US5698671A - Metalloproteinase peptides - Google Patents
Metalloproteinase peptides Download PDFInfo
- Publication number
- US5698671A US5698671A US08/284,721 US28472194A US5698671A US 5698671 A US5698671 A US 5698671A US 28472194 A US28472194 A US 28472194A US 5698671 A US5698671 A US 5698671A
- Authority
- US
- United States
- Prior art keywords
- metalloproteinases
- tcci
- peptide
- peptides
- inhibitor
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Lifetime
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims description 27
- 102000004196 processed proteins & peptides Human genes 0.000 title claims description 16
- 102000005741 Metalloproteases Human genes 0.000 title abstract description 19
- 108010006035 Metalloproteases Proteins 0.000 title abstract description 19
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 21
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 16
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract 3
- 239000000443 aerosol Substances 0.000 claims description 2
- 238000002513 implantation Methods 0.000 claims description 2
- 238000002360 preparation method Methods 0.000 claims description 2
- 230000001225 therapeutic effect Effects 0.000 claims description 2
- 239000000203 mixture Substances 0.000 claims 5
- 239000002671 adjuvant Substances 0.000 claims 1
- 239000003937 drug carrier Substances 0.000 claims 1
- 239000008188 pellet Substances 0.000 claims 1
- 239000000843 powder Substances 0.000 claims 1
- 235000018102 proteins Nutrition 0.000 abstract description 15
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 abstract description 8
- 238000001042 affinity chromatography Methods 0.000 abstract description 5
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 abstract description 3
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 abstract description 3
- 206010003246 arthritis Diseases 0.000 abstract description 3
- 210000002744 extracellular matrix Anatomy 0.000 abstract description 3
- 230000001575 pathological effect Effects 0.000 abstract description 3
- 239000007790 solid phase Substances 0.000 abstract description 3
- 206010028980 Neoplasm Diseases 0.000 abstract description 2
- 230000004071 biological effect Effects 0.000 abstract 1
- 230000015556 catabolic process Effects 0.000 abstract 1
- 238000006731 degradation reaction Methods 0.000 abstract 1
- 238000004519 manufacturing process Methods 0.000 abstract 1
- 230000009826 neoplastic cell growth Effects 0.000 abstract 1
- 238000002560 therapeutic procedure Methods 0.000 abstract 1
- 239000003112 inhibitor Substances 0.000 description 21
- 150000001413 amino acids Chemical group 0.000 description 10
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 9
- 102000002274 Matrix Metalloproteinases Human genes 0.000 description 8
- 108010000684 Matrix Metalloproteinases Proteins 0.000 description 8
- 201000010099 disease Diseases 0.000 description 8
- 210000004881 tumor cell Anatomy 0.000 description 7
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 210000004027 cell Anatomy 0.000 description 6
- 239000002442 collagenase inhibitor Substances 0.000 description 6
- 235000018417 cysteine Nutrition 0.000 description 6
- 230000002401 inhibitory effect Effects 0.000 description 6
- 210000001519 tissue Anatomy 0.000 description 6
- 101000645291 Bos taurus Metalloproteinase inhibitor 2 Proteins 0.000 description 5
- 229940122097 Collagenase inhibitor Drugs 0.000 description 5
- 101000669513 Homo sapiens Metalloproteinase inhibitor 1 Proteins 0.000 description 5
- 102100039364 Metalloproteinase inhibitor 1 Human genes 0.000 description 5
- 235000001014 amino acid Nutrition 0.000 description 5
- 239000003636 conditioned culture medium Substances 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 239000003475 metalloproteinase inhibitor Substances 0.000 description 5
- 210000002966 serum Anatomy 0.000 description 5
- 102000004190 Enzymes Human genes 0.000 description 4
- 108090000790 Enzymes Proteins 0.000 description 4
- 230000000694 effects Effects 0.000 description 4
- 229940088598 enzyme Drugs 0.000 description 4
- 201000001441 melanoma Diseases 0.000 description 4
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 3
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 3
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 3
- 239000001110 calcium chloride Substances 0.000 description 3
- 229910001628 calcium chloride Inorganic materials 0.000 description 3
- 230000006378 damage Effects 0.000 description 3
- 230000004054 inflammatory process Effects 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 238000000034 method Methods 0.000 description 3
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- 238000012163 sequencing technique Methods 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- IEQAICDLOKRSRL-UHFFFAOYSA-N 2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-dodecoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethanol Chemical compound CCCCCCCCCCCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO IEQAICDLOKRSRL-UHFFFAOYSA-N 0.000 description 2
- HRPVXLWXLXDGHG-UHFFFAOYSA-N Acrylamide Chemical compound NC(=O)C=C HRPVXLWXLXDGHG-UHFFFAOYSA-N 0.000 description 2
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 2
- 108010026132 Gelatinases Proteins 0.000 description 2
- 102000013382 Gelatinases Human genes 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- 102000000380 Matrix Metalloproteinase 1 Human genes 0.000 description 2
- 108010016113 Matrix Metalloproteinase 1 Proteins 0.000 description 2
- 206010027476 Metastases Diseases 0.000 description 2
- 108010030544 Peptidyl-Lys metalloendopeptidase Proteins 0.000 description 2
- 229920002684 Sepharose Polymers 0.000 description 2
- 108010005246 Tissue Inhibitor of Metalloproteinases Proteins 0.000 description 2
- 102000005876 Tissue Inhibitor of Metalloproteinases Human genes 0.000 description 2
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 2
- 206010064996 Ulcerative keratitis Diseases 0.000 description 2
- 230000029936 alkylation Effects 0.000 description 2
- 238000005804 alkylation reaction Methods 0.000 description 2
- 230000001363 autoimmune Effects 0.000 description 2
- 230000004888 barrier function Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 238000001962 electrophoresis Methods 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 238000004366 reverse phase liquid chromatography Methods 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- 238000000108 ultra-filtration Methods 0.000 description 2
- 230000008728 vascular permeability Effects 0.000 description 2
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 102000029816 Collagenase Human genes 0.000 description 1
- 108060005980 Collagenase Proteins 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 208000022461 Glomerular disease Diseases 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 206010018691 Granuloma Diseases 0.000 description 1
- 208000004852 Lung Injury Diseases 0.000 description 1
- 102000000422 Matrix Metalloproteinase 3 Human genes 0.000 description 1
- 101710170181 Metalloproteinase inhibitor Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- BQCADISMDOOEFD-UHFFFAOYSA-N Silver Chemical compound [Ag] BQCADISMDOOEFD-UHFFFAOYSA-N 0.000 description 1
- 206010069363 Traumatic lung injury Diseases 0.000 description 1
- 208000025865 Ulcer Diseases 0.000 description 1
