US7524502B2 - Modified anti-TNF alpha antibody - Google Patents
Modified anti-TNF alpha antibody Download PDFInfo
- Publication number
- US7524502B2 US7524502B2 US10/495,146 US49514604A US7524502B2 US 7524502 B2 US7524502 B2 US 7524502B2 US 49514604 A US49514604 A US 49514604A US 7524502 B2 US7524502 B2 US 7524502B2
- Authority
- US
- United States
- Prior art keywords
- antibody
- tnf alpha
- modified
- cells
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Fee Related, expires
Links
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 131
- 210000001744 T-lymphocyte Anatomy 0.000 claims abstract description 73
- 230000002163 immunogen Effects 0.000 claims abstract description 29
- 230000004075 alteration Effects 0.000 claims abstract description 8
- 238000001727 in vivo Methods 0.000 claims abstract description 8
- 108090000623 proteins and genes Proteins 0.000 claims description 73
- 241000282414 Homo sapiens Species 0.000 claims description 54
- 210000004027 cell Anatomy 0.000 claims description 53
- 230000027455 binding Effects 0.000 claims description 48
- 102000004169 proteins and genes Human genes 0.000 claims description 40
- 108091054438 MHC class II family Proteins 0.000 claims description 34
- 102000043131 MHC class II family Human genes 0.000 claims description 26
- 125000000539 amino acid group Chemical group 0.000 claims description 14
- 229960000598 infliximab Drugs 0.000 claims description 14
- 230000000638 stimulation Effects 0.000 claims description 13
- 239000003446 ligand Substances 0.000 claims description 10
- 238000004166 bioassay Methods 0.000 claims description 7
- 230000008030 elimination Effects 0.000 claims description 5
- 238000003379 elimination reaction Methods 0.000 claims description 5
- 239000008194 pharmaceutical composition Substances 0.000 claims description 4
- 230000009467 reduction Effects 0.000 claims description 4
- 239000003085 diluting agent Substances 0.000 claims description 2
- 239000003937 drug carrier Substances 0.000 claims description 2
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 2
- 230000004663 cell proliferation Effects 0.000 claims 4
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 abstract description 72
- 102100040247 Tumor necrosis factor Human genes 0.000 abstract description 64
- 150000001413 amino acids Chemical class 0.000 abstract description 27
- 102000057041 human TNF Human genes 0.000 abstract description 8
- 230000004048 modification Effects 0.000 abstract description 5
- 238000012986 modification Methods 0.000 abstract description 5
- 102000004196 processed proteins & peptides Human genes 0.000 description 70
- 238000003556 assay Methods 0.000 description 62
- 125000003275 alpha amino acid group Chemical group 0.000 description 43
- 238000000034 method Methods 0.000 description 42
- 235000001014 amino acid Nutrition 0.000 description 39
- 235000018102 proteins Nutrition 0.000 description 37
- 238000006467 substitution reaction Methods 0.000 description 31
- 238000000338 in vitro Methods 0.000 description 29
- 238000002360 preparation method Methods 0.000 description 28
- 238000012360 testing method Methods 0.000 description 28
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 25
- 230000001225 therapeutic effect Effects 0.000 description 21
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 20
- 101100347633 Drosophila melanogaster Mhc gene Proteins 0.000 description 19
- 108091034117 Oligonucleotide Proteins 0.000 description 19
- 229920001184 polypeptide Polymers 0.000 description 18
- 238000003752 polymerase chain reaction Methods 0.000 description 16
- 108091007433 antigens Proteins 0.000 description 14
- 102000036639 antigens Human genes 0.000 description 14
- 238000010790 dilution Methods 0.000 description 14
- 239000012895 dilution Substances 0.000 description 14
- 239000000243 solution Substances 0.000 description 14
- 239000000427 antigen Substances 0.000 description 13
- 238000011534 incubation Methods 0.000 description 13
- 239000002609 medium Substances 0.000 description 13
- 239000013641 positive control Substances 0.000 description 13
- 238000011282 treatment Methods 0.000 description 13
- 238000001516 cell proliferation assay Methods 0.000 description 12
- 238000004519 manufacturing process Methods 0.000 description 12
- 239000000203 mixture Substances 0.000 description 12
- 230000005847 immunogenicity Effects 0.000 description 11
- 241001529936 Murinae Species 0.000 description 10
- 230000006052 T cell proliferation Effects 0.000 description 10
- 230000028993 immune response Effects 0.000 description 10
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 9
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 9
- 102000004889 Interleukin-6 Human genes 0.000 description 9
- 108090001005 Interleukin-6 Proteins 0.000 description 9
- 238000007792 addition Methods 0.000 description 9
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 9
- 230000000694 effects Effects 0.000 description 9
- 239000002953 phosphate buffered saline Substances 0.000 description 9
- 230000004044 response Effects 0.000 description 9
- 102000018713 Histocompatibility Antigens Class II Human genes 0.000 description 8
- 125000000729 N-terminal amino-acid group Chemical group 0.000 description 8
- 230000004071 biological effect Effects 0.000 description 8
- 238000006243 chemical reaction Methods 0.000 description 8
- 239000012634 fragment Substances 0.000 description 8
- 241000282412 Homo Species 0.000 description 7
- 108091008874 T cell receptors Proteins 0.000 description 7
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 7
- 238000002835 absorbance Methods 0.000 description 7
- 238000004458 analytical method Methods 0.000 description 7
- 238000013459 approach Methods 0.000 description 7
- UQLDLKMNUJERMK-UHFFFAOYSA-L di(octadecanoyloxy)lead Chemical compound [Pb+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O UQLDLKMNUJERMK-UHFFFAOYSA-L 0.000 description 7
- 238000006386 neutralization reaction Methods 0.000 description 7
- 230000035755 proliferation Effects 0.000 description 7
- 230000009696 proliferative response Effects 0.000 description 7
- 208000011231 Crohn disease Diseases 0.000 description 6
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 6
- 108060003951 Immunoglobulin Proteins 0.000 description 6
- 238000001514 detection method Methods 0.000 description 6
- 239000013604 expression vector Substances 0.000 description 6
- 102000018358 immunoglobulin Human genes 0.000 description 6
- 230000001404 mediated effect Effects 0.000 description 6
- 239000013642 negative control Substances 0.000 description 6
- 238000010079 rubber tapping Methods 0.000 description 6
- 210000002966 serum Anatomy 0.000 description 6
- 102220542303 60S ribosomal protein L27_D87S_mutation Human genes 0.000 description 5
- 102000004127 Cytokines Human genes 0.000 description 5
- 108090000695 Cytokines Proteins 0.000 description 5
- 102220574842 Gap junction alpha-3 protein_L11S_mutation Human genes 0.000 description 5
- 102220590602 Gap junction beta-1 protein_T86N_mutation Human genes 0.000 description 5
- 102220606764 Gap junction beta-1 protein_V23A_mutation Human genes 0.000 description 5
- 102220619799 Glycine receptor subunit alpha-1_A80S_mutation Human genes 0.000 description 5
- 102220622548 Histamine N-methyltransferase_S80A_mutation Human genes 0.000 description 5
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 5
- 108020004511 Recombinant DNA Proteins 0.000 description 5
- 239000012298 atmosphere Substances 0.000 description 5
- 238000005119 centrifugation Methods 0.000 description 5
- 239000003153 chemical reaction reagent Substances 0.000 description 5
- 239000011248 coating agent Substances 0.000 description 5
- 238000000576 coating method Methods 0.000 description 5
- 201000010099 disease Diseases 0.000 description 5
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 5
- 238000000126 in silico method Methods 0.000 description 5
- 230000006698 induction Effects 0.000 description 5
- 238000007834 ligase chain reaction Methods 0.000 description 5
- 102220602191 m7GpppX diphosphatase_I83A_mutation Human genes 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- 102220218476 rs1060503435 Human genes 0.000 description 5
- 102200005733 rs121918586 Human genes 0.000 description 5
- 102220080496 rs148911180 Human genes 0.000 description 5
- 102200007335 rs1554292444 Human genes 0.000 description 5
- 102220243686 rs1555618729 Human genes 0.000 description 5
- 102220067563 rs200327756 Human genes 0.000 description 5
- 102200105384 rs387906979 Human genes 0.000 description 5
- 102220014798 rs56204273 Human genes 0.000 description 5
- 102220045697 rs587782318 Human genes 0.000 description 5
- 102200073592 rs63751243 Human genes 0.000 description 5
- 102200153441 rs768834663 Human genes 0.000 description 5
- 102220062183 rs786203418 Human genes 0.000 description 5
- 241000894007 species Species 0.000 description 5
- 239000013598 vector Substances 0.000 description 5
- 108010038807 Oligopeptides Proteins 0.000 description 4
- 102000015636 Oligopeptides Human genes 0.000 description 4
- 210000000612 antigen-presenting cell Anatomy 0.000 description 4
- 238000004113 cell culture Methods 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- 210000002950 fibroblast Anatomy 0.000 description 4
- 238000000099 in vitro assay Methods 0.000 description 4
- 239000006166 lysate Substances 0.000 description 4
- 239000012139 lysis buffer Substances 0.000 description 4
- 238000002703 mutagenesis Methods 0.000 description 4
- 231100000350 mutagenesis Toxicity 0.000 description 4
- 230000035772 mutation Effects 0.000 description 4
- 230000003472 neutralizing effect Effects 0.000 description 4
- 102220023399 rs199620268 Human genes 0.000 description 4
- 238000003860 storage Methods 0.000 description 4
- 238000003786 synthesis reaction Methods 0.000 description 4
- 108020005065 3' Flanking Region Proteins 0.000 description 3
- 108020005029 5' Flanking Region Proteins 0.000 description 3
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 3
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 3
- 229920001213 Polysorbate 20 Polymers 0.000 description 3
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 3
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 3
- 230000003213 activating effect Effects 0.000 description 3
- 230000004913 activation Effects 0.000 description 3
- 210000004102 animal cell Anatomy 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 244000309466 calf Species 0.000 description 3
- 238000010276 construction Methods 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 210000002889 endothelial cell Anatomy 0.000 description 3
- 239000012997 ficoll-paque Substances 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 210000004408 hybridoma Anatomy 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 210000000265 leukocyte Anatomy 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 230000002503 metabolic effect Effects 0.000 description 3
- 230000003287 optical effect Effects 0.000 description 3
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 3
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 3
- 230000001681 protective effect Effects 0.000 description 3
- 102000005962 receptors Human genes 0.000 description 3
- 108020003175 receptors Proteins 0.000 description 3
- 206010039073 rheumatoid arthritis Diseases 0.000 description 3
- 102200051507 rs1555689937 Human genes 0.000 description 3
- 102220167669 rs199515173 Human genes 0.000 description 3
- 102200078304 rs71651682 Human genes 0.000 description 3
- 102200123491 rs72555390 Human genes 0.000 description 3
- 102220095096 rs876659080 Human genes 0.000 description 3
- 238000012216 screening Methods 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 238000010600 3H thymidine incorporation assay Methods 0.000 description 2
- LRFVTYWOQMYALW-UHFFFAOYSA-N 9H-xanthine Chemical compound O=C1NC(=O)NC2=C1NC=N2 LRFVTYWOQMYALW-UHFFFAOYSA-N 0.000 description 2
- HJCMDXDYPOUFDY-WHFBIAKZSA-N Ala-Gln Chemical compound C[C@H](N)C(=O)N[C@H](C(O)=O)CCC(N)=O HJCMDXDYPOUFDY-WHFBIAKZSA-N 0.000 description 2
- 108700028369 Alleles Proteins 0.000 description 2
- KXDAEFPNCMNJSK-UHFFFAOYSA-N Benzamide Chemical compound NC(=O)C1=CC=CC=C1 KXDAEFPNCMNJSK-UHFFFAOYSA-N 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 2
- 102220509727 Killer cell lectin-like receptor subfamily B member 1_T115L_mutation Human genes 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 206010028980 Neoplasm Diseases 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 241001494479 Pecora Species 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 2
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 2
- 206010003246 arthritis Diseases 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 238000004364 calculation method Methods 0.000 description 2
- 201000011510 cancer Diseases 0.000 description 2
- 229910052799 carbon Inorganic materials 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 231100000135 cytotoxicity Toxicity 0.000 description 2
- 210000004443 dendritic cell Anatomy 0.000 description 2
- 239000003814 drug Substances 0.000 description 2
- 210000003743 erythrocyte Anatomy 0.000 description 2
- 210000003953 foreskin Anatomy 0.000 description 2
- 230000005714 functional activity Effects 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 101150106093 gpt gene Proteins 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 231100000636 lethal dose Toxicity 0.000 description 2
- 230000001665 lethal effect Effects 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 238000013507 mapping Methods 0.000 description 2
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 102000035118 modified proteins Human genes 0.000 description 2
- 108091005573 modified proteins Proteins 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 102000013415 peroxidase activity proteins Human genes 0.000 description 2
- 108040007629 peroxidase activity proteins Proteins 0.000 description 2
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 238000013102 re-test Methods 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 102200128674 rs1059047 Human genes 0.000 description 2
- 102200042162 rs145415848 Human genes 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 239000011550 stock solution Substances 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 235000011149 sulphuric acid Nutrition 0.000 description 2
- 239000001117 sulphuric acid Substances 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 238000003211 trypan blue cell staining Methods 0.000 description 2
- 210000003606 umbilical vein Anatomy 0.000 description 2
- 230000003827 upregulation Effects 0.000 description 2
- 230000035899 viability Effects 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 101100325793 Arabidopsis thaliana BCA2 gene Proteins 0.000 description 1
- 108010077805 Bacterial Proteins Proteins 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-M Bicarbonate Chemical compound OC([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-M 0.000 description 1
- 108010041397 CD4 Antigens Proteins 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 102100033040 Carbonic anhydrase 12 Human genes 0.000 description 1
- 102100033041 Carbonic anhydrase 13 Human genes 0.000 description 1
- 102100033007 Carbonic anhydrase 14 Human genes 0.000 description 1
- 102100032566 Carbonic anhydrase-related protein 10 Human genes 0.000 description 1
- 102100033029 Carbonic anhydrase-related protein 11 Human genes 0.000 description 1
- 102100033779 Collagen alpha-4(IV) chain Human genes 0.000 description 1
- 150000008574 D-amino acids Chemical class 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 238000007400 DNA extraction Methods 0.000 description 1
- 108010092160 Dactinomycin Proteins 0.000 description 1
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 1
- 201000008808 Fibrosarcoma Diseases 0.000 description 1
- 102000004457 Granulocyte-Macrophage Colony-Stimulating Factor Human genes 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102000015789 HLA-DP Antigens Human genes 0.000 description 1
- 108010010378 HLA-DP Antigens Proteins 0.000 description 1
- 108010062347 HLA-DQ Antigens Proteins 0.000 description 1
- 101000867855 Homo sapiens Carbonic anhydrase 12 Proteins 0.000 description 1
- 101000867860 Homo sapiens Carbonic anhydrase 13 Proteins 0.000 description 1
- 101000867862 Homo sapiens Carbonic anhydrase 14 Proteins 0.000 description 1
- 101000867836 Homo sapiens Carbonic anhydrase-related protein 10 Proteins 0.000 description 1
- 101000867841 Homo sapiens Carbonic anhydrase-related protein 11 Proteins 0.000 description 1
- 101000710870 Homo sapiens Collagen alpha-4(IV) chain Proteins 0.000 description 1
- 101001075218 Homo sapiens Gastrokine-1 Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 1
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 108010078049 Interferon alpha-2 Proteins 0.000 description 1
- 102100039350 Interferon alpha-7 Human genes 0.000 description 1
- 150000008575 L-amino acids Chemical class 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- 229930182816 L-glutamine Natural products 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- GDBQQVLCIARPGH-UHFFFAOYSA-N Leupeptin Natural products CC(C)CC(NC(C)=O)C(=O)NC(CC(C)C)C(=O)NC(C=O)CCCN=C(N)N GDBQQVLCIARPGH-UHFFFAOYSA-N 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 108010021757 Polynucleotide 5'-Hydroxyl-Kinase Proteins 0.000 description 1
- 102000008422 Polynucleotide 5'-hydroxyl-kinase Human genes 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 241000219061 Rheum Species 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 206010040070 Septic Shock Diseases 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- 101710145796 Staphylokinase Proteins 0.000 description 1
- 108090000787 Subtilisin Proteins 0.000 description 1
- 230000006044 T cell activation Effects 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 230000005867 T cell response Effects 0.000 description 1
- 108010006785 Taq Polymerase Proteins 0.000 description 1
- 108010055044 Tetanus Toxin Proteins 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 229930183665 actinomycin Natural products 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 238000011095 buffer preparation Methods 0.000 description 1
- 102220408415 c.36C>A Human genes 0.000 description 1
- 238000004422 calculation algorithm Methods 0.000 description 1
- 150000001721 carbon Chemical group 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 230000002526 effect on cardiovascular system Effects 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 230000003511 endothelial effect Effects 0.000 description 1
- 231100000284 endotoxic Toxicity 0.000 description 1
- 230000002346 endotoxic effect Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000008105 immune reaction Effects 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- PGLTVOMIXTUURA-UHFFFAOYSA-N iodoacetamide Chemical compound NC(=O)CI PGLTVOMIXTUURA-UHFFFAOYSA-N 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- GDBQQVLCIARPGH-ULQDDVLXSA-N leupeptin Chemical compound CC(C)C[C@H](NC(C)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C=O)CCCN=C(N)N GDBQQVLCIARPGH-ULQDDVLXSA-N 0.000 description 1
- 108010052968 leupeptin Proteins 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- HPNSFSBZBAHARI-UHFFFAOYSA-N micophenolic acid Natural products OC1=C(CC=C(C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-UHFFFAOYSA-N 0.000 description 1
- 108091005601 modified peptides Proteins 0.000 description 1
- 238000003032 molecular docking Methods 0.000 description 1
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 1
- 229960000951 mycophenolic acid Drugs 0.000 description 1
- HPNSFSBZBAHARI-RUDMXATFSA-N mycophenolic acid Chemical compound OC1=C(C\C=C(/C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-RUDMXATFSA-N 0.000 description 1
- 239000000537 myeloablative agonist Substances 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 238000010899 nucleation Methods 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000007310 pathophysiology Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 102000014187 peptide receptors Human genes 0.000 description 1
- 108010011903 peptide receptors Proteins 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 239000011535 reaction buffer Substances 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 229940116176 remicade Drugs 0.000 description 1
- 102220065988 rs139034501 Human genes 0.000 description 1
- 102220031198 rs187960531 Human genes 0.000 description 1
- 102220103670 rs3218768 Human genes 0.000 description 1
- 102220100995 rs577332041 Human genes 0.000 description 1
- 102220190862 rs771984795 Human genes 0.000 description 1
- 238000003345 scintillation counting Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 230000036303 septic shock Effects 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 229940075420 xanthine Drugs 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/241—Tumor Necrosis Factors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
Definitions
- the present invention relates to polypeptides to be administered especially to humans and in particular for therapeutic use.
- the polypeptides are modified polypeptides whereby the modification results in a reduced propensity for the polypeptide to elicit an immune response upon administration to the human subject.
- the invention in particular relates to the modification of antibodies reactive to human tumor necrosis factor alpha (TNF alpha) to result in anti-TNF alpha antibodies that are substantially non-immunogenic or less immunogenic than any non-modified counterpart when used in vivo.
- Antibodies are not the only class of polypeptide molecule administered as a therapeutic agent against which an immune response may be mounted. Even proteins of human origin and with the same amino acid sequences as occur within humans can still induce an immune response in humans. Notable examples include therapeutic use of granulocyte-macrophage colony stimulating factor [Wadhwa, M. et al (1999) Clin. Cancer Res. 5: 1353-1361] and interferon alpha 2 [Russo, D. et al (1996) Bri. J. Haem. 94: 300-305; Stein, R. et al (1988) New Engl. J. Med. 318: 1409-1413] amongst others.
- T-cell epitopes Key to the induction of an immune response is the presence within the protein of peptides that can stimulate the activity of T-cells via presentation on MHC class II molecules, so-called “T-cell epitopes”. Such T-cell epitopes are commonly defined as any amino acid residue sequence with the ability to bind to MHC Class II molecules. Implicitly, a “T-cell epitope” means an epitope which when bound to MHC molecules can be recognized by a T-cell receptor (TCR), and which can, at least in principle, cause the activation of these T-cells by engaging a TCR to promote a T-cell response.
- TCR T-cell receptor
- MHC Class II molecules are a group of highly polymorphic proteins which play a central role in helper T-cell selection and activation.
- the human leukocyte antigen group DR (HLA-DR) are the predominant isotype of this group of proteins however, isotypes HLA-DQ and HLA-DP perform similar functions.
- the present invention is applicable to the detection of T-cell epitopes presented within the context of DR, DP or DQ MHC Class II. In the human population, individuals bear two to four DR alleles, two DQ and two DP alleles.
- MHC Class II molecules are expressed by professional antigen presenting cells (APCs), such as macrophages and dendritic cells amongst others. Engagement of a MHC class II peptide complex by a cognate T-cell receptor on the surface of the T-cell, together with the cross-binding of certain other co-receptors such as the CD4 molecule, can induce an activated state within the T-cell. Activation leads to the release of cytokines further activating other lymphocytes such as B cells to produce antibodies or activating T killer cells as a full cellular immune response.
- APCs professional antigen presenting cells
- T-cell epitope identification is the first step to epitope elimination, however there are few clear cases in the art where epitope identification and epitope removal are integrated into a single scheme.
- WO98/52976 and WO00/34317 teach computational threading approaches to identifying polypeptide sequences with the potential to bind a sub-set of human MHC class II DR allotypes.
- predicted T-cell epitopes are removed by the use of judicious amino acid substitution within the protein of interest.
- this scheme and other computationally based procedures for epitope identification [Godkin, A. J. et al (1998) J. Immunol. 161: 850-858; Sturniolo, T. et al (1999) Nat.
- peptides predicted to be able to bind MHC class II molecules may not function as T-cell epitopes in all situations, particularly, in vivo due to the processing pathways or other phenomena.
- the computational approaches to T-cell epitope prediction have in general not been capable of predicting epitopes with DP or DQ restriction.
- An exemplary method uses B-cell lines of defined MHC allotype as a source of MHC class II binding surface and may be applied to MHC class II ligand identification [Marshall K. W. et al. (1994) J. Immunol. 152:4946-4956; O'Sullivan et al (1990) J. Immunol. 145: 1799-1808; Robadey C. et al (1997) J. Immunol 159: 3238-3246].
