primer 34 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCS
35 AGGTGCAGSKGGTGGAGTC
Primer 35 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCG
36 AKGTGCAMCTGGTGGAGTC
Primer 36 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCG
37 AAGTGCAVCTGGTGGAGTC
Primer 37 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCG
38 AGGTGAAGCTGATGGARTC
Primer 38 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCG
39 AGGTGCARCTTGTTGAGTC
Primer 39 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCG
40 ARGTRAAGCTTCTCGAGTC
Primer 40 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCG
41 AAGTGAARSTTGAGGAGTC
Primer 41 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCG
42 AAGTGATGCTGGTGGAGTC
Primer 42 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCC
43 AGGTTACTCTRAAAGWGTSTG
Primer 43 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCC
44 AGGTCCAAYTVCAGCARCC
Primer 44 SEQ ID NO: AGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCG
45 ATGTGAACTTGGAAGTGTC
TABLE 3
Primer 45 SEQ ID NO: ACCAGAGCCGCCGCCGCCGCTACCACCACCACCC
46 CGTTTGATTTCCARCTTKG
Primer 46 SEQ ID NO: ACCAGAGCCGCCGCCGCCGCTACCACCACCACCC
47 CGTTTTATTTCCAGCTTGG
Primer 47 SEQ ID NO: ACCAGAGCCGCCGCCGCCGCTACCACCACCACCC
48 CGTTTSAGCTCCAGCTTGG
Primer 48 SEQ ID NO: ACCAGAGCCGCCGCCGCCGCTACCACCACCACCC
49 CGTTYWATTTCCAACTTWG
Primer 49 SEQ ID NO: ACCAGAGCCGCCGCCGCCGCTACCACCACCACCC
50 CCTAGGACAGTCAGTTTGG
TABLE 4
Primer 50 SEQ ID CGGCACCGGCGCACCTGCGGCCGCYGAGGAAACGGTGAC
NO: 51 CGTGGT
Primer 51 SEQ ID CGGCACCGGCGCACCTGCGGCCGCYGAGGAGACTGTGAG
NO: 52 AGTGGT
Primer 52 SEQ ID CGGCACCGGCGCACCTGCGGCCGCYGAGGAGACGGTGAC
NO: 53 TGAGRT
Primer 53 SEQ ID CGGCACCGGCGCACCTGCGGCCGCYGAGGAAGACTGTAG
NO: 54 AGTGGT
Primer 54 SEQ ID CGGCACCGGCGCACCTGCGGCCGCYGCGGAGACASTGAC
NO: 55 CAGAGT
Primer 55 SEQ ID CGGCACCGGCGCACCTGCGGCCGCYGCAGAGACASTGAC
NO: 56 CAGAGT
Step (a-1) Preparation of a Hybridoma (Derived from Mouse Spleen) Capable of Producing Monoclonal Antibodies which Specifically Bind to Troponin I Derived from Human Myocardium
A peptide having an amino acid sequence (SEQ ID NO: 01, purchased from Sigma Aldrich Japan Co., Ltd.,
RPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAK) contained in troponin I derived from human myocardium was connected to human serum albumin (purchased from Sigma Aldrich Japan Co. Ltd.) using a sulfo-SMCC cross linker (purchased from Servo Fischer Scientific Co., Ltd.).
More particularly, the sulfo-SMCC cross linker (0.5 mg) was dissolved in 100 microliters of a phosphate buffered saline so as to obtain a first aqueous solution. This first aqueous solution was left under a temperature of 50 degrees Celsius for ten minutes.
The human serum albumin (10 mg) was dissolved in one milliliter of a phosphate buffered saline to obtain a second aqueous solution.
The first aqueous solution was mixed with the second aqueous solution to obtain a mixture. The mixture was left at rest for 30 minutes. In this way, the sulfo-SMCC cross linker was connected to the human serum albumin.
The mixture was passed through a column (purchased from GE health care, trade name: PD10) to remove the unreacted sulfo-SMCC cross linker.
The above-mentioned peptide (SEQ ID NO: 01, 1.5 mg) was dissolved in dimethylsulfoxide (hereinafter, referred to as “DMSO”) to obtain a DMSO solution. The DMSO solution (100 microliters) was added to the mixture (1 mL) having a concentration of 2 mg/ml. Afterwards, the mixture was left overnight to connect the sulfo-SMCC cross linker to the peptide (SEQ ID NO: 01).
In this way, human serum albumin modified with the peptide having the amino acid sequence (SEQ ID NO: 01) contained in the troponin I was obtained. Hereinafter, this human serum albumin is referred to as “troponin-modified HSA”.
A complete Freud adjuvant (purchased from Wako Pure Chemical Industries Co., Ltd.) and the troponin-modified HSA were mixed to obtain a mixture. This mixture was injected to a BALB/c mouse. The BALB/c mouse is a kind of albino mouse.
Two weeks later, a mixture of phosphate buffered saline (hereinafter, referred to as “PBS”) and troponin-modified HSA was injected into the BALB/c mouse. This was repeated once again. In this way, the BALB/c mouse was immunized by troponin-modified HSA for one month. In other words, by administering the mixture to the BALB/c mouse, antibodies against troponin-modified HSA were produced in the body of the BALB/c mouse.