- 101000998548 Yersinia ruckeri Alkaline proteinase inhibitor Proteins 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 210000004381 amniotic fluid Anatomy 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 230000002788 anti-peptide Effects 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 210000000709 aorta Anatomy 0.000 description 1
- 210000002469 basement membrane Anatomy 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000005540 biological transmission Effects 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 230000009400 cancer invasion Effects 0.000 description 1
- 230000004856 capillary permeability Effects 0.000 description 1
- 210000000845 cartilage Anatomy 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 230000004709 cell invasion Effects 0.000 description 1
- 238000001311 chemical methods and process Methods 0.000 description 1
- 230000003366 colagenolytic effect Effects 0.000 description 1
- 229960002424 collagenase Drugs 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 210000002808 connective tissue Anatomy 0.000 description 1
- 229940124558 contraceptive agent Drugs 0.000 description 1
- 239000003433 contraceptive agent Substances 0.000 description 1
- 230000000593 degrading effect Effects 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 239000003889 eye drop Substances 0.000 description 1
- 229940012356 eye drops Drugs 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 230000003301 hydrolyzing effect Effects 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 230000004968 inflammatory condition Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000009545 invasion Effects 0.000 description 1
- 231100000515 lung injury Toxicity 0.000 description 1
- 206010025135 lupus erythematosus Diseases 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 210000001161 mammalian embryo Anatomy 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 210000004379 membrane Anatomy 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- 229940126170 metalloproteinase inhibitor Drugs 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- 210000004400 mucous membrane Anatomy 0.000 description 1
- 201000006938 muscular dystrophy Diseases 0.000 description 1
- 208000010125 myocardial infarction Diseases 0.000 description 1
- 210000000107 myocyte Anatomy 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 230000000683 nonmetastatic effect Effects 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 230000003169 placental effect Effects 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 238000003751 purification from natural source Methods 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 210000002345 respiratory system Anatomy 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- 239000000523 sample Substances 0.000 description 1
- 239000012723 sample buffer Substances 0.000 description 1
- 201000000306 sarcoidosis Diseases 0.000 description 1
- 229910052709 silver Inorganic materials 0.000 description 1
- 239000004332 silver Substances 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 238000003746 solid phase reaction Methods 0.000 description 1
- 238000010530 solution phase reaction Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 108091007196 stromelysin Proteins 0.000 description 1
- 238000011287 therapeutic dose Methods 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 231100000397 ulcer Toxicity 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
- 239000011701 zinc Substances 0.000 description 1
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/81—Protease inhibitors
- C07K14/8107—Endopeptidase (E.C. 3.4.21-99) inhibitors
- C07K14/8146—Metalloprotease (E.C. 3.4.24) inhibitors, e.g. tissue inhibitor of metallo proteinase, TIMP
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the invention relates to isolated proteins or peptides useful in metalloproteinase inhibition. Specifically, the invention relates to a novel protein, isolated from the conditioned media of cultured human tumor cells which binds with high affinity to metalloproteinase enzymes and analogs thereof. The natural protein is defined by the presence of specific cysteine-containing amino acid sequences. The invention further relates to a novel means of purifying metalloproteinase inhibitors using metalloproteinase affinity chromatography.
- Matrix metalloproteinases are a family of neutral metalloenzymes capable of degrading extracellular matrix macromolecules. All require a metal ion (calcium and/or zinc) for hydrolytic activity, and all are secreted in the latent pre-enzyme form. Members of this family which have been isolated and characterized include interstitial fibroblast collagenase, stromelysin, and type IV collagenase. Other potential members include a poorly characterized 94,000 dalton gelatinase and several low molecular weight gelatinases and telopeptidases.
- the matrix metalloproteinases are thought to play an important role in disease processes characterized by the inappropriate destruction of the extracellular matrix. These diseases include inflammatory processes such as rheumatoid arthritis and other autoimmune disorders, tumor cell invasion and metastases formation, and corneal ulceration. Many tissues contain natural inhibitors of the matrix metalloproteinases. In many cases, this inhibitory activity is derived from the antiproteases in plasma, particularly ⁇ 2 -macroglobulin and ⁇ 1 -anticollagenase. ⁇ 2 -Macroglobulin is a high molecular weight (725,000) inhibitor present in serum. It is thought to account for 95% of the collagenolytic inhibitory activity present in serum.
- ⁇ 2 -macroglobulin may enter the tissue compartment and play a role in the regulation of matrix metalloproteinases.
- the mechanism of inhibition of the matrix metalloproteinases by ⁇ 2 -macroglobulin has not been directly studied. However, it is thought to be similar to the mechanism that causes inhibition of other proteases. Hence, the mechanism is not believed to be unique for the matrix metalloproteinases.
- ⁇ 1 -Anticollagenase is approximately 40,000 daltons in size. It accounts for approximately 5% of the metalloproteinase inhibiting activity of serum. This inhibitor is thought to pass the vascular permeability barrier and be widely distributed in the tissue compartments.
- ⁇ 1 -Anticollagenase may be related to another group of natural inhibitors of the matrix metalloproteinases referred to as TIMPs, tissue inhibitors of metalloproteinase.
- TIMP is a 28,000 dalton protein which was originally isolated from rabbit bone culture and has subsequently been identified in human connective tissues, serum and amniotic fluid (Welgus and Stricklin, 1983, J. Biol. Chem. 258: 12259-12264). This inhibitor is a glycoprotein and specifically inhibits interstitial collagenase on a 1:1 stoichiometric basis. Reduction and alkylation of TIMP abolishes all inhibitory activity. Reduction of TIMP mRNA levels has been associated with the acquisition of the metastatic phenotype in previously nonmetastatic cell lines (Khokha et al., 1989, Science 243: 947-950).
- Another class of biologically active collagenase inhibitors is composed of low molecular weight (>10,000 daltons) cationic proteins isolated from cartilage aorta and teeth, but which are poorly characterized.
- FIG. 1 Gel Electrophoresis of Purified Tumor Cell Collagenase Inhibitor.