- such techniques are not adapted for the screening multiple potential epitopes to a wide diversity of MHC allotypes, nor can they confirm the ability of a binding peptide to function as a T-cell epitope.
- Biological assays of T-cell activation can provide a practical option to providing a reading of the ability of a test peptide/protein sequence to evoke an immune response.
- Examples of this kind of approach include the work of Petra et al using T-cell proliferation assays to the bacterial protein staphylokinase, followed by epitope mapping using synthetic peptides to stimulate T-cell lines [Petra, A. M. et al (2002) J. Immunol. 168: 155-161].
- T-cell proliferation assays using synthetic peptides of the tetanus toxin protein have resulted in definition of immunodominant epitope regions of the toxin [Reece J. C. et al (1993) J.
- WO99/53038 discloses an approach whereby T-cell epitopes in a test protein may be determined using isolated sub-sets of human immune cells, promoting their differentiation in vitro and culture of the cells in the presence of synthetic peptides of interest and measurement of any induced proliferation in the cultured T-cells.
- the same technique is also described by Stickler et al [Stickler, M. M. et al (2000) J. Immunotherapy 23:654-660], where in both instances the method is applied to the detection of T-cell epitopes within bacterial subtilisin.
- Such a technique requires careful application of cell isolation techniques and cell culture with multiple cytokine supplements to obtain the desired immune cell sub-sets (dendritic cells, CD4+ and or CD8+T-cells) and is not conducive to rapid through-put screening using multiple donor samples.
- T-cell epitopes from a given in principal therapeutically valuable but originally immunogenic peptide, polypeptide or protein.
- One of these therapeutically valuable molecules is a monoclonal antibody with binding specificity for tumor necrosis factor alpha (TNF alpha).
- the preferred monoclonal antibody of the present invention is a modified form of the antibody cA2 described in U.S. Pat. No. 6,284,471.
- the antibody cA2 is herein referred to as the “parental” antibody of the invention.
- TNF alpha is involved in the mediation of a number of pathological conditions including Crohn's disease, rheumatoid arthritis and endotoxic or cardiovascular shock.
- the modified antibody of the invention can be expected to have therapeutic utility in these conditions and other diseases in which TNF alpha is a significant component of the pathophysiology.
- the cA2 antibody is not the only antibody with binding specificity for TNF alpha.
- a variety of polyclonal and monoclonal preparations with similar specificity are known in the art. Examples include the anti-TNF alpha preparations disclosed in EP0212489, EP0218868, EP0288088 and WO91/02078.
- Further examples of rodent or murine monoclonal antibodies specific for recombinant human TNF alpha have been described in the literature [see for example; Liang, et al (1986) Biochem. Biophys. Res. Comm. 137: 847-854; Meager, et al. (1987), Hybridoma 6: 305-311; Fendly et al.
- Adair et al [EP0927758] describe recombinant antibody molecules including antibodies with human constant region sequences and versions in which the complementarity determining regions (CDRs) have been engrafted onto modified human antibody framework sequences.
- CDRs complementarity determining regions
- Such antibodies and humanized antibodies are claimed to retain specificity to human TNF alpha ⁇ and may be used in diagnosis and therapy.
- This antibody has demonstrated a degree of therapeutic efficacy in the treatment of rheumatoid arthritis and Crohn's disease has received regulatory approval for its use as in Crohn's disease in the USA and in Europe.
- the antibody is produced by recombinant techniques and as noted above, the antibody is “chimeric” meaning that the constant region of the antibody is comprised of sequence derived from human constant region genes and the contribution of mouse derived protein sequence is therefore reduced. Despite this up to 13% of patients treated for Crohn's disease showed an immune response to the therapeutic antibody [Mani R. N. et al. (1998) Arthritis Rheum.
- anti-TNF alpha antibody analogues with enhanced properties and especially improvements in the biological properties of the protein.
- Such proteins would expect to display an increased circulation time within the human subject and would be of particular benefit in chronic or recurring disease settings such as is the case for a number of indications for anti-TNF alpha antibodies.
- the present invention provides for modified forms of an anti-TNF alpha antibody that are expected to display enhanced properties in vivo.
- the invention discloses sequences identified within the variable region sequences of the heavy and light chains of an anti-TNF alpha antibody that are potential T cell epitopes by virtue of MHC class II binding potential.
- the invention further discloses sequences identified within the variable region sequences of the heavy and light chains of an anti-TNF alpha antibody that are potential T cell epitopes by virtue of their ability when presented as synthetic peptides to a population of human peripheral blood mononuclear cells (PBMC) cultured in vitro to induce a proliferative response in said PBMC cells.
- PBMC peripheral blood mononuclear cells
- anti-TNF alpha antibody molecules including chimeric [U.S. Pat. No. 5,919,425] and humanized [EP0927758] forms
- none of these teachings recognize the importance of T cell epitopes to the immunogenic properties of the protein nor have been conceived to directly influence said properties in a specific and controlled way according to the scheme of the present invention.
- the present invention provides for a modified antibody in which the immune characteristic is modified by means of reduced or removed numbers of potential T-cell epitopes.
- antibody cA2 The preferred murine derived non-modified “parental” monoclonal antibody of the present invention is herein referred to as antibody cA2 is described in U.S. Pat. No. 6,284,471.
- the present invention discloses sequences identified within the cA2 variable region sequences of both the heavy chain and light chain that are potential T-cell epitopes by virtue of MHC class II binding potential.
- the invention further discloses the major regions of the antibody V-region sequence that are immunogenic in man and thereby provides the critical information required to conduct modification to the sequences to eliminate or reduce the immunogenic effectiveness of these sites.
- the invention provides a modified antibody molecule having specificity for an antigen recognized by monoclonal antibody cA2 wherein one or more amino acids in the variable region of the said cA2 antibody is substituted to reduce MHC class II recognition of peptides derived from this region.
- the invention provides a variant monoclonal antibody with reduced immunogenic potential in humans, said variant comprising one or more amino acid substitutions in the V-region of the cA2 antibody to eliminate or reduce peptide fragments of the said V-region from acting as MHC class II ligands or being able to stimulate T-cells.
- a variant monoclonal antibody with reduced immunogenic potential in humans comprising a combination of heavy and light chain V-regions comprising the amino acid sequences selected from Vh1/Vk1, Vh1/Vk5, Vh1/Vk8, Vh5/Vk12, Vh8/Vk5.
- the present invention provides modified anti-TNF alpha antibodies with reduced immunogenicity in man where the modified antibodies comprise heavy and light chain variable region amino acid sequences selected from SEQ ID No:1/SEQ ID No:5, SEQ ID No:1/SEQ ID No:7, SEQ ID No: 1/SEQ ID No:8, SEQ ID No:3/SEQ ID No:6 and SEQ ID No:4/SEQ ID No:7 or combinations of amino acids having at least 70% similarity to one or both amino acid sequences in each of the above listed pairs.
- sequences according to this invention designated as SEQ ID 1-8 are:
- references to “substantially non-immunogenic” or “reduced immunogenic potential” includes reduced immunogenicity compared to a parent antibody, i.e. a non-modified murine or chimeric monoclonal antibody.
- immunogenicity includes an ability to provoke, induce or otherwise facilitate a humoral and or T-cell mediated response in a host animal and in particular where the “host animal” is a human.
- modified antibodies of the present retain the functional activities of the non-modified or “parental” antibody. It is therefore particularly desired to produce modified antibodies in which all of the beneficial technical features associated with the therapeutic efficacy of the parental non-modified antibody are exhibited.
- This is pertinent to the contemplated utility of the invention, namely to provide a composition with therapeutic efficacy in a number of important diseases in man including especially rheumatoid arthritis and Crohn's disease and a number of other clinical indications mediated by TNF alpha.
- Such a therapeutic is a preferred embodiment of the present invention.
- the modified antibody of the present exhibits an affinity for its target antigen that is similar to the affinity exhibited by monoclonal antibody cA2.
- the antibody recognizes TNF alpha but not TNF alpha and is capable of neutralizing TNF alpha activity in a range of in vitro assays. Such assays include cell cytotoxicity, mitogenesis, cytokine induction and induction of adhesion molecules.
- the therapeutic efficacy of the parental molecule is believed also to be mediated by the ability of the antibody to induce antibody-dependent cell mediated cytoxicity (ADCC) and is effective at killing cells expressing cell surface bound forms of TNF alpha.
- ADCC antibody-dependent cell mediated cytoxicity
- the phenomenon of ADCC is mediated by the constant region domain of whole antibody molecules, and the present invention contemplates production of a whole antibody molecules comprising a constant region domain compatible with ADCC induction.
- antibody is meant a protein of the immunoglobulin family that is capable of combining, interacting or otherwise associating with an antigen.
- antigen is used herein to refer to a substance that is capable of interacting with the antibody and in the context of the present invention is meant to be TNF alpha.
- the TNF alpha of the present invention is tumor necrosis factor alpha (TNF alpha) and is most preferably human TNF alpha or any TNF alpha representing an antigen for antibody cA2.
- TNF alpha may be soluble TNF alpha or membrane associated TNF alpha.
- immunoglobulin is used herein to refer to a protein consisting of one or more polypeptides substantially encoded by immunoglobulin genes.
- the recognized immunoglobulin genes include the ⁇ , ⁇ , ⁇ , ⁇ (IgG1, IgG2, IgG3, IgG4), ⁇ , ⁇ and ⁇ constant region genes and in nature multiple immunoglobulin variable region genes.
- One natural form of immunoglobulin is a tetramer comprising two identical pairs in which each pair has one light chain and one heavy chain. In each pair the heavy and light chain variable regions together provide the binding surface capable of interacting with the antigen.
- Vh is used herein to refer to the heavy chain variable region
- Vk is used herein to refer to the light chain variable region and in this instance in common with numerous monoclonal antibodies the light chain is a “kappa” ( ⁇ ) type chain.
- Vh means a polypeptide that is about 110 to 125 amino acid residues in length, the sequence of which corresponds to any of the specified Vh chains herein which in combination with a Vk are capable of binding human TNF alpha.
- Vk means a polypeptide that is about 95-130 amino acid residues in length the sequence of which corresponds to any of the specified Vk chains herein which in combination with a Vh are capable of binding human TNF alpha.
- Full-length immunoglobulin heavy chains are about 50 kDa molecular weight and are encoded by a Vh gene at the N-terminus and one of the constant region genes (e.g. ⁇ ) at the C-terminus.
- full-length light chains are about 25 kDa molecular weight and are encoded by a V-region gene at the N-terminus and a ⁇ or ⁇ constant region gene at the C-terminus.
- immunoglobulins may exist in a number of other forms derived by application of recombinant DNA techniques or protein biochemistry. These forms include for example Fv, Fab, Fab′ and (Fab)2 molecules and could all contain any of the Vh or Vk sequences of the present invention.
- a further example may include a “bi-specific” antibody, that is comprising a Vh/Vk combination of the present invention in combination with a second Vh/Vk combination with a different antigen specificity.
- T-cell epitope means according to the understanding of this invention an amino acid sequence which is able to bind MIC class II, able to stimulate T-cells and/or also to bind (without necessarily measurably activating) T-cells in complex with MHC class II.
- peptide as used herein and in the appended claims, is a compound that includes two or more amino acids.
- the amino acids are linked together by a peptide bond (defined herein below).
- There are 20 different naturally occurring amino acids involved in the biological production of peptides and any number of them may be linked in any order to form a peptide chain or ring.
- the naturally occurring amino acids employed in the biological production of peptides all have the L-configuration.
- Synthetic peptides can be prepared employing conventional synthetic methods, utilizing L-amino acids, D-amino acids, or various combinations of amino acids of the two different configurations. Some peptides contain only a few amino acid units.
- Short peptides e.g., having less than ten amino acid units, are sometimes referred to as “oligopeptides”.
- Other peptides contain a large number of amino acid residues, e.g. up to 100 or more, and are referred to as “polypeptides”.
- a “polypeptide” may be considered as any peptide chain containing three or more amino acids, whereas a “oligopeptide” is usually considered as a particular type of “short” polypeptide.
- any reference to a “polypeptide” also includes an oligopeptide.
- any reference to a “peptide” includes polypeptides, oligopeptides, and proteins.
- Alpha carbon (C ⁇ ) is the carbon atom of the carbon-hydrogen (CH) component that is in the peptide chain.
- a “side chain” is a pendant group to C ⁇ that can comprise a simple or complex group or moiety, having physical dimensions that can vary significantly compared to the dimensions of the peptide.
- the general method of the present invention leading to the modified anti-TNF alpha antibody comprises the following steps:
- step (b) The identification of potential T-cell epitopes according to step (b) can be carried out according to methods described previously in the art. Suitable methods are disclosed in WO 98/59244; WO 98/52976; WO 00/34317.
- Example 1 Another very efficacious method for identifying T-cell epitopes by calculation is described in the Example 1, which is a preferred embodiment according to this invention.
- the analysis has been conducted on both the heavy chain and light chain variable region sequences of the anti-TNF alpha antibody.
- a further technical approach suitable to the detection of T-cell epitopes is via biological T-cell assay.
- biological T-cell assay Such an analysis is described in the Example 2 and is similarly a preferred embodiment according to this invention.
- the preferred method of biological assay embodied herein comprises the testing of overlapping peptides derived from the heavy chain and light chain variable region sequences of the anti-TNF alpha antibody or alternatively a sub-set of V-region derived peptides such as all or some of those derived by calculation according to the method embodied by Example 1.
- the synthetic peptides are tested for their ability to evoke a proliferative response in human T-cells cultured in vitro.
- the proliferative response can be measured by any convenient means but a widely known method as exploited in the present embodiment uses 3 H-thymidine incorporation.
- This approach can be conducted using na ⁇ ve human T-cells taken from healthy donors, and may also be used to test the immunogenicity in vitro of whole protein molecules as well as synthetic peptides. Such a scheme has also been used in the present study (Example 11) to demonstrate to reduced immunogenic potential of a preferred molecule of the invention.
- the inventors have established that in the operation of a na ⁇ ve T-cell assay, a stimulation index equal to or greater than 2.0 is a useful measure of induced proliferation.
- the stimulation index is conventionally derived by division of the proliferation score measured (e.g. counts per minute if using 3 H-thymidine incorporation) to the test peptide, by the proliferation score measured in cells not contacted with a test (poly)peptide.
- variant anti-TNF alpha antibodies may be produced and tested for the desired immune and functional characteristic. It is particularly important when conducting alterations to the protein sequence that the contemplated changes do not introduce new immunogenic epitopes. This event is avoided in practice by re-testing the contemplated sequence for the presence of epitopes and or of MHC class II ligands by any suitable means.
- One particular means which is a further embodiment of the invention, is use of an in vitro immunological recall assay involving PBMC preparations cultured in the presence of a priming quantity of test protein (antibody) and re-challenge with either the same test protein or in parallel a modified version of the protein. Such a scheme provides a convenient practical demonstration of a reduced immunogenic potential in a modified protein in the absence of full-scale clinical trials.
- the variant proteins will be produced by recombinant DNA techniques although other procedures including chemical synthesis may be contemplated.
- the modified antibodies of the present invention are generated by expression of different combinations of the Vh and Vk genes specified herein.
- the most preferred combination according to the invention comprises the combination Vh5/Vk12.
- Other combinations have been produced and tested for functional activity in binding TNF alpha and these combinations comprise Vh1/Vk1, Vh1/Vk5, Vh1/Vk8 and Vh8/Vk5. All such combinations of heavy and light chain are encompassed by the present invention.
- the present invention provides modified anti-TNF alpha antibodies with reduced immunogenicity in man where the modified antibodies comprise heavy and light chain variable region amino acid sequences selected from SEQ ID No:1/SEQ ID No:5, SEQ ID No:1/SEQ ID No:7, SEQ ID No:1/SEQ ID No:8, SEQ ID No:3/SEQ ID No:6 and SEQ ID No:4/SEQ ID No:7 or combinations of amino acids having at least 70% similarity to one or both amino acid sequences in each of the above listed pairs.
- the invention relates to an anti-TNF alpha monoclonal antibody in which substitutions of at least one amino acid residue have been made at positions within the V-regions of the molecule to result in a substantial reduction in activity of or elimination of one or more potential T-cell epitopes from the protein. It is most preferred to provide modified antibody molecules in which amino acid modification (e.g. a substitution) is conducted within the most immunogenic regions of the parent molecule.
- modified antibody molecules in which amino acid modification (e.g. a substitution) is conducted within the most immunogenic regions of the parent molecule.
- the major preferred embodiments of the present invention comprise modified antibody molecules for which any of the MHC class II ligands are altered such as to eliminate binding or otherwise reduce the numbers of MHC allotypes to which the peptide can bind.
- the inventors have discovered and herein disclose, the immunogenic regions of the antibody cA2 molecule in man.
- amino acid substitutions are made at appropriate points within the peptide sequence predicted to achieve substantial reduction or elimination of the activity of the T-cell epitope.
- an appropriate point will preferably equate to an amino acid residue binding within one of the pockets provided within the MHC class II binding groove.
- single amino acid substitutions within a given potential T cell epitope are the most preferred route by which the epitope may be eliminated. Combinations of substitution within a single epitope may be contemplated and for example can be particularly appropriate where individually defined epitopes are in overlap with each other. Moreover, amino acid substitutions either singly within a given epitope or in combination within a single epitope may be made at positions not equating to the “pocket residues” with respect to the MHC class II binding groove, but at any point within the peptide sequence. All such substitutions fall within the scope of the present.
- compositions containing such modified antibodies or fragments of modified antibodies and related compositions should be considered within the scope of the invention.
- the invention therefore contemplates the use and generation of antibody fragments including for example Fv, Fab, Fab′ and F(ab′)2 fragments.
- Such fragments may be prepared by standard methods [for example; Coligan et al ( Current Protocols in Immunology , John Wiley & Sons 1991-1997].
- the present invention also contemplates the various recombinant forms of antibody derived molecular species well known in the art. Such species include stabilised Fv fragments including single chain Fv forms (e.g.
- scFv comprising a peptide linker joining the Vh and V1 domains, or an Fv stabilised by interchain di-sulphide linkage (dsFv) and which contain additional cysteine residues engineered to facilitate the conjoining of the Vh and V1 domains.
- minibodies species referred to as “minibodies”; and single variable domain “dAbs”.
- Other species still may incorporate means for increasing the valency of the modified antibody V-region domain, i.e. species having multiple antigen binding sites for example by the engineering of dimerisation domains (e.g. “leucine zippers”) or also chemical modification strategies.
- the present invention relates to nucleic acids encoding modified anti-TNF alpha antibody entities.
- the present invention relates to methods for therapeutic treatment of humans using the modified anti-TNF alpha antibody.
- FIG. 1 provides tables of peptide sequences derived from the V-region domain of anti-TNF alpha antibody cA2 with potential human MHC class II binding activity.
- FIG. 1A relates to heavy-chain derived sequences.
- FIG. 1B relates to light-chain derived sequences.
- FIG. 2 provides a graph demonstrating the neutralization of TNF alpha induced killing of WEHI cells in vitro using an anti-TNF alpha antibody (Vh5/Vk12) of the invention.
- FIG. 3 provides a graph demonstrating the neutralization of TNF alpha stimulated production of ICAM-1 expression in human umbilical vein endothelial cells in vitro using an anti-TNF alpha antibody (Vh5/Vk12) of the invention.
- FIG. 4 provides a graph demonstrating the ability of an anti-TNF alpha antibody of the invention (Vh5/Vk12) to compete for binding to TNF alpha with a positive control antibody (infliximab) in an in vitro assay.
- FIG. 5 provides a panel of histrograms representing the proliferation response to synthetic peptides in an in vitro na ⁇ ve T-cell proliferation assay.
- the data relate to the responses recorded by PBMC from individual donor # 4 and are presented for each of peptides CA1-CA75 at both 1 ⁇ M and 5 ⁇ M concentration.
- the graphs each plot the Stimulation Index (SI) versus the peptide identification number.
- SI CPM Test Peptide/CPM untreated control. Peptide sequences and methods are detailed in Example 2.
- FIG. 6 provides proliferative response recorded to each of the 13-mer peptides P1-P15 in an in vitro na ⁇ ve T-cell proliferation assay.
- Panel A depicts responses in PBMC from donor # 2 ;
- panel B depicts responses in PBMC from donor # 4 .
- the results are shown for the peptides given at both 1 ⁇ M and 5 ⁇ M concentration.
- responses with an SI>2.0 are indicated as positive (+) and results with an SI ⁇ 2.0 are indicated as negative ( ⁇ ).
- FIG. 7 shows results of a plate ELISA in which TNF alpha is detected by the modified antibody of the invention (Vh5/Vk12).
- the binding curve is a plot of the antibody concentration versus optical density at 492 nm (OD492).
- FIG. 8 provides amino acid sequences of the modified variable region domains of the anti-TNF alpha antibodies of the invention. Sequences are depicted using single letter code.
- FIG. 9 provides a graph demonstrating the neutralization of TNF alpha stimulated production of IL-6 expression in human HS27 fibroblast cells in vitro using an anti-TNF alpha antibody (Vh5/Vk12) of the invention.
- the negative control (210G12) is a non-TNF alpha binding antibody and the positive control (infliximab) is TNF alpha neutralizing.
- FIG. 10 provide a plots depicting the results of an immunogenicity assay using na ⁇ ve human PBMC cultured in the presence of differing concentrations of modified antibody (Vh5/Vk12) or immunogenic parental antibody (infliximab).
- the graphs show the results from a responsive donor PBMC (panel A) and non-responsive donor PBMC (panel B).
- SI stimulation index
- the data set encompasses also the best side-chain conformation for all possible amino acids at the given position.
- the interatomic distances between the peptide side-chains (in the optimum conformation) and the MHC protein are stored in this dataset.
- a test peptide from the protein of interest is analysed by adding its sequence of side-chains to all backbones and then retrieving the data sets for the optimum side-chain conformations and thus calculating a “peptide score” for each backbone.
- the best score is selected for display and the process repeated for each of the available MHC model structures.
- the algorithm has been applied to the analysis of the V-region domains of the anti-TNF alpha antibody cA2.
- the analysis identifies multiple 13mer peptide sequences which are potential T-cell epitopes by their being predicted MHC class II ligands for one or more allotypes. These peptides are shown in FIG. 1A (heavy-chain derived peptides) and 1 B (light-chain derived peptides).
- T-cell proliferation assays test the binding of peptides to MHC and the recognition of MHC/peptide complexes by the TCR.