The spleen of the immunized BALB/c mouse was taken out. In accordance with the cell fusion method disclosed in Non Patent Literature 4, hybridomas were obtained. Afterwards, the hybridomas were incubated in a culture fluid. The number of hybridomas (cells) after the incubation was approximately 5×106. The hybridomas obtained in this way were capable of producing the monoclonal antibody which specifically bound to troponin I derived from human myocardium.
Non Patent Literature 4
G. Kohler et al., Nature, 256, 495 (1975)
Step (a-2) Extraction of Total Mouse RNAs from the Hybridoma Cells
In order to destroy the cell membrane of the cultured hybridomas, one milliliter of TRIzol (Purchased from Invitrogen Co., Ltd.) was added to the culture fluid containing the hybridomas, and the culture fluid was stirred well.
Then, a chloroform liquid having a volume of 0.2 mL (degree of purity: 99.9%) was added to the culture fluid, and the culture fluid was stirred well again.
The culture fluid was subjected to a centrifugal separation at an acceleration of gravity of 117600 m/s2 under a temperature of 4 degrees Celsius for 15 minutes. The supernatant (500 μL) was acquired. Isopropanol (500 μL) was added to the obtained supernatant and left at rest under room temperature for ten minutes.
The culture fluid was again subject to a centrifugal separation having a condition identical to the above-mentioned condition to obtain a precipitate. A seventy-five percent ethanol aqueous solution (1 mL) was added to the obtained precipitate so as to obtain an ethanol solution.
The ethanol solution was subjected to a centrifugal separation at an acceleration of gravity of 73500 m/s2 for five minutes. The precipitate was dried. In this way, total mouse RNAs were obtained.
Step (b-1) Extraction of mRNA from the Total Mouse RNAs
Using an Oligotex™-dT30 <Super> mRNA Purification kit (purchased from Takara bio Co., Ltd.), mRNA was extracted from the total mouse RNAs obtained in the step (a-2).
RNase-free water (100 μL) was injected into a microtube. This microtube was set at a block incubator (purchased from ASTEC CO. LTD.) and heated under a temperature of 70 degrees Celsius for one hour.
The total mouse RNAs were dissolved in the RNase-free water (100 μL).
A 2× binding buffered solution (100 μL) included in the kit and an oligotex (10 μL) included in the kit were mixed with the RNase-free water (100 μL). Subsequently, the mixture was left at rest under a temperature of 70 degrees Celsius for three minutes. Furthermore, the mixture was left at rest under room temperature for ten minutes.
The mixture was subjected to a centrifugal separation at an acceleration of gravity of 147000 m/s2 for five minutes. The supernatant was removed, and the precipitate was suspended in Wash buffer (350 μL) included in the kit. The suspension liquid was supplied to a column included in the kit. The column was subjected to a centrifugal separation at an acceleration of gravity of 147000 m/s2 for 30 seconds.
The Wash buffer (350 μL) was supplied to the column to wash the column. The column was subjected to a centrifugal separation at an acceleration of gravity of 147000 m/s2 again for 30 seconds.
A microtube for sample collection was attached to the bottom of the column.
In order to extract mRNA contained in the column, RNase-free water (20 μL) contained in the microtube was supplied to the column. Subsequently, the column was subjected to a centrifugal separation at an acceleration of gravity of 147000 m/s2 for three minutes. Again, RNase-free water (20 μL) was supplied to the column, and the column was subjected to a centrifugal separation at an acceleration of gravity of 147000 m/s2 for three minutes.
Thus, the extract liquid containing the mRNA was obtained in the microtube.
(Step b-2) Reverse-Transcription from mRNA to cDNA
The mRNA contained in the obtained extract liquid was reverse-transcripted with a reverse-transcriptase (purchased from Takara bio Co., Ltd, trade name: Primersript) to obtain a solution containing cDNA.
Step (b-3-1) Amplification of the Gene Coding for the Light Chain Variable Region Using the cDNA
The gene fragment (SEQ ID NO: 58, hereinafter, referred to as “VL gene fragment”) coding for the light chain variable region of the above-mentioned monoclonal antibody was amplified by a PCR method using the cDNA contained in the solution, the forward primers 1-21 (SEQ ID NOS: 02-22), and the reverse primers 1-5 (SEQ ID NOS: 23-27). The polymerase used in this PCR method was purchased from Takara bio Co., Ltd under a trade name of TaKaRa Ex Taq Hot start Version.