- Tumor cell collagenase inhibitor was purified by affinity chromatography of A2058 human melanoma cell conditioned media on type IV collagenase-gelatin sepharose, as shown in FIG. 1A. The material eluted from this column was then further purified by reverse phase high performance liquid chromatography using a 0.45 ⁇ 10-cm RP 300 column (Pierce Chemical Co.), as shown in FIG. 1B. 10 ⁇ l of the tumor cell collagenase inhibitor peak was heated with sample buffer containing ⁇ mercaptoethanol before electrophoresis on a 15% acrylamide gel. Following electrophoresis, the sample was silver stained to visualize the proteins.
- FIG. 2 Sequence of human Tumor Cell Collagenase Inhibitor (TCCI) and Homology to Tissue Inhibitors of Metalloproteinase (TIMP).
- TCCI Tumor Cell Collagenase Inhibitor
- Tissue Inhibitors of Metalloproteinase Tissue Inhibitors of Metalloproteinase
- the bottom line shows the novel sequence of the invention obtained from direct amino acid sequencing of the protein and endoproteinase Lys-C peptides. The sequence information obtained is aligned (top line) with the known sequence of TIMP to demonstrate scattered homology and conservation of the cysteine residues.
- the novel sequences of the TCCI indicate that it is a product of a separate gene distinct from the gene which encodes TIMP.
- the inhibitors may be obtained from natural sources, may be produced by synthetic means such as the Merrifield process, or by genetically engineered organisms or cell lines.
- the inhibitors of the invention may be used to treat disease conditions which result from activity of metalloproteases. Furthermore, since metalloprotease activity is essential to the implantation of the Zygote, these inhibitors are useful as contraceptives.
- the present invention is a isolated novel metalloproteinase inhibitor distinct from previous inhibitors mentioned above.
- the invention is a novel protein of approximately 23,000 daltons which binds to metalloproteinases and can be isolated using affinity chromatography on solid phase purified metalloproteinases.
- the amino acid sequence of the isolated protein shows that it is a new gene product not previously discovered and has areas of sequence homology with the known natural tissue inhibitor of metalloproteinases (TIMP).
- a new inhibitor was discovered in serum-conditioned media of a human A2058 melanoma cell line. This cell line is available from the American Tissue Culture Collection. The inhibitor was isolated and purified by means described below. It was discovered that the metalloprotease inhibitor of the invention contained a unique amino acid sequence but also contained a cysteine residue at the same intervals as the previously described tissue inhibitor of metalloproteinase protein (TIMP) previously described in European patent 189,784. Analogs of the natural inhibitor of the invention can be made by preparing peptides and proteins having cysteines at the same intervals as the cysteines in the natural inhibitor. Other amino acids may vary from the pattern of the natural inhibitor so long as the cysteine is located at the appropriate intervals. At least two appropriately spaced cysteines must be present in the peptide to ensure inhibitory activity by virtue of a disulfide bridge formation.
- TRIP tissue inhibitor of metalloproteinase protein
- the fragments derived from the natural TCCI molecule were used as immunogens. Antibodies to the fragments can be used to detect the natural inhibitor in serum.
- Particularly preferred peptides are those having at least 3 cysteines.
- Tumor cell collagenase inhibitor was purified from the serum-free conditioned media of the human A2058 melanoma cell line.
- the media was collected, filter sterilized by passing through a 0.22 ⁇ filter, and stored frozen at -20° C.
- the media was thawed and concentrated over a YM 30 ultrafiltration membrane (Amicon Co.) at 4° C.
- the concentrated conditioned media was passed through a gelatin sepharose affinity column (1 ⁇ 10 cm) previously equilibrated in 0.5M NaCl, 0.05M Tris HCl, 0.01M CaCl 2 , 0.02% Brij 35, pH 7.5. After loading, the column was washed exhaustively with this same buffer.
- the column was then eluted using 0.5M NaCl, 0.05M Tris HCl, 0.01M CaCl 2 , 0.02% Brij 35, 10% dimethyl sulfoxide, pH 7.5.
- the eluted material was rapidly concentrated and the buffer exchanged for 0.15M NaCl, 0.05M Tris HCl, 0.01M CaCl 2 , pH 7.5 by ultrafiltration using a YM 30 membrane (Amicon). This material was aliquoted and stored frozen at -70° C. Further purification was achieved by reverse phase chromatography over a 0.45 ⁇ 10 cm RP 300 column (Pierce Chemical Co.) equilibrated in 0.1% trifluoroacetic acid.
- the column was eluted with a linear gradient to 60% acetonitrile.
- this material was electrophoresed under reducing conditions on a 15% acrylamide gel, a single band of protein was identified with an apparent molecular weight of 23,000 daltons, purified TCCI (see FIG. 1).
- the purified TCCI material was subjected to direct amino acid sequencing following reduction and alkylation (Stetler-Stevenson et al., 1989, J. Biol. Chem. 264: 1353-1356, 1989). This yielded the unique amino terminal amino acids (peptide 1-40) of TCCI which are shown in FIG. 2.
- TCCI The purified TCCI was also treated with endoproteinase Lys-C to generate a limited proteolytic digest. These TCCI peptides were again purified by reverse phase chromatography prior to amino acid sequencing. Additional unique sequences obtained from the peptides 56-79, 93-152 and 162-196 are also shown in FIG. 2.
- TCCI shows scattered homology with TIMP, particularly with respect to the conservation of the position of the cysteine residues, all of the TCCI peptides are distinctly different from TIMP.
- the peptides of the invention are encoded by a gene different from that which encodes TIMP.
- Synthetic peptides were prepared using the sequence from the amino terminal portion of the TCCI molecule. These were coupled to bovine serum albumin for use in generating anti-peptide antibodies by standard methods. The antibodies were affinity purified using solid phase peptide-affinity chromatography as previously described (Stetler-Stevenson et al., 1989, J. Biol. Chem. 264: 1353-1356, 1989). These antibodies are reactive on standard western and immunoblots.
- the isolated, purified TCCI and analogs can be used therapeutically in those diseases characterized by the uncontrolled activity of matrix metalloproteinases.
- diseases include arthritis diabetes, cancer, ulcers of mucosa and epithelial tissues, autoimmune mediated inflammation, lung injury, granulomatous diseases.
- Other therapeutic benefit might also be obtained in diseases with basement membrane destruction such as lupus, autoimmune neural disorders, myocyte destruction such as myodystrophies, myocardial infarct and glomerulopathies.