- T-cell proliferation assays of the present example involve the stimulation of peripheral blood mononuclear cells (PBMCs), containing antigen presenting cells (APCs) and T-cells. Stimulation is conducted in vitro using synthetic peptide antigens, and in some experiments whole protein antigen. Stimulated T-cell proliferation is measured using 3 H-thymidine ( 3 H-Thy) and the presence of incorporated 3 H-Thy assessed using scintillation counting of washed fixed cells.
- PBMCs peripheral blood mononuclear cells
- APCs antigen presenting cells
- Stimulation is conducted in vitro using synthetic peptide antigens, and in some experiments whole protein antigen.
- Stimulated T-cell proliferation is measured using 3 H-thymidine ( 3 H-Thy) and the presence of incorporated 3 H-Thy assessed using scin
- Buffy coats from human blood stored for less than 12 hours were obtained from the National Blood Service (Addenbrooks Hospital, Cambridge, UK). Ficoll-paque was obtained from Amersham Pharmacia Biotech (Amersham, UK). Serum free AIM V media for the culture of primary human lymphocytes and containing L-glutamine, 50 ⁇ g/ml streptomycin, 10 ⁇ g/ml gentomycin and 0.1% human serum albumin was from Gibco-BRL (Paisley, UK). Synthetic peptides were obtained from Eurosequence (Groningen, The Netherlands) and Babraham Technix (Cambridge, UK).
- Erythrocytes and leukocytes were separated from plasma and platelets by gentle centrifugation of buffy coats. The top phase (containing plasma and platelets) was removed and discarded. Erythrocytes and leukocytes were diluted 1:1 in phosphate buffered saline (PBS) before layering onto 15 ml ficoll-paque (Amersham Pharmacia, Amersham UK). Centrifugation was done according to the manufacturers recommended conditions and PBMCs were harvested from the serum+PBS/ficoll-paque interface. PBMCs were mixed with PBS (1:1) and collected by centrifugation. The supernatant was removed and discarded and the PBMC pellet resuspended in 50 ml PBS.
- PBS phosphate buffered saline
- Cells were again pelleted by centrifugation and the PBS supernatant discarded. Cells were resuspended using 50 ml AIM V media and at this point counted and viability assessed using trypan blue dye exclusion. Cells were again collected by centrifugation and the supernatant discarded. Cells were resuspended for cryogenic storage at a density of 3 ⁇ 10 7 per ml. The storage medium was 90%(v/v) heat inactivated AB human serum (Sigma, Poole, UK) and 10%(v/v) DMSO (Sigma, Poole, UK). Cells were transferred to a regulated freezing container (Sigma) and placed at ⁇ 70° C. overnight. When required for use, cells were thawed rapidly in a water bath at 37° C. before transferring to 10 ml pre-warmed AIM V medium.
- PBMC peripheral blood mononuclear cells
- Each peptide was screened individually against PBMC's isolated from 20 na ⁇ ve donors.
- Two control peptides C32 (PKYVKQNTLKLAT (SEQ ID NO: 178) and C49 (KVVDQIKKISKPVQH (SEQ ID NO: 179) that have previously been shown to be immunogenic and a potent non-recall antigen KLH were used in each donor assay.
- Peptides were dissolved in DMSO to a final concentration of 10mM, these stock solutions were then diluted 1/500 in AIM V media (final concentration 20 ⁇ M). Peptides were added to a flat bottom 96 well plate to give a final concentration of 2 and 10 ⁇ M in a 100 ⁇ l.
- SI stimulation indices
- T cell epitopes in the cA2 V-region sequences using the na ⁇ ve T cell proliferation assay resulted in the identification of several immunogenic regions.
- the map was refined in sequence regions surrounding the complementarily determining regions (CDRs) for the Vh and the Vk sequences using a further sub-set of 15 different 13-mer peptides (P1-P15) with sequences as below:
- Peptides P1-P7 derive from the Vh chain sequence and peptides P8-P15 derive from the Vk chain sequence.
- Peptides P1-P15 were screened for their ability to evoke an in vitro proliferative response in a further panel of 10 na ⁇ ve PBMC preparations encompassing multiple different MHC allotypes as previously.
- the results of the na ⁇ ve T-cell proliferation assay from both sets of synthetic peptides and donor panels can be taken together to produce an epitope map of the Vh and Vk chains of the antibody. In general, in compilation of such a map, an SI>1.95 is taken as a positive response. Representative histograms showing the SI to all 15-mer peptides for one responsive donor is given in the accompanying FIG. 5 . Exemplary results to the 13-mer peptides P1-P15 are given as FIG. 6 .
- the sequence of the antibody was derived from U.S. Pat. No. 5,656,272.
- the Variable domain heavy chain (Vh) and the variable domain light chain (Vk) genes were made by gene synthesis. Briefly, a panel of synthetic oligonucleotides were designed and synthesised. The genes were assembled using a ligase chain reaction (LCR) wherein the oligonucleotides featuring complementary ends were allowed to anneal followed by amplification and fill-in using a polymerase chain reaction (PCR). The PCR was driven by addition of an increased concentration of the flanking oligonuclotides to act as primers.
- LCR ligase chain reaction
- PCR polymerase chain reaction
- the PCR products were assembled into full-length antibody genes by further PCR from vectors containing 5′ and 3′ immunoglobulin gene flanking regions and sub-cloning into expression vectors for expression of whole antibody.
- the assembled Vh and Vk genes served as templates for mutagenesis and construction of multiple variant antibody sequences in which T-cell epitopes had been removed.
- oligonucleotides OL373-OL391 For assembly of the Vh gene oligonucleotides OL373-OL391 detailed in Table 2 were used.
- Vk gene oligonucleotides OL392-OL410 detailed in Table 3 were used.
- the LCR was conducted by mixing 20 ⁇ l of phosphorylated oligonucleotides with 1 ⁇ l Pfu DNA ligase (Stratagene, Amsterdam, NL), 10 ⁇ l 10 ⁇ reaction buffer (supplied with enzyme) and 69 ⁇ l water. The reaction mix was placed in a thermal cycler for incubation at 95° C. for 2 minutes followed by 25 cycles of 95° C. for 30 seconds followed by gradual cooling to 60° then incubation at 60° C.
- Oligonucleotides OL373 and OL382 were used to drive the Vh reaction, with oligocucleotides OL392 and OL401 used to drive the Vk reaction.
- PCR was conducted in a total volume of 50 ⁇ l for 15 cycles using Taq DNA polymerase (Roche, Lewes, UK). The reaction was run on a 1% agarose gel and the desired band removed and purified using a Qiagen (Crawley, UK) DNA extraction kit. Products were direct cloned into the pGemT-easy vector (Promega, Southampton, UK) for sequence analysis. Several clones were sequenced until correct clones were obtained.
- the primer pairs used in these “linking” reactions were oligonucleotides OL411/OL413 and OL414/OL415 for the Vh gene, whereas for the Vk gene, the oligonucleotides OL411/OL412 and OL411/OL401 were used.
- the heavy chain gene complete with 5′ and 3′ flanking sequences was cloned into the expression vector pSVgpt [Reichmann et al (1988) Nature, 332: 323] which includes the human IgG1 constant region domain [Takahashi et al (1982) Cell, 29: 671] and the gpt gene for selection in mammalian cells.
- the light chain gene complete with 5′ and 3′ flanking sequences was cloned into the expression vector pSVhyg [Reichmann et al ibid] in which the gpt gene is replaced by the gene for hygromycin resistance (hyg) and includes a human kappa constant region domain [Heiter et al (1980) Cell, 22: 197].
- the fully assembled Vh or Vk genes were sub-cloned as HindIII/BamHI fragments purified by gel electrophoresis and handled using well known procedures and reagent systems.
- Vk1 A modified Vk gene termed Vk1 containing the mutations L3Q, A9D, I10T, L11S, V13A, I58V, S74T, T77S, V78L, S80A, I83A, D85T and L104V was constructed by gene synthesis.
- Table 4 lists the oligonucleotides listed used in the assembly of Vk1. These oligonucleotides were used, together with OL393, OL394, OL395, OL400, OL401, OL403, OL405, OL407 and OL408 (see example 3 above) in a gene synthesis reaction as to previously.
- the gene was cloned into the pGEM-T easy vector (Promega) and several clones were sequenced until a correct clone was obtained. Assembly of the full-length immunoglobulin gene and sub-cloning to the expression vector was as per example 3 with the exception that oligonucleotides OL411 and OL469 were used in the linking reaction for the Vk gene.
- Vk gene Additional mutations were introduced in the Vk gene to make further variant Vk genes. These mutations comprised: V19A, Q38H, R39T, S100G, N103K, V106I.
- the mutagenesis was conducted by PCR using the oligonucleotides listed in table 5. OL768 and OL769, OL770 and OL771 were used in overlap PCR, in combination with OL411 and OL401 (see above). OL648 was used in a single PCR in combination with OL411. The PCR products were cloned into pGEM-T Easy (Promega) and a correct clone identified by sequencing.
- Variant Vh genes were also constructed from the wild-type sequence using mutagenesis. Variant Vh genes comprising the substitutions K3Q, E5V, M18L, K19R, V23A, I28T, I51T, I56T, E64D, S79N, A80S, V81L, T86N, D87S, R89K, G94A, T115L and L116V were constructed. These mutations were introduced using the oligonucleotides listed in table 6. Briefly, each set of oligonucleotides was used in overlap PCR, in combination with OL411 and OL415. The PCR products were cloned into pGEM-T Easy (Promega) and a correct clone identified by sequencing.
- Vh or Vk domains were sub-cloned into the expression vectors as HindIII BamHI fragments as previously and variant antibodies expressed according to the method detailed as example 5.
- the heavy and light chain expression vectors were co-transfected using electroporation into NS/0, a non-immunoglobulin producing mouse myeloma, obtained from the European Collection of Animal Cell Cultures (ECACC). Colonies expressing the gpt to gene were selected in Dulbecco's Modified Eagles Medium (DMEM) supplemented with 10% (v/v) foetal calf serum and antibiotics (all from Gibco, Paisley, UK) and with 0.8 ⁇ g/ml mycophenolic acid and 250 ⁇ g/ml xanthine (Sigma, Poole, UK).
- DMEM Dulbecco's Modified Eagles Medium
- DMEM Dulbecco's Modified Eagles Medium
- antibiotics all from Gibco, Paisley, UK
- 0.8 ⁇ g/ml mycophenolic acid and 250 ⁇ g/ml xanthine Sigma, Poole, UK.
- the concentration of the purified antibody was determined using an ELISA detecting the human kappa constant region of the antibodies of interest.
- a standard concentration curve was determined for a commercial preparation of the therapeutic antibody infliximab (Schering-Plough Ltd, UK) and the standard used to compute the concentration of the test to antibody preparation.
- the assay was conducted in 96-well plates and all determinations were conducted in duplicate.
- Doubling dilution series were also set out for the test antibody preparations.
- the plate was incubated at room temperature for 1 hour and the wells washed as previously. Bound antibody was detected using a peroxidase conjugated sheep ant-human IgG ⁇ chain specific reagent (The Binding Site, Birmingham, UK). This secondary antibody was diluted 1:1000 in PBST and 100 ⁇ l added to each well of the plate. The plate was incubated for a further 1 hour at room temperature and washed as previously. Detection was achieved using 100 ul per well “Sigmafast” peroxidase substrate (Sigma, Poole, UK) and the colour development stopped by addition of 40 ul per well 1M sulphuric acid. The optical density was read using a plate reader at 492 nm. A standard curve of antibody concentration versus A 492 was plotted for the control antibody and the concentration of the test antibody determined by comparison with the standard.
- the ability of anti-TNF alpha antibodies to neutralise the lethal effect of TNF alpha on a cell line grown in vitro was tested using the scheme provided by Galloway [Galloway et al. 1991 J. Immunol. Meth. 140:37-43].
- the assay uses the murine fibrosarcoma cell line WEHI164, a line which is very sensitive to the lethal effect of TNF alpha.
- WEHI164 were obtained from the European Collection of Animal Cell Cultures (ECACC #. 8702250) and grown in DMEM medium with Glutamax, (Gibco, Paisley, UK), 10% foetal calf serum (Perbio, Chester, UK) and containing antibiotic-mycotic (Gibco).
- ECACC #. 8702250 European Collection of Animal Cell Cultures
- TNF alpha (PeproTech EC Ltd, London, UK) at 50 ⁇ g/ml in medium containing 4 ⁇ g/ml of actinomycin was prepared and added to the treatment wells.
- the TNF alpha solution was mixed by gently tapping the plate and the plate incubated for at least two hours at room temperature before the prepared solutions were transferred to the assay plate containing the cells.
- the assay plate was prepared by seeding 2.5 ⁇ 10 4 cells in 50 ⁇ l per well and incubating for at least 1 hour at 37° C., 5% CO 2 . Following this, 50 ⁇ l of the TNF alpha/antibody mixture or control preparation was transferred from the plate used to dilute out the various treatments. The cell and treatment mixtures were mixed by gently tapping the plate and the plate incubated overnight at 37° C. in a humidified atmosphere containing 5% CO 2 . Next day, the metabolic activity of the cells in each well was assessed using a “CellTiter 96 Aqueous One Solution Cell Proliferation Assay” (Promega, Southampton, UK).
- the plates were incubated for a further 90 minutes and the absorbance of the solutions in each well was read using a plate reader at 492 nm.
- the absorbance figures are plotted versus antibody concentration.
- the positive control preparation was a sample of the therapeutic antibody infliximab (Schering-Plough Ltd, UK), which in this assay consistently demonstrates significant TNF alpha neutralisation at concentrations of less than 0.1 ⁇ g/ml.
- the modified antibody of the present invention consistently demonstrated a protective effect in this assay equivalent to the positive control preparation.
- FIG. 2 shows an example plot from this assay.
- HUVE human umbilical vein endothelial
- test plate For the assay, two parallel sets of 96 well plates are prepared. One set, termed the “assay plate”, is seeded with cells, the other, termed the “preparation plate”, is used to prepare the dilutions of TNF alpha and the test and control antibody solutions. The contents of the preparation plate are ultimately transferred to the assay plate. All assays are conducted in duplicate.
- HUVE cells (Cambrex Bio Science, Wokingham, UK) were seeded at a density of 5 ⁇ 10 4 cells per well in a volume of 50 ⁇ l. The cells were allowed to adhere to the plate by incubation at 37° C., 5% CO 2 for at least 2 hours.
- the preparation plate doubling dilution series of the test and positive control antibody were set out in duplicate across the plate.
- the starting concentration for the antibodies was 20 ⁇ g/ml in a final volume of 100 ⁇ l/well.
- the negative control received no antibody.
- a solution of 40 ng/ml TNF alpha (PeproTech EC Ltd, London, UK) in medium was prepared and 100 ⁇ l per well added to each of the treatment wells on the preparation plate.
- the plate was mixed by gentle tapping and incubated for 45 minutes at room temperature. Following this incubation, 50 ⁇ l from each well of the preparation plate was added to its corresponding well in the assay plate.
- the assay plate was incubated for 23 hours at 37° C. in a humidified atmosphere containing 5% CO 2 .
- Lysis buffer comprised 8.7 ⁇ l NaCl, 6.05 g/l Tris 0.5%(v/v) NP40, at pH to 8.0. Lysis buffer also contained protease inhibitors PMSF, iodoacetamide and benzamide at 100 mM concentration and pepsatin A and leupeptin at 50 mM and 5 mM concentrations respectively. These inhibitors were added fresh to the lysis buffer preparation at time of use.
- the well contents were mixed using a micropipette before removing the lysate to a fresh round-bottom 96 well plate.
- the plate was spun to clear precipitated cell debris and the cleared lysate removed to a further fresh 96 well plate for storage, ( ⁇ 20° C.) or immediate assay.
- TNF alpha receptor RII, p75
- ELISA plates were coated with the receptor (TNF alpha RII-Fc) and incubated with a mixture of a fixed amount of biotinylated TNF alpha and a doubling dilution series of the antibody. Binding of TNF alpha to the receptor was measured by colourimetric assay using a Streptavidin-HRP conjugate.
- the assay was conducted using Immulon 2HB 96 well plates, (Fisher, Loughborough, UK) prepared by coating overnight at 4° C. with 5 ⁇ g/ml TNF alpha RII-Fc (R&D Systems, Abingdon, UK) in carbonate coating buffer. A volume 50 ⁇ l was applied to each well of the plate. The coated plates were washed at least five times with PBS-0.05% (v/v)Tween 20, (PBS-T) and blocked by addition of a solution of 1% (v/v) BSA in PBS-T and further incubation at room temperature for at least one hour.
- a dilution plate was set up in which the test antibody and control reagents were set out. Typically a doubling dilution series starting at a concentration of 50 ⁇ g/ml in a final volume of 50 ⁇ l/well was used for each test antibody.
- Controls included non-TNF alpha binding antibody as a negative, and a preparation of clinical grade Infliximab (Schering-Plough ltd, UK) as the positive.
- Control antibodies were of the same isotype as the test antibodies.
- 50 ⁇ l per well of a solution of 50 ng/ml biotin-TNF alpha was added and the plate mixed by gentle tapping.
- the TNF alpha was a commercially sourced product as previously (Peprotech, London, UK) and biotinylated using EZ link Sulfo-NHS-biotin (Perbio, Tattenhall, UK) and the suppliers recommended protocol.
- the blocking solution was removed from the assay plate and the plate washed as previously. 50 ⁇ l from each well of the dilution plate was added to the relevant well of the assay plate and following mixing, the assay plate incubated for at least one hour at room temperature. Following incubation, the plate was washed and 100 ⁇ l of a diluted Streptavidin-HRP (Sigma, Poole, UK) reagent added to all wells of the plate. The plate was further incubated for at least one hour at room temperature and washed as previously. The assay is disclosed using Sigma-fast OPD tablets (Sigma, Poole, UK), 100 ⁇ l/well and the colour reaction stopped by adding 50 ⁇ l per well 1M Sulphuric acid.
- FIG. 4 shows an example plot from this assay.
- the preferred antibody of the present invention shows a concentration dependent competition curve for TNF alpha binding equivalent to that for the positive control antibody in this assay.
- Human foreskin fibroblast cells can be induced to produce IL-6 by exposure to TNF alpha.
- the ability of the modified antibodies of the present invention to block this up-regulation of expression was assessed by co-incubation of the cells with TNF alpha and the test antibodies, followed by a determination of the subsequent IL-6 levels secreted into the medium using a commercially available IL-6 detection system.
- test plate For the assay, two parallel sets of 96 well plates are prepared. One set, termed the “assay plate”, is seeded with cells, the other, termed the “preparation plate”, is used to prepare the dilutions of TNF alpha and the test and control antibody solutions. The contents of the preparation plate are ultimately transferred to the assay plate. All assays are conducted in duplicate.
- the preparation plate doubling dilution series of the test and positive control antibody were set out in duplicate across the plate.
- the starting concentration for the antibodies was 1.25 ⁇ g/ml in a final volume of 100 ⁇ l/well.
- the negative control received no antibody.
- a solution of 3 ng/ml TNF alpha (PeproTech EC Ltd., London) was added to all antibody-containing wells, for the control wells with no antibody, an additional 100 ⁇ l/well of medium is added.
- the plate was mixed by gentle tapping and incubated at room temperature for at least 30 minutes.
- the medium was analysed for the presence of IL-6 using a commercial ELISA system (IL-6 Module set; Bender Medsystems, Towcester, UK) and conditions recommended by the supplier.
- IL-6 Module set Bender Medsystems, Towcester, UK
- 50 ⁇ l of medium was diluted 1:15 (v/v).
- the absorbance of the solutions in each well was read using a plate reader at 492 nm.
- the absorbance figures were plotted versus antibody concentration.
- the positive control preparation was a sample of the therapeutic antibody infliximab (Schering-Plough ltd, UK).
- the preferred modified antibody of the present invention consistently demonstrates a concentration dependent inhibition IL-6 expression.
- FIG. 9 shows an example plot from this assay.
- a simple plate ELISA was used to confirm the ability of the modified antibody of the present invention to bind TNF alpha.
- the assay was conducted in comparison with a preparation of the therapeutic antibody Infliximab (Schering-Plough ltd, UK) as positive control and a non-TNF alpha binding human IgG preparation (Sigma I2511) as a negative control.
- the assay was conducted using the method detailed below and demonstrates that the preferred composition (Vh5/Vk12) of the present invention has equal efficacy to the control antibody in this assay.
- a typical binding curve is depicted as FIG. 7 . Immulon 2HB 96 well plates, (Fisher, Loughborough, UK) were coated overnight at 4° C.
- TNF alpha 2.5 ⁇ g/ml TNF alpha (Peprotech, London, UK) in carbonate coating buffer. A volume of 50 ⁇ l was applied to each well of the plate. The coated plates were washed three times with PBS-0.05% (v/v)Tween 20, (PBS-T).
- a doubling dilution series of each antibody was prepared and applied in a volume of 100 ⁇ l per well, each in duplicate. The highest antibody concentration was 1 ⁇ g/ml. Plates were incubated for 1 hour at room temperature and washed as previously with PBST. To detect bound antibody, plates were incubated with a Mouse-anti human IgG-HRP conjugate (Sigma, Poole, UK) preparation diluted 1/1000 in PBST. Incubation was for at least 90 minutes at room temperature. The plates were again washed as previously using PBST and the bound antibody disclosed using 100 ⁇ l/well of Sigma-Fast OPD. The color was allowed to develop for 5 minutes and the reaction stopped by addition of 40 ⁇ l/well of 1M H 2 SO 4 .
- FIG. 7 shows a representative binding curve indicating functional equivalence in this assay between the modified antibody (Vh5/Vk12) and the positive control.
- the modified antibody was prepared according to the method of example 5.
- Positive control challenge antibody
- infliximab Schering-Plough ltd, UK.
- T cell proliferation assays 4 ⁇ 10 6 PBMC (per well) from healthy donors were incubated with unmodified and modified antibodies in 2 ml bulk cultures (in 24 well plates). Each donor was treated with modified and unmodified antibodies at 5 and 50 ⁇ g/ml. In addition an untreated control bulk culture was maintained enabling stimulation indexes to be determined. At days 5, 6, 7 and 8 cells for each bulk culture were gently agitated and 50 ⁇ l samples removed in triplicate for determination of the proliferation index.