The protocol of this PCR method is shown in Table 5.
TABLE 5
One cycle ninety six degrees Celsius for thirty seconds
fifty two degrees Celsius for one minute
sixty eight degrees Celsius for one minute
The number of the cycles: 35.
Finally, the solution was left at 68 degrees Celsius for four minutes. In this way, a PCR solution was obtained. This PCR solution contained the amplified VL gene fragment (SEQ ID NO: 58).
For the confirmation and purification of the amplified VL gene fragment, the obtained PCR solution was subjected to an electrophoresis using a gel containing agarose having a concentration of 2% by weight.
Step (b-3-2) Amplification of the Gene Coding for the Heavy Chain Variable Region Using the cDNA
The gene fragment (SEQ ID NO: 57, hereinafter, referred to as “VH gene fragment”) coding for the heavy chain variable region of the above-mentioned monoclonal antibody was amplified by a PCR method using the cDNA contained in the solution, the forward primers 22-44 (SEQ ID NOS: 28-50), and the reverse primers 6-11 (SEQ ID NOS: 51-56). The polymerase used in this PCR method was purchased from Takara bio Co., Ltd under a trade name of TaKaRa Ex Tag Hot start Version.
The protocol of this PCR method was identical to that used for the VL gene fragment.
Finally, the solution was left at 68 degrees Celsius for four minutes. In this way, a PCR solution was obtained. This PCR solution contained the amplified VH gene fragment (SEQ ID NO: 57).
For the confirmation of the generation of the VH gene fragment and for the purification of the VH gene fragment, the obtained PCR solution was subjected to an electrophoresis using a gel containing agarose having a concentration of 2% by weight.
Step (b-4) Connection of the VL Gene Fragment and the VH Gene Fragment
The purified VH gene fragment (SEQ ID NO: 57) was connected to the purified VL gene fragment (SEQ ID NO: 58) using an overlap extension PCR method. In this way, the gene fragment (SEQ ID NO: 59, hereinafter, referred to as “scFv gene fragment”) coding for the scFv antibody fragment of the above-mentioned monoclonal antibody was obtained. The obtained gene fragment (SEQ ID NO: 59) was modified with restriction enzyme sites Nco1 and Not 1 at the 5′-end and 3′-end thereof, respectively.
Step (c-1) Introduction of the Gene to a Vector
The scFv gene fragment was ligated into a protein expression vector (purchased from Takara bio Co., Ltd, trade name: pET22b(+)). The detail of the ligation is described below.
First, the scFv gene fragment was treated with restriction enzymes Nco1 and Not1 (both of which were purchased from Takara bio Co., Ltd.). The scFv gene fragment was purified by an electrophoresis method to obtain an aqueous solution containing the scFv gene fragment.
The protein expression vector was also treated with restriction enzymes Nco1 and Not1 (both of which were purchased from Takara bio Co., Ltd.). The protein expression vector was also purified by an electrophoresis method to obtain an aqueous solution containing the protein expression vector.
These two aqueous solutions were mixed to obtain a mixture.
An enzyme (purchased from Toyobo Co., Ltd., trade name: Ligation High ver. 2) was added to the mixture, and the mixture was left under a temperature of 16 degrees Celsius for two hours. In this way, the scFv gene fragment was ligated into the protein expression vector.
Escherichia coli cells (purchased from Takara bio Co., Ltd., trade name; DH5α competent cell) were transformed with the protein expression vector in which the scFv gene fragment was thus ligated.
Subsequently, the Escherichia coli cells were incubated for sixteen hours on an LB plate culture medium containing ampicillin having a concentration of 100 μg/mL. After the incubation, a single colony formed on the LB plate culture medium was picked up. The single colony was supplied to an LB liquid culture medium (5 mL) containing ampicillin having a concentration of 100 μg/mL, and the colony was incubated for 16 hours.
In order to remove an unnecessary gene sequence included in the protein expression vector pET22b(+), the protein expression vector pET22b(+) was extracted from this LB liquid culture medium using a kit (QIAGEN Co., Ltd. trade name: QIAprep spin miniprep kit). By a PCR method using the extracted protein expression vector pET22b(+), the primer 56 (SEQ ID NO: 67), and the primer 57 (SEQ ID NO: 68), the signal sequence (DNA sequence, SEQ ID NO: 60) of the protein expression vector pET22b(+) was removed. Thus, the expression vector coding for the wild type scFv antibody fragment was obtained.