- TCCI could also be used as a potential birth control methodology by preventing embryo/placental attachment or invasion.
- metalloproteinase inhibitors of the invention When metalloproteinase inhibitors of the invention are used in the treatment of inappropriate angiogenesis, arthritis, tumor growth, invasion and metastasis, and granulomatous inflammatory conditions such as sarcoidosis and other pathological conditions, it is possible to estimate the amount of enzyme produced and the amount of peptide inhibitor required to inhibit greater than 90% of the active enzyme.
- the therapeutic dose of the inhibitory peptide falls within an acceptable pharmacologic range of 1-250 mg/kg/da, with a more preferred dosage being 25-100 mg/kg/d.
- the dosage for a given patient will depend on the amount of enzyme produced in the patient, the condition and size of the patient.
- the inhibitors may be given as infusions or by any means which provides ready transmission into the circulation.
- Lyophilized powders may be "snorted". Preparations for buccal or sublingual administration may also be given.
- the peptides may be administered by inhalation. Aerosols are particularly useful for this purpose.
- the peptides may be administered as eye drops.
- the isolated TCCI proteins, natural or recombinant, or active peptides derived therefrom can be administered intravenously, orally, intrauterine, by inhalation or topical application.
- a topical application can be prepared using a suitable carrier for treatment of basal cell carcinomas or melanomas of the skin or for the treatment of corneal ulceration.
- the complete TCCI protein or TCCI peptides can be produced by purification from natural sources, by synthetic peptide chemistry methods, or by recombinant DNA technology. In the latter case, suitable cDNA clones for TCCI in a suitable expression vector can be used to produce peptides with TCCI activity.
- TCCI peptides and antibodies to TCCI are also useful in diagnosis of diseases characterized by abnormal balances of metalloproteinase/inhibitor ratios.
- Purified TCCI may be used by virtue of its ability to bind metalloproteinases as a means to purify and or detect metalloproteinases from any natural source.
- Suitable immunoassays for TCCI could include anti-TCCI antibodies, reference TCCI antigen and solid or solution phase reactions.
- Purified TCCI or peptide domains of TCCI can be tagged with suitable enzymatic, fluorescent or radioactive labels by means well known in the art.
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
Inappropriate degradation of extracellular matrix molecules by metalloproteinases plays an important role in a wide variety of pathologic conditions including neoplasia and arthritis. The present invention is an isolated protein of approximately 23,000 daltons in size which binds to metalloproteinases with high affinity, can be purified using affinity chromatography on solid phase metalloproteinases, and is potentially useful for therapy of pathologic conditions involving the inappropriate production of metalloproteinases. This protein is characterized by the presence of the following amino acid sequences:
CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNPIYGNNI
KDIEFIYTAPSEAVCGVELDVEGK
KRHITLCDFIVPWDTLSTTQKKSLNHRYQQGCEECKITRCPMIPCYISSPDECLWTDTVV
KFFACIKRHITLCDFIVPWSQIADXLSS
With the positions of the cysteine residues and associated disulfide bridges required for biologic activity.
Description
This is a Continuation of application of Ser. No. 08/075,855, filed Jun. 10, 1993, now abandoned, which is a continuation of application Ser. No. 07/837,102 filed Feb. 19, 1992, now abandoned, which is a continuation of application Ser. No. 07/326,334, filed on Mar. 21, 1989, now abandoned.
The invention relates to isolated proteins or peptides useful in metalloproteinase inhibition. Specifically, the invention relates to a novel protein, isolated from the conditioned media of cultured human tumor cells which binds with high affinity to metalloproteinase enzymes and analogs thereof. The natural protein is defined by the presence of specific cysteine-containing amino acid sequences. The invention further relates to a novel means of purifying metalloproteinase inhibitors using metalloproteinase affinity chromatography.
Matrix metalloproteinases are a family of neutral metalloenzymes capable of degrading extracellular matrix macromolecules. All require a metal ion (calcium and/or zinc) for hydrolytic activity, and all are secreted in the latent pre-enzyme form. Members of this family which have been isolated and characterized include interstitial fibroblast collagenase, stromelysin, and type IV collagenase. Other potential members include a poorly characterized 94,000 dalton gelatinase and several low molecular weight gelatinases and telopeptidases.
The matrix metalloproteinases are thought to play an important role in disease processes characterized by the inappropriate destruction of the extracellular matrix. These diseases include inflammatory processes such as rheumatoid arthritis and other autoimmune disorders, tumor cell invasion and metastases formation, and corneal ulceration. Many tissues contain natural inhibitors of the matrix metalloproteinases. In many cases, this inhibitory activity is derived from the antiproteases in plasma, particularly α2 -macroglobulin and β1 -anticollagenase. α2 -Macroglobulin is a high molecular weight (725,000) inhibitor present in serum. It is thought to account for 95% of the collagenolytic inhibitory activity present in serum. Because of its large size, it is normally unable to pass the vascular permeability barrier under conditions of extreme inflammation in which there is increased capillary permeability, α2 -macroglobulin may enter the tissue compartment and play a role in the regulation of matrix metalloproteinases. The mechanism of inhibition of the matrix metalloproteinases by α2 -macroglobulin has not been directly studied. However, it is thought to be similar to the mechanism that causes inhibition of other proteases. Hence, the mechanism is not believed to be unique for the matrix metalloproteinases.
β1 -Anticollagenase is approximately 40,000 daltons in size. It accounts for approximately 5% of the metalloproteinase inhibiting activity of serum. This inhibitor is thought to pass the vascular permeability barrier and be widely distributed in the tissue compartments. β1 -Anticollagenase may be related to another group of natural inhibitors of the matrix metalloproteinases referred to as TIMPs, tissue inhibitors of metalloproteinase.
TIMP is a 28,000 dalton protein which was originally isolated from rabbit bone culture and has subsequently been identified in human connective tissues, serum and amniotic fluid (Welgus and Stricklin, 1983, J. Biol. Chem. 258: 12259-12264). This inhibitor is a glycoprotein and specifically inhibits interstitial collagenase on a 1:1 stoichiometric basis. Reduction and alkylation of TIMP abolishes all inhibitory activity. Reduction of TIMP mRNA levels has been associated with the acquisition of the metastatic phenotype in previously nonmetastatic cell lines (Khokha et al., 1989, Science 243: 947-950). Another class of biologically active collagenase inhibitors is composed of low molecular weight (>10,000 daltons) cationic proteins isolated from cartilage aorta and teeth, but which are poorly characterized.