- the 50 ⁇ l sample aliquots were each transferred to 3 wells of a U-bottom 96 well plate. Fresh AIM V media (130 ⁇ l) was added to each of the 96 wells. Cells were pulsed (for 18-21 hours) with 1 ⁇ Ci [ 3 H]Thymidine per well diluted in a total volume of 20 ul AIM V media. The total volume for each culture was 200 ⁇ l. CPM values were collected using a beta-plate reader and the stimulation index for each time point determined as per example 2 above.
- the SI was plotted for each time point and antibody treatment. A significant SI was taken as >2.0. In responsive donors, treatment with infliximab results in a significant proliferative response with a peak at day 7. In the same donors, treatment with the modified antibody composition (Vh5/Vk12) of the present invention does not result in a significant proliferative response. This result indicates a reduced immunogenic potential in the preferred antibody composition of the present compared with the parental antibody. A representative plot from this assay is provided in FIG. 10 .
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Veterinary Medicine (AREA)
- General Chemical & Material Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Public Health (AREA)
- Immunology (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Rheumatology (AREA)
- Physical Education & Sports Medicine (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Pain & Pain Management (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
The invention relates to the modification of antibodies reactive to human tumor necrosis factor alpha (TNF alpha) to result in anti-TNF alpha antibodies that are substantially non-immunogenic or less immunogenic than any non-modified parental antibody when used in vivo. The invention relates also to peptide molecules comprising T-cell epitopes of the V-regions of the parental antibody which are modified by amino acid alteration in order to reduce or eliminate said T-cell epitopes.
Description
This application is the National Stage of International Application Ser. No. PCT/EP02/12566 filed on Nov. 11, 2002.
The present invention relates to polypeptides to be administered especially to humans and in particular for therapeutic use. The polypeptides are modified polypeptides whereby the modification results in a reduced propensity for the polypeptide to elicit an immune response upon administration to the human subject. The invention in particular relates to the modification of antibodies reactive to human tumor necrosis factor alpha (TNF alpha) to result in anti-TNF alpha antibodies that are substantially non-immunogenic or less immunogenic than any non-modified counterpart when used in vivo.
There are many instances whereby the efficacy of a therapeutic protein is limited by an unwanted immune reaction to the therapeutic protein. Several mouse monoclonal antibodies have shown promise as therapies in a number of human disease settings but in certain cases have failed due to the induction of significant degrees of a human anti-murine antibody (HAMA) response [Schroff, R. W. et al (1985) Cancer Res. 45: 879-885; Shawler, D. L. et al (1985) J. Immunol. 135: 1530-1535]. For monoclonal antibodies, a number of techniques have been developed in attempt to reduce the HAMA response [WOA8909622; EPA0239400; EPA0438310; WOA9106667; EPA0699755]. These recombinant DNA approaches have generally reduced the mouse genetic information in the final antibody construct whilst increasing the human genetic information in the final construct. Notwithstanding, the resultant “humanized” antibodies have, in several cases, still elicited an immune response in patients [Issacs J. D. (1990) Sem. Immunol. 2: 449, 456; Rebello, P. R. et al (1999) Transplantation 68: 1417-1420].
Antibodies are not the only class of polypeptide molecule administered as a therapeutic agent against which an immune response may be mounted. Even proteins of human origin and with the same amino acid sequences as occur within humans can still induce an immune response in humans. Notable examples include therapeutic use of granulocyte-macrophage colony stimulating factor [Wadhwa, M. et al (1999) Clin. Cancer Res. 5: 1353-1361] and interferon alpha 2 [Russo, D. et al (1996) Bri. J. Haem. 94: 300-305; Stein, R. et al (1988) New Engl. J. Med. 318: 1409-1413] amongst others.
Key to the induction of an immune response is the presence within the protein of peptides that can stimulate the activity of T-cells via presentation on MHC class II molecules, so-called “T-cell epitopes”. Such T-cell epitopes are commonly defined as any amino acid residue sequence with the ability to bind to MHC Class II molecules. Implicitly, a “T-cell epitope” means an epitope which when bound to MHC molecules can be recognized by a T-cell receptor (TCR), and which can, at least in principle, cause the activation of these T-cells by engaging a TCR to promote a T-cell response.
MHC Class II molecules are a group of highly polymorphic proteins which play a central role in helper T-cell selection and activation. The human leukocyte antigen group DR (HLA-DR) are the predominant isotype of this group of proteins however, isotypes HLA-DQ and HLA-DP perform similar functions. The present invention is applicable to the detection of T-cell epitopes presented within the context of DR, DP or DQ MHC Class II. In the human population, individuals bear two to four DR alleles, two DQ and two DP alleles. The structure of a number of DR molecules has been solved and these appear as an open-ended peptide binding groove with a number of hydrophobic pockets which engage hydrophobic residues (pocket residues) of the peptide [Brown et al Nature (1993) 364: 33: Stem et al (1994) Nature 368: 215]. Polymorphism identifying the different allotypes of class H molecule contributes to a wide diversity of different binding surfaces for peptides within the peptide binding grove and at the population level ensures maximal flexibility with regard to the ability to recognize foreign proteins and mount an immune response to pathogenic organisms.
An immune response to a therapeutic protein proceeds via the MHC class II peptide presentation pathway. Here exogenous proteins are engulfed and processed for presentation in association with MHC class II molecules of the DR, DQ or DP type. MHC Class II molecules are expressed by professional antigen presenting cells (APCs), such as macrophages and dendritic cells amongst others. Engagement of a MHC class II peptide complex by a cognate T-cell receptor on the surface of the T-cell, together with the cross-binding of certain other co-receptors such as the CD4 molecule, can induce an activated state within the T-cell. Activation leads to the release of cytokines further activating other lymphocytes such as B cells to produce antibodies or activating T killer cells as a full cellular immune response.
T-cell epitope identification is the first step to epitope elimination, however there are few clear cases in the art where epitope identification and epitope removal are integrated into a single scheme. Thus WO98/52976 and WO00/34317 teach computational threading approaches to identifying polypeptide sequences with the potential to bind a sub-set of human MHC class II DR allotypes. In these teachings, predicted T-cell epitopes are removed by the use of judicious amino acid substitution within the protein of interest. However with this scheme and other computationally based procedures for epitope identification [Godkin, A. J. et al (1998) J. Immunol. 161: 850-858; Sturniolo, T. et al (1999) Nat. Biotechnol. 17: 555-561], peptides predicted to be able to bind MHC class II molecules may not function as T-cell epitopes in all situations, particularly, in vivo due to the processing pathways or other phenomena. In addition, the computational approaches to T-cell epitope prediction have in general not been capable of predicting epitopes with DP or DQ restriction.
Besides computational techniques, there are in vitro methods for measuring the ability of synthetic peptides to bind MHC class II molecules. An exemplary method uses B-cell lines of defined MHC allotype as a source of MHC class II binding surface and may be applied to MHC class II ligand identification [Marshall K. W. et al. (1994) J. Immunol. 152:4946-4956; O'Sullivan et al (1990) J. Immunol. 145: 1799-1808; Robadey C. et al (1997) J. Immunol 159: 3238-3246]. However, such techniques are not adapted for the screening multiple potential epitopes to a wide diversity of MHC allotypes, nor can they confirm the ability of a binding peptide to function as a T-cell epitope.
Recently techniques exploiting soluble complexes of recombinant MHC molecules in combination with synthetic peptides have come into use [Kern, F. et al (1998) Nature Medicine 4:975-978; Kwok, W. W. et al (2001) TRENDS in Immunol. 22:583-588]. These reagents and procedures are used to identify the presence of T-cell clones from peripheral blood samples from human or experimental animal subjects that are able to bind particular MHC-peptide complexes and are not adapted for the screening multiple potential epitopes to a wide diversity of MHC allotypes.
Biological assays of T-cell activation can provide a practical option to providing a reading of the ability of a test peptide/protein sequence to evoke an immune response. Examples of this kind of approach include the work of Petra et al using T-cell proliferation assays to the bacterial protein staphylokinase, followed by epitope mapping using synthetic peptides to stimulate T-cell lines [Petra, A. M. et al (2002) J. Immunol. 168: 155-161]. Similarly, T-cell proliferation assays using synthetic peptides of the tetanus toxin protein have resulted in definition of immunodominant epitope regions of the toxin [Reece J. C. et al (1993) J. Immunol. 151: 6175-6184]. WO99/53038 discloses an approach whereby T-cell epitopes in a test protein may be determined using isolated sub-sets of human immune cells, promoting their differentiation in vitro and culture of the cells in the presence of synthetic peptides of interest and measurement of any induced proliferation in the cultured T-cells. The same technique is also described by Stickler et al [Stickler, M. M. et al (2000) J. Immunotherapy 23:654-660], where in both instances the method is applied to the detection of T-cell epitopes within bacterial subtilisin. Such a technique requires careful application of cell isolation techniques and cell culture with multiple cytokine supplements to obtain the desired immune cell sub-sets (dendritic cells, CD4+ and or CD8+T-cells) and is not conducive to rapid through-put screening using multiple donor samples.
As depicted above and as consequence thereof, it would be desirable to identify and to remove or at least to reduce T-cell epitopes from a given in principal therapeutically valuable but originally immunogenic peptide, polypeptide or protein. One of these therapeutically valuable molecules is a monoclonal antibody with binding specificity for tumor necrosis factor alpha (TNF alpha). The preferred monoclonal antibody of the present invention is a modified form of the antibody cA2 described in U.S. Pat. No. 6,284,471. The antibody cA2 is herein referred to as the “parental” antibody of the invention.
It is an objective of the invention to provide for modified forms of the parental mouse-derived monoclonal antibody with binding specificity to human TNF alpha with one or more T cell epitopes removed. TNF alpha is involved in the mediation of a number of pathological conditions including Crohn's disease, rheumatoid arthritis and endotoxic or cardiovascular shock. The modified antibody of the invention can be expected to have therapeutic utility in these conditions and other diseases in which TNF alpha is a significant component of the pathophysiology.
The cA2 antibody is not the only antibody with binding specificity for TNF alpha. A variety of polyclonal and monoclonal preparations with similar specificity are known in the art. Examples include the anti-TNF alpha preparations disclosed in EP0212489, EP0218868, EP0288088 and WO91/02078. Further examples of rodent or murine monoclonal antibodies specific for recombinant human TNF alpha have been described in the literature [see for example; Liang, et al (1986) Biochem. Biophys. Res. Comm. 137: 847-854; Meager, et al. (1987), Hybridoma 6: 305-311; Fendly et al. (1987), Hybridoma 6: 359-369; Bringman, et al (1987), Hybridoma 6: 489-507; Hirai, et al., (1987) J. Immunol. Meth. 96: 57-62 and Moller, et al (1990), Cytokine 2: 162-169]. Some of these antibodies are able to neutralise the effect of TNF alpha in vitro and have been used to develop immunoassays for TNF alpha or are used in the purification of recombinant TNF alpha. In general, and in contrast with antibody cA2, these antibodies have not been developed for in vivo diagnostic or therapeutic uses in humans.
Clinical studies have however been conducted using a murine anti-TNF alpha antibody in human subjects. In fourteen patients with severe septic shock receiving a single dose of a murine anti-TNF alpha antibody seven developed a human anti-murine antibody response to the treatment, due to the immunogenicity of the therapeutic murine antibody. [Exley, A. R. et al.(1990), Lancet 335: 1275-1277]. Such immunogenicity can render treatment ineffective in patients undergoing diagnostic or therapeutic administration of murine anti-TNF alpha antibodies.
In this regard, Adair et al [EP0927758] describe recombinant antibody molecules including antibodies with human constant region sequences and versions in which the complementarity determining regions (CDRs) have been engrafted onto modified human antibody framework sequences. Such antibodies and humanized antibodies are claimed to retain specificity to human TNF alpha□ and may be used in diagnosis and therapy.
The clinical use of antibody cA2 is described by Le et al [U.S. Pat. No. 5,919,425] who detail methods of treating TNF alpha mediated disease using cA2 which is in fact a chimeric form of an original murine monoclonal antibody designated A2. Similarly, Feldmen et al [U.S. Pat. No. 6,270,766] describe use of the same antibody in combination therapy with a myeloablative agent methotrexate for the treatment of arthritis and Crohn's disease.
Large clinical trials have now been conducted using this antibody, which has received the compound name “infliximab”, and is traded in some territories as REMICADE. This antibody has demonstrated a degree of therapeutic efficacy in the treatment of rheumatoid arthritis and Crohn's disease has received regulatory approval for its use as in Crohn's disease in the USA and in Europe. The antibody is produced by recombinant techniques and as noted above, the antibody is “chimeric” meaning that the constant region of the antibody is comprised of sequence derived from human constant region genes and the contribution of mouse derived protein sequence is therefore reduced. Despite this up to 13% of patients treated for Crohn's disease showed an immune response to the therapeutic antibody [Mani R. N. et al. (1998) Arthritis Rheum. 41:1552-1563; Elliot M. J. et al (1994) Lancet 344: 1105-1110; Targan S. R. et al (1997) N. Engl. J. Med. 337: 1029-1035; Present D. H. et al (1999) N. Engl. J. Med. 340: 1398-1405].
There is therefore a need for anti-TNF alpha antibody analogues with enhanced properties and especially improvements in the biological properties of the protein. In this regard, it is highly desired to provide anti-TNF alpha antibodies with reduced or absent potential to induce an immune response in the human subject. Such proteins would expect to display an increased circulation time within the human subject and would be of particular benefit in chronic or recurring disease settings such as is the case for a number of indications for anti-TNF alpha antibodies. The present invention provides for modified forms of an anti-TNF alpha antibody that are expected to display enhanced properties in vivo.
It is a particular objective of the present invention to provide modified anti-TNF alpha antibodies in which the immune characteristic is modified by means of reduced numbers of potential T-cell epitopes.
The invention discloses sequences identified within the variable region sequences of the heavy and light chains of an anti-TNF alpha antibody that are potential T cell epitopes by virtue of MHC class II binding potential.
The invention further discloses sequences identified within the variable region sequences of the heavy and light chains of an anti-TNF alpha antibody that are potential T cell epitopes by virtue of their ability when presented as synthetic peptides to a population of human peripheral blood mononuclear cells (PBMC) cultured in vitro to induce a proliferative response in said PBMC cells. Such information thereby has enabled the constitution of a map of T-cell epitopes present in the said variable regions of the antibody and has provided the critical information required for removing the T-cell epitopes from the molecule.
Where others have provided anti-TNF alpha antibody molecules including chimeric [U.S. Pat. No. 5,919,425] and humanized [EP0927758] forms, none of these teachings recognize the importance of T cell epitopes to the immunogenic properties of the protein nor have been conceived to directly influence said properties in a specific and controlled way according to the scheme of the present invention.
The present invention provides for a modified antibody in which the immune characteristic is modified by means of reduced or removed numbers of potential T-cell epitopes.
The preferred murine derived non-modified “parental” monoclonal antibody of the present invention is herein referred to as antibody cA2 is described in U.S. Pat. No. 6,284,471.
The present invention discloses sequences identified within the cA2 variable region sequences of both the heavy chain and light chain that are potential T-cell epitopes by virtue of MHC class II binding potential.
The invention further discloses the major regions of the antibody V-region sequence that are immunogenic in man and thereby provides the critical information required to conduct modification to the sequences to eliminate or reduce the immunogenic effectiveness of these sites.
In one aspect, the invention provides a modified antibody molecule having specificity for an antigen recognized by monoclonal antibody cA2 wherein one or more amino acids in the variable region of the said cA2 antibody is substituted to reduce MHC class II recognition of peptides derived from this region.
In another aspect, the invention provides a variant monoclonal antibody with reduced immunogenic potential in humans, said variant comprising one or more amino acid substitutions in the V-region of the cA2 antibody to eliminate or reduce peptide fragments of the said V-region from acting as MHC class II ligands or being able to stimulate T-cells.
In a further aspect of the invention, there is provided a variant monoclonal antibody with reduced immunogenic potential in humans, said variant comprising a combination of heavy and light chain V-regions comprising the amino acid sequences selected from Vh1/Vk1, Vh1/Vk5, Vh1/Vk8, Vh5/Vk12, Vh8/Vk5.
It is most preferred to provide and antibody featuring the combination of V-region domains Vh5/Vk12 although other combinations of V-region compositions as listed above may be contemplated.
The sequences of the above listed Vh and Vk sequences are detailed in full in the itemized summary below and as FIG. 8 which also sets out the SEQ ID No assignments as used herein.
Accordingly, the present invention provides modified anti-TNF alpha antibodies with reduced immunogenicity in man where the modified antibodies comprise heavy and light chain variable region amino acid sequences selected from SEQ ID No:1/SEQ ID No:5, SEQ ID No:1/SEQ ID No:7, SEQ ID No: 1/SEQ ID No:8, SEQ ID No:3/SEQ ID No:6 and SEQ ID No:4/SEQ ID No:7 or combinations of amino acids having at least 70% similarity to one or both amino acid sequences in each of the above listed pairs.