Step (c-2) Introduction of the Mutations to the Vector
The expression vector obtained in the step (c-1) included the scFv gene fragment (SEQ ID NO: 59). Among the 729 bases constituting the scFv gene fragment (SEQ ID NO: 59) included in the expression vector, seven bases were substituted. In more detail, the 589th adenine (A), the 590th cytosine (C), the 607th thymine (T), the 608th cytosine (C), the 609th cytosine (C), the 613th adenine (A), and the 615th cytosine (C) were substituted with guanine (G), adenine (A), guanine (G), adenine (A), thymine (T), guanine (G), and thymine (T), respectively.
More particularly, as shown in FIG. 2, a PCR method using the primer 58 (SEQ ID NO: 69), the primer 59 (SEQ ID NO: 70) and the expression vector obtained in the step (c-1) was performed. The primer 58 (SEQ ID NO: 69) was complementary to the gene sequence from 579th base to 626th base included in the scFv gene fragment (SEQ ID NO: 59) except for the seven bases to be substituted. The primer 59 (SEQ ID NO: 70) was complementary to the gene sequence from 579th base to 626th base included in the gene fragment complimentary to the scFv gene fragment (SEQ ID NO: 59) except for the seven bases to be substituted. The PCR method shown in FIG. 2 allowed the seven bases (AC, TCC, A, C) included in the expression vector coding for the wild type scFv antibody fragment to be substituted with the different seven bases (GA, GAT, G, T). Thus, the expression vector containing the gene sequence (SEQ ID NO: 71) encoding the mutant scFv was obtained.
Step (c-3) Acquisition of the Protein Using the Vector
Escherichia coli cells (purchased from Takara bio Co., Ltd, trade name: BL21(DE3)) were transformed with the vector obtained in the step (c-2). Subsequently, the Escherichia coli cells were incubated on an LB plate culture medium containing ampicillin having a concentration of 100 μg/mL under a temperature of 37 degrees Celsius for 16 hours.
After the incubation, a single colony formed on the LB plate culture medium was picked up. The single colony was supplied to an LB liquid culture medium containing ampicillin (500 mL) having a concentration of 100 μg/mL. Subsequently, the Escherichia coli cells contained in the single colony were propagated in such a manner that the absorbance of the LB liquid culture medium at a wavelength of 600 nanometers was adjusted to 0.5.
Furthermore, an aqueous solution of isopropyl beta-D-thiogalactopyranoside (0.5 mL) having a concentration of 1 M was added to the LB liquid culture medium. Afterwards, the Escherichia coli cells were incubated with shaking under a temperature of 37 degrees Celsius for five hours. In this way, a culture fluid was obtained.
The obtained culture fluid was subjected to a centrifugal separation at an acceleration of gravity of 49000 m/s2 under a temperature of 4 degrees Celsius for five minutes. The precipitation containing the Escherichia coli cells was again suspended in a phosphate buffered saline (50 mL).
The suspension was subjected to an ultrasonic treatment to crush the Escherichia coli cells. The solution containing the crushed Escherichia coli cells was subjected to a centrifugal separation at an acceleration of gravity of 98000 m/s2 under a temperature of 4 degrees Celsius for thirty minutes. In this way, the precipitation was obtained.
The precipitation was washed twice with a phosphate buffered saline containing a surface active agent (purchased from Wako Pure Chemical Industries Co., Ltd., trade name: Triton X-100) having a concentration of 4%. The precipitation was further washed with a phosphate buffered saline without containing a surface active agent.
An aqueous solution A (10 mL) containing chemical reagents shown in Table 6 was added to the precipitation.
TABLE 6
Chemical reagents Concentration
Guanidine hydrochloride 6M
Sodium chloride 0.1M
MES buffer solution 50 mM
Ethylene diamine tetraacetic acid 10 mM
The aqueous solution A had a pH of 6.
Subsequently, the aqueous solution A was left under a temperature of 4 degrees Celsius for eighteen hours. In this way, the precipitation was dissolved.
The aqueous solution A was passed through a filter (purchased from Sartorius, trade name: Minisart) having a mesh size of 0.45 μm to remove the residue. In this way, the filtrate was obtained.