FIG. 1: Gel Electrophoresis of Purified Tumor Cell Collagenase Inhibitor. Tumor cell collagenase inhibitor was purified by affinity chromatography of A2058 human melanoma cell conditioned media on type IV collagenase-gelatin sepharose, as shown in FIG. 1A. The material eluted from this column was then further purified by reverse phase high performance liquid chromatography using a 0.45×10-cm RP 300 column (Pierce Chemical Co.), as shown in FIG. 1B. 10 μl of the tumor cell collagenase inhibitor peak was heated with sample buffer containing βmercaptoethanol before electrophoresis on a 15% acrylamide gel. Following electrophoresis, the sample was silver stained to visualize the proteins.
FIG. 2: Sequence of human Tumor Cell Collagenase Inhibitor (TCCI) and Homology to Tissue Inhibitors of Metalloproteinase (TIMP). The bottom line shows the novel sequence of the invention obtained from direct amino acid sequencing of the protein and endoproteinase Lys-C peptides. The sequence information obtained is aligned (top line) with the known sequence of TIMP to demonstrate scattered homology and conservation of the cysteine residues. The novel sequences of the TCCI indicate that it is a product of a separate gene distinct from the gene which encodes TIMP.
It is the object of this invention to provide means of purifying natural inhibitors of metalloproteinase.
It is a further object of this invention to provide metalloproteinase inhibitors and derivatives thereof. The inhibitors may be obtained from natural sources, may be produced by synthetic means such as the Merrifield process, or by genetically engineered organisms or cell lines. The inhibitors of the invention may be used to treat disease conditions which result from activity of metalloproteases. Furthermore, since metalloprotease activity is essential to the implantation of the Zygote, these inhibitors are useful as contraceptives.
The present invention is a isolated novel metalloproteinase inhibitor distinct from previous inhibitors mentioned above. The invention is a novel protein of approximately 23,000 daltons which binds to metalloproteinases and can be isolated using affinity chromatography on solid phase purified metalloproteinases. The amino acid sequence of the isolated protein shows that it is a new gene product not previously discovered and has areas of sequence homology with the known natural tissue inhibitor of metalloproteinases (TIMP).
A new inhibitor was discovered in serum-conditioned media of a human A2058 melanoma cell line. This cell line is available from the American Tissue Culture Collection. The inhibitor was isolated and purified by means described below. It was discovered that the metalloprotease inhibitor of the invention contained a unique amino acid sequence but also contained a cysteine residue at the same intervals as the previously described tissue inhibitor of metalloproteinase protein (TIMP) previously described in European patent 189,784. Analogs of the natural inhibitor of the invention can be made by preparing peptides and proteins having cysteines at the same intervals as the cysteines in the natural inhibitor. Other amino acids may vary from the pattern of the natural inhibitor so long as the cysteine is located at the appropriate intervals. At least two appropriately spaced cysteines must be present in the peptide to ensure inhibitory activity by virtue of a disulfide bridge formation.
The fragments derived from the natural TCCI molecule were used as immunogens. Antibodies to the fragments can be used to detect the natural inhibitor in serum.
Particularly preferred peptides are those having at least 3 cysteines. An amino acid sequence containing the sequence CSCSPVHPQQAFCNA derived from the amino terminal of the molecule and a segment containing the amino acid sequence CPMIPCYISSPDECLWTDTVVKFFAC appear particularly active.
Tumor cell collagenase inhibitor (TCCI) was purified from the serum-free conditioned media of the human A2058 melanoma cell line. The media was collected, filter sterilized by passing through a 0.22μ filter, and stored frozen at -20° C. The media was thawed and concentrated over a YM 30 ultrafiltration membrane (Amicon Co.) at 4° C. The concentrated conditioned media was passed through a gelatin sepharose affinity column (1×10 cm) previously equilibrated in 0.5M NaCl, 0.05M Tris HCl, 0.01M CaCl2, 0.02% Brij 35, pH 7.5. After loading, the column was washed exhaustively with this same buffer. The column was then eluted using 0.5M NaCl, 0.05M Tris HCl, 0.01M CaCl2, 0.02 % Brij 35, 10% dimethyl sulfoxide, pH 7.5. The eluted material was rapidly concentrated and the buffer exchanged for 0.15M NaCl, 0.05M Tris HCl, 0.01M CaCl2, pH 7.5 by ultrafiltration using a YM 30 membrane (Amicon). This material was aliquoted and stored frozen at -70° C. Further purification was achieved by reverse phase chromatography over a 0.45×10 cm RP 300 column (Pierce Chemical Co.) equilibrated in 0.1% trifluoroacetic acid. The column was eluted with a linear gradient to 60% acetonitrile. When this material was electrophoresed under reducing conditions on a 15% acrylamide gel, a single band of protein was identified with an apparent molecular weight of 23,000 daltons, purified TCCI (see FIG. 1).
The purified TCCI material was subjected to direct amino acid sequencing following reduction and alkylation (Stetler-Stevenson et al., 1989, J. Biol. Chem. 264: 1353-1356, 1989). This yielded the unique amino terminal amino acids (peptide 1-40) of TCCI which are shown in FIG. 2.
The purified TCCI was also treated with endoproteinase Lys-C to generate a limited proteolytic digest. These TCCI peptides were again purified by reverse phase chromatography prior to amino acid sequencing. Additional unique sequences obtained from the peptides 56-79, 93-152 and 162-196 are also shown in FIG. 2.
These data show that while TCCI shows scattered homology with TIMP, particularly with respect to the conservation of the position of the cysteine residues, all of the TCCI peptides are distinctly different from TIMP. Thus, the peptides of the invention are encoded by a gene different from that which encodes TIMP. This demonstrates that TCCI is the product of a separate gene. Synthetic peptides were prepared using the sequence from the amino terminal portion of the TCCI molecule. These were coupled to bovine serum albumin for use in generating anti-peptide antibodies by standard methods. The antibodies were affinity purified using solid phase peptide-affinity chromatography as previously described (Stetler-Stevenson et al., 1989, J. Biol. Chem. 264: 1353-1356, 1989). These antibodies are reactive on standard western and immunoblots.