The sequences according to this invention designated as SEQ ID 1-8 are:
| SEQ ID No: 1 (= Vh 1) | |
| EVQLVESGGGLVQPGGSLRLSCAASGFTFSNHWMNWVRQSPEKGLEWVAE | |
| IRSKSINSATHYAESVKGRFTISRDDSKNSLYLQNNSLKTEDTAVYYCSR | |
| NYYGSTYDYWGQGTTLTVSS | |
| SEQ ID No: 2 (= Vh 3) | |
| EVKLEESGGGLVQPGGSLRLSCAASGFTFSNHWMNWVRQSPEKGLEWVAE | |
| IRSKSINSATHYAESVKGRFTISRDDSKNSLYLQMNSLKTEDTGVYYCSR | |
| NYYGSTYDYWGQGTTVTVSS | |
| SEQ ID No: 3 (= Vh 5) | |
| EVKLEESGGGLVQPGGSLRLSCAASGFTFSNHWMNWVRQSPEKGLEWVAE | |
| TRSKSTNSATHYAESVKGRFTISRDDSKNSLYLQMNSLKTEDTGVYYCSR | |
| NYYGSTYDYWGQGTTVTVSS | |
| SEQ ID No: 4 (= Vh 8) | |
| EVQLVESGGGLVQPGGSLRLSCAASGFTFSNHWMNWVRQSPEKGLEWVAE | |
| TRSKSTNSATHYADSVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCSR | |
| NYYGSTYDYWGQGTLVTVSS | |
| SEQ ID No: 5 (= Vk 1) | |
| DIQLTQSPDTSSASPGERVSFSCRASQFVGSSIHWYQQRTNGSPRLLIKY | |
| ASESMSGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSHSWPFTFGS | |
| GTNVEVKR | |
| SEQ ID No: 6 (= Vk 12) | |
| DIQLTQSPDTSSASPGERASFSCRASQFVGSSIHWYQHTTNGSPRLLIKY | |
| ASESMSGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSHSWPFTFGS | |
| GTNLEVKR | |
| SEQ ID No: 7 (= Vk 5) | |
| DIQLTQSPDTSSASPGERVSFSCRASQFVGSSIHWYQQRTNGSPRLLIKY | |
| ASESMSGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSHSWPFTFGG | |
| GTKVEIKR | |
| SEQ ID No: 8 (= Vk 8) | |
| DIQLTQSPDTSSASPGERASFSCRASQFVGVVIHWYQHTTNGSPRLLIKY | |
| ASESMSGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSHSWPFTFGG | |
| GTKVEIKR |
In summary the invention relates to the following issues:
-
- a monoclonal antibody V-region heavy chain termed herein Vh1, comprising, in single letter code, the amino acid sequence (SEQ ID NO: 1)
- EVQLVESGGGLVQPGGSLRLSCAASGFTFSNHWMNWVRQSPEKGLEWVAEIRSKSINSATHYAESVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCSRNYYGSTYDYWGQGTTLTVSS;
- a monoclonal antibody V-region heavy chain termed herein Vh3, comprising, in single letter code, the amino acid sequence (SEQ ID NO: 2)
- EVKLEESGGGLVQPGGSLRLSCAASGFTFSNHWMNWVRQSPEKGLEWVAEIRSKSINSATHYAESVKGRFTISRDDSKNSLYLQMNSLKTEDTGVYYCSRNYYGSTYDYWGQGTTVTVSS;
- a monoclonal antibody V-region heavy chain termed herein Vh5 comprising, in single letter code, the amino acid sequence (SEQ ID NO: 3)
- EVKLEESGGGLVQPGGSLRLSCAASGFTFSNHWMNWVRQSPEKGLEWVAETRSKSTNSATHYAESVKGRFTISRDDSKNSLYLQMNSLKTEDTGVYYCSRNYYGSTYDYWGQGTTVTVSS;
- a monoclonal antibody V-region heavy chain termed herein Vh8, comprising, in single letter code, the amino acid sequence (SEQ ID NO: 4)
| EVQLVESGGGLVQPGGSLRLSCAASGFTFSNHWMNWVRQSPEKGLEWVAE | |
| TRSKSTNSATHYADSVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCSR | |
| NYYGSTYDYWGQGTLVTVSS; |
-
- a monoclonal antibody V-region light chain termed herein Vk1, comprising, in single letter code, the amino acid sequence (SEQ ID NO: 5)
| DIQLTQSPDTSSASPGERVSFSCRASQFVGSSIHWYQQRTNGSPRLLIKY | |
| ASESMSGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSHSWPFTFGS | |
| GTNVEVKR; |
-
- a monoclonal antibody V-region light chain termed herein Vk12, comprising, in single letter code, the amino acid sequence (SEQ ID NO: 6)
| DIQLTQSPDTSSASPGERASFSCRASQFVGSSIHWYQHTTNGSPRLLIKY | |
| ASESMSGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSHSWPFTFGS | |
| GTNLEVKR; |
-
- a monoclonal antibody V-region light chain termed herein Vk5, comprising, in single letter code, the amino acid sequence (SEQ ID NO: 7)
| DIQLTQSPDTSSASPGERVSFSCRASQFVGSSIHWYQQRTNGSPRLLIKY | |
| ASESMSGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSHSWPFTFGG | |
| GTKVEIKR; |
-
- a monoclonal antibody V-region light chain termed herein Vk8, comprising, in single letter code, the amino acid sequence (SEQ ID NO: 8)
| DIQLTQSPDTSSASPGERASFSCRASQFVGSSIHWYQHTTNGSPRLLIKY | |
| ASESMSGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQQSHSWPFTFGG | |
| GTKVEIKR; |
-
- a monoclonal antibody comprising the heavy chain V-region sequence Vh1 and a the light chain sequence Vk1
- a monoclonal antibody comprising the heavy chain V-region sequence Vh1 and a the light chain sequence Vk5
- a monoclonal antibody comprising the heavy chain V-region sequence Vh1 and a the light chain sequence Vk8
- a monoclonal antibody comprising the heavy chain V-region sequence Vh5 and a the light chain sequence Vk12
- a monoclonal antibody comprising the heavy chain V-region sequence Vh8 and a the light chain sequence Vk5
- a monoclonal antibody V-region heavy chain comprising the amino acid sequence of antibody cA2 modified to contain one or more substitutions selected from the group of substitutions; M18L, K19R, V23A, I28T, I51T, I56T, S79N, A80S, V81L, T86N, D87S, R89K, L116V wherein the amino acids are identified using single letter code and the numbering refers to the numerical position of the amino acid where the N-terminal residue equals
residue 1; - a monoclonal antibody V-region heavy chain comprising the amino acid sequence of antibody cA2 modified to contain one or more substitutions selected from the group of substitutions K3Q, E5V, M18L, K19R, V23A, I28T, S79N, A80S, V81L, T86N, D87S, R89K, G94A wherein the amino acids are identified using single letter code and the numbering refers to the numerical position of the amino acid where the N-terminal residue equals
residue 1; - a monoclonal antibody V-region heavy chain comprising the amino acid sequence of antibody cA2 modified to contain one or more substitutions selected from the group of substitutions M18L, K19R, V23A, I28T, S79N, A80S, V81L, T86N, D87S, R89K, L116V wherein the amino acids are identified using single letter code and the numbering refers to the numerical position of the amino acid where the N-terminal residue equals
residue 1; - a monoclonal antibody V-region heavy chain comprising the amino acid sequence of antibody cA2 modified to contain one or more substitutions selected from the group of substitutions K3Q, E5V, M18L, K19R, V23A, I28T, I51T, I56T, E64D, S79N, A80S, V81L, T86N, D87S, R89K, G94A, T115L, L116V wherein the amino acids are identified using single letter code and the numbering refers to the numerical position of the amino acid where the N-terminal residue equals
residue 1; - a monoclonal antibody V-region light chain comprising the amino acid sequence of antibody cA2 modified to contain one or more substitutions selected from the group of substitutions; L3Q, A9D, I10T, L11S, V13A, V19A, Q38H, R39T, I58V, S74T, T77S, V78L, S80A, I83A, D85T wherein the amino acids are identified using single letter code and the numbering refers to the numerical position of the amino acid where the N-terminal residue equals
residue 1; - a monoclonal antibody V-region light chain comprising the amino acid sequence of antibody cA2 modified to contain one or more substitutions selected from the group of substitutions L3Q, A9D, I10T, L11S, V13A, I58V, S74T, T77S, V78L, S80A, I83A, D85T, L104V wherein the amino acids are identified using single letter code and the numbering refers to the numerical position of the amino acid where the N-terminal residue equals
residue 1; - a monoclonal antibody V-region light chain comprising the amino acid sequence of antibody cA2 modified to contain one or more substitutions selected from the group of substitutions L3Q, A9D, I10T, L11S, V13A, I58V, S74T, T77S, V78L, S80A, I83A, D85T, S100G, N103K, L104V, V106I wherein the amino acids are identified using single letter code and the numbering refers to the numerical position of the amino acid where the N-terminal residue equals
residue 1; - a monoclonal antibody V-region light chain comprising the amino acid sequence of antibody cA2 modified to contain one or more substitutions selected from the group of substitutions L3Q, A9D, I10T, L11S, V13A, Q38H, R39T, I58V, S74T, T77S, V78L, S80A, I83A, D85T, S100G, N103K, L104V, V106I wherein the amino acids are identified using single letter code and the numbering refers to the numerical position of the amino acid where the N-terminal residue equals
residue 1; - an accordingly modified antibody V-region additionally comprising a human IgG1 constant region domain and a human kappa constant region domain;
- an accordingly modified antibody able to bind TNF alpha
- an accordingly modified antibody able to provide a protective effect to WEHI164 cells grown in otherwise lethal concentrations of TNF alpha in vitro;
- an accordingly modified antibody able to inhibit TNF alpha stimulated production of ICAM-1 in human endothelial cells in vitro;
- an accordingly modified antibody able to inhibit TNF alpha stimulated production of IL-6 in human fibroblast cells in vitro;
- an accordingly modified antibody comprising one or more V-region domains in which the immunogenic regions have been mapped using a T-cell assay and then modified such that upon re-testing in a T-cell assay the modified protein evokes a stimulation index smaller than the parental (non-modified) molecule;
- a modified antibody molecule having the biological activity of monoclonal antibody cA2 and being substantially non-immunogenic or less immunogenic than the non-modified cA2;
- a modified antibody molecule having the same biological activity as antibody cA2 when used in vivo;
- an accordingly specified antibody molecule, wherein said loss of immunogenicity is achieved by removing one or more T-cell epitopes derived from the originally non-modified molecule;
- an accordingly specified antibody molecule, wherein said loss of immunogenicity is achieved by reduction in numbers of MHC allotypes able to bind peptides derived from said molecule;
- an accordingly specified antibody molecule, wherein one T-cell epitope is removed;
- an accordingly specified antibody molecule, wherein said originally present T-cell epitopes are MHC class II ligands or peptide sequences which show the ability to stimulate or bind T-cells via presentation on MHC class II;
- an accordingly specified molecule, wherein said peptide sequences are selected from the group as depicted in
FIG. 1 ; - an accordingly specified molecule, wherein 1-9 amino acid residues, preferably one amino acid residue in any of the originally present T-cell epitopes are altered;
- an accordingly specified molecule, wherein the alteration of the amino acid residues is substitution, addition or deletion of originally present amino acid(s) residue(s) by other amino acid residue(s) at specific position(s);
- an accordingly specified molecule, wherein, if necessary, additionally further alteration usually by substitution, addition or deletion of specific amino acid(s) is conducted to restore biological activity of said molecule;
- an accordingly specified molecule wherein alteration is conducted at one or more residues from any or all of the string of contiguous residues of sequences (A)-(H) as below wherein said sequences are derived from the cA2 antibody V-region sequence domains of the molecule and where using single letter code;
| A. = GLVQPGGSMKLSCVAS; | (SEQ ID NO:9) | |
| B. = WVAEIRSKSINSA; | (SEQ ID NO:10) | |
| C. = SRDDSKSAVYLQMTDLRT; | (SEQ ID NO:11) | |
| D. = RNYYGSTYDYWGQGTTLTVSS; | (SEQ ID NO:12) | |
| E. = DILLTQSPAILSVSPGERVSF; | (SEQ ID NO:13) | |
| F. = HWYQQRTNGSPR; | (SEQ ID NO:14) | |
| G. = LIKYASESMSGIPS; | (SEQ ID NO:15) | |
| H. = DFTLSINTVESEDIADYYCQQ; | (SEQ ID NO:16) |
-
- a peptide molecule comprising at least 9 consecutive residues from any of the sequences (A)-(H) above;
- a peptide molecule of above sharing greater than 90% amino acid identity with any of the peptide sequences derived from (A)-(H);
- a peptide molecule of above sharing greater than 80% amino acid identity with any of the peptide sequences derived from (A)-(H) above;
- a peptide molecule containing a sequence element identical or substantially homologous with one or more of the sequences (A)-(H) above;
- peptide sequences as above able to bind MHC class II;
- a pharmaceutical composition comprising any of the peptides or modified peptides of above having the activity of binding to MHC class II
- a DNA sequence or molecule which codes for any of said specified modified molecules as defined above and below;
- a pharmaceutical composition comprising a modified molecule having the biological activity of cA2;
- a pharmaceutical composition as defined above and/or in the claims, optionally together with a pharmaceutically acceptable carrier, diluent or excipient;
- a method for manufacturing a modified molecule having the biological activity of antibody cA2 as defined above or below and comprising the following steps: (i) determining the amino acid sequence of the polypeptide or part thereof; (ii) identifying one or more potential T-cell epitopes within the amino acid sequence of the protein by any method including determination of the binding of the peptides to MHC molecules using in vitro or in silico techniques or biological assays; (iii) designing new sequence variants with one or more amino acids within the identified potential T-cell epitopes modified in such a way to substantially reduce or eliminate the activity of the T-cell epitope as determined by the binding of the peptides to MHC molecules using in vitro or in silico techniques or biological assays; (iv) constructing such sequence variants by recombinant DNA techniques and testing said variants in order to identify one or more variants with desirable properties; and (v) optionally repeating steps (ii)-(iv);
- an accordingly specified method, wherein step (iii) is carried out by substitution, addition or deletion of 1-9 amino acid residues in any of the originally present T-cell epitopes;
- an accordingly specified method, wherein the alteration is made with reference to an homologous protein sequence and/or in silico modeling techniques;
- a peptide sequence consisting of at least 9 consecutive amino acid residues of a 13mer T-cell epitope peptide as specified above and its use for the manufacture of an anti-TNF alpha antibody having substantially no or less immunogenicity than any non-modified molecule and having the biological activity of an anti-TNF alpha antibody when used in vivo.
Reference to “substantially non-immunogenic” or “reduced immunogenic potential” includes reduced immunogenicity compared to a parent antibody, i.e. a non-modified murine or chimeric monoclonal antibody. The term “immunogenicity” includes an ability to provoke, induce or otherwise facilitate a humoral and or T-cell mediated response in a host animal and in particular where the “host animal” is a human.
An important and significant feature of the modified antibodies of the present is that they retain the functional activities of the non-modified or “parental” antibody. It is therefore particularly desired to produce modified antibodies in which all of the beneficial technical features associated with the therapeutic efficacy of the parental non-modified antibody are exhibited. This is pertinent to the contemplated utility of the invention, namely to provide a composition with therapeutic efficacy in a number of important diseases in man including especially rheumatoid arthritis and Crohn's disease and a number of other clinical indications mediated by TNF alpha. Such a therapeutic is a preferred embodiment of the present invention.
Accordingly, the modified antibody of the present exhibits an affinity for its target antigen that is similar to the affinity exhibited by monoclonal antibody cA2. The antibody recognizes TNF alpha but not TNF alpha and is capable of neutralizing TNF alpha activity in a range of in vitro assays. Such assays include cell cytotoxicity, mitogenesis, cytokine induction and induction of adhesion molecules. In addition to neutralizing the biological activity of TNF alpha, the therapeutic efficacy of the parental molecule is believed also to be mediated by the ability of the antibody to induce antibody-dependent cell mediated cytoxicity (ADCC) and is effective at killing cells expressing cell surface bound forms of TNF alpha. The phenomenon of ADCC is mediated by the constant region domain of whole antibody molecules, and the present invention contemplates production of a whole antibody molecules comprising a constant region domain compatible with ADCC induction.
In regard to in vitro assays demonstrating TNF alpha neutralizing activity a number of such assays are described herein as experimental examples and provide evidence that the preferred antibodies of the invention have in vitro potency.
By “antibody” is meant a protein of the immunoglobulin family that is capable of combining, interacting or otherwise associating with an antigen. The term “antigen” is used herein to refer to a substance that is capable of interacting with the antibody and in the context of the present invention is meant to be TNF alpha. The TNF alpha of the present invention is tumor necrosis factor alpha (TNF alpha) and is most preferably human TNF alpha or any TNF alpha representing an antigen for antibody cA2. The TNF alpha may be soluble TNF alpha or membrane associated TNF alpha.
The term “immunoglobulin” is used herein to refer to a protein consisting of one or more polypeptides substantially encoded by immunoglobulin genes. The recognized immunoglobulin genes include the κ, λ, α, γ (IgG1, IgG2, IgG3, IgG4), σ, ε and μ constant region genes and in nature multiple immunoglobulin variable region genes. One natural form of immunoglobulin is a tetramer comprising two identical pairs in which each pair has one light chain and one heavy chain. In each pair the heavy and light chain variable regions together provide the binding surface capable of interacting with the antigen. The term Vh is used herein to refer to the heavy chain variable region, and the term Vk is used herein to refer to the light chain variable region and in this instance in common with numerous monoclonal antibodies the light chain is a “kappa” (κ) type chain.
As used herein, Vh means a polypeptide that is about 110 to 125 amino acid residues in length, the sequence of which corresponds to any of the specified Vh chains herein which in combination with a Vk are capable of binding human TNF alpha. Similarly, Vk means a polypeptide that is about 95-130 amino acid residues in length the sequence of which corresponds to any of the specified Vk chains herein which in combination with a Vh are capable of binding human TNF alpha. Full-length immunoglobulin heavy chains are about 50 kDa molecular weight and are encoded by a Vh gene at the N-terminus and one of the constant region genes (e.g. γ) at the C-terminus. Similarly, full-length light chains are about 25 kDa molecular weight and are encoded by a V-region gene at the N-terminus and a κ or λ constant region gene at the C-terminus.
In addition to whole antibody (tetramers), immunoglobulins may exist in a number of other forms derived by application of recombinant DNA techniques or protein biochemistry. These forms include for example Fv, Fab, Fab′ and (Fab)2 molecules and could all contain any of the Vh or Vk sequences of the present invention. A further example may include a “bi-specific” antibody, that is comprising a Vh/Vk combination of the present invention in combination with a second Vh/Vk combination with a different antigen specificity.
The term “T-cell epitope” means according to the understanding of this invention an amino acid sequence which is able to bind MIC class II, able to stimulate T-cells and/or also to bind (without necessarily measurably activating) T-cells in complex with MHC class II.
The term “peptide” as used herein and in the appended claims, is a compound that includes two or more amino acids. The amino acids are linked together by a peptide bond (defined herein below). There are 20 different naturally occurring amino acids involved in the biological production of peptides, and any number of them may be linked in any order to form a peptide chain or ring. The naturally occurring amino acids employed in the biological production of peptides all have the L-configuration. Synthetic peptides can be prepared employing conventional synthetic methods, utilizing L-amino acids, D-amino acids, or various combinations of amino acids of the two different configurations. Some peptides contain only a few amino acid units. Short peptides, e.g., having less than ten amino acid units, are sometimes referred to as “oligopeptides”. Other peptides contain a large number of amino acid residues, e.g. up to 100 or more, and are referred to as “polypeptides”. By convention, a “polypeptide” may be considered as any peptide chain containing three or more amino acids, whereas a “oligopeptide” is usually considered as a particular type of “short” polypeptide. Thus, as used herein, it is understood that any reference to a “polypeptide” also includes an oligopeptide. Further, any reference to a “peptide” includes polypeptides, oligopeptides, and proteins. Each different arrangement of amino acids forms different polypeptides or proteins. The number of polypeptides—and hence the number of different proteins-that can be formed is practically unlimited. “Alpha carbon (Cα)” is the carbon atom of the carbon-hydrogen (CH) component that is in the peptide chain. A “side chain” is a pendant group to Cα that can comprise a simple or complex group or moiety, having physical dimensions that can vary significantly compared to the dimensions of the peptide.
The general method of the present invention leading to the modified anti-TNF alpha antibody comprises the following steps:
- (a) Determining the amino acid sequence of the polypeptide or part thereof
- (b) Identifying one or more potential T cell epitopes within the amino acid sequence of the protein by any method including determination of the binding of the peptides to MHC molecules using in vitro or in silico techniques or biological assays.
- (c) Designing new sequence variants with one or more amino acids within the identified potential T cell epitopes modified in such a way to substantially reduce or eliminate the activity of the T cell epitope as determined by the binding of the peptides to MHC molecules using in vitro or in silico techniques or biological assays. Such sequence variants are created in such a way to avoid creation of new potential T cell epitopes by the sequence variations unless such new potential T cell epitopes are, in turn, modified in such a way to substantially reduce or eliminate the activity of the T cell epitope.
- (d) Constructing such sequence variants by recombinant DNA techniques and testing said variants in order to identify one or more variants with desirable properties.
The identification of potential T-cell epitopes according to step (b) can be carried out according to methods described previously in the art. Suitable methods are disclosed in WO 98/59244; WO 98/52976; WO 00/34317.
Another very efficacious method for identifying T-cell epitopes by calculation is described in the Example 1, which is a preferred embodiment according to this invention. The analysis has been conducted on both the heavy chain and light chain variable region sequences of the anti-TNF alpha antibody.
A further technical approach suitable to the detection of T-cell epitopes is via biological T-cell assay. Such an analysis is described in the Example 2 and is similarly a preferred embodiment according to this invention. Accordingly, the preferred method of biological assay embodied herein comprises the testing of overlapping peptides derived from the heavy chain and light chain variable region sequences of the anti-TNF alpha antibody or alternatively a sub-set of V-region derived peptides such as all or some of those derived by calculation according to the method embodied by Example 1. The synthetic peptides are tested for their ability to evoke a proliferative response in human T-cells cultured in vitro. The proliferative response can be measured by any convenient means but a widely known method as exploited in the present embodiment uses 3H-thymidine incorporation. This approach can be conducted using naïve human T-cells taken from healthy donors, and may also be used to test the immunogenicity in vitro of whole protein molecules as well as synthetic peptides. Such a scheme has also been used in the present study (Example 11) to demonstrate to reduced immunogenic potential of a preferred molecule of the invention. The inventors have established that in the operation of a naïve T-cell assay, a stimulation index equal to or greater than 2.0 is a useful measure of induced proliferation. The stimulation index is conventionally derived by division of the proliferation score measured (e.g. counts per minute if using 3H-thymidine incorporation) to the test peptide, by the proliferation score measured in cells not contacted with a test (poly)peptide.
In practice a number of variant anti-TNF alpha antibodies may be produced and tested for the desired immune and functional characteristic. It is particularly important when conducting alterations to the protein sequence that the contemplated changes do not introduce new immunogenic epitopes. This event is avoided in practice by re-testing the contemplated sequence for the presence of epitopes and or of MHC class II ligands by any suitable means. One particular means, which is a further embodiment of the invention, is use of an in vitro immunological recall assay involving PBMC preparations cultured in the presence of a priming quantity of test protein (antibody) and re-challenge with either the same test protein or in parallel a modified version of the protein. Such a scheme provides a convenient practical demonstration of a reduced immunogenic potential in a modified protein in the absence of full-scale clinical trials. For most purposes, the variant proteins will be produced by recombinant DNA techniques although other procedures including chemical synthesis may be contemplated.
In a particularly preferred embodiment, the modified antibodies of the present invention are generated by expression of different combinations of the Vh and Vk genes specified herein. The most preferred combination according to the invention comprises the combination Vh5/Vk12. Other combinations have been produced and tested for functional activity in binding TNF alpha and these combinations comprise Vh1/Vk1, Vh1/Vk5, Vh1/Vk8 and Vh8/Vk5. All such combinations of heavy and light chain are encompassed by the present invention.
Accordingly, the present invention provides modified anti-TNF alpha antibodies with reduced immunogenicity in man where the modified antibodies comprise heavy and light chain variable region amino acid sequences selected from SEQ ID No:1/SEQ ID No:5, SEQ ID No:1/SEQ ID No:7, SEQ ID No:1/SEQ ID No:8, SEQ ID No:3/SEQ ID No:6 and SEQ ID No:4/SEQ ID No:7 or combinations of amino acids having at least 70% similarity to one or both amino acid sequences in each of the above listed pairs.
The invention relates to an anti-TNF alpha monoclonal antibody in which substitutions of at least one amino acid residue have been made at positions within the V-regions of the molecule to result in a substantial reduction in activity of or elimination of one or more potential T-cell epitopes from the protein. It is most preferred to provide modified antibody molecules in which amino acid modification (e.g. a substitution) is conducted within the most immunogenic regions of the parent molecule. The major preferred embodiments of the present invention comprise modified antibody molecules for which any of the MHC class II ligands are altered such as to eliminate binding or otherwise reduce the numbers of MHC allotypes to which the peptide can bind. The inventors have discovered and herein disclose, the immunogenic regions of the antibody cA2 molecule in man. It is understood that under certain circumstances additional regions of sequence to those disclosed herein can become immunogenic epitopes, for example in the event of infection with a pathogen expressing a protein or peptide with a similar sequence to that of the present case. In any event, it will be critical for the sequence element to act as an MHC class II ligand and in principle therefore any of the sequences disclosed in FIG. 1 can be considered immunogenic epitopes under the scope of the present invention.
For the elimination of T-cell epitopes, amino acid substitutions are made at appropriate points within the peptide sequence predicted to achieve substantial reduction or elimination of the activity of the T-cell epitope. In practice an appropriate point will preferably equate to an amino acid residue binding within one of the pockets provided within the MHC class II binding groove.
It is most preferred to alter binding within the first pocket of the cleft at the so-called P1 or P1 anchor position of the peptide. The quality of binding interaction between the P1 anchor residue of the peptide and the first pocket of the MHC class II binding groove is recognized as being a major determinant of overall binding affinity for the whole peptide. An appropriate substitution at this position of the peptide will be for a residue less readily accommodated within the pocket, for example, substitution to a more hydrophilic residue. Amino acid residues in the peptide at positions equating to binding within other pocket regions within the MHC binding cleft are also considered and fall under the scope of the present.
It is understood that single amino acid substitutions within a given potential T cell epitope are the most preferred route by which the epitope may be eliminated. Combinations of substitution within a single epitope may be contemplated and for example can be particularly appropriate where individually defined epitopes are in overlap with each other. Moreover, amino acid substitutions either singly within a given epitope or in combination within a single epitope may be made at positions not equating to the “pocket residues” with respect to the MHC class II binding groove, but at any point within the peptide sequence. All such substitutions fall within the scope of the present.
In as far as this invention relates to modified anti-TNF alpha antibodies, compositions containing such modified antibodies or fragments of modified antibodies and related compositions should be considered within the scope of the invention. The invention therefore contemplates the use and generation of antibody fragments including for example Fv, Fab, Fab′ and F(ab′)2 fragments. Such fragments may be prepared by standard methods [for example; Coligan et al (Current Protocols in Immunology, John Wiley & Sons 1991-1997]. The present invention also contemplates the various recombinant forms of antibody derived molecular species well known in the art. Such species include stabilised Fv fragments including single chain Fv forms (e.g. scFv) comprising a peptide linker joining the Vh and V1 domains, or an Fv stabilised by interchain di-sulphide linkage (dsFv) and which contain additional cysteine residues engineered to facilitate the conjoining of the Vh and V1 domains. Equally, other compositions are familiar in the art and could include species referred to as “minibodies”; and single variable domain “dAbs”. Other species still may incorporate means for increasing the valency of the modified antibody V-region domain, i.e. species having multiple antigen binding sites for example by the engineering of dimerisation domains (e.g. “leucine zippers”) or also chemical modification strategies.