Two milliliters of an aqueous solution B was added dropwise to the filtrate (1 mL). The composition of the aqueous solution B (concentrations of chemical reagents contained in the aqueous solution B) is shown in Table 7.
TABLE 7
Chemical reagents Concentration
Tris-HCl 0.1M
Ethylene diamine tetraacetic acid   2 mM
Arginine hydrochloride 1.0M
Cystamine 3.73 mM
Cysteamine hydrochloride 6.73 mM
The aqueous solution B had a pH of 8.0. In this way, an aqueous solution having a volume of 3 mL was obtained.
The aqueous solution (3 mL) was added dropwise to an aqueous solution having a volume of one liter which contained the chemical reagents shown in Table 7. Afterwards, the obtained aqueous solution was stirred under a temperature of 4 degrees Celsius for 96 hours. In this way, the mutant scFv antibody fragment (SEQ ID NO: 61) was obtained.
Subsequently, the solution was concentrated using a filtration unit (purchased from Sartorius, trade name: VIVAFLOW50) so that the solution had a volume of 10 milliliters. The mutant scFv antibody fragment contained in the solution was purified with a column (purchased from GE healthcare, trade name: HiLoad 26/60 Superdex 75 pg).
The detail of the amino acid sequence (SEQ ID NO: 61) of the mutant scFv antibody fragment is described below.
Light chain variable region (SEQ ID NO: 63):
    DVVLTQSPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLV
SKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPLTFGAGTKLEIKR
The amino acid sequence modified at the N-terminal of the light chain variable region: None
The amino acid sequence modified at the C-terminal of the light chain variable region: None
Linker (SEQ ID NO: 64):
GGGGSGGGGSGGGGS
Heavy chain variable region (SEQ ID NO: 65):
    QLQLQQSGAELVRSGASVKLSCTASGFNIKDYYMNWVKQRPEQGLE
WIGWIDPANGDTAYAPRFQVKADMTADKDSDTAYLQLSSLTSEDTAVYYC
NADLPMDQWGQGTSVTVSS
The amino acid sequence modified at the N-terminal of the heavy chain variable region: None
The amino acid sequence modified at the C-terminal of the heavy chain variable region:
AAALEHHHHHH (SEQ ID NO: 66)
Step (d) Calculation of Association Rate Constant and Dissociation Rate Constant
Using an intermolecular interaction analyzer Biacore T100 (purchased from GE health care company), the association rate constant and the dissociation rate constant of the mutant scFv antibody fragment were calculated in accordance with the manual attached to the intermolecular interaction analyzer Biacore T100.
Troponin I (purchased from Funakoshi) derived from human myocardium having approximately 500 RU (Resonance Unit) was fixed on a CM5 chip (purchased from GE health care company). This CM5 chip was set in the Biacore T100. Then, aqueous solutions (concentrations: 100 nM, 50 nM, 25 nM, 12.5 nM, and 6.25 nM; volume: 150 microliters) containing the mutant scFv antibody fragment were flowed through the Biacore T100. The association rate constant and the dissociation rate constant measured with the intermolecular interaction analyzer Biacore T100 are shown in Table 9.
Comparative Example 1
In Comparative Example 1, the experiment similar to Example 1 was conducted except that the step (c-2) was not conducted. In this way, the wild type scFv antibody fragment consisting of the amino acid sequence represented by SEQ ID NO: 62 was obtained. Similarly to Example 1, the association rate constant and the dissociation rate constant of the wild-type scFv antibody fragment were measured. The results are shown in Table 9.
The differences between the wild type scFv antibody fragment (SEQ ID NO: 62) and the mutant scFv antibody fragment (SEQ ID NO: 61) are shown in Table 8.
TABLE 8
Wild type scFv Mutant scFv
antibody fragment antibody fragment
(SEQ ID: 62) (SEQ ID: 61)
197th amino acid in the scFv T D
antibody fragment
203rd amino acid in the scFv S D
antibody fragment
205th amino acid in the scFv N D
antibody fragment
TABLE 9
Comparative
example 1 Example 1
Association rate constant 5.173 × 10+4 1.24 × 10+5
Dissociation rate constant 1.361 × 10−4 2.14 × 10−4
As is clear from Table 9, the mutant scFv antibody fragment according to Example 1 has a higher association rate constant than that of the wild-type scFv antibody fragment according to Comparative Example 1. This means that the mutant scFv antibody fragment bound specifically to troponin I derived from human myocardium more quickly than the wild-type scFv antibody fragment.
Industrial Applicability
The recombinant protein and the method according to the present disclosure can be used for a sensor for detecting acute myocardial infarction.