The isolated, purified TCCI and analogs can be used therapeutically in those diseases characterized by the uncontrolled activity of matrix metalloproteinases. Such diseases include arthritis diabetes, cancer, ulcers of mucosa and epithelial tissues, autoimmune mediated inflammation, lung injury, granulomatous diseases. Other therapeutic benefit might also be obtained in diseases with basement membrane destruction such as lupus, autoimmune neural disorders, myocyte destruction such as myodystrophies, myocardial infarct and glomerulopathies. TCCI could also be used as a potential birth control methodology by preventing embryo/placental attachment or invasion.
When metalloproteinase inhibitors of the invention are used in the treatment of inappropriate angiogenesis, arthritis, tumor growth, invasion and metastasis, and granulomatous inflammatory conditions such as sarcoidosis and other pathological conditions, it is possible to estimate the amount of enzyme produced and the amount of peptide inhibitor required to inhibit greater than 90% of the active enzyme. For use in treating any disease condition, the therapeutic dose of the inhibitory peptide falls within an acceptable pharmacologic range of 1-250 mg/kg/da, with a more preferred dosage being 25-100 mg/kg/d. The dosage for a given patient will depend on the amount of enzyme produced in the patient, the condition and size of the patient. The inhibitors may be given as infusions or by any means which provides ready transmission into the circulation. Lyophilized powders may be "snorted". Preparations for buccal or sublingual administration may also be given. For respiratory tract involvement, the peptides may be administered by inhalation. Aerosols are particularly useful for this purpose. For conditions of the eye, the peptides may be administered as eye drops.
The isolated TCCI proteins, natural or recombinant, or active peptides derived therefrom can be administered intravenously, orally, intrauterine, by inhalation or topical application. For example, a topical application can be prepared using a suitable carrier for treatment of basal cell carcinomas or melanomas of the skin or for the treatment of corneal ulceration.
The complete TCCI protein or TCCI peptides can be produced by purification from natural sources, by synthetic peptide chemistry methods, or by recombinant DNA technology. In the latter case, suitable cDNA clones for TCCI in a suitable expression vector can be used to produce peptides with TCCI activity.
TCCI peptides and antibodies to TCCI are also useful in diagnosis of diseases characterized by abnormal balances of metalloproteinase/inhibitor ratios. Purified TCCI may be used by virtue of its ability to bind metalloproteinases as a means to purify and or detect metalloproteinases from any natural source. Suitable immunoassays for TCCI could include anti-TCCI antibodies, reference TCCI antigen and solid or solution phase reactions. Purified TCCI or peptide domains of TCCI can be tagged with suitable enzymatic, fluorescent or radioactive labels by means well known in the art.
Claims (9)
1. A peptide derivable from TCCI having the amino acid sequence:
(i) CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNPIYGNNI
(ii) KDIEFIYTAPSEAVCGVELDVEGK
(iii) KRHITLCDFIVPWDTLSTTQKKSLNHRYQQGCEECKITRCPMIPCYISSPDECLWTDTVV or
(iv) KFFACIKRHITLCDFIVPWSQIADXLSS.
2. A peptide of claim 1 of the structure CSCSPVHPQQAFC.
3. A peptide of claim 1 consisting of the amino acid sequence CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNPIYGNNI.
4. A therapeutic preparation consisting of the isolated protein or peptides of claim 1 suspended in a pharmaceutically acceptable carrier.
5. A composition of matter which is a powder containing at least one peptide of claim 1.
6. A composition of matter which is at least one peptide of claim 1 in a carrier.
7. A composition of matter of claim 6 containing an adjuvant.
8. A composition of claim 6 which is an aerosol.
9. A composition of claim 6 which is a pellet suitable for intrauterine implantation.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US08/284,721 US5698671A (en) | 1989-03-21 | 1994-08-02 | Metalloproteinase peptides |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US32633489A | 1989-03-21 | 1989-03-21 | |
| US83710293A | 1993-02-19 | 1993-02-19 | |
| US7585593A | 1993-06-10 | 1993-06-10 | |
| US08/284,721 US5698671A (en) | 1989-03-21 | 1994-08-02 | Metalloproteinase peptides |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US7585593A Continuation | 1989-03-21 | 1993-06-10 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US5698671A true US5698671A (en) | 1997-12-16 |
Family
ID=27372758
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US08/284,721 Expired - Lifetime US5698671A (en) | 1989-03-21 | 1994-08-02 | Metalloproteinase peptides |
Country Status (1)
| Country | Link |
|---|---|
| US (1) | US5698671A (en) |
Cited By (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5990293A (en) * | 1996-09-05 | 1999-11-23 | Celltech Therapeutics Limited | Human metalloproteinase, variants thereof and DNA sequence coding therefor |
| WO2000054796A1 (en) * | 1999-03-18 | 2000-09-21 | Children's Medical Center Corporation | Novel antiangiogenic peptides |
| WO2002053173A3 (en) * | 2000-12-29 | 2003-04-10 | Kimberly Clark Co | Design and use of advanced zinc chelating peptides to regulate matrix metalloproteinases |
| US20030096757A1 (en) * | 2001-08-16 | 2003-05-22 | Kimberly-Clark Worldwide, Inc. | Anti-cancer and wound healing compounds |
| US20030119073A1 (en) * | 2001-12-21 | 2003-06-26 | Stephen Quirk | Sensors and methods of detection for proteinase enzymes |