In another aspect, the present invention relates to nucleic acids encoding modified anti-TNF alpha antibody entities.
In a further aspect the present invention relates to methods for therapeutic treatment of humans using the modified anti-TNF alpha antibody.
The invention will now be illustrated, but not limited, by the following examples. The examples refer to the following drawings:
Identification of Potential MHC class II Ligands in Anti-TNF Alpha VH and VL Protein Sequence by Computational Means.
The scheme for the analysis of peptide sequences with potential to act as MHC class II binding ligands has been described in detail previously [WO 02/069232]. A software tool using this procedure has been developed and applied to the analysis of the anti-TNF alpha antibody V-region domains. In brief, the software was built from a number of elements including a library of model MHC class II molecules, produced to cover a wide number of allotypic variants extant in the human population; a library of peptide backbone structures, produced to encompass theoretical and known backbone conformations. Using these elements, a large data set was generated based on the results of docking each backbone conformation within each model MHC allotype binding groove. The data set encompasses also the best side-chain conformation for all possible amino acids at the given position. The interatomic distances between the peptide side-chains (in the optimum conformation) and the MHC protein are stored in this dataset. A test peptide from the protein of interest is analysed by adding its sequence of side-chains to all backbones and then retrieving the data sets for the optimum side-chain conformations and thus calculating a “peptide score” for each backbone. The best score is selected for display and the process repeated for each of the available MHC model structures. The algorithm has been applied to the analysis of the V-region domains of the anti-TNF alpha antibody cA2. The analysis identifies multiple 13mer peptide sequences which are potential T-cell epitopes by their being predicted MHC class II ligands for one or more allotypes. These peptides are shown in FIG. 1A (heavy-chain derived peptides) and 1B (light-chain derived peptides).
Identification of T-Cell Epitopes Using Synthetic Peptides and Naïve Human PBMC In Vitro Proliferation Assays.
The interaction between MHC, peptide and T-cell receptor (TCR) provides the structural basis for the antigen specificity of T-cell recognition. T-cell proliferation assays test the binding of peptides to MHC and the recognition of MHC/peptide complexes by the TCR. In vitro T-cell proliferation assays of the present example, involve the stimulation of peripheral blood mononuclear cells (PBMCs), containing antigen presenting cells (APCs) and T-cells. Stimulation is conducted in vitro using synthetic peptide antigens, and in some experiments whole protein antigen. Stimulated T-cell proliferation is measured using 3H-thymidine (3H-Thy) and the presence of incorporated 3H-Thy assessed using scintillation counting of washed fixed cells.
| TABLE 1 |
| Synthetic Peptides |
| Peptide # | |||
| (SEQ ID NO:) | Peptide Sequence | ||
| Heavy chain peptides |
| CA1 (17) | EVKLEESGGGLVQPG | |
| CA2 (18) | LEESGGGLVQPGGSM | |
| CA3 (19) | SGGGLVQPGGSMKLS | |
| CA4 (20) | GLVQPGGSMKLSCVA | |
| CA5 (21) | QPGGSMKLSCVASGF | |
| CA6 (22) | GSMKLSCVASGFIFS | |
| CA7 (23) | KLSCVASGFIFSNHW | |
| CA8 (24) | CVASGFIFSNHWMNW | |
| CA9 (25) | SGFIFSNHWMNWVRQ | |
| CA10 (26) | IFSNHWMNWVRQSPE | |
| CA11 (27) | NHWMNWVRQSPEKGL | |
| CA12 (28) | MNWVRQSPEKGLEWV | |
| CA13 (29) | VRQSPEKGLEWVAEI | |
| CA14 (30) | SPEKGLEWVAEIRSK | |
| CA15 (31) | KGLEWVAEIRSKSIN | |
| CA16 (32) | EWVAEIRSKSINSAT | |
| CA17 (33) | AEIRSKSINSATHYA | |
| CA18 (34) | RSKSINSATHYAESV | |
| CA19 (35) | SINSATHYAESVKGR | |
| CA20 (36) | SATHYAESVKGRFTI | |
| CA21 (37) | HYAESVKGRFTISRD | |
| CA22 (38) | ESVKGRFTISRDDSK | |
| CA23 (39) | KGRFTISRDDSKSAV | |
| CA24 (40) | FTISRDDSKSAVYLQ | |
| CA25 (41) | SRDDSKSAVYLQMTD | |
| CA26 (42) | DSKSAVYLQMTDLRT | |
| CA27 (43) | SAVYLQMTDLRTEDT | |
| CA28 (44) | YLQMTDLRTEDTGVY | |
| CA29 (45) | MTDLRTEDTGVYYCS | |
| CA30 (46) | LRTEDTGVYYCSRNY | |
| CA31 (47) | EDTGVYYCSRNYYGS | |
| CA32 (48) | GVYYCSRNYYGSTYD | |
| CA33 (49) | YCSRNYYGSTYDYWG | |
| CA34 (50) | RNYYGSTYDYWGQGT | |
| CA35 (51) | YGSTYDYWGQGTTLT | |
| CA36 (52) | TYDYWGQGTTLTVSS | |
| CA37 (53) | YWGQGTTLTVSSAST | |
| CA38 (54) | QGTTLTVSSASTKGP | |
| CA39 (55) | TLTVSSASTKGPSVF | |
| CA40 (56) | VSSASTKGPSVFPLA |
| Light chain peptides |
| CA41 (57) | DILLTQSPAILSVSP | ||
| CA42 (58) | LTQSPAILSVSPGER | ||
| CA43 (59) | SPAILSVSPGERVSF | ||
| CA44 (60) | ILSVSPGERVSFSCR | ||
| CA45 (61) | VSPGERVSFSCRASQ | ||
| CA46 (62) | GERVSFSCRASQFVG | ||
| CA47 (63) | VSFSCRASQFVGSSI | ||
| CA48 (64) | SCRASQFVGSSIHWY | ||
| CA49 (65) | ASQFVGSSIHWYQQR | ||
| CA50 (66) | FVGSSIHWYQQRTNG | ||
| CA51 (67) | SSIHWYQQRTNGSPR | ||
| CA52 (68) | HWYQQRTNGSPRLLI | ||
| CA53 (69) | QQRTNGSPRLLIKYA | ||
| CA54 (70) | TNGSPRLLIKYASES | ||
| CA55 (71) | SPRLLIKYASESMSG | ||
| CA56 (72) | LLIKYASESMSGIPS | ||
| CA57 (73) | KYASESMSGIPSRFS | ||
| CA58 (74) | SESMSGIPSRFSGSG | ||
| CA59 (75) | MSGIPSRFSGSGSGT | ||
| CA60 (76) | IPSRFSGSGSGTDFT | ||
| CA61 (77) | RFSGSGSGTDFTLSI | ||
| CA62 (78) | GSGSGTDFTLSINTV | ||
| CA63 (79) | SGTDFTLSINTVESE | ||
| CA64 (80) | DFTLSINTVESEDIA | ||
| CA65 (81) | LSINTVESEDIADYY | ||
| CA66 (82) | NTVESEDIADYYCQQ | ||
| CA67 (83) | ESEDIADYYCQQSHS | ||
| CA68 (84) | DIADYYCQQSHSWPF | ||
| CA69 (85) | DYYCQQSHSWPFTFG | ||
| CA70 (86) | CQQSHSWPFTFGSGT | ||
| CA71 (87) | SHSWPFTFGSGTNLE | ||
| CA72 (88) | WPFTFGSGTNLEVKR | ||
| CA73 (89) | TFGSGTNLEVKRTVA | ||
| CA74 (90) | SGTNLEVKRTVAAPS | ||
| CA75 (91) | NLEVKRTVAAPSVFI | ||
Buffy coats from human blood stored for less than 12 hours were obtained from the National Blood Service (Addenbrooks Hospital, Cambridge, UK). Ficoll-paque was obtained from Amersham Pharmacia Biotech (Amersham, UK). Serum free AIM V media for the culture of primary human lymphocytes and containing L-glutamine, 50 μg/ml streptomycin, 10 μg/ml gentomycin and 0.1% human serum albumin was from Gibco-BRL (Paisley, UK). Synthetic peptides were obtained from Eurosequence (Groningen, The Netherlands) and Babraham Technix (Cambridge, UK). Erythrocytes and leukocytes were separated from plasma and platelets by gentle centrifugation of buffy coats. The top phase (containing plasma and platelets) was removed and discarded. Erythrocytes and leukocytes were diluted 1:1 in phosphate buffered saline (PBS) before layering onto 15 ml ficoll-paque (Amersham Pharmacia, Amersham UK). Centrifugation was done according to the manufacturers recommended conditions and PBMCs were harvested from the serum+PBS/ficoll-paque interface. PBMCs were mixed with PBS (1:1) and collected by centrifugation. The supernatant was removed and discarded and the PBMC pellet resuspended in 50 ml PBS. Cells were again pelleted by centrifugation and the PBS supernatant discarded. Cells were resuspended using 50 ml AIM V media and at this point counted and viability assessed using trypan blue dye exclusion. Cells were again collected by centrifugation and the supernatant discarded. Cells were resuspended for cryogenic storage at a density of 3×107 per ml. The storage medium was 90%(v/v) heat inactivated AB human serum (Sigma, Poole, UK) and 10%(v/v) DMSO (Sigma, Poole, UK). Cells were transferred to a regulated freezing container (Sigma) and placed at −70° C. overnight. When required for use, cells were thawed rapidly in a water bath at 37° C. before transferring to 10 ml pre-warmed AIM V medium.
PBMC were stimulated with protein and peptide antigens in a 96 well flat bottom plate at a density of 2×105 PBMC per well. PBMC were incubated for 7 days at 37° C. before pulsing with 3H-Thy (Amersham-Phamacia, Amersham, UK). For the present study, synthetic peptides (15mers) spanning the entire V-region domains of both the heavy chain and light chain of antibody cA2 were produced. Each peptide overlapped each successive peptide in the sequence by 12 residues, i.e., each peptide incremented from the next in the sequence by 3 residues. The peptide sequences and identification numbers are shown in Table 1. Each peptide was screened individually against PBMC's isolated from 20 naïve donors. Two control peptides C32 (PKYVKQNTLKLAT (SEQ ID NO: 178) and C49 (KVVDQIKKISKPVQH (SEQ ID NO: 179) that have previously been shown to be immunogenic and a potent non-recall antigen KLH were used in each donor assay. Peptides were dissolved in DMSO to a final concentration of 10mM, these stock solutions were then diluted 1/500 in AIM V media (final concentration 20 μM). Peptides were added to a flat bottom 96 well plate to give a final concentration of 2 and 10 μM in a 100 μl. The viability of thawed PBMC's was assessed by trypan blue dye exclusion, cells were then resuspended at a density of 2×106 cells/ml, and 100 μl (2×105 PBMC/well) was transferred to each well containing peptides. Triplicate well cultures were assayed at each peptide concentration. Plates were incubated for 7 days in a humidified atmosphere of 5% Co2 at 37° C. Cells were pulsed for 18-21 hours with 1 μCi 3H-Thymidine per well before harvesting onto filter mats. CPM values were determined using a Wallac microplate beta top plate counter (Perkin Elmer). Results were expressed as stimulation indices (SI), where SI=CPM Test Peptide/CPM untreated control.
Mapping T cell epitopes in the cA2 V-region sequences using the naïve T cell proliferation assay resulted in the identification of several immunogenic regions. Peptides with significant stimulation indices in individual donors include for example CA34 (SI=2.22) and CA52 (SI=2.09) amongst others.
The map was refined in sequence regions surrounding the complementarily determining regions (CDRs) for the Vh and the Vk sequences using a further sub-set of 15 different 13-mer peptides (P1-P15) with sequences as below:
- P1=KGLEWVAEIRSKS (SEQ ID NO: 92)
- P2=EWVAEIRSKSINS (SEQ ID NO: 93)
- P3=AEIRSKSINSATH (SEQ ID NO: 94)
- P4=KSINSATHYAESV (SEQ ID NO: 95)
- P5=TGVYYCSRNYYGS (SEQ ID NO: 96)
- P6=STYDYWGQGTTLT (SEQ ID NO: 97)
- P7=SQFVGSSIHWYQQ (SEQ ID NO: 98)
- P8=QFVGSSIHWYQQR (SEQ ID NO: 99)
- P9=SSIHWYQQRTNGS (SEQ ID NO: 100)
- P10=HWYQQRTNGSPRL (SEQ ID NO: 101)
- P11=PRLLIKYASESMS (SEQ ID NO: 102)
- P12=RLLIKYASESMSG (SEQ ID NO: 103)
- P13=LLIKYASESMSGI (SEQ ID NO: 104)
- P14=IKYASESMSGIPS (SEQ ID NO: 105)
- P15=ESMSGIPSRFSGS (SEQ ID NO: 106)
Peptides P1-P7 derive from the Vh chain sequence and peptides P8-P15 derive from the Vk chain sequence. Peptides P1-P15 were screened for their ability to evoke an in vitro proliferative response in a further panel of 10 naïve PBMC preparations encompassing multiple different MHC allotypes as previously. The results of the naïve T-cell proliferation assay from both sets of synthetic peptides and donor panels can be taken together to produce an epitope map of the Vh and Vk chains of the antibody. In general, in compilation of such a map, an SI>1.95 is taken as a positive response. Representative histograms showing the SI to all 15-mer peptides for one responsive donor is given in the accompanying FIG. 5 . Exemplary results to the 13-mer peptides P1-P15 are given as FIG. 6 .
Construction of Anti-TNF Alpha Antibody Vh and Vk Genes.
The sequence of the antibody was derived from U.S. Pat. No. 5,656,272. The Variable domain heavy chain (Vh) and the variable domain light chain (Vk) genes were made by gene synthesis. Briefly, a panel of synthetic oligonucleotides were designed and synthesised. The genes were assembled using a ligase chain reaction (LCR) wherein the oligonucleotides featuring complementary ends were allowed to anneal followed by amplification and fill-in using a polymerase chain reaction (PCR). The PCR was driven by addition of an increased concentration of the flanking oligonuclotides to act as primers. The PCR products were assembled into full-length antibody genes by further PCR from vectors containing 5′ and 3′ immunoglobulin gene flanking regions and sub-cloning into expression vectors for expression of whole antibody. The assembled Vh and Vk genes served as templates for mutagenesis and construction of multiple variant antibody sequences in which T-cell epitopes had been removed.
For assembly of the Vh gene oligonucleotides OL373-OL391 detailed in Table 2 were used. For assembly of the Vk gene oligonucleotides OL392-OL410 detailed in Table 3 were used. For both genes, the LCR was conducted by mixing 20 μl of phosphorylated oligonucleotides with 1 μl Pfu DNA ligase (Stratagene, Amsterdam, NL), 10 μl 10× reaction buffer (supplied with enzyme) and 69 μl water. The reaction mix was placed in a thermal cycler for incubation at 95° C. for 2 minutes followed by 25 cycles of 95° C. for 30 seconds followed by gradual cooling to 60° then incubation at 60° C. for 20 minutes and a final incubation of 3 hours at 60° C. Typically, analysis of a sample of the LCR using 2% agarose gel electrophoresis gave smear with a faint band of correct size just visible. The oligonucleotides in all cases were from were from MWG-Biotech (Ebersberg, Germany) and were phosphorylated in vitro using T4 DNA kinase (Roche, Lewes, UK) and the suppliers recommended protocol. Following LCR, 5 μL of the reaction was transferred to a PCR mix to amplify the assembled fragment. Oligonucleotides OL373 and OL382 were used to drive the Vh reaction, with oligocucleotides OL392 and OL401 used to drive the Vk reaction. PCR was conducted in a total volume of 50 μl for 15 cycles using Taq DNA polymerase (Roche, Lewes, UK). The reaction was run on a 1% agarose gel and the desired band removed and purified using a Qiagen (Crawley, UK) DNA extraction kit. Products were direct cloned into the pGemT-easy vector (Promega, Southampton, UK) for sequence analysis. Several clones were sequenced until correct clones were obtained. Full-length immunoglobulin genes containing the variable region cassettes produced as described above were assembled using overlapping PCR. Briefly, DNA of the vectors M13-VHPCR1 and M13-VKPCR1 [Orlandi et al (1989), PNAS, 89: 3833-7] were used as templates to produce a further two overlapping PCR fragments for each Vh and Vk chains including 5′ flanking sequence with the murine heavy chain immunoglobulin promoter and encoding the leader signal peptide and 3′ flanking sequence including a splice site and intron sequences. The DNA fragments so produced for each Vh and Vk were combined in a PCR using flanking primers required to obtain full-length DNA sequences. The primer pairs used in these “linking” reactions were oligonucleotides OL411/OL413 and OL414/OL415 for the Vh gene, whereas for the Vk gene, the oligonucleotides OL411/OL412 and OL411/OL401 were used.
The heavy chain gene complete with 5′ and 3′ flanking sequences was cloned into the expression vector pSVgpt [Reichmann et al (1988) Nature, 332: 323] which includes the human IgG1 constant region domain [Takahashi et al (1982) Cell, 29: 671] and the gpt gene for selection in mammalian cells. The light chain gene complete with 5′ and 3′ flanking sequences was cloned into the expression vector pSVhyg [Reichmann et al ibid] in which the gpt gene is replaced by the gene for hygromycin resistance (hyg) and includes a human kappa constant region domain [Heiter et al (1980) Cell, 22: 197]. For both vectors, the fully assembled Vh or Vk genes were sub-cloned as HindIII/BamHI fragments purified by gel electrophoresis and handled using well known procedures and reagent systems.
| TABLE 2 |
| Synthetic oligonucleotides for Vh |
| SEQ | |||
| Name | Sequence | length | ID NO: |
| OL 373 | GAAGTGAAGCTGGAGGAGTCTGGAGGCGGC | 40 | 107 |
| TTGGTGCAAC | |||
| OL 374 | CTGGAGGCTCCATGAAACTCTCCTGTGTTG | 40 | 108 |
| CCTCTGGATT | |||
| OL 375 | CATTTTCAGTAACCACTGGATGAACTGGGT | 40 | 109 |
| CCGCCAGTCT | |||
| OL 376 | CCAGAGAAGGGGCTTGAGTGGGTTGCTGAA | 40 | 110 |
| ATTAGATCAA | |||
| OL 377 | AATCGATTAATTCTGCAACACATTATGCGG | 40 | 111 |
| AGTCTGTGAA | |||
| OL 378 | AGGGAGGTTCACCATCTCAAGAGATGATTC | 40 | 112 |
| CAAAAGTGCT | |||
| OL 379 | GTGTACCTGCAAATGACCGACCTGAGAACT | 40 | 113 |
| GAAGACACTG | |||
| OL 380 | GCGTTTATTACTGTTCCAGGAATTACTACG | 40 | 114 |
| GTAGTACCTA | |||
| OL 381 | CGACTACTGGGGCCAAGGCACCACTCTCAC | 42 | 115 |
| AGTGTCCTCAGG | |||
| OL 382 | CCTGAGGACACTGTGAGAGTGG | 22 | 116 |
| OL 383 | TGCCTTGGCCCCAGTAGTCGTAGGTACTAC | 40 | 117 |
| CGTAGTAATT | |||
| OL 384 | CCTGGAACAGTAATAAACGCCAGTGTCTTC | 40 | 118 |
| AGTTCTCAGG | |||
| OL 385 | TCGGTCATTTGCAGGTACACAGCACTTTTG | 40 | 119 |
| GAATCATCTC | |||
| OL 386 | TTGAGATGGTGAACCTCCCTTTCACAGACT | 40 | 120 |
| CCGCATAATG | |||
| OL 387 | TGTTGCAGAATTAATCGATTTTGATCTAAT | 40 | 121 |
| TTCAGCAACC | |||
| OL 388 | CACTCAAGCCCCTTCTCTGGAGACTGGCGG | 40 | 122 |
| ACCCAGTTCA | |||
| OL 389 | TCCAGTGGTTACTGAAAATGAATCCAGAGG | 40 | 123 |
| CAACACAGGA | |||
| OL 390 | GAGTTTCATGGAGCCTCCAGGTTGCACCAA | 40 | 124 |
| GCCGCCTCCA | |||
| OL 391 | |
20 | 125 |
| OL 413 | AGACTCCTCCAGCTTCACTTCGGAGTGGAC | 42 | 126 |
| ACCTGTGGAGAG | |||
| OL 414 | ACCACTCTCACAGTGTCCTCAGGTGAGTCC | 42 | 127 |
| TTACAACCTCTC | |||
| OL 415 | |
24 | 128 |
| TABLE 3 |
| Synthetic oligonucleotides for Vk |
| SEQ | |||
| Name | Sequence | length | ID NO: |
| OL 392 | GACATCTTGCTGACTCAGTCTCCAGCCATC | 40 | 129 |
| CTGTCTGTGA | |||
| OL 393 | GTCCAGGAGAAAGAGTCAGTTTCTCCTGCA | 40 | 130 |
| GGGCCAGTCA | |||
| OL 394 | GTTCGTTGGCTCAAGCATCCACTGGTATCA | 40 | 131 |
| GCAAAGAACA | |||
| OL 395 | AATGGTTCTCCAAGGCTTCTCATAAAGTAT | 40 | 132 |
| GCTTCTGAGT | |||
| OL 396 | CTATGTCTGGCATCCCTTCTAGATTTAGTG | 40 | 133 |
| GCAGTGGATC | |||
| OL 397 | AGGGACAGATTTTACTCTTAGCATCAACAC | 40 | 134 |
| TGTGGAGTCT | |||
| OL 398 | GAAGATATTGCAGATTATTACTGTCAACAA | 40 | 135 |
| AGTCATAGCT | |||
| OL 399 | GGCCATTCACGTTCGGCTCGGGGACAAATT | 40 | 136 |
| TGGAAGTAAA | |||
| OL 400 | |
50 | 137 |
| AGTTGGATCCTGGCAGAGTC | |||
| OL 401 | |
30 | 138 |
| OL 402 | AGTTTAAATTCTACTCACGTTTTACTTCCA | 40 | 139 |
| AATTTGTCCC | |||
| OL 403 | CGAGCCGAACGTGAATGGCCAGCTATGACT | 40 | 140 |
| TTGTTGACAG | |||
| OL 404 | TAATAATCTGCAATATCTTCAGACTCCACA | 40 | 141 |
| GTGTTGATGC | |||
| OL 405 | TAAGAGTAAAATCTGTCCCTGATCCACTGC | 40 | 142 |
| CACTAAATCT | |||
| OL 406 | AGAAGGGATGCCAGACATAGACTCAGAAGC | 40 | 143 |
| ATACTTTATG | |||
| OL 407 | AGAAGCCTTGGAGAACCATTTGTTCTTTGC | 40 | 144 |
| TGATACCAGT | |||
| OL 408 | GGATGCTTGAGCCAACGAACTGACTGGCCC | 40 | 145 |
| TGCAGGAGAA | |||
| OL 409 | ACTGACTCTTTCTCCTGGACTCACAGACAG | 40 | 146 |
| GATGGCTGGA | |||
| OL 410 | |
20 | 147 |
| OL 411 | |
29 | 148 |
| OL 412 | AGACTGACTCAGCAAGATGTCGGAGTGGAC | 42 | 149 |
| ACCTGTGGAGAG | |||
Construction of Modified Antibody Vh and Vk Genes.