Claims (12)

What is claimed is:
1. A recombinant protein which binds specifically to troponin I derived from human myocardium, the recombinant protein comprising:
a light chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 63; and
a heavy chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 65.
2. The recombinant protein according to claim 1, wherein the recombinant protein is an antibody.
3. The recombinant protein according to claim 1, wherein the recombinant protein is an antibody fragment.
4. The recombinant protein according to claim 3, wherein the antibody fragment is a Fab antibody fragment.
5. The recombinant protein according to claim 3, wherein the antibody fragment is a F(ab′)2 antibody fragment.
6. The recombinant protein according to claim 3, wherein the antibody fragment is an scFv antibody fragment.
7. A method for binding a recombinant protein specifically to troponin I derived from human myocardium, the method comprising:
a step (a) of preparing the recombinant protein, wherein
the recombinant protein comprises:
a light chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 63; and
a heavy chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 65; and
a step (b) of bringing the recombinant protein into contact with the troponin I derived from human myocardium to bind the recombinant protein specifically to the troponin I derived from human myocardium.
8. The method according to claim 7, wherein the recombinant protein is an antibody.
9. The method according to claim 7, wherein the recombinant protein is an antibody fragment.
10. The method according to claim 9, wherein the antibody fragment is a Fab antibody fragment.
11. The method according to claim 9, wherein the antibody fragment is a F(ab′)2 antibody fragment.
12. The method according to claim 9, wherein the antibody fragment is an scFv antibody fragment.
US13/680,925 2011-12-16 2012-11-19 Recombinant protein capable of binding specifically and quickly to troponin I derived from human myocardium Expired - Fee Related US8663933B2 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
JP2011275413 2011-12-16
JP2011-275413 2011-12-16
PCT/JP2012/001726 WO2013088587A1 (en) 2011-12-16 2012-03-13 Recombinant protein capable of binding to troponin-i from human cardiac muscle specifically and rapidly