| US6600057B2 (en) | 2000-12-29 | 2003-07-29 | Kimberly-Clark Worldwide, Inc. | Matrix metalloproteinase inhibitors |
| US20030148959A1 (en) * | 2001-08-16 | 2003-08-07 | Stephen Quirk | Anti-aging and wound healing compounds |
| US20030166567A1 (en) * | 2001-08-16 | 2003-09-04 | Kimberly-Clark Worldwide, Inc. | Anti-aging and wound healing compounds |
| US6673623B1 (en) | 2000-09-12 | 2004-01-06 | Novocure, Inc. | Methods and compositions that control lipid production |
| US20040127421A1 (en) * | 2002-12-30 | 2004-07-01 | Sohail Malik | Method to increase fibronectin |
| US20040259802A1 (en) * | 2003-06-20 | 2004-12-23 | Shu-Ping Yang | Anti-chrondrosarcoma compounds |
| US6849450B2 (en) * | 1989-05-19 | 2005-02-01 | Childrens Hospital Of Los Angeles | Antibodies to the metalloproteinase inhibitor |
| US7186693B2 (en) | 2001-08-16 | 2007-03-06 | Kimberly - Clark Worldwide, Inc. | Metalloproteinase inhibitors for wound healing |
| DE102009027374A1 (en) | 2009-07-01 | 2011-01-05 | Robert Bosch Gmbh | Exhaust gas sensor device, engine control device and method |
| WO2015073538A3 (en) * | 2013-11-12 | 2015-11-12 | Echogen, Inc. | Interaction with metalloenzymes |
| JP2016528236A (en) * | 2013-08-07 | 2016-09-15 | アスチュート メディカル,インコーポレイテッド | Assay for TIMP2 with improved performance in biological samples |
| US11718682B2 (en) | 2017-04-05 | 2023-08-08 | Astute Medical, Inc. | Assays for TIMP2 having improved performance in biological samples |
-
1994
- 1994-08-02 US US08/284,721 patent/US5698671A/en not_active Expired - Lifetime
Non-Patent Citations (16)
| Title |
|---|
| Article entitled "Cancer Metastasis and Angiogenesis: An Imbalane of Positive and Negative Regulation" by Liotta Lance A. et al. Cell vol. 64, pp. 327-336 Jan. 25, 1991. |
| Article entitled "Inhibition of Human Renin by Synthetic Peptides Derived from Its Prosegment" by Frederic Cumin et al. The Journal of Biological Chemistry vol. 260 No. 16, pp. 9154-9157. |
| Article entitled "Inhibition of Human Type IV Collagenase by a Highly Consvd . . . "by Stetler-Stevenson et al(NIH). |
| Article entitled "Inhibition of In Vitro Tumor Cell Invasion by Arg-Gly-Asp-containing Synthetic Peptides" by Kurt R. Gehlsen, et al. The Journal of Cell Biology, vol. 106, Mar. 1988 pp. 925-930. |
| Article entitled "Potent new inhibitors of human renin"Nature vol. 299 Oct. 7, 1982 by M.Szelke et al.pp.555-557. |
| Article entitled "Preferential Inhibition of 72 kDa and 92kDa Gelatinases by TIMP-2" by Eric W. Howard et al. submitted to Journal of Biological Chemistry No. 1, 1990 revised Mar. 12, 1991. |
| Article entitled "YIGSR, a synthetic Laminin Pentapeptide, Inhibits Experimental Metastasis Formation" by Yukihide Iwamoto, et al. Science, vol. 238 pp. 1132-1134 Nov. 1987. |
| Article entitled Cancer Metastasis and Angiogenesis: An Imbalane of Positive and Negative Regulation by Liotta Lance A. et al. Cell vol. 64, pp. 327 336 Jan. 25, 1991. * |
| Article entitled Inhibition of Human Renin by Synthetic Peptides Derived from Its Prosegment by Frederic Cumin et al. The Journal of Biological Chemistry vol. 260 No. 16, pp. 9154 9157. * |
| Article entitled Inhibition of Human Type IV Collagenase by a Highly Consvd . . . by Stetler Stevenson et al(NIH). * |
| Article entitled Inhibition of In Vitro Tumor Cell Invasion by Arg Gly Asp containing Synthetic Peptides by Kurt R. Gehlsen, et al. The Journal of Cell Biology, vol. 106, Mar. 1988 pp. 925 930. * |
| Article entitled Potent new inhibitors of human renin Nature vol. 299 Oct. 7, 1982 by M.Szelke et al.pp.555 557. * |
| Article entitled Preferential Inhibition of 72 kDa and 92kDa Gelatinases by TIMP 2 by Eric W. Howard et al. submitted to Journal of Biological Chemistry No. 1, 1990 revised Mar. 12, 1991. * |
| Article entitled YIGSR, a synthetic Laminin Pentapeptide, Inhibits Experimental Metastasis Formation by Yukihide Iwamoto, et al. Science, vol. 238 pp. 1132 1134 Nov. 1987. * |
| Carmichael, DF et al. "Primary Structure and cDNA Cloning of Human Fibroblast Collagenase Inhibitor", Proc. Natl. Acad. Sci., USA vol. 83 pp. 2407-2411 (Apr. 1986). |
| Carmichael, DF et al. Primary Structure and cDNA Cloning of Human Fibroblast Collagenase Inhibitor , Proc. Natl. Acad. Sci., USA vol. 83 pp. 2407 2411 (Apr. 1986). * |
Cited By (33)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6849450B2 (en) * | 1989-05-19 | 2005-02-01 | Childrens Hospital Of Los Angeles | Antibodies to the metalloproteinase inhibitor |
| US7553630B2 (en) | 1989-05-19 | 2009-06-30 | Amgen Inc. | Methods for detecting metalloproteinase inhibitors |
| US20050196390A1 (en) * | 1989-05-19 | 2005-09-08 | Amgen Inc. | Metalloproteinase inhibitor |
| US5990293A (en) * | 1996-09-05 | 1999-11-23 | Celltech Therapeutics Limited | Human metalloproteinase, variants thereof and DNA sequence coding therefor |
| WO2000054796A1 (en) * | 1999-03-18 | 2000-09-21 | Children's Medical Center Corporation | Novel antiangiogenic peptides |
| AU771755B2 (en) * | 1999-03-18 | 2004-04-01 | Children's Medical Center Corporation | Novel antiangiogenic peptides |
| US6737507B2 (en) | 1999-03-18 | 2004-05-18 | Children's Medical Center Corporation | Antiangiogenic peptides and compositions thereof |
| US6673623B1 (en) | 2000-09-12 | 2004-01-06 | Novocure, Inc. | Methods and compositions that control lipid production |
| WO2002053173A3 (en) * | 2000-12-29 | 2003-04-10 | Kimberly Clark Co | Design and use of advanced zinc chelating peptides to regulate matrix metalloproteinases |
| US20030073808A1 (en) * | 2000-12-29 | 2003-04-17 | Stephen Quirk | Design and use of advanced zinc chelating peptides to regulate matrix metalloproteinases |