A modified Vk gene termed Vk1 containing the mutations L3Q, A9D, I10T, L11S, V13A, I58V, S74T, T77S, V78L, S80A, I83A, D85T and L104V was constructed by gene synthesis. Table 4 lists the oligonucleotides listed used in the assembly of Vk1. These oligonucleotides were used, together with OL393, OL394, OL395, OL400, OL401, OL403, OL405, OL407 and OL408 (see example 3 above) in a gene synthesis reaction as to previously. The gene was cloned into the pGEM-T easy vector (Promega) and several clones were sequenced until a correct clone was obtained. Assembly of the full-length immunoglobulin gene and sub-cloning to the expression vector was as per example 3 with the exception that oligonucleotides OL411 and OL469 were used in the linking reaction for the Vk gene.
Additional mutations were introduced in the Vk gene to make further variant Vk genes. These mutations comprised: V19A, Q38H, R39T, S100G, N103K, V106I. The mutagenesis was conducted by PCR using the oligonucleotides listed in table 5. OL768 and OL769, OL770 and OL771 were used in overlap PCR, in combination with OL411 and OL401 (see above). OL648 was used in a single PCR in combination with OL411. The PCR products were cloned into pGEM-T Easy (Promega) and a correct clone identified by sequencing.
Variant Vh genes were also constructed from the wild-type sequence using mutagenesis. Variant Vh genes comprising the substitutions K3Q, E5V, M18L, K19R, V23A, I28T, I51T, I56T, E64D, S79N, A80S, V81L, T86N, D87S, R89K, G94A, T115L and L116V were constructed. These mutations were introduced using the oligonucleotides listed in table 6. Briefly, each set of oligonucleotides was used in overlap PCR, in combination with OL411 and OL415. The PCR products were cloned into pGEM-T Easy (Promega) and a correct clone identified by sequencing.
The Vh or Vk domains were sub-cloned into the expression vectors as HindIII BamHI fragments as previously and variant antibodies expressed according to the method detailed as example 5.
| TABLE 4 |
| Synthetic oligonucleotides for Vk1 assembly |
| SEQ | |||
| Name | Sequence | length | ID NO: |
| OL 459 | GACATCCAGCTGACTCAGTCTCCAGACACC | 40 | 150 |
| TCCTCTGCCA | |||
| OL 460 | CTATGTCTGGCGTGCCTTCTAGATTTAGTG | 40 | 151 |
| GCAGTGGATC | |||
| OL 461 | AGGGACAGATTTTACTCTTACCATCAACTC | 40 | 152 |
| CCTGGAGGCC | |||
| OL 462 | GAAGATGCCGCAACCTATTACTGTCAACAA | 40 | 153 |
| AGTCATAGCT | |||
| OL 463 | GGCCATTCACGTTCGGCTCGGGGACAAATG | 40 | 154 |
| TGGAAGTAAA | |||
| OL 464 | AGTTTAAATTCTACTCACGTTTTACTTCCA | 40 | 155 |
| CATTTGTCCC | |||
| OL 465 | TAATAGGTTGCGGCATCTTCGGCCTCCAGG | 40 | 156 |
| GAGTTGATGG | |||
| OL 466 | AGAAGGCACGCCAGACATAGACTCAGAAGC | 40 | 157 |
| ATACTTTATG | |||
| OL 467 | ACTGACTCTTTCTCCTGGACTGGCAGAGGA | 40 | 158 |
| GGTGTCTGGA | |||
| OL 468 | |
20 | 159 |
| OL 469 | AGACTGAGTCAGCTGGATGTCGGAGTGGAC | 42 | 160 |
| ACCTGTGGAGAG | |||
| TABLE 5 |
| Synthetic oligonucleotides for Vk mutageneis |
| SEQ | |||
| Name | Sequence | length | ID NO: |
| OL 648 | GGATCCAACTGAGGAAGCAAAGTTTAAATT | 80 | 161 |
| CTACTCACGTTTGATTTCCACCTTTGTCCC | |||
| GCCGCCGAACGTGAATGGCC | |||
| OL 768 | |
33 | 162 |
| AGG | |||
| OL 769 | |
33 | 163 |
| ACT | |||
| OL 770 | |
35 | 164 |
| TCCAA | |||
| OL 771 | |
35 | 165 |
| AGTGG | |||
| TABLE 6 |
| Synthetic oligonucleotides for Vh mutagenesis |
| SEQ | |||
| Name | Sequence | length | ID NO: |
| OL 642 | |
62 | 166 |
| CGCCTCCAGACTCCACCAGCTGCACTTCGG | |||
| AG | |||
| OL 643 | |
62 | 167 |
| CTGCCTCTGGATTCACTTTCAGTAACCACT | |||
| GG | |||
| OL 644 | AGGCTGTTCATTTGCAGGTACAGAGAATTT | 41 | 168 |
| TTGGAATCATC | |||
| OL 645 | |
50 | 169 |
| GACACTGCCGTTTATTACTG | |||
| OL 654 | |
30 | 170 |
| OL 655 | |
30 | 171 |
| OL 656 | CACATTATGCGGACTCTGTGAAAGGG | 26 | 172 |
| OL 657 | CCCTTTCACAGAGTCCGCATAATGTG | 26 | 173 |
| OL 658 | |
30 | 174 |
| OL 659 | |
30 | 175 |
| OL 899 | |
31 | 176 |
| G | |||
| OL 900 | |
31 | 177 |
| C | |||
Expression, Purification and Quantitation of Anti-TNF Alpha Antibodies
The heavy and light chain expression vectors were co-transfected using electroporation into NS/0, a non-immunoglobulin producing mouse myeloma, obtained from the European Collection of Animal Cell Cultures (ECACC). Colonies expressing the gpt to gene were selected in Dulbecco's Modified Eagles Medium (DMEM) supplemented with 10% (v/v) foetal calf serum and antibiotics (all from Gibco, Paisley, UK) and with 0.8 μg/ml mycophenolic acid and 250 μg/ml xanthine (Sigma, Poole, UK).
Production of human antibody by transfected cell clones was measured by ELISA for human IgG [Tempest et al (1991) BioTechnology 9: 266]. Cell lines secreting antibody were expanded and antibody purified by protein A affinity chromatography [Harlow E. Lane D.; in Antibodies a Laboratory Manual, pp 309; Cold Spring Harbor Laboratory Press (1988), NY, USA].
The concentration of the purified antibody was determined using an ELISA detecting the human kappa constant region of the antibodies of interest. A standard concentration curve was determined for a commercial preparation of the therapeutic antibody infliximab (Schering-Plough Ltd, UK) and the standard used to compute the concentration of the test to antibody preparation. The assay was conducted in 96-well plates and all determinations were conducted in duplicate.
For the assay, plates (Dynatech Immulon 2) were coated using 100 μl per well sheep anti-human κ antibody (The Binding Site, Birmingham, UK) diluted 1:250 in carbonate/bicarbonate coating buffer pH9.6 (Sigma, Poole, UK). Coating was conducted for 1 hour at 37° C. and the wells washed 3 times with PBST (PBS with 0.05% Tween 20). The wells were filled with 100 μL of PBST and the dilutions for the control and test antibodies set out. The negative control uses PBST only and no antibody was added. The standard preparation (infliximab) was diluted 1:1000 (v/v) and a doubling dilution series set out across the plate. Doubling dilution series were also set out for the test antibody preparations. The plate was incubated at room temperature for 1 hour and the wells washed as previously. Bound antibody was detected using a peroxidase conjugated sheep ant-human IgG γ chain specific reagent (The Binding Site, Birmingham, UK). This secondary antibody was diluted 1:1000 in PBST and 100 μl added to each well of the plate. The plate was incubated for a further 1 hour at room temperature and washed as previously. Detection was achieved using 100 ul per well “Sigmafast” peroxidase substrate (Sigma, Poole, UK) and the colour development stopped by addition of 40 ul per well 1M sulphuric acid. The optical density was read using a plate reader at 492 nm. A standard curve of antibody concentration versus A492 was plotted for the control antibody and the concentration of the test antibody determined by comparison with the standard.
Protection of TNF Alpha Sensitive Cells in Vitro by TNF Alpha Neutralisation Using Modified Antibodies
The ability of anti-TNF alpha antibodies to neutralise the lethal effect of TNF alpha on a cell line grown in vitro was tested using the scheme provided by Galloway [Galloway et al. 1991 J. Immunol. Meth. 140:37-43]. The assay uses the murine fibrosarcoma cell line WEHI164, a line which is very sensitive to the lethal effect of TNF alpha.
For the assay, cells were grown overnight in the presence of a fixed, lethal concentration of TNF alpha and a range of different antibody concentrations. The next day, the metabolic activity of cells was measured as an indication of survival. Antibodies that neutralise TNF alpha confer a protective effect to the cells and thereby a greater metabolic activity is measured in the assay.
WEHI164 were obtained from the European Collection of Animal Cell Cultures (ECACC #. 8702250) and grown in DMEM medium with Glutamax, (Gibco, Paisley, UK), 10% foetal calf serum (Perbio, Chester, UK) and containing antibiotic-mycotic (Gibco). On the day prior to assay, cells are sub-cultured to ensure active proliferation during the subsequent assay period. The assay was conducted in 96 well plates in duplicate for all treatments. Plates were prepared to contain dilutions of control antibody, test antibody and negative control with no antibody. Typically, doubling dilution series of the antibodies were arranged across a plate starting from a concentration of 10 μg/ml antibody in a volume of 50 μl. A stock solution of TNF alpha (PeproTech EC Ltd, London, UK) at 50 μg/ml in medium containing 4 μg/ml of actinomycin was prepared and added to the treatment wells. The TNF alpha solution was mixed by gently tapping the plate and the plate incubated for at least two hours at room temperature before the prepared solutions were transferred to the assay plate containing the cells.
The assay plate was prepared by seeding 2.5×104 cells in 50 μl per well and incubating for at least 1 hour at 37° C., 5% CO2. Following this, 50 μl of the TNF alpha/antibody mixture or control preparation was transferred from the plate used to dilute out the various treatments. The cell and treatment mixtures were mixed by gently tapping the plate and the plate incubated overnight at 37° C. in a humidified atmosphere containing 5% CO2. Next day, the metabolic activity of the cells in each well was assessed using a “CellTiter 96 Aqueous One Solution Cell Proliferation Assay” (Promega, Southampton, UK). Following addition of the assay solution, the plates were incubated for a further 90 minutes and the absorbance of the solutions in each well was read using a plate reader at 492 nm. The absorbance figures are plotted versus antibody concentration. In all assays the positive control preparation was a sample of the therapeutic antibody infliximab (Schering-Plough Ltd, UK), which in this assay consistently demonstrates significant TNF alpha neutralisation at concentrations of less than 0.1 μg/ml. Similarly the modified antibody of the present invention consistently demonstrated a protective effect in this assay equivalent to the positive control preparation. FIG. 2 shows an example plot from this assay.
Neutralisation of TNF Alpha Stimulated Production of ICAM-1 by Human Endothelial Cells in Vitro.
The ability of anti-TNF alpha antibodies to neutralise TNF alpha stimulated production in human umbilical vein endothelial (HUVE) cells of membrane bound ICAM-1, was tested in an in vitro assay. Briefly, HUVE cells are grown in a 96-well plate in the presence of TNF alpha and varying concentrations of test or control antibody. The quantitative relative expression of membrane bound ICAM-1 is subsequently assessed by cell lysis and an enzyme linked immunoabsorbance assay (ELISA) using a commercially available ICAM-1 detection system.
For the assay, two parallel sets of 96 well plates are prepared. One set, termed the “assay plate”, is seeded with cells, the other, termed the “preparation plate”, is used to prepare the dilutions of TNF alpha and the test and control antibody solutions. The contents of the preparation plate are ultimately transferred to the assay plate. All assays are conducted in duplicate.
For the assay plate, HUVE cells (Cambrex Bio Science, Wokingham, UK) were seeded at a density of 5×104 cells per well in a volume of 50 μl. The cells were allowed to adhere to the plate by incubation at 37° C., 5% CO2 for at least 2 hours.
For the preparation plate, doubling dilution series of the test and positive control antibody were set out in duplicate across the plate. The starting concentration for the antibodies was 20 μg/ml in a final volume of 100 μl/well. The negative control received no antibody. A solution of 40 ng/ml TNF alpha (PeproTech EC Ltd, London, UK) in medium was prepared and 100 μl per well added to each of the treatment wells on the preparation plate. The plate was mixed by gentle tapping and incubated for 45 minutes at room temperature. Following this incubation, 50 μl from each well of the preparation plate was added to its corresponding well in the assay plate. The assay plate was incubated for 23 hours at 37° C. in a humidified atmosphere containing 5% CO2.
Next day, the medium from all wells was removed and the cells washed once with phosphate buffered saline (PBS). The cells were lysed and the lysate assayed for the presence of ICAM-1. Lysis was achieved by incubation at 4° C. for 45 minutes in 80 μl lysis buffer. Lysis buffer comprised 8.7 μl NaCl, 6.05 g/l Tris 0.5%(v/v) NP40, at pH to 8.0. Lysis buffer also contained protease inhibitors PMSF, iodoacetamide and benzamide at 100 mM concentration and pepsatin A and leupeptin at 50 mM and 5 mM concentrations respectively. These inhibitors were added fresh to the lysis buffer preparation at time of use.
The well contents were mixed using a micropipette before removing the lysate to a fresh round-bottom 96 well plate. The plate was spun to clear precipitated cell debris and the cleared lysate removed to a further fresh 96 well plate for storage, (−20° C.) or immediate assay.
For assay, 20 μl of cleared lysate was analyzed for the presence of solubilized ICAM-1 using a commercial ELISA system (sICAM-1 Module set; Bender Medsystems, Towcester, UK) and conditions recommended by the supplier. The absorbance of the solutions in each well was read using a plate reader at 492 nm. The absorbance figures were plotted versus antibody concentration. In all assays the positive control preparation was a sample of the therapeutic antibody infliximab (Schering-Plough ltd), which in this assay consistently demonstrates significant TNF alpha neutralisation at concentrations of less than 1 g/ml. Similarly the modified antibody of the present invention consistently demonstrates a concentration dependent inhibition ICAM-1 expression equivalent to the positive control preparation. FIG. 3 shows an example plot from this assay.
Competition Assay of Modified Antibodies for Binding to TNF Alpha
The ability of the modified antibodies of the present invention to compete with the TNF alpha receptor (RII, p75) is measured in a competition ELISA, based on Siegel et al [Siegel et al. (1995) Cytokine 7(1):15-25]. ELISA plates were coated with the receptor (TNF alpha RII-Fc) and incubated with a mixture of a fixed amount of biotinylated TNF alpha and a doubling dilution series of the antibody. Binding of TNF alpha to the receptor was measured by colourimetric assay using a Streptavidin-HRP conjugate. The assay was conducted using Immulon 2HB 96 well plates, (Fisher, Loughborough, UK) prepared by coating overnight at 4° C. with 5 μg/ml TNF alpha RII-Fc (R&D Systems, Abingdon, UK) in carbonate coating buffer. A volume 50 μl was applied to each well of the plate. The coated plates were washed at least five times with PBS-0.05% (v/v)Tween 20, (PBS-T) and blocked by addition of a solution of 1% (v/v) BSA in PBS-T and further incubation at room temperature for at least one hour.
During this incubation, a dilution plate was set up in which the test antibody and control reagents were set out. Typically a doubling dilution series starting at a concentration of 50 μg/ml in a final volume of 50 μl/well was used for each test antibody. Controls included non-TNF alpha binding antibody as a negative, and a preparation of clinical grade Infliximab (Schering-Plough ltd, UK) as the positive. Control antibodies were of the same isotype as the test antibodies. Following addition of the antibodies, 50 μl per well of a solution of 50 ng/ml biotin-TNF alpha was added and the plate mixed by gentle tapping. The TNF alpha was a commercially sourced product as previously (Peprotech, London, UK) and biotinylated using EZ link Sulfo-NHS-biotin (Perbio, Tattenhall, UK) and the suppliers recommended protocol.
The blocking solution was removed from the assay plate and the plate washed as previously. 50 μl from each well of the dilution plate was added to the relevant well of the assay plate and following mixing, the assay plate incubated for at least one hour at room temperature. Following incubation, the plate was washed and 100 μl of a diluted Streptavidin-HRP (Sigma, Poole, UK) reagent added to all wells of the plate. The plate was further incubated for at least one hour at room temperature and washed as previously. The assay is disclosed using Sigma-fast OPD tablets (Sigma, Poole, UK), 100 μl/well and the colour reaction stopped by adding 50 μl per well 1M Sulphuric acid. The plate was read and the results plotted as antibody concentration versus absorbance at 492 nm. FIG. 4 shows an example plot from this assay. The preferred antibody of the present invention shows a concentration dependent competition curve for TNF alpha binding equivalent to that for the positive control antibody in this assay.
Inhibition of TNF Alpha Induced Up-Regulation of IL-6 in Hs 27 Cells
Human foreskin fibroblast cells can be induced to produce IL-6 by exposure to TNF alpha. The ability of the modified antibodies of the present invention to block this up-regulation of expression was assessed by co-incubation of the cells with TNF alpha and the test antibodies, followed by a determination of the subsequent IL-6 levels secreted into the medium using a commercially available IL-6 detection system.
For the assay, two parallel sets of 96 well plates are prepared. One set, termed the “assay plate”, is seeded with cells, the other, termed the “preparation plate”, is used to prepare the dilutions of TNF alpha and the test and control antibody solutions. The contents of the preparation plate are ultimately transferred to the assay plate. All assays are conducted in duplicate.
For the assay plate, human foreskin fibroblast cells Hs 27, obtained from the European Collection of Animal Cell Cultures (ECACC no. 94041901), were seeded at a density of 2×104 cells per well and the cells allowed to adhere to the plate by overnight incubation at 37° C. in a humidified atmosphere containing 5% CO2. The culture medium throughout was DMEM+Glutamax (Gibco, Paisley, UK) containing 10% foetal calf serum (Perbio, Chester, UK) and a conventional antibiotic/mycotic preparation (Gibco).
For the preparation plate, doubling dilution series of the test and positive control antibody were set out in duplicate across the plate. The starting concentration for the antibodies was 1.25 μg/ml in a final volume of 100 μl/well. The negative control received no antibody. A solution of 3 ng/ml TNF alpha (PeproTech EC Ltd., London) was added to all antibody-containing wells, for the control wells with no antibody, an additional 100 μl/well of medium is added. The plate was mixed by gentle tapping and incubated at room temperature for at least 30 minutes.
Medium was removed from the assay plate containing the Hs 27 cells and 10 μl from each well of the preparation plate was transferred to the relevant well of the assay plate. The plate was mixed by gentle tapping and incubated for at least 18 hours at 37° C. in a humidified atmosphere containing 5% CO2. Following incubation, the medium was removed from each well to a fresh U-bottomed 96 well plate for storage at −20° C. or immediate assay.
The medium was analysed for the presence of IL-6 using a commercial ELISA system (IL-6 Module set; Bender Medsystems, Towcester, UK) and conditions recommended by the supplier. For assay, 50 μl of medium was diluted 1:15 (v/v). The absorbance of the solutions in each well was read using a plate reader at 492 nm. The absorbance figures were plotted versus antibody concentration. In all assays the positive control preparation was a sample of the therapeutic antibody infliximab (Schering-Plough ltd, UK). The preferred modified antibody of the present invention consistently demonstrates a concentration dependent inhibition IL-6 expression. FIG. 9 shows an example plot from this assay.
Detection of TNF Alpha
A simple plate ELISA was used to confirm the ability of the modified antibody of the present invention to bind TNF alpha. The assay was conducted in comparison with a preparation of the therapeutic antibody Infliximab (Schering-Plough ltd, UK) as positive control and a non-TNF alpha binding human IgG preparation (Sigma I2511) as a negative control. The assay was conducted using the method detailed below and demonstrates that the preferred composition (Vh5/Vk12) of the present invention has equal efficacy to the control antibody in this assay. A typical binding curve is depicted as FIG. 7 . Immulon 2HB 96 well plates, (Fisher, Loughborough, UK) were coated overnight at 4° C. with 2.5 μg/ml TNF alpha (Peprotech, London, UK) in carbonate coating buffer. A volume of 50 μl was applied to each well of the plate. The coated plates were washed three times with PBS-0.05% (v/v)Tween 20, (PBS-T).
A doubling dilution series of each antibody was prepared and applied in a volume of 100 μl per well, each in duplicate. The highest antibody concentration was 1 μg/ml. Plates were incubated for 1 hour at room temperature and washed as previously with PBST. To detect bound antibody, plates were incubated with a Mouse-anti human IgG-HRP conjugate (Sigma, Poole, UK) preparation diluted 1/1000 in PBST. Incubation was for at least 90 minutes at room temperature. The plates were again washed as previously using PBST and the bound antibody disclosed using 100 μl/well of Sigma-Fast OPD. The color was allowed to develop for 5 minutes and the reaction stopped by addition of 40 μl/well of 1M H2SO4. The plates were read at 492 nm and the data plotted as concentration of antibody versus the optical density. FIG. 7 shows a representative binding curve indicating functional equivalence in this assay between the modified antibody (Vh5/Vk12) and the positive control.
Demonstration of Reduced Immunogenic Potential in Modified Anti-TNF Alpha Antibody Using Human PBMC in Vitro Proliferation Assay.