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
PCT/JP2012/001726 Continuation WO2013088587A1 (en) 2011-12-16 2012-03-13 Recombinant protein capable of binding to troponin-i from human cardiac muscle specifically and rapidly

Publications (2)

Publication Number Publication Date
US20130158237A1 US20130158237A1 (en) 2013-06-20
US8663933B2 true US8663933B2 (en) 2014-03-04

Family

ID=48610776

Family Applications (1)

Application Number Title Priority Date Filing Date
US13/680,925 Expired - Fee Related US8663933B2 (en) 2011-12-16 2012-11-19 Recombinant protein capable of binding specifically and quickly to troponin I derived from human myocardium

Country Status (1)

Country Link
US (1) US8663933B2 (en)

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8603759B2 (en) * 2011-12-06 2013-12-10 Panasonic Corporation Recombinant protein capable of binding specifically and quickly to troponin I derived from human myocardium
ES2810229B2 (en) * 2019-09-05 2022-02-21 Univ Cadiz RECOMBINANT PROTEIN OF NANNOCHLOROPSIS GADITANA
CN119504989B (en) * 2023-08-25 2025-11-18 东莞市朋志生物科技有限公司 An anti-cardiac troponin I antibody and its application

Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1994027156A1 (en) 1993-05-17 1994-11-24 Fortron Bioscience, Inc. Assay for cardiac troponin i
US6991907B1 (en) * 1995-04-18 2006-01-31 Biosite, Inc. Methods for the assay of troponin I and T and complexes of troponin I and T and selection of antibodies for use in immunoassays
WO2007114947A2 (en) 2006-04-04 2007-10-11 Singulex, Inc. Highly sensitive system and methods for analysis of troponin
US7285418B2 (en) * 1996-06-25 2007-10-23 Hytest Ltd. Method and kit for the diagnosis of troponin I
US20080003685A1 (en) 2004-09-28 2008-01-03 Goix Philippe J System and methods for sample analysis
JP2010107363A (en) 2008-10-30 2010-05-13 Sysmex Corp Method and reagent kit for measuring troponin i
US7838250B1 (en) * 2006-04-04 2010-11-23 Singulex, Inc. Highly sensitive system and methods for analysis of troponin
US8030026B2 (en) * 2009-02-24 2011-10-04 Abbott Laboratories Antibodies to troponin I and methods of use thereof
US20130143245A1 (en) * 2011-12-06 2013-06-06 Panasonic Corporation Recombinant protein capable of binding specifically and quickly to troponin i derived from human myocardium

Patent Citations (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1994027156A1 (en) 1993-05-17 1994-11-24 Fortron Bioscience, Inc. Assay for cardiac troponin i
JPH09503050A (en) 1993-05-17 1997-03-25 フォートロン バイオサイエンス インク. Assay for Cardiac Troponin I
US5756682A (en) 1993-05-17 1998-05-26 Wicks; Richard W. Assay for cardiac troponin I
US5834220A (en) * 1993-05-17 1998-11-10 Fortron Bioscience, Inc. Assay for cardiac troponin I
US6991907B1 (en) * 1995-04-18 2006-01-31 Biosite, Inc. Methods for the assay of troponin I and T and complexes of troponin I and T and selection of antibodies for use in immunoassays
US7285418B2 (en) * 1996-06-25 2007-10-23 Hytest Ltd. Method and kit for the diagnosis of troponin I
US20080003685A1 (en) 2004-09-28 2008-01-03 Goix Philippe J System and methods for sample analysis
WO2007114947A2 (en) 2006-04-04 2007-10-11 Singulex, Inc. Highly sensitive system and methods for analysis of troponin
JP2009532701A (en) 2006-04-04 2009-09-10 シングレックス,インコーポレイテッド Sensitive system and method for the analysis of troponin
US7838250B1 (en) * 2006-04-04 2010-11-23 Singulex, Inc. Highly sensitive system and methods for analysis of troponin
JP2010107363A (en) 2008-10-30 2010-05-13 Sysmex Corp Method and reagent kit for measuring troponin i
US8030026B2 (en) * 2009-02-24 2011-10-04 Abbott Laboratories Antibodies to troponin I and methods of use thereof
US20130143245A1 (en) * 2011-12-06 2013-06-06 Panasonic Corporation Recombinant protein capable of binding specifically and quickly to troponin i derived from human myocardium

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
A.G. Katrukha et al., "Troponin I is released in bloodstream of patients with acute myocardial infarction not in free form but as complex," Enzymes and Protein Markers, Clinical Chemistry 43:8, 1379-1385 (1997).
G. Kohler et al., "Continuous cultures of used cells secreting antibody of predefined specificity," Nature, vol. 256; Aug. 7, 1975.
International Search Report issued in International Patent Application No. PCT/JP2012/001726 dated Apr. 10, 2012.
J. Kamishikiryo et al., "Molecular Basis for LLT1 Protein Recognition by Human CD161 Protein (NKRP1A/KLRB1)," The Journal of Biological Chemistry, vol. 286, No. 27, pp. 23823-23830, 2011.
T. Keller, M.D. et al., "Sensitive Troponin I Assasy in Early Diagnosis of Acute Myocardial Infarction," The New England Journal of Medicine, vol. 361, pp. 868-877 (2009).