| US7041787B2 (en) | 2000-12-29 | 2006-05-09 | Kimberly-Clark Worldwide, Inc. | Design and use of advanced zinc chelating peptides to regulate matrix metalloproteinases |
| US6600057B2 (en) | 2000-12-29 | 2003-07-29 | Kimberly-Clark Worldwide, Inc. | Matrix metalloproteinase inhibitors |
| US20030166567A1 (en) * | 2001-08-16 | 2003-09-04 | Kimberly-Clark Worldwide, Inc. | Anti-aging and wound healing compounds |
| US7196162B2 (en) | 2001-08-16 | 2007-03-27 | Kimberly-Clark Worldwide, Inc. | Anti-aging and wound healing compounds |
| US20030096757A1 (en) * | 2001-08-16 | 2003-05-22 | Kimberly-Clark Worldwide, Inc. | Anti-cancer and wound healing compounds |
| US6906036B2 (en) | 2001-08-16 | 2005-06-14 | Kimberly-Clark Worldwide, Inc. | Anti-aging and wound healing compounds |
| US20030148959A1 (en) * | 2001-08-16 | 2003-08-07 | Stephen Quirk | Anti-aging and wound healing compounds |
| US7186693B2 (en) | 2001-08-16 | 2007-03-06 | Kimberly - Clark Worldwide, Inc. | Metalloproteinase inhibitors for wound healing |
| US7071164B2 (en) | 2001-08-16 | 2006-07-04 | Kimberly-Clark Worldwide, Inc. | Anti-cancer and wound healing compounds |
| US7094754B2 (en) | 2001-08-16 | 2006-08-22 | Kimberly-Clark Worldwide, Inc. | Anti-aging and wound healing compounds |
| US20030119073A1 (en) * | 2001-12-21 | 2003-06-26 | Stephen Quirk | Sensors and methods of detection for proteinase enzymes |
| US20040127421A1 (en) * | 2002-12-30 | 2004-07-01 | Sohail Malik | Method to increase fibronectin |
| US7148194B2 (en) | 2002-12-30 | 2006-12-12 | Kimberly-Clark Worldwide, Inc. | Method to increase fibronectin |
| US7795225B2 (en) | 2003-06-20 | 2010-09-14 | Kimberly-Clark Worldwide, Inc. | Anti-chrondrosarcoma compounds |
| US20070078090A1 (en) * | 2003-06-20 | 2007-04-05 | Kimberly-Clark Worldwide, Inc. | Anti-chrondrosarcoma compounds |
| US20040259802A1 (en) * | 2003-06-20 | 2004-12-23 | Shu-Ping Yang | Anti-chrondrosarcoma compounds |
| US7189700B2 (en) | 2003-06-20 | 2007-03-13 | Kimberly-Clark Worldwide, Inc. | Anti-chrondrosarcoma compounds |
| DE102009027374A1 (en) | 2009-07-01 | 2011-01-05 | Robert Bosch Gmbh | Exhaust gas sensor device, engine control device and method |
| JP2016528236A (en) * | 2013-08-07 | 2016-09-15 | アスチュート メディカル,インコーポレイテッド | Assay for TIMP2 with improved performance in biological samples |
| US10457744B2 (en) | 2013-08-07 | 2019-10-29 | Astute Medical, Inc. | Assays for TIMP2 having improved performance in biological samples |
| WO2015073538A3 (en) * | 2013-11-12 | 2015-11-12 | Echogen, Inc. | Interaction with metalloenzymes |
| US11718682B2 (en) | 2017-04-05 | 2023-08-08 | Astute Medical, Inc. | Assays for TIMP2 having improved performance in biological samples |
| US12624121B2 (en) | 2017-04-05 | 2026-05-12 | Biomerieux, Inc. | Assays for TIMP2 having improved performance in biological samples |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP0464147B1 (en) | Matrix metalloproteinase inhibitor peptides | |
| Simmer et al. | Purification, characterization, and cloning of enamel matrix serine proteinase 1 | |
| AU697535B2 (en) | Haemopoietic maturation factor | |
| US5501969A (en) | Human osteoclast-derived cathepsin | |
| CA2153789C (en) | Biologically active tgf-.beta.1 and tgf-.beta.2 peptides | |
| JP2736821B2 (en) | Matrix metalloproteinase peptides: role in diagnosis and therapy | |
| ES2267151T3 (en) | METHODS AND COMPOSITIONS FOR THE TREATMENT OF NEOPLASIC DISEASES. | |
| US6448042B1 (en) | Human tissue inhibitor of metalloproteinase-4 | |
| JP5645362B2 (en) | Tissue inhibitors of metalloproteinases linked to glycosylphosphatidylinositol (GPI) anchors for the treatment of cancer and skin lesions | |
| KR970707141A (en) | Tumor necrosis factor-gamma | |
| US5491129A (en) | Synthetic peptides derived from vitronectin and pharmaceutical compositions comprising them | |
| WO1992022320A1 (en) | C1 inhibitor variants and treating inflammatory response with c1 inhibitor | |
| US7157596B2 (en) | Inhibitors of serine protease activity of matriptase or MTSP1 | |
| HUP9900979A2 (en) | Endothelial cell proliferation inhibitor and method of use | |
| US7045594B1 (en) | Serine proteinase inhibitors | |
| US6939851B1 (en) | Serine proteinase inhibitors | |
| JPH02149527A (en) | Antithrombotic agent | |
| JP3610395B2 (en) | Mature hepatocyte growth factor | |
| KR100538465B1 (en) | Composition comprising kringle domain 1-2 peptide having anti-angiogenic activity and cancer growth inhibitory activity and its use thereof | |
| CA2046649C (en) | Matrix metalloproteinase inhibitor peptides | |
| Olczyk et al. | Characteristics of TNF-alpha, type I, III collagen, and matrix metalloproteinases. Their clinical applications | |
| Haas et al. | Angiotensin II-producing enzyme III from acidified serum of nephrectomized dogs: activation of proenzyme III to enzyme III by cathepsin G | |
| WO1994009825A1 (en) | DIAGNOSIS AND TREATMENT OF OSTEOARTHRITIS INVOLVING A 92 kD GELATINASE | |
| EP0641858A1 (en) | Serum calcium depressing factor | |
| WO1994009825A9 (en) | DIAGNOSIS AND TREATMENT OF OSTEOARTHRITIS INVOLVING A 92 kD GELATINASE |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| FEPP | Fee payment procedure |
Free format text: PAYOR NUMBER ASSIGNED (ORIGINAL EVENT CODE: ASPN); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY |
|
| STCF | Information on status: patent grant |
Free format text: PATENTED CASE |
|
| FPAY | Fee payment |
Year of fee payment: 4 |
|
| FPAY | Fee payment |
Year of fee payment: 8 |
|
| FPAY | Fee payment |
Year of fee payment: 12 |