The modified antibody was prepared according to the method of example 5. Positive control (challenge antibody) was clinical grade infliximab (Schering-Plough ltd, UK). For T cell proliferation assays 4×106 PBMC (per well) from healthy donors were incubated with unmodified and modified antibodies in 2 ml bulk cultures (in 24 well plates). Each donor was treated with modified and unmodified antibodies at 5 and 50 μg/ml. In addition an untreated control bulk culture was maintained enabling stimulation indexes to be determined. At days 5, 6, 7 and 8 cells for each bulk culture were gently agitated and 50 μl samples removed in triplicate for determination of the proliferation index. The 50 μl sample aliquots were each transferred to 3 wells of a U-bottom 96 well plate. Fresh AIM V media (130□l) was added to each of the 96 wells. Cells were pulsed (for 18-21 hours) with 1 μCi [3H]Thymidine per well diluted in a total volume of 20 ul AIM V media. The total volume for each culture was 200 μl. CPM values were collected using a beta-plate reader and the stimulation index for each time point determined as per example 2 above.
The SI was plotted for each time point and antibody treatment. A significant SI was taken as >2.0. In responsive donors, treatment with infliximab results in a significant proliferative response with a peak at day 7. In the same donors, treatment with the modified antibody composition (Vh5/Vk12) of the present invention does not result in a significant proliferative response. This result indicates a reduced immunogenic potential in the preferred antibody composition of the present compared with the parental antibody. A representative plot from this assay is provided in FIG. 10 .
Claims (4)
1. A modified monoclonal anti-TNF alpha antibody that is substantially non-immunogenic or less immunogenic than any non-modified antibody having essentially the same biological specificity when used in vivo, and comprising specific amino acid residues having alterations in the V-region of its heavy and/or light chain compared with the non-modified parental antibody, wherein said alterations cause a reduction or an elimination of the number of peptide sequences within said V-region, which act in the parental antibody as MHC class II binding ligands and stimulate T-cells, the parental antibody being infliximab, wherein the modified monoclonal anti-TNF alpha antibody comprises, a heavy chain variable region consisting of SEQ ID NO: 3 and a light chain variable region consisting of SEQ ID NO: 6.
2. The modified antibody of claim 1 , wherein the constant region domains derive from human IgG1 and human kappa.
3. The modified antibody according to claim 1 , wherein when tested as a whole protein in a biological assay of induced cellular proliferation of human T-cells exhibits a stimulation index smaller than the parental antibody tested in parallel using cells from the same donor wherein said index is taken as the value of cellular proliferation scored following stimulation by the protein and divided by the value of cellular proliferation scored in control cells not in receipt of protein and wherein cellular proliferation is measured by any suitable means.
4. A pharmaceutical composition comprising the modified anti-TNF alpha antibody as defined in claim 1 , together with a pharmaceutically acceptable carrier, diluent or excipient.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US11/005,726 US7754853B2 (en) | 2001-11-12 | 2004-12-07 | TNF alpha-binding polypeptide compositions and methods |
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP01126858 | 2001-11-12 | ||
| EP01126858.8 | 2001-11-12 | ||
| PCT/EP2002/012566 WO2003042247A2 (en) | 2001-11-12 | 2002-11-11 | Modified anti-tnf alpha antibody |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US11/005,726 Continuation-In-Part US7754853B2 (en) | 2001-11-12 | 2004-12-07 | TNF alpha-binding polypeptide compositions and methods |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| US20040260069A1 US20040260069A1 (en) | 2004-12-23 |
| US7524502B2 true US7524502B2 (en) | 2009-04-28 |
Family
ID=8179220
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US10/495,146 Expired - Fee Related US7524502B2 (en) | 2001-11-12 | 2002-11-11 | Modified anti-TNF alpha antibody |
| US11/005,726 Expired - Fee Related US7754853B2 (en) | 2001-11-12 | 2004-12-07 | TNF alpha-binding polypeptide compositions and methods |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US11/005,726 Expired - Fee Related US7754853B2 (en) | 2001-11-12 | 2004-12-07 | TNF alpha-binding polypeptide compositions and methods |
Country Status (17)
| Country | Link |
|---|---|
| US (2) | US7524502B2 (en) |
| EP (1) | EP1448602B1 (en) |
| JP (1) | JP4304073B2 (en) |
| KR (1) | KR20050044405A (en) |
| CN (1) | CN1585778A (en) |
| AT (1) | ATE469176T1 (en) |
| AU (1) | AU2002351957B2 (en) |
| BR (1) | BR0213565A (en) |
| CA (1) | CA2466592A1 (en) |
| DE (1) | DE60236536D1 (en) |
| ES (1) | ES2346517T3 (en) |
| HU (1) | HUP0402333A3 (en) |
| MX (1) | MXPA04004417A (en) |
| PL (1) | PL369739A1 (en) |
| RU (1) | RU2004117915A (en) |
| WO (1) | WO2003042247A2 (en) |
| ZA (1) | ZA200404626B (en) |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2011038301A2 (en) | 2009-09-25 | 2011-03-31 | Xoma Technology Ltd. | Screening methods |
| US8574855B2 (en) | 2009-10-26 | 2013-11-05 | Nestec S.A. | Assays for the detection of anti-TNF drugs and autoantibodies |
| US8658171B2 (en) | 2011-02-28 | 2014-02-25 | Livzon Mabpharm Inc. | Humanized anti-TNFα antibodies |
| US9465027B2 (en) | 2011-07-06 | 2016-10-11 | Nestec S.A. | Assays for detecting neutralizing autoantibodies to biologic therapy |
| US9784748B2 (en) | 2010-10-18 | 2017-10-10 | Nestec S.A. | Methods for determining anti-drug antibody isotypes |
| US10422807B2 (en) | 2014-12-05 | 2019-09-24 | Precision Ibd, Inc. | Indirect homogeneous mobility shift assays for the detection of biologics in patient samples |
| US10668167B2 (en) | 2016-06-02 | 2020-06-02 | Abbvie Inc. | Glucocorticoid receptor agonist and immunoconjugates thereof |
| US10772970B2 (en) | 2017-12-01 | 2020-09-15 | Abbvie Inc. | Glucocorticoid receptor agonist and immunoconjugates thereof |
| US12371488B2 (en) | 2009-09-25 | 2025-07-29 | Xoma (Us) Llc | Modulators |
Families Citing this family (29)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2002505574A (en) * | 1997-04-30 | 2002-02-19 | エンゾン,インコーポレイテッド | Polyalkylene oxide-modified single-chain polypeptides |
| US20040009166A1 (en) * | 1997-04-30 | 2004-01-15 | Filpula David R. | Single chain antigen-binding polypeptides for polymer conjugation |
| US7101978B2 (en) | 2003-01-08 | 2006-09-05 | Applied Molecular Evolution | TNF-α binding molecules |
| US8147832B2 (en) * | 2003-08-14 | 2012-04-03 | Merck Patent Gmbh | CD20-binding polypeptide compositions and methods |
| US7264806B2 (en) | 2003-11-01 | 2007-09-04 | Biovation Ltd. | Modified anti-CD52 antibody |
| US7435799B2 (en) | 2004-01-08 | 2008-10-14 | Applied Molecular Evolution | TNF-α binding molecules |
| GB0425713D0 (en) | 2004-11-23 | 2004-12-22 | Baker Matthew | Immunogencity testing and antibody selection methods |
| KR101385886B1 (en) | 2005-02-03 | 2014-04-24 | 안티토페 리미티드 | Human antibodies and proteins |
| EP1869192B1 (en) * | 2005-03-18 | 2016-01-20 | MedImmune, LLC | Framework-shuffling of antibodies |
| KR20080029963A (en) * | 2005-05-12 | 2008-04-03 | 아테뉴온, 엘엘씨 | Inflammatory Bowel Disease Treatment Using Angiogenesis Inhibitory Compounds |
| RU2464276C2 (en) | 2005-05-18 | 2012-10-20 | Аблинкс Н.В. | Improved nanobodies against tumour necrosis factor-alpha |
| SI1919951T1 (en) | 2005-08-04 | 2015-05-29 | Janssen Biotech, Inc. | Anti-tnf-alpha antibodies and methods of use |
| EP2450368A1 (en) * | 2007-01-30 | 2012-05-09 | Epivax, Inc. | Regulatory t cell epitopes, compositions and uses thereof |
| WO2008157776A2 (en) | 2007-06-21 | 2008-12-24 | Angelica Therapeutics, Inc. | Modified diphtheria toxins |
| WO2009110944A1 (en) | 2008-02-29 | 2009-09-11 | Angelica Therapeutics, Inc. | Modified toxins |
| JP5767708B2 (en) * | 2010-09-30 | 2015-08-19 | ツェンドゥー カンホン バイオテクノロジーズ カンパニー リミテッド | Humanized anti-human tumor necrosis factor α (TNF-α) antibody and antigen-binding fragment (Fab) thereof and method of use thereof |
| NZ610267A (en) | 2010-10-08 | 2015-05-29 | Hope City | A monoclonal antibody framework binding interface for meditopes, meditope delivery systems and methods for their use |
| US8962804B2 (en) | 2010-10-08 | 2015-02-24 | City Of Hope | Meditopes and meditope-binding antibodies and uses thereof |
| CN102675460B (en) * | 2011-02-28 | 2015-08-19 | 珠海市丽珠单抗生物技术有限公司 | The humanized antibody of Tumor necrosis factorα |
| US9428553B2 (en) | 2012-02-10 | 2016-08-30 | City Of Hope | Meditopes and meditope-binding antibodies and uses thereof |
| JP2016519651A (en) | 2013-03-15 | 2016-07-07 | アンジェリカ セラピューティックス,インク. | Modified toxin |
| JP6545666B2 (en) * | 2013-05-28 | 2019-07-17 | ディーシービー−ユーエスエー エルエルシーDcb−Usa Llc | Antibody locker for protein drug inactivation |
| RU2556816C1 (en) * | 2014-03-12 | 2015-07-20 | Открытое акционерное общество "Фармацевтический импорт, экспорт" (ОАО "Фармимэкс") | Strain of cells of chinese hamster ovaries - producer of recombinant antibody against tumour necrosis factor alpha of human being |
| CN105820246A (en) * | 2015-01-07 | 2016-08-03 | 上海张江生物技术有限公司 | Method for preparing novel recombinant anti-TNF alpha chimeric monoclonal antibody and application thereof |
| US10947305B2 (en) | 2015-03-20 | 2021-03-16 | Full Spectrum Genetics, Inc. | Anti-TNFα binding compounds and uses thereof |
| WO2020206149A2 (en) * | 2019-04-05 | 2020-10-08 | The Regents Of The University Of California | Methods and compositions involving chimeric binding polypeptides |
| CN111909267B (en) * | 2019-05-07 | 2022-03-25 | 北京天成新脉生物技术有限公司 | Low-immunogenicity anti-TNF-alpha humanized monoclonal antibody TCX063 and its application |
| GB202004916D0 (en) * | 2020-04-02 | 2020-05-20 | Univ Oxford Innovation Ltd | Antibodies |
| WO2024254381A2 (en) * | 2023-06-08 | 2024-12-12 | Xentria, Inc. | Methods for detecting a neutralizing antibody (nab) against an anti-tnf alpha antibody |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5712120A (en) * | 1994-06-30 | 1998-01-27 | Centro De Immunologia Molecular | Method for obtaining modified immunoglobulins with reduced immunogenicity of murine antibody variable domains, compositions containing them |
| US5919452A (en) * | 1991-03-18 | 1999-07-06 | New York University | Methods of treating TNFα-mediated disease using chimeric anti-TNF antibodies |
Family Cites Families (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IL162181A (en) * | 1988-12-28 | 2006-04-10 | Pdl Biopharma Inc | A method of producing humanized immunoglubulin, and polynucleotides encoding the same |
| US6277969B1 (en) * | 1991-03-18 | 2001-08-21 | New York University | Anti-TNF antibodies and peptides of human tumor necrosis factor |
| EP0610201B2 (en) * | 1991-03-18 | 2007-09-26 | New York University | Monoclonal and chimeric antibodies specific for human tumor necrosis factor |
| US5519000A (en) * | 1994-04-01 | 1996-05-21 | Centecor, Inc. | Tumor necrosis factor inhibitors |
| ATE319745T1 (en) * | 1997-05-21 | 2006-03-15 | Biovation Ltd | METHOD FOR PRODUCING NON-IMMUNOGENIC PROTEINS |
| US6835550B1 (en) * | 1998-04-15 | 2004-12-28 | Genencor International, Inc. | Mutant proteins having lower allergenic response in humans and methods for constructing, identifying and producing such proteins |
| AU776910B2 (en) * | 1998-12-08 | 2004-09-23 | Merck Patent Gesellschaft Mit Beschrankter Haftung | Modifying protein immunogenicity |
| AU1456101A (en) * | 1999-11-03 | 2001-05-14 | Maxygen, Inc. | Antibody diversity generation |
| UA81743C2 (en) * | 2000-08-07 | 2008-02-11 | Центокор, Инк. | HUMAN MONOCLONAL ANTIBODY WHICH SPECIFICALLY BINDS TUMOR NECROSIS FACTOR ALFA (TNFα), PHARMACEUTICAL MIXTURE CONTAINING THEREOF, AND METHOD FOR TREATING ARTHRITIS |
| EP1366455B1 (en) * | 2001-02-19 | 2008-07-02 | MERCK PATENT GmbH | Method for identification of t-cell epitopes and use for preparing molecules with reduced immunogenicity |
-
2002
- 2002-11-11 HU HU0402333A patent/HUP0402333A3/en unknown
- 2002-11-11 JP JP2003544082A patent/JP4304073B2/en not_active Expired - Fee Related
- 2002-11-11 AT AT02787636T patent/ATE469176T1/en not_active IP Right Cessation
- 2002-11-11 ES ES02787636T patent/ES2346517T3/en not_active Expired - Lifetime
- 2002-11-11 AU AU2002351957A patent/AU2002351957B2/en not_active Ceased
- 2002-11-11 DE DE60236536T patent/DE60236536D1/en not_active Expired - Lifetime
- 2002-11-11 CN CNA028223578A patent/CN1585778A/en active Pending
- 2002-11-11 RU RU2004117915/13A patent/RU2004117915A/en not_active Application Discontinuation
- 2002-11-11 KR KR1020047007141A patent/KR20050044405A/en not_active Withdrawn
- 2002-11-11 CA CA002466592A patent/CA2466592A1/en not_active Abandoned
- 2002-11-11 EP EP02787636A patent/EP1448602B1/en not_active Expired - Lifetime
- 2002-11-11 MX MXPA04004417A patent/MXPA04004417A/en not_active Application Discontinuation
- 2002-11-11 PL PL02369739A patent/PL369739A1/en unknown
- 2002-11-11 BR BR0213565-5A patent/BR0213565A/en not_active IP Right Cessation
- 2002-11-11 US US10/495,146 patent/US7524502B2/en not_active Expired - Fee Related
- 2002-11-11 WO PCT/EP2002/012566 patent/WO2003042247A2/en active Application Filing
-
2004
- 2004-06-10 ZA ZA200404626A patent/ZA200404626B/en unknown
- 2004-12-07 US US11/005,726 patent/US7754853B2/en not_active Expired - Fee Related
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5919452A (en) * | 1991-03-18 | 1999-07-06 | New York University | Methods of treating TNFα-mediated disease using chimeric anti-TNF antibodies |
| US5712120A (en) * | 1994-06-30 | 1998-01-27 | Centro De Immunologia Molecular | Method for obtaining modified immunoglobulins with reduced immunogenicity of murine antibody variable domains, compositions containing them |
Non-Patent Citations (7)
| Title |
|---|
| Colman P. M., Research in Immunology, 145:33-36, 1994. * |
| Deavin et al., Mol lmmunol. Feb. 1996;33(2):145-55. * |
| Harold Chapman, Current Opinion in Immunology 1998, 10:93-102. * |
| Janeway et al., Immunobiology, 5th Ed., Garland Science, pp. 94-105 (2001). * |
| Mateo et al., Hybridoma. Dec. 2000;19(6):463-71. * |
| Rudikoff et al, Proc. Natl. Acad. Sci. USA, 79:1979-1883, Mar. 1982. * |
| Vajdos et al., J Mol Biol. Jul. 5, 2002;320(2):415-28. * |
Cited By (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2011038301A2 (en) | 2009-09-25 | 2011-03-31 | Xoma Technology Ltd. | Screening methods |
| US12371488B2 (en) | 2009-09-25 | 2025-07-29 | Xoma (Us) Llc | Modulators |
| EP3187877A1 (en) | 2009-09-25 | 2017-07-05 | XOMA Technology Ltd. | Screening methods |
| US8865417B2 (en) | 2009-10-26 | 2014-10-21 | Nestec S.A. | Assays for the detection of anti-TNF drugs and autoantibodies |
| US9506920B2 (en) | 2009-10-26 | 2016-11-29 | Nestec S.A. | Assays for the detection of anti-TNF drugs and autoantibodies |
| US8574855B2 (en) | 2009-10-26 | 2013-11-05 | Nestec S.A. | Assays for the detection of anti-TNF drugs and autoantibodies |
| US9784748B2 (en) | 2010-10-18 | 2017-10-10 | Nestec S.A. | Methods for determining anti-drug antibody isotypes |
| US8658171B2 (en) | 2011-02-28 | 2014-02-25 | Livzon Mabpharm Inc. | Humanized anti-TNFα antibodies |
| US9465027B2 (en) | 2011-07-06 | 2016-10-11 | Nestec S.A. | Assays for detecting neutralizing autoantibodies to biologic therapy |
| US10794906B2 (en) | 2011-07-06 | 2020-10-06 | Prometheus Biosciences, Inc. | Assays for detecting neutralizing autoantibodies to biologic therapy |
| US10422807B2 (en) | 2014-12-05 | 2019-09-24 | Precision Ibd, Inc. | Indirect homogeneous mobility shift assays for the detection of biologics in patient samples |
| US11846642B2 (en) | 2014-12-05 | 2023-12-19 | Prometheus Laboratories Inc. | Indirect homogeneous mobility shift assays for the detection of biologics in patient samples |
| US10668167B2 (en) | 2016-06-02 | 2020-06-02 | Abbvie Inc. | Glucocorticoid receptor agonist and immunoconjugates thereof |
| US10772970B2 (en) | 2017-12-01 | 2020-09-15 | Abbvie Inc. | Glucocorticoid receptor agonist and immunoconjugates thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| RU2004117915A (en) | 2005-05-10 |
| JP2005510216A (en) | 2005-04-21 |
| EP1448602A2 (en) | 2004-08-25 |
| AU2002351957B2 (en) | 2009-09-03 |
| US20040260069A1 (en) | 2004-12-23 |
| WO2003042247A3 (en) | 2004-03-11 |
| EP1448602B1 (en) | 2010-05-26 |
| ATE469176T1 (en) | 2010-06-15 |
| DE60236536D1 (en) | 2010-07-08 |
| US20060018903A1 (en) | 2006-01-26 |
| PL369739A1 (en) | 2005-05-02 |
| CN1585778A (en) | 2005-02-23 |
| HUP0402333A3 (en) | 2007-05-02 |
| ES2346517T3 (en) | 2010-10-18 |
| ZA200404626B (en) | 2005-10-26 |
| CA2466592A1 (en) | 2003-05-22 |
| JP4304073B2 (en) | 2009-07-29 |
| US7754853B2 (en) | 2010-07-13 |
| HUP0402333A2 (en) | 2005-02-28 |
| MXPA04004417A (en) | 2004-08-11 |
| WO2003042247A2 (en) | 2003-05-22 |
| BR0213565A (en) | 2004-10-26 |
| KR20050044405A (en) | 2005-05-12 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US7524502B2 (en) | Modified anti-TNF alpha antibody | |
| AU2002351957A1 (en) | Modified anti-TNF alpha antibody | |
| JP4804357B2 (en) | Modified anti-CD52 antibody | |
| KR102256152B1 (en) | Pd-1 antibody, antigen-binding fragment thereof, and medical use thereof | |
| US8597648B2 (en) | Fully human anti-TNF-alpha monoclonal antibody, preparation method and use thereof | |
| CN109414500A (en) | PD-L1-specific monoclonal antibodies for therapy and diagnosis | |
| CN107660150A (en) | The associated proteins of IL 18 (IL 18BP) and antibody are in inflammatory disease | |
| WO2004041863A2 (en) | Single domain antibodies directed against interferon- gamma and uses therefor | |
| EP1558646A2 (en) | Single domain antibodies directed against interferon- gamma and uses thereof | |
| CN104822704A (en) | Humanized antibodies to cluster of differentiation 3 (CD3) | |
| US12269890B2 (en) | Humanized anti-human OX40 monoclonal antibody, preparation method therefor and use thereof | |
| CA3194384A1 (en) | Caninized rat antibodies to canine interleukin-31 receptor alpha | |
| CN112125975A (en) | PD-L1 and CD47 bispecific fusion protein and medical application thereof | |
| JP6742237B2 (en) | Human anti-IFN-alpha antibody | |
| CN114591434A (en) | anti-Siglec 15 antibody and preparation method and application thereof | |
| US20060034833A1 (en) | Single domain antibodies directed against interferron-gamma and uses therefor | |
| ZA200803817B (en) | Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor | |
| KR101525919B1 (en) | Bispecific antibody based on TNFR2 for preventing and traeating autoimmune disease | |
| CN105061596B (en) | The monoclonal antibody and its application of human B lymphocyte stimulating factor | |
| CN118459587A (en) | Anti-CD 47 antibodies and uses thereof | |
| CN114269788B (en) | Molecule capable of binding with human 4-1BB and application thereof | |
| Kaur | Overview of monoclonal antibodies | |
| TW202227504A (en) | Anti-erbb3 antibody, antigen binding fragment thereof and medical use thereof | |
| CN118388648B (en) | A human PD-L1 antibody based on fully human antibody mice and its preparation method and application | |
| WO2025124266A1 (en) | Bispecific antibody and use thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: MERCK PATENT GMBH, GERMANY Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:HELLENDOORN, KOEN;BAKER, MATTHEW;CARR, FRANCIS J.;REEL/FRAME:015826/0020 Effective date: 20040304 |
|
| CC | Certificate of correction | ||
| REMI | Maintenance fee reminder mailed | ||
| LAPS | Lapse for failure to pay maintenance fees | ||
| STCH | Information on status: patent discontinuation |
Free format text: PATENT EXPIRED DUE TO NONPAYMENT OF MAINTENANCE FEES UNDER 37 CFR 1.362 |
|
| FP | Lapsed due to failure to pay maintenance fee |
Effective date: 20130428 |