Also Published As

Publication number Publication date
US20130158237A1 (en) 2013-06-20

Similar Documents

Publication Publication Date Title
US8846869B2 (en) Mutant protein capable of binding specifically and quickly to troponin I derived from human myocardium
US7956165B2 (en) Compositions and methods for purifying and crystallizing molecules of interest
US12509661B2 (en) Compositions and methods related to aptamer-based reversible cell selection
JP2020519696A (en) Multispecific protein drugs and libraries thereof, and methods of manufacture and use
US8663933B2 (en) Recombinant protein capable of binding specifically and quickly to troponin I derived from human myocardium
US8603759B2 (en) Recombinant protein capable of binding specifically and quickly to troponin I derived from human myocardium
JP5528643B2 (en) Recombinant protein capable of specifically and rapidly binding to human cardiac troponin I
US20130178606A1 (en) Recombinant protein capable of binding specifically and quickly to troponin i derived from human myocardium
WO2022148491A1 (en) Assembled protein element and use thereof
JPH07506727A (en) Reagents for agglutination assay
US8603760B2 (en) Recombinant protein capable of binding specifically and quickly to troponin I derived from human myocardium
CN117229413B (en) A bispecific antibody against SFTSV-Gn and CD3 and a preparation method thereof
JP2013172663A (en) scFv ANTIBODY FRAGMENT HAVING HIGH AFFINITY WITH TROPONIN I DERIVED FROM HUMAN CARDIAC MUSCLE
JPWO2013094080A1 (en) Recombinant protein capable of specifically and rapidly binding to human cardiac troponin I
CN104388570A (en) Piezoelectric thin film technology-based nucleic acid single-gene mutation detection method
EP4223878A1 (en) Sars-cov-2-binding peptide
CN111333732B (en) Preparation and application of bispecific antibody targeting human BCMA and activating NK cells
CN102477096B (en) Human creatine kinase single-chain antibody with molecular chaperone function
JPWO2013088587A1 (en) Recombinant protein capable of specifically and rapidly binding to human cardiac troponin I
JP2013177338A (en) Troponin i binding protein
WO2014192202A1 (en) Recombinant protein capable of bonding specifically and quickly to troponin i from human myocardium
CN112239504A (en) Nano antibody aiming at PD-L1 and application thereof
CN120025428B (en) Nano antibody targeting NS3a and application thereof
CN104073502B (en) Neutrality genetic engineering antibody 3C1 of human brain natriuretic peptide and its preparation method and application
JP3728757B2 (en) Method for producing fluorescently labeled antibody

Legal Events

Date Code Title Description
AS Assignment

Owner name: PANASONIC CORPORATION, JAPAN

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:FUKUNAGA, ATSUSHI;REEL/FRAME:031558/0289

Effective date: 20121105

AS Assignment

Owner name: PANASONIC HEALTHCARE CO., LTD., JAPAN

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:PANASONIC CORPORATION;REEL/FRAME:032360/0795

Effective date: 20131127

FEPP Fee payment procedure

Free format text: MAINTENANCE FEE REMINDER MAILED (ORIGINAL EVENT CODE: REM.)

LAPS Lapse for failure to pay maintenance fees

Free format text: PATENT EXPIRED FOR FAILURE TO PAY MAINTENANCE FEES (ORIGINAL EVENT CODE: EXP.)

STCH Information on status: patent discontinuation

Free format text: PATENT EXPIRED DUE TO NONPAYMENT OF MAINTENANCE FEES UNDER 37 CFR 1.362

FP Lapsed due to failure to pay maintenance fee

Effective date: 20180304